spacer

EBI Dbfetch

ID   CH466528; SV 2; linear; genomic DNA; CON; MUS; 49650983 BP.
XX
AC   CH466528;
XX
PR   Project:PRJNA11785;
XX
DT   04-AUG-2005 (Rel. 84, Created)
DT   10-JUN-2007 (Rel. 92, Last updated, Version 7)
XX
DE   Mus musculus 232000009757810 genomic scaffold, whole genome shotgun
DE   sequence.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-49650983
RX   DOI; 10.1126/science.1069193.
RX   PUBMED; 12040188.
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Miklos G.L., Wides R.,
RA   Halpern A., Li P.W., Sutton G.G., Nadeau J., Salzberg S.L., Holt R.A.,
RA   Kodira C.D., Lu F., Chen L., Deng Z., Evangelista C.C., Gan W.,
RA   Heiman T.J., Li J., Li Z., Merkulov G.V., Milshina N.V., Naik A.K., Qi R.,
RA   Shue B.C., Wang A., Wang J., Wang X., Yan X., Ye J., Yooseph S., Zhao Q.,
RA   Zheng L., Zhu S.C., Biddick K., Bolanos R., Delcher A.L., Dew I.M.,
RA   Fasulo D., Flanigan M.J., Huson D.H., Kravitz S.A., Miller J.R.,
RA   Mobarry C.M., Reinert K., Remington K.A., Zhang Q., Zheng X.H.,
RA   Nusskern D.R., Lai Z., Lei Y., Zhong W., Yao A., Guan P., Ji R.R., Gu Z.,
RA   Wang Z.Y., Zhong F., Xiao C., Chiang C.C., Yandell M., Wortman J.R.,
RA   Amanatides P.G., Hladun S.L., Pratts E.C., Johnson J.E., Dodson K.L.,
RA   Woodford K.J., Evans C.A., Gropman B., Rusch D.B., Venter E., Wang M.,
RA   Smith T.J., Houck J.T., Tompkins D.E., Haynes C., Jacob D., Chin S.H.,
RA   Allen D.R., Dahlke C.E., Sanders R., Li K., Liu X., Levitsky A.A.,
RA   Majoros W.H., Chen Q., Xia A.C., Lopez J.R., Donnelly M.T., Newman M.H.,
RA   Glodek A., Kraft C.L., Nodell M., Ali F., An H.J., Baldwin-Pitts D.,
RA   Beeson K.Y., Cai S., Carnes M., Carver A., Caulk P.M., Center A.,
RA   Chen Y.H., Cheng M.L., Coyne M.D., Crowder M., Danaher S., Davenport L.B.,
RA   Desilets R., Dietz S.M., Doup L., Dullaghan P., Ferriera S., Fosler C.R.,
RA   Gire H.C., Gluecksmann A., Gocayne J.D., Gray J., Hart B., Haynes J.,
RA   Hoover J., Howland T., Ibegwam C., Jalali M., Johns D., Kline L., Ma D.S.,
RA   MacCawley S., Magoon A., Mann F., May D., McIntosh T.C., Mehta S., Moy L.,
RA   Moy M.C., Murphy B.J., Murphy S.D., Nelson K.A., Nuri Z., Parker K.A.,
RA   Prudhomme A.C., Puri V.N., Qureshi H., Raley J.C., Reardon M.S.,
RA   Regier M.A., Rogers Y.H., Romblad D.L., Schutz J., Scott J.L., Scott R.,
RA   Sitter C.D., Smallwood M., Sprague A.C., Stewart E., Strong R.V., Suh E.,
RA   Sylvester K., Thomas R., Tint N.N., Tsonis C., Wang G., Wang G.,
RA   Williams M.S., Williams S.M., Windsor S.M., Wolfe K., Wu M.M., Zaveri J.,
RA   Chaturvedi K., Gabrielian A.E., Ke Z., Sun J., Subramanian G., Venter J.C.,
RA   Pfannkoch C.M., Barnstead M., Stephenson L.D.;
RT   "A comparison of whole-genome shotgun-derived mouse chromosome 16 and the
RT   human genome";
RL   Science 296(5573):1661-1671(2002).
XX
RN   [2]
RP   1-49650983
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (05-JUL-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
RN   [3]
RP   1-49650983
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (02-SEP-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
DR   MD5; 6193fa81d88c83e5c4bcf6d10f693280.
DR   ENA; AAHY010000000; SET.
DR   ENA; AAHY000000000; SET.
DR   ENA-CON; CM000226.
DR   Ensembl-Gn; ENSMUSG00000001473; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000007480; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000008301; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000023036; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024427; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024431; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024440; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024454; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024471; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024480; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024493; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024497; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024498; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024500; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024502; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024505; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024511; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024512; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024515; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024516; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024518; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024525; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024526; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024529; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024534; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024538; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024544; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024552; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024560; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024570; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024571; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024575; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024576; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024580; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024589; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024610; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024617; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024621; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024622; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024644; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024645; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024646; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025423; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025428; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025880; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025885; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026322; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000033032; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000033319; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000033323; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000033993; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000034320; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000035394; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000036412; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000036585; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000036880; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000040560; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000041607; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000041789; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000042705; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000043079; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000043313; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000043458; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000044022; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000044024; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000044176; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000045569; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000045657; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000045730; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000045876; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000046387; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000046886; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000047033; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000047307; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000047466; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000047910; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000048347; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000048410; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000049090; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000050304; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000051050; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000051242; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000051486; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000051732; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000052102; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000052713; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000053477; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000053624; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000053846; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000054072; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000054477; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000056812; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000057561; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000058152; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000059336; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000060450; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000060534; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000062328; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000071855; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000071856; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000071858; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000073542; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000073555; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000073591; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000075232; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000078963; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000079608; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000079614; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000090942; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000001513; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000003599; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025295; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025300; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025311; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025349; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025357; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025374; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025375; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025377; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025383; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025390; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025393; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025394; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025396; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025403; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025404; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025409; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025413; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025419; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025421; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025434; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025444; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025462; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025463; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025468; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025477; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025523; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025546; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025547; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025549; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000026495; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000026999; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027560; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031549; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000032473; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000036226; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000037090; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000040359; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000040647; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000041053; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000043498; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000048109; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000049388; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000050034; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000050487; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000051126; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000051163; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000051442; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000052347; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000053073; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000053640; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000053856; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000055495; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000055725; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000055935; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000055949; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000056915; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000057228; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000058635; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000059571; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000060223; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000060328; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000061405; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000062991; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000063219; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000063775; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000063814; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000064763; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000066140; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000066149; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000066193; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000066532; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000066890; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000066912; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000067450; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000069749; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000072376; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000072666; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000072726; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000072835; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000073379; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000074157; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000074653; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000078079; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000079716; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000080418; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000080721; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000082254; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000091789; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000091813; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000091884; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000091932; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000096570; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000097542; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000097563; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000097590; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000097609; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000099945; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114748; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114895; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114939; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114943; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114959; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114977; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115268; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115297; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115318; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115498; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115567; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115571; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115582; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000117687; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000117692; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000120472; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000120632; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000121693; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000121875; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000125127; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000125763; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000126432; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000127234; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000130163; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000131348; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000143275; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000146409; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000155195; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000160180; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000160292; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000160639; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000161003; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000162265; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000162511; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000163367; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000163516; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000163590; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000163742; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000164223; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000164666; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000165123; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000166219; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000167610; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000168249; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000168382; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000168419; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000168882; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000168918; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000170811; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000171297; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000171461; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000171470; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000172148; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000174118; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000178011; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000178678; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000183850; mus_musculus.
XX
CC   On Sep 6, 2005 this sequence version replaced gi:70980452.
CC   This is the July 2001 combined whole genome shotgun assembly of Mus
CC   musculus. It contains 27 million Celera reads on four Mus musculus
CC   strains (129X1/SvJ, 129S1/SvImJ, DBA/2J and A/J), 13 million reads
CC   on C57BL/6J from the NCBI Trace Archive, 0.4 million BAC end
CC   sequences from TIGR, and unfinished and finished BACs pulled from
CC   NCBI (Nature 2002. 420:520-562). The assembly process relied on
CC   Celera's paired reads and BAC end reads for long range order and
CC   orientation. Its scaffolds were mapped to chromosomes using STS
CC   maps. For more detailed information about whole genome sequencing
CC   and Celera's assembly process, please refer to Venter, J.C. et al.
CC   Science 2001. 291:1304-1351.
CC   This version of genes, transcripts, and proteins was
CC   computationally created in November 2001 from the whole-genome
CC   mapping of transcript and protein sequences on the Celera mouse
CC   genome assembly by Celera Chromosome Team and Content Systems.  The
CC   data sets used by this annotation process were collected in 2001
CC   and include RefSeq (NM_ from mouse and human) sequences, GenBank
CC   mRNA and dbEST sequences, mammalian SwissProt sequences,  and NRAA
CC   sequences (all mouse unless noted otherwise).  The initial gene set
CC   was manually curated between 2002 and 2003. Subsequently, automated
CC   annotation updates were performed.  The CDS of each transcript was
CC   manually or computationally defined by either the longest
CC   ATG-to-Stop or the longest open reading frame. All CDSs
CC   corresponding to the longest open reading frames with no starting
CC   ATG were flagged as partial.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..49650983
FT                   /organism="Mus musculus"
FT                   /chromosome="18"
FT                   /strain="mixed"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   gene            7019..9823
FT                   /locus_tag="mCG_141302"
FT                   /note="gene_id=mCG141302.1"
FT   mRNA            7019..9823
FT                   /locus_tag="mCG_141302"
FT                   /product="mCG141302"
FT                   /note="gene_id=mCG141302.1 transcript_id=mCT174371.1
FT                   created on 23-APR-2004"
FT   CDS             7186..9585
FT                   /codon_start=1
FT                   /locus_tag="mCG_141302"
FT                   /product="mCG141302"
FT                   /note="gene_id=mCG141302.1 transcript_id=mCT174371.1
FT                   protein_id=mCP97287.1"
FT                   /protein_id="EDL10169.1"
FT                   /translation="MEAGEEMEQILKKRQVLLFFVLLGIAQAGSTIRRYSVEEEAENGV
FT                   FVANLLKDLGLEVEELAARGPRVISKGKKLNLEFNRQTGDLLLREKLDREELCGPAEPC
FT                   VVPFQVLLGNPLQIFQAELQIRDINDHSPVFLDKEITLKISESTASGTTFLIERAQDLD
FT                   VGSNGLQTYTINPNFYFHLNLQNSPDGTVLPQLVLDKVLDREERSEIRLILTALDGGNP
FT                   PRSGTVQILIEVLDINDNAPVFSKLRYEVQIPENSPVGSQVATVSARDLDIGDHGNIAY
FT                   AFSQASEDIRKTFRMNATSGEILLVKTLDFESIQAYTICVQATDGGGLSGGSVVIVQVM
FT                   DLNDNPPELTMSTFTNHIPENALETVIAVFSVADSDSGDNGKMVCSIQEDLPFILKPSF
FT                   ENFYTLMTNTALDRETRSQYNITIMVSDLGTPRLTAQHTIIVQVSDINDNAPAFTQTSY
FT                   TIFVRENNSPALHIGTISATDSDSGSNAHITYSLLPPQDPQLALHSLVSINADNGQLFA
FT                   LRALDYEDQQTFKFHVGATDGGSPALSSQTLVRVVVLDDNDNAPFVLYPLQNSSVPCTE
FT                   LLPRAAEPGYLVTKVVAVDRDSGQNAWLSFQLLKATEPGLFSVWAHNGEVRTTRLLSER
FT                   DAPKHRLLLLVKDNGDPPHSASVTLQVLVVDGFSQPYLPLPEVARDPAQDEDILTLYLV
FT                   IALASVSSLFLLSVLLFVGVRLCRRARATSLGGCSMPEGHFPAHLVDVGGAGTLSQSYQ
FT                   YEVCLTGDTGTPDFKFLKPIIPNFLLQSSETENDTNPSYRNSFEFS"
FT   gene            <13194..16191
FT                   /gene="Pcdhb3"
FT                   /locus_tag="mCG_141301"
FT                   /note="gene_id=mCG141301.0"
FT   mRNA            <13194..16191
FT                   /gene="Pcdhb3"
FT                   /locus_tag="mCG_141301"
FT                   /product="protocadherin beta 3"
FT                   /note="gene_id=mCG141301.0 transcript_id=mCT174370.0
FT                   created on 15-OCT-2002"
FT   CDS             13194..15548
FT                   /codon_start=1
FT                   /gene="Pcdhb3"
FT                   /locus_tag="mCG_141301"
FT                   /product="protocadherin beta 3"
FT                   /note="gene_id=mCG141301.0 transcript_id=mCT174370.0
FT                   protein_id=mCP97288.0"
FT                   /protein_id="EDL10168.1"
FT                   /translation="MEAREERFLKQRQVLLLFVFLGGSLAGSMSRRYSVAEEKEKGFVI
FT                   ANLATDLGLSIEELAERRAQAISKGNIQYFQLSHQTGDLLLVEKLDREELCGSTEPCVL
FT                   HFQILLHDPLQFITNELEVIDVNDHAPEFFEKAMQLKVLENFVPGTVIPLGNAVDLDVG
FT                   RNGLQNYTVSPTSHFHVHTRRRRDGRKYPELVLDRALDREEQSEISLTLTALDGGSPPR
FT                   SGTTQVHILVLDTNDNAPEFTQSLYEVQILEKSPIGSVITTVSASDLDTGNFGAISYVF
FT                   FHASEEILETFRLNSSTGNIQLLKGLDYEAINTYEVDVEAKDGGGLSGKCTVIVQILDV
FT                   NDNPPELTLSSVNSLIPENSAETVVAVFSVSDLDSGDNGRVTCSIQNDLPFILKPSVEN
FT                   FYTIASEWALDREIRAEYNITITVSDLGTPRLTTQHTITVQVSDLNDNAPAFTQTSYTM
FT                   SVRENNSPALHIGTISATDSDSGSNAHITYSLLPPHDPQLALDSLISINADNGQLFALR
FT                   ALDYEALQAFEFHVGATDGGSPALSSQALVRVVVLDDNDNAPFVLYPLQNASAPCTELL
FT                   PRAAEPGYLVTKVVAVDRDSGQNAWLSFQLLKSTEPGLFSVWAHNGEVRTARLLSERDM
FT                   LKQKLLLLVKDNGDPPRSASVTLNVLLVDGFSQPYLPLPEMARDSVQNDVDLLTLYLVI
FT                   ALASVSSLFLLSVLLFVGVRLCRRARAASMGGCSVPEGHFPGHLVDVSGMGTLSQSYQY
FT                   EVCLTGDAGTGEFKLLNPVIPNLFLEESERS"
FT   gene            19530..23289
FT                   /gene="Pcdhb4"
FT                   /locus_tag="mCG_141299"
FT                   /note="gene_id=mCG141299.1"
FT   mRNA            19530..23289
FT                   /gene="Pcdhb4"
FT                   /locus_tag="mCG_141299"
FT                   /product="protocadherin beta 4"
FT                   /note="gene_id=mCG141299.1 transcript_id=mCT174369.1
FT                   created on 23-APR-2004"
FT   CDS             19755..22109
FT                   /codon_start=1
FT                   /gene="Pcdhb4"
FT                   /locus_tag="mCG_141299"
FT                   /product="protocadherin beta 4"
FT                   /note="gene_id=mCG141299.1 transcript_id=mCT174369.1
FT                   protein_id=mCP97289.1"
FT                   /protein_id="EDL10167.1"
FT                   /translation="METALAKMSQQRQVVFLTMLLLLWVSGSEAIKYSMPEETESGYLV
FT                   ANLAQDLGIRVGELAAREARVHHRGNKDLLQLDAETGNLFLKEKLDREGLCGATEPCVL
FT                   HFQIILKNPVQFFQTELQLTDINDHSPEFPDTEMLLTIPESAQPGTVFPLKAAQDPDMG
FT                   SNAIQNYTVSPNLHFHVVTLSRSDGRKYPELVLDRALDREEQPELTLILTALDGGAPRR
FT                   SGMTTVHIEIMDINDNAPQFVQSLYEVQVPENFPLDALLVTVSARDLDAGIYGNVAYSL
FT                   FQGDGDSQPFVIDEITGEIRLSKKLDFEVTPYYNVEIAATDGGGLSGKCTVAVQVLDVN
FT                   DNAPELTVSTLSSPIPENSPETVVAVFGVFDPDSGDNGRMVCSIQNELPFLLKSTFENY
FT                   YTLATERPLDRESIAEYNITITVSDMGTPRLTTQHTIKVQVSDINDNAPAFTQTSYTLF
FT                   VHENNSPALHIGTISATDSDSGSNAHITYSLLPPQDPQLALSSLISINADNGQLFALRA
FT                   LDYEALQAFEFHVGATDGGSPALSSQTLVRVVVLDDNDNAPFVLYPLQNASAPYTELLP
FT                   RAAEPGYLVTKVVAVDRDSGQNAWLSFQLLKATEPGLFSVWAHNGEVRTTRLLSERDAP
FT                   KHRLLLLVKDNGEPLRSASVTMHVLVVDGFSQPYLPLPEVALDPTREEDNLTLYLVISL
FT                   ASVSSLFLLSVLLFVGARLCRRAREASLGGYSLPEGHFPGHLVDVSGAGTLSQSYQYEV
FT                   CLSGDSGITDFKFLKPSNPNSLIPDNYMLNS"
FT   gene            <32703..>35081
FT                   /locus_tag="mCG_141297"
FT                   /note="gene_id=mCG141297.0"
FT   mRNA            <32703..>35081
FT                   /locus_tag="mCG_141297"
FT                   /product="mCG141297"
FT                   /note="gene_id=mCG141297.0 transcript_id=mCT174366.0
FT                   created on 15-OCT-2002"
FT   CDS             32703..35081
FT                   /codon_start=1
FT                   /locus_tag="mCG_141297"
FT                   /product="mCG141297"
FT                   /note="gene_id=mCG141297.0 transcript_id=mCT174366.0
FT                   protein_id=mCP97290.0"
FT                   /protein_id="EDL10166.1"
FT                   /translation="MEKLERNHRNRQVIPFLFMLLWDEVLMVPTRYSVLEESESGSFVA
FT                   HLAKDLGLGAGELAARSARVVSDHDKQQLILDPETGDLLLREKLDREELCGSVDPCVLH
FT                   FQVFLEKPVQFFQGELLIQDINDNSPEFPDKELLLKIPENSQPGTRFSLKLAQDLDVGS
FT                   NGLQQYTVNPNSHFHVLTRNNSEGKKYPELVQDRALDREEQAELSLILTALDGGSPPRS
FT                   GTALVRILIMDINDNAPEFVNNPYEVQVLESSPPDSPVLTVFAQDADAGNFGRVSYGLF
FT                   QASDEIQKTFSINEFTGEIRLKTKLDFEKTKSYHVEIEATDGGGLSGKGSVVIEVLDVN
FT                   DNAPELTISSLTSSVPENSPETVVAIIRIRDRDAGENGKMICSISDHVPFILKPSYKNF
FT                   YTLVTESPLDRESRAEYNITITVSDLGTPRLTTQHTITVQVSDVNDNAPAFTRTSYTMF
FT                   VRENNSPALHIGTISATDSDSGSNAHITYSLLPPHDPQLALHSLISINADNGQLFALSA
FT                   LDYEALQGFEFYVGATDRGSPELSSRALVRVVVLDDNDNAPFVLYPLQNASAPCTELLP
FT                   RAAEPGYLVTKVVAVDRDSGQNAWLSFQLLKATEPGLFSVWAHNGEVRTTRLLSERDAP
FT                   KHRLLLLVKDNGEPQRSASVTLHVLLVDGFSQPYLPLPEVARDPAQDDTDVLTLYLVIA
FT                   LASVSSLFLLSVLMFVGVRLCRRAREPSLSGCSVPEGHFPGHLVDVSHAGTLSQSYQYD
FT                   VCLTGESGTGEFKFLKPIVPNLMVQDTGNLHCRDSFVFS"
FT   gene            <48681..>50309
FT                   /locus_tag="mCG_141295"
FT                   /note="gene_id=mCG141295.0"
FT   mRNA            <48681..>50309
FT                   /locus_tag="mCG_141295"
FT                   /product="mCG141295"
FT                   /note="gene_id=mCG141295.0 transcript_id=mCT174376.0
FT                   created on 15-OCT-2002"
FT   CDS             48681..>50309
FT                   /codon_start=1
FT                   /locus_tag="mCG_141295"
FT                   /product="mCG141295"
FT                   /note="gene_id=mCG141295.0 transcript_id=mCT174376.0
FT                   protein_id=mCP97293.0"
FT                   /protein_id="EDL10165.1"
FT                   /translation="METTLAKTPEKRQVVFLAILLLLWEAGSEAIRYSIPEETESGYLV
FT                   AHLAKDLGFRVGELATRRARIHHRGNKELLQLDVETGNLLLKEKPDREALCGATEPCVL
FT                   HFQIILENPVQFFQTELQLTDINDHSPEFPDTEMLLKIQESTQPATVFLLKAAQDSDIG
FT                   SNAVQNYTVSPNLHFHVVTLSRSDGRKYPELVLDRALDREEQPELTLILTALDGGAPPK
FT                   SGTTTVRIEVVDINDNAPEFVQSLYSVEVPENSPLDALVVTVSARDLDAGIHGNVAYSL
FT                   FQGGGGPQPFVIDEITGEIRLKGALDFEATSYYTMEIVATDSGGLSGKCTVAIQVLDVN
FT                   DNAPKLTISSLTSSIPENAPEAVVAVFSVSDPDSGDNGRMVCSIQNELPFLLKPTFENY
FT                   YTLAAEGPLDREIREEYNITIIVSDLGTPRLTTQHTITVQVVDINDNAPAFTQTSYTMF
FT                   VHENNNPALHIGTISATDSDSGSNAHITYSLLPPHDLQLSLASLVSINADNGQLFALRA
FT                   MDYEALQAFEFHVGATDGGSPALSSQ"
FT   gene            <60572..63469
FT                   /locus_tag="mCG_141294"
FT                   /note="gene_id=mCG141294.0"
FT   mRNA            <60572..63469
FT                   /locus_tag="mCG_141294"
FT                   /product="mCG141294"
FT                   /note="gene_id=mCG141294.0 transcript_id=mCT174364.0
FT                   created on 15-OCT-2002"
FT   CDS             60572..62968
FT                   /codon_start=1
FT                   /locus_tag="mCG_141294"
FT                   /product="mCG141294"
FT                   /note="gene_id=mCG141294.0 transcript_id=mCT174364.0
FT                   protein_id=mCP97291.0"
FT                   /db_xref="GOA:Q925M2"
FT                   /db_xref="InterPro:IPR002126"
FT                   /db_xref="InterPro:IPR013164"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR020894"
FT                   /db_xref="MGI:MGI:2136741"
FT                   /db_xref="UniProtKB/TrEMBL:Q925M2"
FT                   /protein_id="EDL10164.1"
FT                   /translation="MEKLEKAHPKRQVIAFIFMMVLVQVCSEPTTQYSILEETESGSFV
FT                   AHLAKDLGLGARELAARSARVVSDDYKQRLLLDPETGDLLLREKVDREEVCSTVDPCVL
FT                   HFQVTLEKPVQYFQGELLIQDINDHAPEFPEGEMLLNIPENSQPGTLLPLNLAQDLDVG
FT                   SNGLQQYTVSPNSHFHVLTRNNSEGKKYPELVQDRALDREEQAELSLTLIALDGGSPPR
FT                   SGTALVRILIMDINDNAPEFVNSPYEVQVLESSLPDSPVLTVFAQDADAGNFGRVSYGF
FT                   FQASDEIQRTFSINKVTGEIQLKKELDFEKIKFYHVKIEATDGGGLSGKGLVIVEVLDV
FT                   NDNAPELTISSLTSSVPENAPETIISIFRVGDRDSGENAKVVCSIPENLPFILKSTFKN
FT                   FYTLVTESPLDRESRAEYNITIMVSDLGTPRLTTWHTITVQVSDVNDNAPAFTRTSYTM
FT                   FVRENNSPALHIGTISATDSDSGSNAHITYSLLLPHDPELPLSSLISINADNGQLFALR
FT                   ALDYEVLQAFEFHVGATDRGSPALSSQALVRVVVLDDNDNAPFVLYPMQNTSAPCTELL
FT                   PRAAEPGYLVTKVVAVDRDSGQNAWLSFQLLKATEPGLFSVWAHNGEVRTSRLLSERDA
FT                   LKHRLLMLVKDNGEPPRSASVTLHVLLVDGFSQPYLSLPEVAPDPTQEVEDALTVYLVI
FT                   ALASVSSLFLLSVVLFVGVKLCRRAREPSLGGCSVPEELFPGHMVDVSGTGTLSHNYQY
FT                   EVCLTRDSGIGEFKFLKPMIPNLLVQDAGRELNENLHCRDSFVFS"
FT   gene            <73913..>76252
FT                   /locus_tag="mCG_141292"
FT                   /note="gene_id=mCG141292.0"
FT   mRNA            <73913..>76252
FT                   /locus_tag="mCG_141292"
FT                   /product="mCG141292"
FT                   /note="gene_id=mCG141292.0 transcript_id=mCT174363.0
FT                   created on 15-OCT-2002"
FT   CDS             73913..76252
FT                   /codon_start=1
FT                   /locus_tag="mCG_141292"
FT                   /product="mCG141292"
FT                   /note="gene_id=mCG141292.0 transcript_id=mCT174363.0
FT                   protein_id=mCP97292.0"
FT                   /db_xref="GOA:Q91XZ2"
FT                   /db_xref="InterPro:IPR002126"
FT                   /db_xref="InterPro:IPR013164"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR020894"
FT                   /db_xref="MGI:MGI:2136742"
FT                   /db_xref="UniProtKB/TrEMBL:Q91XZ2"
FT                   /protein_id="EDL10163.1"
FT                   /translation="METALTKTPEKRQVIFLAILLLLWEASSEAISYSMPEETESGYLV
FT                   ANLAQDLGLRVGELTTRGARIHHNGNKELLQLDAERGNLLLKEKPDREALCGATEPCVL
FT                   HFQIILENPVQFFQTDLQFTDINDHFPEFPDTEMLLKIQEIAQPGTVFPLKAAQDPDIG
FT                   SNAVQNYTVSPNLHFHVVTLSRSDDRKYPELVLDRALDREEQPELTLILTALDGGAPPK
FT                   SGTTTVRIEVVDINDNAPQFLQSLYAVEVPENSPLNALVVTVSARDLDAGIHGNVAYSL
FT                   FQGGGGPQPFVIDEITGEIRLKGALDFEATSYYTMEIVATDSGGLSGKCTVAIQVLDVN
FT                   DNAPKLTISSLTSSIPENAPEAVVAVFSVSDPDSGDNGRMVCSIQNGLPFLLKPTFKNF
FT                   YTLVTERPLDRESNAEYNITITVSDLGTPRLTTQHTITVQVSDINDNAPAFTQTSYTLF
FT                   VHENNSPALHIGTISATDSDSGSNGLIIYSLLPPHDQQLGLASLISINSDNGQLFALRA
FT                   LDYEALQAFEFHVGATDRGSPALSSEALVRVVVLDDNDNAPFVLYPLQNASAPCTELLP
FT                   RAAEPGYLITKVVAVDRDSGQNAWLSFQLLKATEPGLFSVWAHNGEVRTTRLLSERDAP
FT                   KHRLLLLVKDNGEPLRSASVMLQVLVVDGFSQPYLPLPEVALNPTQEEDMLTLYLVIAL
FT                   ASVSSLFLLSVLLFVGVKLCKKAREASLADCSIPEGHFPSHLVDVSGAGTLSQSYHYEV
FT                   CLTEDSGTSDFKFMNPIIPSSLLQDS"
FT   gene            <119252..>121633
FT                   /locus_tag="mCG_141289"
FT                   /note="gene_id=mCG141289.0"
FT   mRNA            <119252..>121633
FT                   /locus_tag="mCG_141289"
FT                   /product="mCG141289"
FT                   /note="gene_id=mCG141289.0 transcript_id=mCT174358.0
FT                   created on 15-OCT-2002"
FT   CDS             119252..121633
FT                   /codon_start=1
FT                   /locus_tag="mCG_141289"
FT                   /product="mCG141289"
FT                   /note="gene_id=mCG141289.0 transcript_id=mCT174358.0
FT                   protein_id=mCP97286.0"
FT                   /db_xref="GOA:Q91XZ1"
FT                   /db_xref="InterPro:IPR002126"
FT                   /db_xref="InterPro:IPR013164"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR020894"
FT                   /db_xref="MGI:MGI:2136744"
FT                   /db_xref="UniProtKB/TrEMBL:Q91XZ1"
FT                   /protein_id="EDL10162.1"
FT                   /translation="MEKLGRIHLNRQVMAFIFMMVLVQVCSEPTIRYSILEETESGSFV
FT                   AHLAKDLGLGARELAARSARVLSDDYKQRLLLDPETGDLLLREKVDREEVCSTVDPCVL
FT                   HFQVTLEKPVQYFQRELLIQDINDHAPEFPDRELLLRIPENSQQGTQFSLNLAQDLDVG
FT                   SNGLQQYTVSPNPYFHVLTQNNSKGKKYPELVQDRGLDREEQAELSLTLTALDGGSPPR
FT                   SGTALVRILIMDINDNAPEFVNSPYEVQVLESSPPDSPVLTVLARDADAGNFGRVSYGF
FT                   FQASDEIQQTFSINATSGDMRLKKKLDFEKIKSYHVEIEAIDGGGLSGKGSVTIEVVDV
FT                   NDNAPELTISSLTSSVPENAPETIISIFRVGDRDSGENGKMVCSIPENLPFILKSTFKN
FT                   FYTLVTESPLDRESRAEYNITIMVSDMGTPRLTTWHTIKVQVSDINDNTPAFTQTSYTM
FT                   FVRENNSPALHIGTISATDSDSGSNAHITYSLLPPHDPELALSSLISINADNGQLFALR
FT                   ALDYEALQVFEFHVGATDGGSPPLSSQALVRVVVLDDNDNAPFVLYPMQNASAPFTELL
FT                   PRAAEPGYLVTKVVAVDRDSGQNAWLSFQLLKATEPGLFSVWAHNGEVRTTRLLSERDV
FT                   PKHRLLLVVKDNGEPQRSASVTLQVLLVDGFSQSYLPLPEVARDPAHEDEDVLTLYLVI
FT                   ALASVSSLFLLSVLLFVGVRLCRRAREVSLGGCSMPGEHFPGHLVDVSGAGTLSQSYQY
FT                   EVCLRGDSGTGEFKFLKPMIPNAGIEIMESPHCRDSFVFN"
FT   gene            <130063..>132456
FT                   /gene="Pcdhb10"
FT                   /locus_tag="mCG_141287"
FT                   /note="gene_id=mCG141287.0"
FT   mRNA            <130063..>132456
FT                   /gene="Pcdhb10"
FT                   /locus_tag="mCG_141287"
FT                   /product="protocadherin beta 10"
FT                   /note="gene_id=mCG141287.0 transcript_id=mCT174359.0
FT                   created on 15-OCT-2002"
FT   CDS             130063..132456
FT                   /codon_start=1
FT                   /gene="Pcdhb10"
FT                   /locus_tag="mCG_141287"
FT                   /product="protocadherin beta 10"
FT                   /note="gene_id=mCG141287.0 transcript_id=mCT174359.0
FT                   protein_id=mCP97285.0"
FT                   /db_xref="GOA:Q91VE5"
FT                   /db_xref="InterPro:IPR002126"
FT                   /db_xref="InterPro:IPR013164"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR020894"
FT                   /db_xref="MGI:MGI:2136745"
FT                   /db_xref="UniProtKB/TrEMBL:Q91VE5"
FT                   /protein_id="EDL10161.1"
FT                   /translation="MEMTLAKTPENRQVLFFTILLLLWKSCADAIIYSIPEETESGYLV
FT                   ANLAKDLGLRVGELAIRGARIHYKGNKELLQLDAETGNLFLKEKPDREVLCRATEPCVL
FT                   HFQIILENPVQFFQTELQLTDINDHSPEFPDRKMLLKIPESAQPGTTFPLKAAQDPDIG
FT                   SNAVQNYTVSPNLHFHVVTLSRSDGRKYPELVLDRALDREEQPELTLILTALDGGAPPR
FT                   SGTTEVHIEVVDINDNAPQFIQSLYEVQILENSPLDALVATVSARDLDAGIYGKVAYSL
FT                   FQDDGISQPFVIDEITGEIRLKGALDFEATPYYNMEIVATDPGGFSGKCTVVIQVVDVN
FT                   DNAPKLTISSLNSSIPENAPETVVAVFSVSDPDSGENGRMVCSIQNELPFLLKSTFENY
FT                   YTLVTEGTLDRESKAEYNITISVTDLGTPRLTTQHTITVQVSDINDNAPTFTRTSYTMF
FT                   IRENNSPALHIGTISATDSDAGSNAHITYSLLPPHDPQLTLTSLVSINEDNGQLFALRA
FT                   LDYEALRAFEFHVRATDRGSPALSSQALVLVVVLDDNDNEPFVLYPLQNSSAPCKELVP
FT                   RAAEAGYLVTKVVAVDRDSGQNAWLSFQLLKATEPGLFSVWAHNGEVRTTRLLSERDAP
FT                   KHRLLLVVKDNGDPPRSASVTLHVLLVDGFSQPYLPLSEVVQDPAQEGDDALTLYLVIA
FT                   LASVSSLFLISVLLFVGMKLCKRARSPSLGVCSVPEGHFPGHLVDVSGTGTLSQSYQYE
FT                   VCLSGDSGTGEFKFLKPMISNLMVQDPEREVKESPHCRDSFVFS"
FT   gene            139587..142898
FT                   /locus_tag="mCG_141285"
FT                   /note="gene_id=mCG141285.1"
FT   mRNA            139587..142898
FT                   /locus_tag="mCG_141285"
FT                   /product="mCG141285"
FT                   /note="gene_id=mCG141285.1 transcript_id=mCT174372.1
FT                   created on 23-APR-2004"
FT   CDS             139790..142183
FT                   /codon_start=1
FT                   /locus_tag="mCG_141285"
FT                   /product="mCG141285"
FT                   /note="gene_id=mCG141285.1 transcript_id=mCT174372.1
FT                   protein_id=mCP97278.1"
FT                   /db_xref="GOA:Q91UZ8"
FT                   /db_xref="InterPro:IPR002126"
FT                   /db_xref="InterPro:IPR013164"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR020894"
FT                   /db_xref="MGI:MGI:2136746"
FT                   /db_xref="UniProtKB/TrEMBL:Q91UZ8"
FT                   /protein_id="EDL10160.1"
FT                   /translation="METALAKMPEQRQVFFLTILLLLWKSGSGATRYSMPEEKESGYLV
FT                   ANVAKDLGLRVGELATRGAQIHYKGNKELLQMDAETGNLFLKEKLDREALCGATEPCVL
FT                   HFQVILENPVQFFQTELQLTDINDHSPEFPDREMLLKIPENAQPGTVFPLKAAQDSDIG
FT                   SNAVQNYTVSPNIHFHVITHSRSDGRKYPELVLDRALDREEQPELTLILTALDGGAPPR
FT                   SGTTIVHIEVVDINDNAPQFIQSLYEVQILENSPIDTLVVTVSARDLDSGIYGNVAYSL
FT                   FQGDGLSQPFVIDEVTGEIRLSKELDFEGISHYNIEIAATDGGDLLGKCTVVIQVLDVN
FT                   DNAPELMIRKLTVPVPENSAETVVAVFSVSDSDSGDNGRIVCSIQNNIPFLLKPTFENY
FT                   YTLVTEGPLDRESRAEYNITITVWDLGTPRLTTQHTITVQVSDINDNAPAFTQTSYTLF
FT                   VQENNSPALQIGTISATDSDSGSNAHITYSLLLPQDPQLALASLISINPDNGQLFVLRA
FT                   LDYESLQAFEFRVGATDQGSPALSSQTLVRVVVLDDNDNAPFVLYPMQNASAPCTELLP
FT                   REAESGYLVTKVVAVDRDSGQNAWLSFQLLKATEPGLFSVWAHNGEVRTTRLLSERDVP
FT                   KHRLLLLVKDNGEPQLSASVTLQVLLVNSFSQPYLSLPEVAQDPIQEDGEMLTLYLVIA
FT                   LASVSSLFLLSVLMFVGMRLCRRAREASLGVCSVPEGHFPGHLMDVSGTGTLSHSYQYD
FT                   VCLSGDSRTGEFKFLKPMIPNVMVQEAGREVKENPPCRDSFVFS"
FT   gene            153807..156825
FT                   /locus_tag="mCG_141300"
FT                   /note="gene_id=mCG141300.1"
FT   mRNA            153807..156825
FT                   /locus_tag="mCG_141300"
FT                   /product="mCG141300"
FT                   /note="gene_id=mCG141300.1 transcript_id=mCT174373.1
FT                   created on 25-JUN-2004"
FT   CDS             153974..156343
FT                   /codon_start=1
FT                   /locus_tag="mCG_141300"
FT                   /product="mCG141300"
FT                   /note="gene_id=mCG141300.1 transcript_id=mCT174373.1
FT                   protein_id=mCP97277.1"
FT                   /db_xref="GOA:Q91Y07"
FT                   /db_xref="InterPro:IPR002126"
FT                   /db_xref="InterPro:IPR013164"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR020894"
FT                   /db_xref="MGI:MGI:2136747"
FT                   /db_xref="UniProtKB/TrEMBL:Q91Y07"
FT                   /protein_id="EDL10159.1"
FT                   /translation="MPGQRQVFFLTILLLFWKSDSEAIRYSMPEEKESGYLVANVAKDL
FT                   GLRVEELATRGAQIHYRGNKELLQMDAETGNLFLKEKLDREALCGATEPCVLHFQIILE
FT                   NPVQFFQTELQLTDINDHSPEFSDTEMLLTIPENAQPGTVFPLKAAHDSDIGSNAVQNY
FT                   TVNPNIHFHVVTLSRSDGRKYPELVLDRALDREEQPELTLTLTALDGGSPPRSGTTEVH
FT                   IEVVDINDNAPQFIQSLYEVQVPENSPLNALVVMVSATDLDAGIYGNVAYSLFQGDGLS
FT                   QPFVIDKITGEIRLTKELDFEVSHHYTIEIAATDGGGLSGKCTVVIQVLDVNDNAPELA
FT                   IRKLTVPVPENSAETVVAVFSVSDSDSGDNGRIVCSIQNNIPFLLKPTFENYYTLVTEG
FT                   PLDRESRAEYNITITVWDLGTPRLTTQHTITVQVADINDNAPAFTQTSYTLFVQENNSP
FT                   ALHIGTISATDSDSGSNAHITYSLLPPHDSQLALASLVSINSDNGQLFALRAMDYEMLQ
FT                   AFELHVDATDGGSPALSSQALVRVVVLDDNDNSPFVLYPMQNASAPCTELLPRAAEPGY
FT                   LITKVVAVDRDSGQNAWLSFQLLKATEPGLFSVWAHNGEVRTTRLLSERDAPKHKLLLL
FT                   VKDNGDPPRSASVTLHVLVVDGFSQPYLPLPEVARDSTQDDYDVLTLYLVVALASVSSL
FT                   FLLSVLLFVGVRLCRRARAASLGDYSVPEGHFPSHLVDVSRAGTLSQSYQYEVCLNGGT
FT                   GTNEFNFLKPLFPILPTQAAAEERENAVVRNSVEFY"
FT   gene            <160742..>163132
FT                   /gene="Pcdhb13"
FT                   /locus_tag="mCG_141298"
FT                   /note="gene_id=mCG141298.0"
FT   mRNA            <160742..>163132
FT                   /gene="Pcdhb13"
FT                   /locus_tag="mCG_141298"
FT                   /product="protocadherin beta 13"
FT                   /note="gene_id=mCG141298.0 transcript_id=mCT174375.0
FT                   created on 15-OCT-2002"
FT   CDS             160742..163132
FT                   /codon_start=1
FT                   /gene="Pcdhb13"
FT                   /locus_tag="mCG_141298"
FT                   /product="protocadherin beta 13"
FT                   /note="gene_id=mCG141298.0 transcript_id=mCT174375.0
FT                   protein_id=mCP97294.0"
FT                   /db_xref="GOA:Q91Y06"
FT                   /db_xref="InterPro:IPR002126"
FT                   /db_xref="InterPro:IPR013164"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR020894"
FT                   /db_xref="MGI:MGI:2136748"
FT                   /db_xref="UniProtKB/TrEMBL:Q91Y06"
FT                   /protein_id="EDL10158.1"
FT                   /translation="MSHAKMWCKTRQVMVLITSMLLWEVGSGSIQYAMLEETESGTFVA
FT                   NLTKHLGLRVGELAARDARVVFKGNRQYLQLDPQTQDLMLNENLDREELCGSTEPCVLS
FT                   FRVLLKNPLQFYQAELRVIDINDHAPEFPAREMLLKISEIAPPGKIFPLKMAQDLDTGS
FT                   HSIQSYTVSDNPHFHVLTRNRSDGKKFPELVLDKALDREKQDQLRLKLTAVDGGSPPRS
FT                   GTTEIQILVLDINDNTPEFAQELYEVQVPENSPIGSLLITVSARDLDAGPFGEVSYGLS
FT                   QDDDVNEPFEINTKTGEIRLKSTLDFEAFQSYHVDVEALDGGGLTGKCSLVVQVLDVND
FT                   NAPEVILSSLNSPIPENLPGIIVAVFSVSDADSGNNQQVMCSIDDNLPFLLRPSMENFY
FT                   TLETDGALDRESRSEYNITITVTDMGTPRLTTQHNITVQVSDINDNAPAFTQTSYTLFV
FT                   HENNSPALHIGTISATDSDSGSNAHITYSLLLPQDKQLTLTSLVSINADNGQLFALRAL
FT                   DYEALQAFEFRVDATDQGSPALSSQVLVRVVVLDDNDNAPFVLYPMQNASAPCTELLPR
FT                   AAEPGYLVTKVVAVDRDSGQNAWLSFQLFKATEPGLFSVWAHNGEVRTTRLLSERDVPK
FT                   HRLLLLVKDNGEPPRSASVTLHVLLVDGFSQPYLPLPEVAQDSTEDAEDALTLYLVIAL
FT                   ASVSSLFLLSVVLFVGVRLCKKFRAASLGGYSVPEGHFPGHLVDVSGAGTLSQSYQYEV
FT                   CLRGDTGTGEFKLRKAINPHFPSVPSERNTEESPTLRNSFLFI"
FT   gene            165826..169265
FT                   /gene="Pcdhb14"
FT                   /locus_tag="mCG_141296"
FT                   /note="gene_id=mCG141296.1"
FT   mRNA            165826..169265
FT                   /gene="Pcdhb14"
FT                   /locus_tag="mCG_141296"
FT                   /product="protocadherin beta 14"
FT                   /note="gene_id=mCG141296.1 transcript_id=mCT174374.1
FT                   created on 23-APR-2004"
FT   CDS             165978..168404
FT                   /codon_start=1
FT                   /gene="Pcdhb14"
FT                   /locus_tag="mCG_141296"
FT                   /product="protocadherin beta 14"
FT                   /note="gene_id=mCG141296.1 transcript_id=mCT174374.1
FT                   protein_id=mCP97295.1"
FT                   /protein_id="EDL10157.1"
FT                   /translation="MIICCIFWSRGTMETSLHKAPQKRQVTAIIFLLLLWEAGSATITY
FT                   SVLEETDRGSLVGNLAKDLGLSLRELITRGAQILSKGNKQLLQLEQKSGNLLLKEKLDR
FT                   EELCGSTNPCILHFQVLLKSPVQFIQGEIQLQDVNDHAPEFMEDEILLKILESSLPGAV
FT                   FPLKIAQDLDVGSNTVQNYTISTNAHFHLLTRNHSDGRKYPELVLDKALDREEQAQIRL
FT                   TLTAMDSGSPPKTGTTQVVIVVLDINDNAPEFAQGLYEVQVQENSPVGSLVLTVSARDL
FT                   DAGTHGELSYSLFQSSNQVLQAFEVNTDTGEIRVRKLLDFEEIQSYRMEIEASDGGGLS
FT                   GKCTVVIHVMDVNDNAPELTMSVLISEIPENSPETIVAIFGISDPDSGDNGKMVCSVQD
FT                   RLPFLLKPNEENFYTLVTERALDRESRAEYNITITVSDMGTPRLTTQHTITVQVSDIND
FT                   NAPAFTHTSYTMFVRENNSPALHIGTISATDSDSGSNAHITYSLLPPHDPQLALNSLIS
FT                   INADNGQLFALRALDYEALQAFEFHVGATDGGSPALSSQALVRVVVLDDNDNAPFVLYP
FT                   MQNASAPCTELLPRAAEPGYLVTKVVAVDRDSGQNAWLSFQLLKTTEPGLFSVWAHNGE
FT                   VRTTRLLSERDVPKHRLLLLVKDNGEPPHSASVTLHVLLVDGFSQPYLPLPEVARDPAQ
FT                   EDVLTLYLVIALASVSSLFLVSVLLFVGVRLCRKAGETSLGGCSVPEGHFPGHLVDVSG
FT                   TGTLSQSYQYEVCLTGGTGTNEFKFLKPVLPNFLNEGGYRNTEENSNFRDSLGFS"
FT   gene            191715..194510
FT                   /gene="Pcdhb15"
FT                   /locus_tag="mCG_141293"
FT                   /note="gene_id=mCG141293.1"
FT   mRNA            191715..194510
FT                   /gene="Pcdhb15"
FT                   /locus_tag="mCG_141293"
FT                   /product="protocadherin beta 15"
FT                   /note="gene_id=mCG141293.1 transcript_id=mCT174361.1
FT                   created on 23-APR-2004"
FT   CDS             191887..194247
FT                   /codon_start=1
FT                   /gene="Pcdhb15"
FT                   /locus_tag="mCG_141293"
FT                   /product="protocadherin beta 15"
FT                   /note="gene_id=mCG141293.1 transcript_id=mCT174361.1
FT                   protein_id=mCP97283.1"
FT                   /db_xref="GOA:Q91Y04"
FT                   /db_xref="InterPro:IPR002126"
FT                   /db_xref="InterPro:IPR013164"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR020894"
FT                   /db_xref="MGI:MGI:2136750"
FT                   /db_xref="UniProtKB/TrEMBL:Q91Y04"
FT                   /protein_id="EDL10156.1"
FT                   /translation="MEARLEQAVQKRQVLFLYVFLGASWASAEQLQYSVAEETERGTFL
FT                   ANLAKDLGLGLGELSAREARIVSDQNTRFLLLSPLTGELILNEKLDREELCGPTEPCVL
FT                   TFQLLLERPFQIYRAALHIKDINDNSPVFLDKEILLKISESTTPGATLLLERAQDADVG
FT                   TNSLSNYTISPNDYFHIHVHDGGEGPIIPELVLDKMLDREEIPEFTLTLTALDGGSPPR
FT                   SGTALVQILVLDINDNSPQFVQSLYKVQSPENTPVGSLVVAVSARDLDTGSYGQIDYTF
FT                   FYATERILQTFQINSTSGELYLKRELNYEAIQTYSITIQARDGGGLSGKCAVVVEVMDV
FT                   NDNPPEFLLSSLNSPIPENSQETVVAVFKIRDRDSGNNGKTLCSIANDLPFVLKPSVEN
FT                   FYTLVTEKPLDRESNTEYNITITVTDMGIPRLTTQHTITVQVSDINDNAPTFTQTSYTM
FT                   FVRENNSPALHIGTISATDSDSGSNAHITYSLRLPHDPQLALDSLISINADNGQLFALR
FT                   ALDYEALQAFEFHVGAIDQGSPALSSQALVRVVILDDNDNAPFVLYPMQNASAPYTELL
FT                   PRAAEPGYLVTKVVAVDRDSGQNAWLSFQLLKATEPGLFSVWAHNGEVRTTRLLSERDV
FT                   PKHKLLVVVKDNGEPPRSASVTLHVLLVDGFSQPFLILPEVARDPAQEDDELTLYLVIA
FT                   LASVSSLFLVSVLLFVGVRLCRRARAASPGVCFVPEEHFPGHLVDVSGAGTLSQNYQYE
FT                   VCLTGGSGITSEFKFLSPIASNFLTESTGREIE"
FT   gene            <196157..>198565
FT                   /locus_tag="mCG_141291"
FT                   /note="gene_id=mCG141291.0"
FT   mRNA            <196157..>198565
FT                   /locus_tag="mCG_141291"
FT                   /product="mCG141291"
FT                   /note="gene_id=mCG141291.0 transcript_id=mCT174360.0
FT                   created on 15-OCT-2002"
FT   CDS             196157..198565
FT                   /codon_start=1
FT                   /locus_tag="mCG_141291"
FT                   /product="mCG141291"
FT                   /note="gene_id=mCG141291.0 transcript_id=mCT174360.0
FT                   protein_id=mCP97284.0"
FT                   /db_xref="GOA:Q91Y03"
FT                   /db_xref="InterPro:IPR002126"
FT                   /db_xref="InterPro:IPR013164"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR020894"
FT                   /db_xref="MGI:MGI:2136752"
FT                   /db_xref="UniProtKB/TrEMBL:Q91Y03"
FT                   /protein_id="EDL10155.1"
FT                   /translation="MEASRKLICRQRQVLFFFLLLGFPLTTAGELRRYSVVEEKEGRSF
FT                   VTNLVKDLGLGQLELSRRGAKVISKGNKLHLQLDQETGDLLLNEKVDREKLCGHTEPCL
FT                   LSFQVLLDNPLDIFQAELEVTDINDHSPEFLDKEIMLKISESSLPGATFPLKNAQDMDV
FT                   GQNGIDKYLISSNSYFRVLTRKRSDGKKYPELVLDRALDREEEAELRLTLTAQDGGSLP
FT                   RSGTTEVHIEVLDINDNAPQFEQLFYKAQIPEDSPIGFLIITVSATDKDIGVNGQISYS
FT                   LFQVSDDISKTFSIHPLTGEVRLKEHLDFEKTQSYEINIEARDAGTFSGKCTILAQVLD
FT                   VNDHAPEIILSAFTNSILENLPETMVAVFSVSDLDSGENGKVSCSIQDDLPFFLKPSGE
FT                   NFYTLLSQKPLDRESVAEYNITITVADMGSPILKTQVNLTVQVSDINDNAPIFTQTSYT
FT                   MFIRENNSPALHIGTISATDSDSGSNAHITYSLLPPHDHQLALASFISINADNGQLFVL
FT                   RALDYEALQAFEFHVGATDGGSPALSSQALVRMVVLDDNDNAPFVLYPMQNASAPYTEL
FT                   LPRAAEPGYLVTKVVAVDRDSGQNAWLSFQLLKATEPGLFSVWAHNGEVHTSRLLSERD
FT                   VHKHRLILLVKDNGDPPRSASVTLHVLLVDGFSQPYLPLPEVARDPDHEDSELTLYLVI
FT                   ALASVSSLFLVSVLLFVGVRLCRRAREVSLGGCSVPEGHFPGHLVDVSGTGTLSQSYQY
FT                   EVCLTGDSGTGEFKYLKPILPNFQDHSFRPEMGENPNSRNDWSFGIQLK"
FT   gene            <203336..206466
FT                   /locus_tag="mCG_141290"
FT                   /note="gene_id=mCG141290.0"
FT   mRNA            <203336..206466
FT                   /locus_tag="mCG_141290"
FT                   /product="mCG141290"
FT                   /note="gene_id=mCG141290.0 transcript_id=mCT174362.0
FT                   created on 15-OCT-2002"
FT   CDS             203336..205735
FT                   /codon_start=1
FT                   /locus_tag="mCG_141290"
FT                   /product="mCG141290"
FT                   /note="gene_id=mCG141290.0 transcript_id=mCT174362.0
FT                   protein_id=mCP97282.0"
FT                   /db_xref="GOA:Q91VD8"
FT                   /db_xref="InterPro:IPR002126"
FT                   /db_xref="InterPro:IPR010221"
FT                   /db_xref="InterPro:IPR013164"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR020894"
FT                   /db_xref="MGI:MGI:2136754"
FT                   /db_xref="UniProtKB/TrEMBL:Q91VD8"
FT                   /protein_id="EDL10154.1"
FT                   /translation="METAWMCNLRQRQVLAFFVLLHVSGAGAELGPYSIEEETERGSFV
FT                   ANLGKDLGVDLAEISNRRARIISQENKEHLQLNLQSGDLLINEKLDREELCGPIEPCVL
FT                   HFQVLMENPLEVFQAELRVMDINDYSPVFSEREMILRILENSALGDTFPLNNALDSDVA
FT                   INNIQTYRLSSNSHFLVVTRNRSDGRKYPELVLEKELDREEEPELRLTLTALDGGAPPR
FT                   SGTAQVLIEVVDINDNAPKFQQPTYRVQIPENSPTGSLVLTVSANDLDSGDYGKVLYAL
FT                   SQPSEDISKTLEVNPVTGEIRLRKEVDFETIPSYEVDIKATDGGGLSGKCTLLLKVVDV
FT                   NDNAPEVMLSALTSPVPENSPDEVVAVFSVKDPDSANNGKMIASIEEDLPFLLKSSGKN
FT                   FYTLVTKRALDREEREKYNITITVSDLGTPRLTTQHTITVQVSDTNDNAPAFNQTSYTL
FT                   FVRENNSPAMHIGTISATDSDAGSNSHISYSLLPSHDPQLALDSLISINADNGQLFALR
FT                   ALDYEALQAFEFHVGAIDQGSPALSSQALVRVVVLDDNDNAPFVLYPMQNSSAPCTELL
FT                   PRAAEPGYLVTKVVAVDRDSGQNAWLSFQLLKATEPGLFSVWAHNGEVRTTRLLSERDV
FT                   PKHRLVLLVKDNGDPPRSASVTLHVLVVDGFSQPYLPLPEVARNPAHDEDALTLYLVIA
FT                   LASVSSLFLLSVLLFVGVRLCRRARSASLSGYSVPEGHIPGHLVDVRGVGTLSQSYQYD
FT                   VCLMGDSSGTSEFNFLKPVFPSSLDQCSGKEIEENSSLHNSFGFHH"
FT   gene            <207797..>210175
FT                   /gene="Pcdhb18"
FT                   /locus_tag="mCG_141288"
FT                   /note="gene_id=mCG141288.0"
FT   mRNA            <207797..>210175
FT                   /gene="Pcdhb18"
FT                   /locus_tag="mCG_141288"
FT                   /product="protocadherin beta 18"
FT                   /note="gene_id=mCG141288.0 transcript_id=mCT174365.0
FT                   created on 15-OCT-2002"
FT   CDS             207797..210175
FT                   /codon_start=1
FT                   /gene="Pcdhb18"
FT                   /locus_tag="mCG_141288"
FT                   /product="protocadherin beta 18"
FT                   /note="gene_id=mCG141288.0 transcript_id=mCT174365.0
FT                   protein_id=mCP97281.0"
FT                   /db_xref="GOA:Q91Y02"
FT                   /db_xref="InterPro:IPR002126"
FT                   /db_xref="InterPro:IPR013164"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR020894"
FT                   /db_xref="MGI:MGI:2136756"
FT                   /db_xref="UniProtKB/TrEMBL:Q91Y02"
FT                   /protein_id="EDL10153.1"
FT                   /translation="MAARGSCVSRQRQVLFLFLLGGLCLAGSELGRYSVTEETERGSFV
FT                   ANLAKDLGLGVEALAAKRTRVVCDDNKQHLFLDSHTGDLLTNEKLDREKLCGPTEPCML
FT                   YFQILMDNPFQIYRAELRILDINDHSPIFQDKKMILKILENTAVGTTFRLERAQDSDGG
FT                   RNGIQNYTISPNTFFHITVHNSDEGMIYPELVLDKALDWEGQPEFSLTLTALDGGSPPR
FT                   SGTATIHILVLDINDNAPQFPQELYEIQAPENSPIGLVVIKVTGEDVDSGVNAEISYSF
FT                   FDASEDIRATFQINPFSGEITLKALLDYEFIKSYKLNVQAVDGGGLSARCTVLVRVLDV
FT                   NDNAPELIMSSLVNEVVENSPETVLAVFRINDRDSGENGKMVCHIQENLPFLLKPSVDN
FT                   FYILMTEGALDRESRAEYNITITVSDLGTPRLTTQHTIRVQVSDINDNAPAFNQTSYTL
FT                   FVRENNSPAMHIGTISATDSDAGSNAHITYSLLPTQDLQMTLTSLVSINADNGQLFAIK
FT                   ALDYEALQAFEFHVGATDRGSPELSSQALVRVVVLDDNDNAPFVLYPMQNASAPYTELL
FT                   PRTAEPGYLVTKVVAVDRDSGQNAWLSFQLLKATEPGLFSVWAHNGEVRTTRLLSERDV
FT                   PKHRLLLLVKDNGDPPRSASVTLQVLLVDGFSQPYLPLPEVAHNPTQGEEDVLTLYLVI
FT                   ALASVSSLFLLSVLLFVGVRLCRRARAASLGGCSVPEGHFPGHLVDVSGTGTLSQNYQY
FT                   EVCLMGGSSGTSDFKFLKSIYPEVHAYSSQDNSDGNPTF"
FT   gene            <215332..218011
FT                   /locus_tag="mCG_141286"
FT                   /note="gene_id=mCG141286.0"
FT   mRNA            <215332..218011
FT                   /locus_tag="mCG_141286"
FT                   /product="mCG141286"
FT                   /note="gene_id=mCG141286.0 transcript_id=mCT174368.0
FT                   created on 15-OCT-2002"
FT   CDS             215332..217737
FT                   /codon_start=1
FT                   /locus_tag="mCG_141286"
FT                   /product="mCG141286"
FT                   /note="gene_id=mCG141286.0 transcript_id=mCT174368.0
FT                   protein_id=mCP97279.0"
FT                   /db_xref="GOA:Q91Y01"
FT                   /db_xref="InterPro:IPR002126"
FT                   /db_xref="InterPro:IPR013164"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR020894"
FT                   /db_xref="MGI:MGI:2136757"
FT                   /db_xref="UniProtKB/TrEMBL:Q91Y01"
FT                   /protein_id="EDL10152.1"
FT                   /translation="MENQEGLYLQTRQVLLLFVFLGMSQAHSEAGRLSVVEEMLSGALV
FT                   GNLVKDLGLQVDELSAREAQVASSDNKLPLQLNINTGDLLLSEPLDREELCGSTEPCVL
FT                   HFQVLLKNPLKILQAELQVTDVNDNSPVFLEKEMVLEIPENSPVGAVFLLESAIDLDVG
FT                   INAVKSYEISQNSHFHVTMRVNPDGRKYPELVLDKALDYEEQHELRLILTALDGGTPPR
FT                   SGTALVRVEVIDINDNSPEFDHMFYEVTVPENSMLGSLLITASAWDLDSGINGEVSYAF
FT                   SHASEDIRKTFAINEHSGEIRLKGYLDFETTESYSIIIKATDRGGLFGKSTVRIQVMDV
FT                   NDNFPEIIVSSFISPIPENTAETLVMIFSIRDKDSGENGKMVCTIPEGLPFVLKSSIEN
FT                   YYHLETDGALDRESIAEYNITISVTDLGTPRLTTQHTIIVQVADINDNAPAFTQTSYTM
FT                   FFHENNSPALHIGTISATDSDAGSNAHITYSLMSAQDLQMALSSLISINADNGQLFALR
FT                   ALDYEVLQAFEFQVGATDRGSPALSSQALVRVVVLDDNDNAPFVLYPMQNASAPCTELL
FT                   PRAAEPGYLVTKVVAVDRDSGQNAWLSFQLLKATEPGLFSVWAHNGEVRTTRLLSERDA
FT                   PKHRLLLLVKDNGDPPRSASVTLHVLVVDGFSQPYLPLPEVARNPAHEEDALTLYLVTA
FT                   LASVSSLFLLSVMLFVGVRLCRRARAASLGGCTVPEGHFPDHLMGINSAGTLSQSYQYE
FT                   VCLMGGSGTNEFRFLKPVSPNLQPQFPGKEIEESSTLRNSFGLFRDCN"
FT   gene            <222447..226005
FT                   /locus_tag="mCG_141284"
FT                   /note="gene_id=mCG141284.1"
FT   mRNA            <222447..226005
FT                   /locus_tag="mCG_141284"
FT                   /product="mCG141284"
FT                   /note="gene_id=mCG141284.1 transcript_id=mCT174367.1
FT                   created on 23-APR-2004"
FT   CDS             <222586..225006
FT                   /codon_start=1
FT                   /locus_tag="mCG_141284"
FT                   /product="mCG141284"
FT                   /note="gene_id=mCG141284.1 transcript_id=mCT174367.1
FT                   protein_id=mCP97280.1"
FT                   /protein_id="EDL10151.1"
FT                   /translation="KKSPEGTMGRRRALILQKRQVLVFFVFLGLSQASAESLRYSVAEE
FT                   TEIGSFVANLAKDLGLGVAELSSREARVVSDDNKKHLLLNLLTGDMLLNERLDREELCG
FT                   STQPCVLPFQVVLENPLQFYRAELHVRDINDHSPTFLDKEITIKISESTTIGATFLIEN
FT                   AQDLDIGSNSLQDYSISPSSYFYVKIHDSGDGKIYPELVLDKALDHEEESELRLTLTAL
FT                   DGGSPPRSGTTLIVIKVLDINDNAPEFAQSFYEVQVPEDMPIGSSITAISAKDLDMGIY
FT                   GKISYSFLHASEDIRKTFEINPTSGEVNLRSLMDFEVIQSYSVNIQATDGGGLSAKCTL
FT                   SVKVLDINDNAPEVIMSSVTKAIPENASETLVALFSVRDQDSGDNGRILCSIQDDLPFI
FT                   LKPSFKNFFTLLSEKALDRERRAEYNITITASDMGTPRLTTQHTIRVQVSDINDNAPAF
FT                   TQTSYTMFIYENNSPALHIGTISATDKDSGSNAHITYSLLPAQDPELALASLISINADN
FT                   GQLFALRALDYEVLQAFEFQVGATDRGSPALSSQTLVRVVVLDDNDNAPFVLYPMQNAS
FT                   APCTELLPRVAEPGYLVTKVVAVDRDSGQNAWLSFQLLKATEPGLFSVWAHNGEVRTTR
FT                   LLSERDVPKHRLVLLVKDNGDPPRSASVTLHVLVVDGFSQPYLPLPEVARDPAQEEDVL
FT                   TLYLVIALASVSSLFLLSVLLFVGVRLCRRARAASLGGCSVPEGHFPGHLVDVTGTGTL
FT                   SQNYQYEVCFTGGTGTNEFKFLRPVMPSLQLHDPDSNMLEKENFRNSLGFNIQ"
FT   gene            <232014..234557
FT                   /locus_tag="mCG_1033322"
FT                   /note="gene_id=mCG1033322.1"
FT   mRNA            <232014..234557
FT                   /locus_tag="mCG_1033322"
FT                   /product="mCG1033322"
FT                   /note="gene_id=mCG1033322.1 transcript_id=mCT151026.1
FT                   created on 15-OCT-2002"
FT   CDS             232014..234338
FT                   /codon_start=1
FT                   /locus_tag="mCG_1033322"
FT                   /product="mCG1033322"
FT                   /note="gene_id=mCG1033322.1 transcript_id=mCT151026.1
FT                   protein_id=mCP77965.0"
FT                   /db_xref="GOA:Q91V48"
FT                   /db_xref="InterPro:IPR002126"
FT                   /db_xref="InterPro:IPR013164"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR020894"
FT                   /db_xref="MGI:MGI:2136759"
FT                   /db_xref="UniProtKB/TrEMBL:Q91V48"
FT                   /protein_id="EDL10150.1"
FT                   /translation="MEPGVGAAQHIRQVLLFFVFLEGSSVLATTWRYSVPEEMETGSSI
FT                   ANIIKDMDVGDLAARGARVIFDDYQPYLRLELETGNLLLNEKLDREALCSSSEPCILHF
FT                   QVLLENPLQFFQAELLIEDINDHTPTFLEKLIFLNISESATPGTSFQMDDAQDLDIGMN
FT                   GIQNYSISPNPYFYLKLKDSGKGRRYPELVLVRSLDREKEASISLILTAMDGGSLPRSG
FT                   TVLVQVVVLDVNDNAPEFERTLYEVQVPENSSVDSLVIKVSATDLDSGINGEISYSFSH
FT                   ISRDVQKTFEIHPTSGEVRLKRLLDFEVIQSYTINIQAIDGGGLSGKSAIIVQVTDVND
FT                   NPPEIVITSLMSSIPENGLSEMVVAVFSLRDQDSGENGRMMCSIEDKLPFLLKPTFKNF
FT                   YTLVTEHPLDRESRAEYNITVMISDLGTPRLTTQHTITVHISDINDNAPAFTQTTYTMF
FT                   VRENNSPALHIGTISATDSDLGSNAHITYSLLPPQDQRLALTSLISINADNGQLFALRA
FT                   LDYETLQAFEFRVGATDRGSPALSSQALVRVVVLDDNDNAPFVLYPMQNASAPCTELLP
FT                   RAAEPGYLVTKVVAVDRDSGQNAWLSFQLLKATEPGLFSVWAHNGEVRTTRLLSERDVP
FT                   KHRLLLLVKDNGDPPRSASVTLHLLVVDGFSQPYLPLPEVAHDSTQVDEEALTLYLVIA
FT                   LASVSSLFLLSVLLFVGVRLCRRARAASLSGYSEPDGHFSGHLVDVSGAGTLSQSYQYE
FT                   VCLTGMSDSNDIRFLKPVSQP"
FT   gene            236546..239613
FT                   /gene="Pcdhb22"
FT                   /locus_tag="mCG_1033321"
FT                   /note="gene_id=mCG1033321.2"
FT   mRNA            236546..239613
FT                   /gene="Pcdhb22"
FT                   /locus_tag="mCG_1033321"
FT                   /product="protocadherin beta 22"
FT                   /note="gene_id=mCG1033321.2 transcript_id=mCT151025.2
FT                   created on 23-APR-2004"
FT   CDS             236675..239059
FT                   /codon_start=1
FT                   /gene="Pcdhb22"
FT                   /locus_tag="mCG_1033321"
FT                   /product="protocadherin beta 22"
FT                   /note="gene_id=mCG1033321.2 transcript_id=mCT151025.2
FT                   protein_id=mCP77954.2"
FT                   /db_xref="GOA:Q91XZ8"
FT                   /db_xref="InterPro:IPR002126"
FT                   /db_xref="InterPro:IPR013164"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR020894"
FT                   /db_xref="MGI:MGI:2136760"
FT                   /db_xref="UniProtKB/TrEMBL:Q91XZ8"
FT                   /protein_id="EDL10149.1"
FT                   /translation="MKIGREHRKRQVLLIFLLLGVVGAGSEPRRYFVMEETPSGTVLAD
FT                   LVQDLGLGVAELAARGAQVVSEEKESRLQLDLQTGKLILNEKLDREELCGSTEPCVTHF
FT                   QVLLKKPLEIFQAELRVGDINDHSPEFPEREMAVKIIENSPVGTAFLLKTAQDLDVGNN
FT                   SVQNYKIGTNSHFHVSIRNRGDGRKYPELVLDKELDREVQAAFRLTLTALDGGSPPRTG
FT                   TSQIRIVVLDVNDNAPEFAQAFYRVQIPENSPSGSMVAKVSAKDLDTGTNGEVSYSLFH
FT                   SSQEMSKTFELNALSGEVRLIKTLDFETTPSYELDIEATDGGGLSGKCSVSIQVVDVND
FT                   NYPELIISSLTNPIPENSPETEVALFRIRDRDSGENGRTICSIQDGVPFTLEPSVENFY
FT                   RLVTDGALDREIRAEYNITISVTDLGIPKLTTQHTITVQVSDINDNAPAFTQVSYTMLV
FT                   HENNSPALHIGTISATDSDSGSNAHITYSLLPAQEPQLALNSLISINADNGQLFALRAL
FT                   DYEALQAFEFHVSATDRGSPALSSQALVRIVVLDDNDNAPFVLYPMQNASAPCTELLPR
FT                   AAEPGYLVTKVVAVDRDSGQNAWLSFQLLKATEPGLFSVWAHNGEVRTTRLLSERDVPK
FT                   HRLLLVVKDNGEPPRSASVTLQVLMVDGFSQPYLPLPEVVRDPSHQEGDVLTLYLVIAL
FT                   ASVSSLFLLSVLLFVGVRLCRRAREVSLGGCSVPEGHFPGHLVDVSGAGTLSQSYQYEV
FT                   CLTGDSQSNEFKFLKPVFSGIVDQNYGRQPDDQSFSSVLGM"
FT   gene            324973..325833
FT                   /locus_tag="mCG_147296"
FT                   /note="gene_id=mCG147296.0"
FT   mRNA            join(324973..325075,325454..325833)
FT                   /locus_tag="mCG_147296"
FT                   /product="mCG147296"
FT                   /note="gene_id=mCG147296.0 transcript_id=mCT187559.0
FT                   created on 13-JAN-2004"
FT   CDS             join(325027..325075,325454..325548)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147296"
FT                   /product="mCG147296"
FT                   /note="gene_id=mCG147296.0 transcript_id=mCT187559.0
FT                   protein_id=mCP109684.0"
FT                   /protein_id="EDL10148.1"
FT                   /translation="MEPIGEDDEPEPRGAIIIWEEEPLLRKCLLLITYRQVCETFSCGT
FT                   FS"
FT   gene            complement(336738..337942)
FT                   /locus_tag="mCG_1033320"
FT                   /note="gene_id=mCG1033320.1"
FT   mRNA            complement(336738..337942)
FT                   /locus_tag="mCG_1033320"
FT                   /product="mCG1033320"
FT                   /note="gene_id=mCG1033320.1 transcript_id=mCT151024.1
FT                   created on 16-OCT-2002"
FT   CDS             complement(337038..337835)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1033320"
FT                   /product="mCG1033320"
FT                   /note="gene_id=mCG1033320.1 transcript_id=mCT151024.1
FT                   protein_id=mCP77942.1"
FT                   /db_xref="GOA:Q99ML6"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="MGI:MGI:2137907"
FT                   /db_xref="UniProtKB/TrEMBL:Q99ML6"
FT                   /protein_id="EDL10147.1"
FT                   /translation="MQTFPQLYKGLADCFLKTYNQVGIRGLYRGTSPALLAYVTQGSVL
FT                   FMCFGFCQQFVRKVARVEQNAELNDLETATAGSLASAFAALALCPTELVKCRLQTMYEM
FT                   KMSGKIAQSYNTIWSMVKSIFMKDGPLGFYRGLSTTLAQEIPGYFFYFGGYEISRSFFA
FT                   SGGSKDELGPVPLMLSGGFAGICLWLIIFPVDCIKSRIQVLSMFGKPAGLIETFISVVR
FT                   NEGISALYSGLKATLIRAIPSNAALFLVYEYSRKMMMNMVEEY"
FT   gene            complement(341383..343513)
FT                   /gene="Taf7"
FT                   /locus_tag="mCG_133387"
FT                   /note="gene_id=mCG133387.0"
FT   mRNA            complement(join(341383..342893,343306..343513))
FT                   /gene="Taf7"
FT                   /locus_tag="mCG_133387"
FT                   /product="TAF7 RNA polymerase II, TATA box binding protein
FT                   (TBP)-associated factor"
FT                   /note="gene_id=mCG133387.0 transcript_id=mCT134753.0
FT                   created on 15-OCT-2002"
FT   CDS             complement(341848..342873)
FT                   /codon_start=1
FT                   /gene="Taf7"
FT                   /locus_tag="mCG_133387"
FT                   /product="TAF7 RNA polymerase II, TATA box binding protein
FT                   (TBP)-associated factor"
FT                   /note="gene_id=mCG133387.0 transcript_id=mCT134753.0
FT                   protein_id=mCP77549.1"
FT                   /protein_id="EDL10146.1"
FT                   /translation="MSKNKDDAPHELESQFILRLPPEYAATVRRAVQSGHVNLKDKLSI
FT                   ELHPDGRHGIVRVDRVPLAAKLVDLPCVTESLKTIDKKTFYKTADISQMLVATVDGDLY
FT                   PPVEEAAATADPKANKKKDKDKEKKFVWNHGITLPLKNVRKRRFRKTAKKKYIESPDVE
FT                   KEVKRLLSTDAEAVSTRWEIIAEDETKETENQGLDISSPGMSGHRQGHDSLEHDELREI
FT                   FNDLSSSSEDEEDVNILDTEEDLERQLQDKLNESDEQHQENEGTNQLVMGIQKQIDNMK
FT                   GKLQETQDRAKRQEDLIMKVENLALKNRFQAVLDELKQKEDREKEQLSSLQEELESLLE
FT                   K"
FT   gene            complement(351749..352312)
FT                   /pseudo
FT                   /locus_tag="mCG_133389"
FT                   /note="gene_id=mCG133389.0"
FT   mRNA            complement(351749..352312)
FT                   /pseudo
FT                   /locus_tag="mCG_133389"
FT                   /note="gene_id=mCG133389.0 transcript_id=mCT134755.0
FT                   created on 15-OCT-2002"
FT   gene            <355263..358064
FT                   /locus_tag="mCG_145145"
FT                   /note="gene_id=mCG145145.0"
FT   mRNA            join(<355263..356001,356008..356624,356645..358064)
FT                   /locus_tag="mCG_145145"
FT                   /product="mCG145145"
FT                   /note="gene_id=mCG145145.0 transcript_id=mCT184569.0
FT                   created on 05-JUN-2003"
FT   CDS             <356811..357248
FT                   /codon_start=1
FT                   /locus_tag="mCG_145145"
FT                   /product="mCG145145"
FT                   /note="gene_id=mCG145145.0 transcript_id=mCT184569.0
FT                   protein_id=mCP106256.0"
FT                   /protein_id="EDL10145.1"
FT                   /translation="FLFLPDQVTLHQESATVLCQQGQTAAVFLETTWKLVLSLIIRVWL
FT                   AQCHPEPPYWGGWLTQNTRSMLCQHLHKIRHCSAHCGACLPRDQSIHQLEAQELTALSH
FT                   ISDQLMWFFNLGTHTAKYVQHCSVSESEPTRAYVVDSHHVV"
FT   gene            <361336..552225
FT                   /locus_tag="mCG_133388"
FT                   /note="gene_id=mCG133388.1"
FT   mRNA            join(<361336..363756,535369..535427,543604..543692,
FT                   550253..552222)
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, transcript variant mCT174342"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174342.0
FT                   created on 14-OCT-2002"
FT   CDS             join(361336..363756,535369..535427,543604..543692,
FT                   550253..550479)
FT                   /codon_start=1
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, isoform CRA_t"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174342.0
FT                   protein_id=mCP97268.0 isoform=CRA_t"
FT                   /db_xref="GOA:Q91XZ0"
FT                   /db_xref="InterPro:IPR002126"
FT                   /db_xref="InterPro:IPR013164"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR020894"
FT                   /db_xref="MGI:MGI:1935212"
FT                   /db_xref="UniProtKB/TrEMBL:Q91XZ0"
FT                   /protein_id="EDL10137.1"
FT                   /translation="MAIPEKLTGWSLLVLVCLSLELLLEAGAGNIRYSVPEETDKGSFV
FT                   GSIAKDLGLETRELMERGIRIVSRGRSQLFSLNPRSGSLVTAGRIDREELCAQSTPCVV
FT                   SFNILMEDEMKLLPIEVEIIDINDNTPQFQLEELELKMSEITTPGTRIPLPLGQDLDVG
FT                   INSLQSYQLSANPHFSLDVQQGPEGPQQPEMVLQRPLDREKDAVHYLVLTASDGGSPIH
FT                   SGTLQIHVQVVDVNDNPPAFTKAEYHVSVPENVPLGTRLLKVNATDPDEGANGRVTYSF
FT                   HKVDHSVVRKFQLDAYTGELSNKEPLDFEEYKVYPMEIQAQDGAGLMARAKVLVTVLDV
FT                   NDNAPEVGITSVTNTVPENFPPGTTIALISVHDQDADNNGHITCSIPGNLPFKLEKLVD
FT                   NYYRLVTERTLDREQSSRHNITITATDQGTPPLSTQAHISLLVTDINDNPPVFEQDSYS
FT                   VYIPENNPRGASIFSVKAQDADHNENALVTYALVEDTIQGVPLSSYFSINSDTGVVYAL
FT                   QSFDYEQFRDLQLRVMAHDSGNPQLSSNVSLSLFMIDQNDNAPEILYPVLPTDGSTGVE
FT                   LAPRSAEPGYLVTKVVAVDKDSGQNSWLSYRLLKASEPGLFSVGLHTGEVRTARALLER
FT                   DALKQSLVVAVQDHGQPPLSTTVTFTIAVADSIPDLLADLGSMGTPADPQDSDLTLYLV
FT                   VAVAVVSCIFLAFVIVLLVLKLRHWYSSRLLQTEANGLTGLPASNFVGVDGVHAFLQTY
FT                   SREISLTADSRKSHLIFPQPNYADTLISHESCEKQEFLSAPQSLLEDKEEIFSQQAPPN
FT                   TDWRFSQAQRPGTSGSQNGDETGTWPNNQFDTEMLQAMILASASEAADGSSTLGGGAGT
FT                   MGLSARYGPQFTLQHVPDYRQNVYIPGSNATLTNAAGKRDGKAPAGGNGNKKKSGKKEK
FT                   K"
FT   mRNA            join(<368497..370917,535369..535427,543604..543692,
FT                   550253..552222)
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, transcript variant mCT174335"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174335.0
FT                   created on 14-OCT-2002"
FT   CDS             join(368497..370917,535369..535427,543604..543692,
FT                   550253..550479)
FT                   /codon_start=1
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, isoform CRA_c"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174335.0
FT                   protein_id=mCP97257.0 isoform=CRA_c"
FT                   /db_xref="GOA:Q91XY6"
FT                   /db_xref="InterPro:IPR002126"
FT                   /db_xref="InterPro:IPR013164"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR020894"
FT                   /db_xref="MGI:MGI:1935214"
FT                   /db_xref="UniProtKB/TrEMBL:Q91XY6"
FT                   /protein_id="EDL10120.1"
FT                   /translation="MATLQKLPQSRMLVLLCALWAALWEAKAGQIRYSVPEEIDKGSFV
FT                   GSIAKDLGLEPQALEERGVRIVSRGKSQLFALNPRSGSLVTAGRIDREELCAQSTPCLV
FT                   NFNLLLEDKLTIYSVEVEVTDVNDNAPRFGVEDPELKISETTTPGFRIPLKSAHDADVG
FT                   ENTLQKYKLNSNDHFSLDVRTGADGNKYPELVLERALDREEEAVHHLVLVASDGGNPVR
FT                   SGTCRIRVKVLDANDNAPAFTQAEYRVRVPENTPVGTRILTVTATDADEGYNAQVTYFQ
FT                   EHDPGETTDAFELKSTSGDITITKSLDYEKAKFHEIDIEAQDGPGLLTRTKVIVTVLDV
FT                   NDNAPEFYMTSATASVPEDAPLGTVIALFNVHDRDSGQNAVVTCSLPEMLPFKLERSVD
FT                   SYYRLVTTRALDREQFSFYNITVSAKDGGSPSLSTDAHLLLQVADINDNPPSFPRRVYS
FT                   AYIPENNPRGTSIFSVLASDPDSNDNAHVTYSLAEDSFQGAPLSSYVSINSDTGVLYAL
FT                   RSFDYEQFQDLQLWVIAADSGNPPLSSNVSLSLFLVDQNDNTPEILYPALPTDGSTGVE
FT                   LAPRSADPGYLVTKVVAVDKDSGQNAWLSYRLLKASEPGLFSVGLHTGEVRTARALLDR
FT                   DALKQSLVVAVQDHGQPPLSATVTLTIAIADNIPEVLADLGSIRTPANPDDSELTLYLV
FT                   VAVAVVSCVFLAFVIALLALRLRRWHLSRMLQASRDGLGGIPASHFVGVDGVRAFLQTY
FT                   SHEVSLTADSGKSHIIFPQPNYADTLISQESCEKTDFLSAPQSLLDDKREETPQQAPPN
FT                   TDWRFSQAQRPGTSGSQNGDETGTWPNNQFDTEMLQAMILASASEAADGSSTLGGGAGT
FT                   MGLSARYGPQFTLQHVPDYRQNVYIPGSNATLTNAAGKRDGKAPAGGNGNKKKSGKKEK
FT                   K"
FT   mRNA            join(<373886..374708,386834..387318,535369..535427,
FT                   543604..543692,550253..552222)
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, transcript variant mCT174345"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174345.0
FT                   created on 14-OCT-2002"
FT   CDS             373886..374389
FT                   /codon_start=1
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, isoform CRA_v"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174345.0
FT                   protein_id=mCP97263.0 isoform=CRA_v"
FT                   /protein_id="EDL10139.1"
FT                   /translation="MIRLGQGTAGALLCALLGTVCAAGFRQIRYSVPEELDKGSFVGNI
FT                   SKDLGLEPRELAVRGVRIISRGKSQLFSLDPRSGSLVTGGRIDREELCAQSAPCLVSFN
FT                   ILVEDKLKIFEVEVDITDINDNAPSFPTEELEIKIGELTDPGTRFPLKTAFDPGCGHER
FT                   PAEL"
FT   mRNA            join(<380899..382770,535369..535427,543604..543692,
FT                   550253..552222)
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, transcript variant mCT174337"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174337.0
FT                   created on 14-OCT-2002"
FT   CDS             join(<380899..382770,535369..535427,543604..543692,
FT                   550253..550479)
FT                   /codon_start=1
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, isoform CRA_d"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174337.0
FT                   protein_id=mCP97254.0 isoform=CRA_d"
FT                   /protein_id="EDL10121.1"
FT                   /translation="KESPDGSKYPELLLENPLDREHQSSHHLILTAMDGGDPPLSSTTQ
FT                   VWIKVTDANDNAPVFSQDTYKVSLRENIPPGTLVLQVTATDQDESIHGEITYAFLNAPA
FT                   STNLVFNLNPNTGAITTNGTLDFEEKNRYTLGVEAKDGGVHTAHCNVQIEILDDNDNAP
FT                   EVTFMSFSNQVPEDSVLGTVIALIKVRDKDSGQNGLVACHIQEELPFKLQPTSKNYYKL
FT                   VIDKALNREQTPEYNVTITATDSGKPSLSSKTCVTVHITDINDNAPVFHQASYLVHVAE
FT                   NNPPGASIAQVSASDPDLGSNGLISYSIIASDLEPRALSSFVSVNQDSGVVFAQRAFDH
FT                   EQLRSFQLTLQARDHGSPTLSANVSMRVLVGDRNDNAPRVLYPTLEPDGSALFDMVPRA
FT                   AEPGYLVTKVVAVDADSGHNAWLSYHVLQASDPGLFSLGLRTGEVRTARALGDRDSARQ
FT                   RLLVAVRDGGQPPLSATATLHLIFADSLQEVLPDLSDDPLPSDPQSELQFYLVVALALI
FT                   SVLFLLSVILAIALRLRHSSRSAAWGCFQPGLSLKSQPVVPPNYSEGTLPYSYNLCVAS
FT                   HSMTMAGFNFHHVAPEVAPPQDLLCDDLSVVVCGNNEDPQVSDDSAFQQAPPNTDWRFS
FT                   QAQRPGTSGSQNGDETGTWPNNQFDTEMLQAMILASASEAADGSSTLGGGAGTMGLSAR
FT                   YGPQFTLQHVPDYRQNVYIPGSNATLTNAAGKRDGKAPAGGNGNKKKSGKKEKK"
FT   mRNA            join(<385331..387748,535369..535427,543604..543692,
FT                   550253..552222)
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, transcript variant mCT174339"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174339.0
FT                   created on 14-OCT-2002"
FT   CDS             join(385331..387748,535369..535427,543604..543692,
FT                   550253..550479)
FT                   /codon_start=1
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, isoform CRA_e"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174339.0
FT                   protein_id=mCP97276.0 isoform=CRA_e"
FT                   /protein_id="EDL10122.1"
FT                   /translation="MAAPYKSDRRGLIWICIFLGSLCDIRAEQIRYSVPEELERGSVVG
FT                   NLAADLGLEPGKLAERGVRIVSRGKTQLFALNPRSGSLVTAGRVDREGLCDRSPKCTAN
FT                   LEILLEDKVRILAIEVEIIDVNDNAPSFGAQQREIKVAESENPGTRFPLPEAFDLDIGV
FT                   NALQGYQLSSNDHFSLDVQSGPDGIKYPELVLENALDREEEAVHHLVLTAFDGGDPVRS
FT                   GTATIQVTLVDTNDNAPVFTQPEYHISVKENLPVGTRLLTIKATDPDEGANGEVTYSFR
FT                   NVREKISQLFQLNSLTGDITVLGELDYEDSGFYDVDVEAHDGPGLRARSKVLVTVLDVN
FT                   DNAPEVTVTSLTSSIQEASSPGTVIALFNVHDSDSGENGLVTCSIPDNLPFRLEKTYGN
FT                   YHRLLIHRTLDREEVSDYNITITATDQGTPPLSTETYISLQVVDINDNPPTFTHASYSA
FT                   YIPENNPRGASILSITAQDPDSGENAQVIYSLSEDTIQGAPLSSYVSINSNTGVLYALR
FT                   SFDYEQFQDLKLLVTARDSGTPPLSSNVSLSLFVLDQNDNIPEILYPTIPTDGSTGVEL
FT                   TPRSADPGYLVTKVVAVDKDSGQNAWLSYRLLKASEPGLFSVGLHTGEVRTARALLDRD
FT                   ALKQSLVVTVQDHGQPPLSATVTLTIAVSDNIPDILADLVNINAPIDQEDSDITLYLVV
FT                   AVAAVSCVFLAFVIVLLIHRLRRWHSTRLLQAAGNGLSSLPASHFVGVDGVHAFLQTYS
FT                   HEVSLTADSGKSHLIFPQPNYADTLISQESCGKSDPLLVSQDLLEIKGDSSLQQAPPNT
FT                   DWRFSQAQRPGTSGSQNGDETGTWPNNQFDTEMLQAMILASASEAADGSSTLGGGAGTM
FT                   GLSARYGPQFTLQHVPDYRQNVYIPGSNATLTNAAGKRDGKAPAGGNGNKKKSGKKEKK
FT                   "
FT   mRNA            join(<389903..392314,535369..535427,543604..543692,
FT                   550253..552222)
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, transcript variant mCT174340"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174340.0
FT                   created on 14-OCT-2002"
FT   CDS             join(389903..392314,535369..535427,543604..543692,
FT                   550253..550479)
FT                   /codon_start=1
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, isoform CRA_s"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174340.0
FT                   protein_id=mCP97272.0 isoform=CRA_s"
FT                   /protein_id="EDL10136.1"
FT                   /translation="MRRGSGSGPAWWLQVLSPFLLLLFHGALADQIRYSIPEELAKNSI
FT                   VGNLARDLGLSVQNLPTRKLRVSAEKDYFTVNPESGDLLVGDRIDREQVCGKQPQCVLE
FT                   FDIVAEKPLNIFHVAVILQDVNDNAPLFKQSEVDLNIGESARPGKAFPLDPALDLDAGS
FT                   NSLQKYYLTDNEYFEVTEKETPDGRKYPELILKRFLDREEHNFHQLVLTAVDGGDPPRS
FT                   GTTQIRIQVTDINDNPPMFSQDVFSVTLREDVPPGFSVLQVTATDQDEGVNAEITYAFH
FT                   NVDEQVERIFNLDKRTGEITTKDNLDFETAKSYTLNVEAKDPGDLASHCSIQVKILDEN
FT                   DCVPEVIVTSVFTPLPEDSPLGTVIALIKTRDRDSGENGDVYCHVLGNEGFVLKSSSKN
FT                   YYKLVTDRTLDREAIPEYNVTIVAADRGKPPLSSNVIITLHISDVNDNAPVFHQASYLV
FT                   HVAENNPPGTSIAQVSASDPDLGSNGLISYSIIASDLEPRALSSFVSVNQDSGVVFAQR
FT                   AFDHEQLRSFQLTLQARDHGSPTLSANVSMHVLVGDRNDNAPRVLYPTLEPDGSALFDM
FT                   VPRAAEPGYLVTKVVAVDADSGHNAWLSYHVLQASDPGLFSLGLRTGEVRTARALGDRD
FT                   SARQRLLVAVRDGGQPPLSATATLHLIFADSLQEVLPDLSDDPLPSDPQSELQFYLVVA
FT                   LALISVLFLLSVILAIALRLRHSSRSAAWGCFQPGLSSNLATGVLPNYNEGTLPYSYNV
FT                   CIASQSAKTEFNFLNVTPEVAPQDLLCGDDSWVPGTLGDTDVPFVSDSISKQAPPNTDW
FT                   RFSQAQRPGTSGSQNGDETGTWPNNQFDTEMLQAMILASASEAADGSSTLGGGAGTMGL
FT                   SARYGPQFTLQHVPDYRQNVYIPGSNATLTNAAGKRDGKAPAGGNGNKKKSGKKEKK"
FT   mRNA            join(<389945..392154,543604..543692,550253..552222)
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, transcript variant mCT174346"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174346.0
FT                   created on 14-OCT-2002"
FT   CDS             join(<389945..392154,543604)
FT                   /codon_start=1
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, isoform CRA_h"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174346.0
FT                   protein_id=mCP97273.0 isoform=CRA_h"
FT                   /protein_id="EDL10125.1"
FT                   /translation="VLSPFLLLLFHGALADQIRYSIPEELAKNSIVGNLARDLGLSVQN
FT                   LPTRKLRVSAEKDYFTVNPESGDLLVGDRIDREQVCGKQPQCVLEFDIVAEKPLNIFHV
FT                   AVILQDVNDNAPLFKQSEVDLNIGESARPGKAFPLDPALDLDAGSNSLQKYYLTDNEYF
FT                   EVTEKETPDGRKYPELILKRFLDREEHNFHQLVLTAVDGGDPPRSGTTQIRIQVTDIND
FT                   NPPMFSQDVFSVTLREDVPPGFSVLQVTATDQDEGVNAEITYAFHNVDEQVERIFNLDK
FT                   RTGEITTKDNLDFETAKSYTLNVEAKDPGDLASHCSIQVKILDENDCVPEVIVTSVFTP
FT                   LPEDSPLGTVIALIKTRDRDSGENGDVYCHVLGNEGFVLKSSSKNYYKLVTDRTLDREA
FT                   IPEYNVTIVAADRGKPPLSSNVIITLHISDVNDNAPVFHQASYLVHVAENNPPGTSIAQ
FT                   VSASDPDLGSNGLISYSIIASDLEPRALSSFVSVNQDSGVVFAQRAFDHEQLRSFQLTL
FT                   QARDHGSPTLSANVSMHVLVGDRNDNAPRVLYPTLEPDGSALFDMVPRAAEPGYLVTKV
FT                   VAVDADSGHNAWLSYHVLQASDPGLFSLGLRTGEVRTARALGDRDSARQRLLVAVRDGG
FT                   QPPLSATATLHLIFADSLQEVLPDLSDDPLPSDPQSELQFYLVVALALISVLFLLSVIL
FT                   AIALRLRHSSRSAAWGCFQPGLSSNLATGVLPNYNEGTLPYS"
FT   mRNA            join(<394439..396862,535369..535427,543604..543692,
FT                   550253..552222)
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, transcript variant mCT174350"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174350.0
FT                   created on 14-OCT-2002"
FT   CDS             join(394439..396862,535369..535427,543604..543692,
FT                   550253..550479)
FT                   /codon_start=1
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, isoform CRA_w"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174350.0
FT                   protein_id=mCP97267.0 isoform=CRA_w"
FT                   /db_xref="GOA:Q91XY3"
FT                   /db_xref="InterPro:IPR002126"
FT                   /db_xref="InterPro:IPR013164"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR020894"
FT                   /db_xref="MGI:MGI:1935217"
FT                   /db_xref="UniProtKB/TrEMBL:Q91XY3"
FT                   /protein_id="EDL10140.1"
FT                   /translation="MADPPRRWICNDLLTFFMLLGTLCAPGKGQIRYSVREELDKGSFV
FT                   GNISKDLGLEPRELAERGVRIISRGRSQLFSLNPRGGSLVTAGRIDREELCVQSSPCLV
FT                   SFNILVENKMKIYGVEVEILDINDNFPRFRDEELKVKVNENAAAGTRLVLPFARDGDVG
FT                   VNSLQGYKLSSNRHFSLDVKSGSDGQKHPELVLEQPLDREKESAHDLVLTALDGGNPVL
FT                   SSTVHISVTVLDANDNAPLFTQSEYRVSVPENTPVGTRLLTLTATDADEGINAKLTFSF
FT                   RNEEDKISETFQLDSNLGEISTIQSLDYEESRFYLMEVVAQDGGALLASAKVLVTVQDV
FT                   NDNAPEVILTSLTSSVSEDCLPGTIIALFSVHDADSGENGEISCSIPKNLPFKLEKSVD
FT                   NYYHLLTTRALDREETSDYNITVTVVDRGTPPLSTENHISLKVADINDNPPTFSRPFYS
FT                   TSISENNPRGVSIFSVYAYDADSGDNAQVTYSLAENTFQEVPVSSYVSINSDTGVLYAL
FT                   QSFDYEHLRDLQLLVTAKDSGTPPLSSNVSMSLFVLDQNDNIPEILYPTIPTDGSTGVE
FT                   LAPRSAEPGYLVTKVVAVDKDSGQNAWLSYRLLKASEPGLFSIGLHTGEVCTARALLDR
FT                   DVLKQSLVVAVQDHGQPPLSATVTLTIAVGDSIPDVLTDLGNHNTLAEPQDSDLTLYLV
FT                   VSVAVVSCVFLGFVTVLLALRLRHWHMSRLLQTSTGRLADMPASHFVGMDGVQAYLQTY
FT                   SHEISLTTDSKKSHLIFPQPNYADRLISEESCEKSEPLLIPHNIHTHKEEPGDAQQAPP
FT                   NTDWRFSQAQRPGTSGSQNGDETGTWPNNQFDTEMLQAMILASASEAADGSSTLGGGAG
FT                   TMGLSARYGPQFTLQHVPDYRQNVYIPGSNATLTNAAGKRDGKAPAGGNGNKKKSGKKE
FT                   KK"
FT   mRNA            join(<407171..409594,535369..535427,543604..543692,
FT                   550253..552222)
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, transcript variant mCT174351"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174351.0
FT                   created on 14-OCT-2002"
FT   CDS             join(407171..409594,535369..535427,543604..543692,
FT                   550253..550479)
FT                   /codon_start=1
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, isoform CRA_z"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174351.0
FT                   protein_id=mCP97260.0 isoform=CRA_z"
FT                   /protein_id="EDL10143.1"
FT                   /translation="MAALQRRPPCCELLLLLNLLWWLWGSEAGQLRYSIPEEVEKGSFV
FT                   GSIAKDLGLQPRELAERGIRIISRGRSQLFSLNQRSGSLVTAGRIDREELCAQSAPCLV
FT                   SFNILIEDKLNLYPVEVEIVDINDNAPRFLKEEMELKILENAALSSHFLLMDVYDPDVG
FT                   VNSIQGFKLSGSSHFSVHVQSQDHGPKYPELVLEHSLDREEEAVHHLVLVAMDGGDPVR
FT                   TGMARILVTVVDVNDNAPVFTQPIYRVSVPENLPVGTRVLTVNATDQDEGVHAEIRYSF
FT                   VRITEEISRIFCLDPFTGEISTSGTLDYENSRFYELDVEARDQPGLQDRAKVLITILDM
FT                   NDNAPEVVVTSGSRAIAENAPPGTIIALFQVYDKDSERNGLVICSISESLPFKLEESLD
FT                   NYFRLMTNTELDREQVSSYNITVTATDRGTPPLSTKIFISLDVADINDNPPVFSRSSYS
FT                   VYVSENNPKGVSIFSLNAVDPDSEENAEIIYSLAKETLQGTPLSSFLSINSITGVLYAL
FT                   CSFDYEQFRELNLLVTASDRGKPPLSSNVSLNLFVLDQNDNVPEILYPVLPTDGSTGVE
FT                   LAPRSAEPGYLVTKVVAVDKDSGQNAWLSYRLIKASEPGLFSVGLHTGEVRTARVLLDR
FT                   DALKQSLVVAVQDHGQPPLSATVTLTVAVASSIPDILADLGSLDLPHKSEDSSLTIYLV
FT                   VAVATVSCIFFAFVMGLLVLRLWHWHKSRLLKATRKGVSNMSTSHFVGIDGVQAFLQTY
FT                   SHEVSLTADSRKSHLIFPQPNYAHTLISQEGCEKNEPLLIQEDSAFCKEEDSLDQQAPP
FT                   NTDWRFSQAQRPGTSGSQNGDETGTWPNNQFDTEMLQAMILASASEAADGSSTLGGGAG
FT                   TMGLSARYGPQFTLQHVPDYRQNVYIPGSNATLTNAAGKRDGKAPAGGNGNKKKSGKKE
FT                   KK"
FT   mRNA            join(<414879..417311,535369..535427,543604..543692,
FT                   550253..552222)
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, transcript variant mCT174352"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174352.0
FT                   created on 14-OCT-2002"
FT   CDS             join(414879..417311,535369..535427,543604..543692,
FT                   550253..550479)
FT                   /codon_start=1
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, isoform CRA_l"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174352.0
FT                   protein_id=mCP97258.0 isoform=CRA_l"
FT                   /protein_id="EDL10129.1"
FT                   /translation="MAPEQRGWGSHYRGFVLLSILLGMRWEAWAGQILYSVSEETDKGS
FT                   FVGNITKDLGLQPRELAERGVRIITKGKTQLFSLNPRSGSLVTAGRIDREELCAQSPRC
FT                   LVSFNILIEDKMNLYPIEVEIMDVNDNAPRFLTEEINIKIMENAAPGVRFPLKEATDSD
FT                   VGKNSLQRYQLSPNHHFSLVVQSGDDGTKYPELVLEKALDREEEGLHHLVLTAYDGGDP
FT                   LRSGTASIRVTVVDVNDHMPVFSLPRYQATVPENVPVGTRLLTINAIDLDEGVNGEVTY
FT                   SFWKITPELLQIFHLSSLTGELSTLKGLDYEQSSYYELEVQAQDGAGSLTKAKVLITVL
FT                   DVNDNAPEVTVTSVSSPVPEDTPPGTVIALFYLQDKDSGKNGEVTCSLPENLPFKLEQS
FT                   IDNYYRLVTARNLDREKMSVYNITLKATDGGIPPLSTETRMSIHVSDTNDNPPTFSDSS
FT                   YSIYVPENNPRGASIFSVTAQDPDSDKNAQVTYALAEDTIQGVPVSSYVSINSDTGILY
FT                   ALGSFDYEQFRDLQLRVTARDSGDPPLSSNVSLKLFVLDKNDNAPEILYPALPTDGSTG
FT                   VELAPRSAEPGYLVTKVVAVDKDSGPNAWLSYRLLKASEPGLFSVGLHTGEVRTARALL
FT                   DRDALKQNLVVVVQDHGQPPLSATVTLTVAVANSIPDVLADLGSIRTPSEPDDSDITLY
FT                   LVVAVATVSCVFLVFVTVLLALRLWRWHKSHMLQASSGGGLEDVPASHFVGLDGVQAFL
FT                   QTYSHEVSLTADSRKSHIIFPQPNYVDTLISQDSCEKSDSLLTSIDFQECKGEAPSSQQ
FT                   APPNTDWRFSQAQRPGTSGSQNGDETGTWPNNQFDTEMLQAMILASASEAADGSSTLGG
FT                   GAGTMGLSARYGPQFTLQHVPDYRQNVYIPGSNATLTNAAGKRDGKAPAGGNGNKKKSG
FT                   KKEKK"
FT   mRNA            join(<420493..422856,535369..535427,543604..543692,
FT                   550253..552222)
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, transcript variant mCT174344"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174344.0
FT                   created on 14-OCT-2002"
FT   CDS             join(420493..422856,535369..535427,543604..543692,
FT                   550253..550479)
FT                   /codon_start=1
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, isoform CRA_u"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174344.0
FT                   protein_id=mCP97271.0 isoform=CRA_u"
FT                   /protein_id="EDL10138.1"
FT                   /translation="MREGTAERGRGQRRPMLLPFLLPLFCPTLSEQIRYKIPEEMPTGS
FT                   VVGNLAKDLGFSVQELPTRKLRISSEKPYFSVSSESGELLVSSRLDREQICGKKLVCAL
FT                   EFEAVAENPLNFYHLSVELEDINDHTPKFAHTSFELQISESSKPGTRFILGSAHDADIG
FT                   TNSLQNYQLSPNDHFSLVNKEKSDGSKYPEMILKTALDREKQKLYHLTLTALDFGHPPL
FT                   NSTAQIQVLVTDANDNPPVFSQDIYRVSLPENVYPGTTVLRVVATDQDEGVNSEITFSF
FT                   SEAGQVTQFNLDSNTGEITTLHTLDFEEVKEYSLVLEAKDGGGMIAQCTVEIEVLDEND
FT                   NVPEVLFQSLPDLIMEDAEPGTYIALLKTRDKDSGRNGEVICKLEGGAPFKILTSSGNT
FT                   YKLVTDGVLDREQNPEYNITIRATDKGDPPLSSSSSVTLHIGDVNDNAPVFTKVSYLVH
FT                   VAENNPPGASIAQVSASDPDLGANGQVTYYIIASDLEPESLWSYVTINAQSGVLFAQRA
FT                   FDHEQLRSFQLTLQARDHGSPTLSANVSMRLLVGDRNDNAPRVLYPTLEPDGSALFDMV
FT                   PRSAEPGYLVTKVVAVDADSGHNAWLSYHVLQASDPGLFSLGLRTGEVRTARALGDRDS
FT                   ARQRLLVAVRDGGQPPLSATATLHLIFADSLQEVLPDLSDDPLPPDPQSELQFYLVVAL
FT                   ALISVLFLLAVILAIALRLRHSSSRKAWGCFQSEVVVPPNYSEGTLPYSYNLCAAEFNS
FT                   LTCNDQLKSGQDLQFADSAGALFPLCNSNESTSHQQAPPNTDWRFSQAQRPGTSGSQNG
FT                   DETGTWPNNQFDTEMLQAMILASASEAADGSSTLGGGAGTMGLSARYGPQFTLQHVPDY
FT                   RQNVYIPGSNATLTNAAGKRDGKAPAGGNGNKKKSGKKEKK"
FT   mRNA            join(<425836..428259,535369..535427,543604..543692,
FT                   550253..552222)
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, transcript variant mCT174353"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174353.0
FT                   created on 14-OCT-2002"
FT   CDS             join(425836..428259,535369..535427,543604..543692,
FT                   550253..550479)
FT                   /codon_start=1
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, isoform CRA_m"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174353.0
FT                   protein_id=mCP97255.0 isoform=CRA_m"
FT                   /db_xref="GOA:Q91XY0"
FT                   /db_xref="InterPro:IPR002126"
FT                   /db_xref="InterPro:IPR013164"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR020894"
FT                   /db_xref="MGI:MGI:1935197"
FT                   /db_xref="UniProtKB/TrEMBL:Q91XY0"
FT                   /protein_id="EDL10130.1"
FT                   /translation="MAASKNQHRHGRLVLLCTLMGTLCKISVGQIRYSVPEETDKGTVV
FT                   GNISKDLGLEPRELAERGVRIVSRGRSQLFSLNPRGGSLVTAGRIDREELCAQSTPCLV
FT                   NINILVEEKGKLFGVEIEITDINDNNPKFHVGDLEVKINEIAAPGARYPLPEAVDPDVG
FT                   INSLQSYQLSPNRHFSLHLQTGDDGTINPELVLERTLDREEEPTHHLVLTASDGGEPRR
FT                   SSTALIQITVLDTNDNAPVFDQPVYRVKVLENVAPGTLLLTVRASDPDEGVNGKVTYKF
FT                   RKINEKQSLLFHLHENTGEMTVAKNLDYEECSLYEMEIQAEDVGALLGRSKVIIMVEDV
FT                   NDNRPEVTITSLFNPVLENSLPGTVIAFLNVHDQDSGKNGQVVCYTHDNLPFKLEKSID
FT                   NYYRLVTWKYLDREKVSTYNITVIASDLGAPPLSTETYIALTVADTNDNPPRFSHTSYT
FT                   AYLPENNLRGASIFSLTAHDPDSQENAQVTYSVSEDTIQGVPLSSYISINSDTGILYAL
FT                   QSFDFEKIQDLQLLVIATDSGSPPLSSNVSLSLFVLDQNDNAPEILYPSFPTDGSTGVE
FT                   LAPRSAEPGYLVTKVVAVDKDSGQNAWLSYRLLKASEPGLFSVGLHTGEVRTARALLDR
FT                   DALKQNLVMAVQDHGQPPLSATVTLTVAVANSIPEVLADLSSIMTPEVPEDSDLTLHLV
FT                   VAVAVVSCVFLVFVIVLLALRLQRWQKSRQLQGSRSGLAPAPPSHFVGIDGVQAFLQTY
FT                   SHEVSLTSGSQTSHIIFPQPNYADMLINQESCEKNDSLLTSIDFHENKDEDACAPQAPP
FT                   NTDWRFSQAQRPGTSGSQNGDETGTWPNNQFDTEMLQAMILASASEAADGSSTLGGGAG
FT                   TMGLSARYGPQFTLQHVPDYRQNVYIPGSNATLTNAAGKRDGKAPAGGNGNKKKSGKKE
FT                   KK"
FT   mRNA            join(<431097..433502,535369..535427,543604..543692,
FT                   550253..552222)
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, transcript variant mCT174343"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174343.0
FT                   created on 14-OCT-2002"
FT   CDS             join(431097..433502,535369..535427,543604..543692,
FT                   550253..550479)
FT                   /codon_start=1
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, isoform CRA_g"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174343.0
FT                   protein_id=mCP97262.0 isoform=CRA_g"
FT                   /protein_id="EDL10124.1"
FT                   /translation="MWEGTAERGRGQRRPMLLPFLLPLFCPALSEQIRYKIPEEMPTGS
FT                   VVGNLAKDLGFSVQELPTRKLRISSKKPYFSVSSESGELLVSSRLDREQICGKKLMCAL
FT                   EFEAVAENPLNFYHLSVELEDINDHTPKFAHTSTELQISESAQPGTRFILEVAEDADVA
FT                   LNSLQNYKLSPSPVFSMVNKEKQDGRKYPELVLEKTLDREQQNYYRLVLTALDGGDPPL
FT                   SGTTELRIQVTDANDNPPVFNQEVYKVRLPENVPPGTTVLRVTATDKDEGVNSEISYSL
FT                   HRAGQVFGLNSKSGEITTQTTLDFEEIKEYSLVVEARDGGGLVAQCTVEINIQDENDNR
FT                   PEITVDSLLETILENAETGTLIALIKIHDGDSGENGEVNCRLDGEVPFKIISSSKNSYK
FT                   LVTDRALDRELTPEYNVTITATDRGKPPLSSSTKVTLHVGDVNDNAPLFHQASYLVYIA
FT                   ENNPPGASIAQVSASDLDLGSNGHVSYSIIASDLEPKSLWSYVTVNAQSGVVFAQRAFD
FT                   HEQLRSFQLTLQARDQGSPSLSANVSMRVLVGDRNDNAPRVLYPTLEPDGSALFDMVPR
FT                   AAEPGYLVTKVVAVDADSGHNAWLSYHVLQASDPGLFSLGLRTGEVRTARALGEKDAAR
FT                   QRLLVGVRDGGQPPLSATATLLLVFADSLQEALPDLSDRSLPPDPQAELQFYLVVALAL
FT                   VSVLFLLAVILAIALRLRHSSSPSVWNCFQPGFCSESKPVVFPNYSEGTLPYSYNLYGA
FT                   HAGKTECNFLKCSEPLSSGQGLLCPESSGALFPLCDSSEPTSHPEPLTPQAPPNTDWRF
FT                   SQAQRPGTSGSQNGDETGTWPNNQFDTEMLQAMILASASEAADGSSTLGGGAGTMGLSA
FT                   RYGPQFTLQHVPDYRQNVYIPGSNATLTNAAGKRDGKAPAGGNGNKKKSGKKEKK"
FT   mRNA            join(<437062..439485,535369..535427,543604..543692,
FT                   550253..552222)
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, transcript variant mCT174354"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174354.0
FT                   created on 14-OCT-2002"
FT   CDS             join(437062..439485,535369..535427,543604..543692,
FT                   550253..550479)
FT                   /codon_start=1
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, isoform CRA_x"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174354.0
FT                   protein_id=mCP97253.0 isoform=CRA_x"
FT                   /protein_id="EDL10141.1"
FT                   /translation="MAAAPARRPHCRELVVLCALLGMLWEARAGQIRYSVPEETEKGYI
FT                   VGNISKDLGLEPRELAERGVRIVSKGKTQLFSLSPRSGSLVTAGRIDREELCAQSAPCL
FT                   LSFKVLVEDRVKLYGVEVEVVDINDNAPKFEAKNLVVKISEIAAPGARYPLPEAVDPDV
FT                   GINSLQSYQLSPNHHFSLHLQTGDDGTINPELVLERTLDREEEPTHHLVLTAYDGGNPR
FT                   RSSTALIQVTVLDTNDNAPVFDQPVYRVKVLENVAPGTLLLTVRASDPDEGANGKVTYK
FT                   FRKINEKHSLLFHLHENTGEMTVAKNLDYEECSLYEMEIQAEDGGGLKGRTKVVVMVED
FT                   VNDNRPEVTITSLFSPVREDAPPGTVILLFNAHDQDSGKNGQVVCSIQENPSFKLENSV
FT                   DDYYRLLTAQILDREKASEYNITVTATDRGTPSMSTEVHITLYVADINDNPPAFSQTSY
FT                   SVYLPENNPRGTSIFSVSAHDPDDEENAKVTYSLVENTIQGAPLSSYVSINSDTGVLYA
FT                   LQSFDYEQFQNLQMQVKASDNGHPPLSSNVSLSVFLLDQNDNAPKILYPSLPTDGSTGV
FT                   ELAPRSAEAGYLVTKVVAVDKDSGQNAWLSYRLLKASEPGLFTVGLRSGEIRTARALLE
FT                   RDALKQSLVVAVQDHGQPPLSATITLTVAVADSIPDILADLGSINTPADPDSDITLYLV
FT                   VAVAVVSCIFLLFVLVLLALRLRRWHASHLLQDAMGGSTGVPTSHIVGVHGVQTFLQTY
FT                   SQEFSLTPDSGKSHLIFPQPNYADTLISQESCGKSEPLCSSVEPKFPIDDTPLVPQAPP
FT                   NTDWRFSQAQRPGTSGSQNGDETGTWPNNQFDTEMLQAMILASASEAADGSSTLGGGAG
FT                   TMGLSARYGPQFTLQHVPDYRQNVYIPGSNATLTNAAGKRDGKAPAGGNGNKKKSGKKE
FT                   KK"
FT   mRNA            join(<442183..444600,535369..535427,543604..543692,
FT                   550253..552222)
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, transcript variant mCT174355"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174355.0
FT                   created on 14-OCT-2002"
FT   CDS             join(442183..444600,535369..535427,543604..543692,
FT                   550253..550479)
FT                   /codon_start=1
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, isoform CRA_n"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174355.0
FT                   protein_id=mCP97274.0 isoform=CRA_n"
FT                   /db_xref="GOA:Q91XX4"
FT                   /db_xref="InterPro:IPR002126"
FT                   /db_xref="InterPro:IPR013164"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR020894"
FT                   /db_xref="MGI:MGI:1935197"
FT                   /db_xref="UniProtKB/TrEMBL:Q91XX4"
FT                   /protein_id="EDL10131.1"
FT                   /translation="MGGSSARRKRPDRPQVLFTLLLPLFCPALGQPVRYSIPEELDRGS
FT                   VVGKLAKDLGLSVLEVSSRKLRVSAEKLHFSVDSESGDLLVKDRIDREQICKGRRKCEL
FT                   QLEAVLENPLNIFHVVVGIEDVNDNAPQFEKKETRLEILETVAVGTRIPLEPATDPDIN
FT                   LNSVKDYQISSNPYFSLMVRVNPDGGKTPELSLEKLLDREEQRSHRLILTALDGGDPPR
FT                   SATTQIEISVKDNNDNPPVFSKEEYWVSVSENLSPGSSVLQVTATDEDEGVNAEILYYF
FT                   RSTAQSTRHVFSLDEKTGVIKNNQSLDFEDIERYTMEVEAKDGGGLSTRCKIIIEVLDE
FT                   NDNSPEITITSLSDHILENSPPGVVVVLFKTRDRDFGGNGEVTCDIGKDLPFKIQASSS
FT                   NYYKLVTDGALDREQNPQYNVTITATDKGKPALSSSTTIVLHITDINDNAPAFQKSSYI
FT                   VHVAENNPPGASIAQVSASDPDLGANGHVSYSIIASDLEPKSLWSYVTVNAQSGVVFAQ
FT                   RAFDHEQLRSFQLTLQARDQGKPSLSANVSMRVLVGDRNDNAPRVLYPALEPDGSALFD
FT                   MVPRAAEPGYLVTKVVAVDADSGHNAWLSYHVLQASDPGLFSLGLRTGEVRTARALGEK
FT                   DAARQRLLVGVRDGGQPPLSATATLLLVFADSLQEALPDLSDRSLPPDPQAELQFYLVV
FT                   ALALISVLFLLAVILAIALRLRHSSSPSVWGCFQSGLCSKARPGVSLNYSEGTLPYSYN
FT                   LCVGQTGKAELNFLKCSAPLPSSQEIVSGSSPGALIPLHLGDDLTTHPETLTPQAPPNT
FT                   DWRFSQAQRPGTSGSQNGDETGTWPNNQFDTEMLQAMILASASEAADGSSTLGGGAGTM
FT                   GLSARYGPQFTLQHVPDYRQNVYIPGSNATLTNAAGKRDGKAPAGGNGNKKKSGKKEKK
FT                   "
FT   mRNA            join(<447130..449547,535369..535427,543604..543692,
FT                   550253..552222)
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, transcript variant mCT174356"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174356.0
FT                   created on 14-OCT-2002"
FT   CDS             join(447130..449547,535369..535427,543604..543692,
FT                   550253..550479)
FT                   /codon_start=1
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, isoform CRA_o"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174356.0
FT                   protein_id=mCP97270.0 isoform=CRA_o"
FT                   /protein_id="EDL10132.1"
FT                   /translation="MAAQRNLSERTKLVLLFLWMPWESAARQIRYSVPEELEKGSFVGN
FT                   IAKDLGLEPRQLAERGVRIISRGRSQLFSLNPRGGSLVTAGRIDREELCAQSAPCLVSF
FT                   NILVEDRVKLFGIEIEVTDVNDNAPKFQAETLDVKINENVAPGMRFPLPEATDPDVGVN
FT                   SLQSYQLSSNKHFSLVVQSGAKGVKYPELVLEQALDREEEAIHHLVLVASDGGNPPRSG
FT                   TVLITVTVFDANDNAPVFTSTEYRVNIPENLPVGTQLLKVTATDKDEGANGEVTYAFRK
FT                   SLDTQLSKFQLDKHTGEIKISENLDYEEMSFYEIEIQAEDGGAYLATAKVLITVEDVND
FT                   NSPEVTITSLFSPVTEDSPVGTVIALLNVHDLDSGQNGEVACSISGNLPFKLEKSIDNY
FT                   YRLVTQRALDREQVPAYNITVTATDGGNPPLSTKADFTLQVADINDNPPTFSHPSYFTY
FT                   IPENNPRGASIFSVTALDPDSKENAQIVYSLAEDTIEGAPLSSYISINSDTGILYALWS
FT                   FDYEQFRELQVQVTASDSGKPPLHSNVSLTLFVLDQNDNSPEILYPTMPTDGSTGVELA
FT                   PRSAELGYLVTKVVAVDRDSGQNAWLSYRLLKASEPGLFTVGLHTGEVRTARALMERDA
FT                   LKQSLVVAVQDHGQPPLSATVTLTVAVADSIPDVLADLGNLEPPQDSEASNLTLYLVVA
FT                   VAAVSCVFLAFVIVLLALKLRRWHKSHVLQSSRDGLAGMPASHYVGVDGVRAFLQTYSH
FT                   EVSLTADSRKSHLIFPQPNYADTLISQESCEKKDPLSLLDDSKCPVEDAPLVPQAPPNT
FT                   DWRFSQAQRPGTSGSQNGDETGTWPNNQFDTEMLQAMILASASEAADGSSTLGGGAGTM
FT                   GLSARYGPQFTLQHVPDYRQNVYIPGSNATLTNAAGKRDGKAPAGGNGNKKKSGKKEKK
FT                   "
FT   mRNA            join(<452580..454994,535369..535427,543604..543692,
FT                   550253..552222)
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, transcript variant mCT174357"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174357.0
FT                   created on 14-OCT-2002"
FT   CDS             join(452580..454994,535369..535427,543604..543692,
FT                   550253..550479)
FT                   /codon_start=1
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, isoform CRA_y"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174357.0
FT                   protein_id=mCP97264.0 isoform=CRA_y"
FT                   /db_xref="GOA:Q91XX3"
FT                   /db_xref="InterPro:IPR002126"
FT                   /db_xref="InterPro:IPR013164"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR020894"
FT                   /db_xref="MGI:MGI:1935199"
FT                   /db_xref="UniProtKB/TrEMBL:Q91XX3"
FT                   /protein_id="EDL10142.1"
FT                   /translation="MGGSSARRKRPGRPQVLFILLLPLFCPALGQPVRYSIPEELDRGS
FT                   VVGKLAKDLGLSVLEVSARKLRVSAEKLHFSVDSESGDLLVKDRIDREQICKGRRKCEL
FT                   QLEAVLENPLNIFHVVVEIEDVNDHAPQFPKDEINLEISESDSPGARTILESAKDLDIG
FT                   MNSLSKYQLSPNDYFLLLVKDNPDGSKYPELELQKMLDREAESTHHLMLTAVDGGDPPR
FT                   TGTTQLRIRVVDANDNRPVFSQDVYRVRLPEDLPPGTTVLRLKAMDQDEGINAEFTYSF
FT                   LGVANKAQFSLDPITGDIVTRQSLDFEEVEQYTIDVEAKDRGSLSSQCKVIIEVLDEND
FT                   NRPEIIITSLSDQISEDSPSGTVVALFKVRDRDSGENAEVMCSLSGNNPFKIHSSSNNY
FT                   YKLVTDSILDREQTPGYNVTITATDRGKPPLSSSTTITLNVADVNDNAPVFQQQAYLIN
FT                   VAENNQPGTSITQVKAWDPDVGSNGLVSYSIIASDLEPKALSSFVSVNQDSGVVYAQRA
FT                   FDHEQIRSFQLTLQARDQGSPALSANVSMRVLVDDRNDNAPRVLYPTLEPDGSALFDMV
FT                   PRAAEPGYLVTKVVAVDADSGHNAWLSYHVLQASDPGLFSLGLRTGEVRTARALSDKDA
FT                   ARQRLLVAVRDGGQPPLSATATLLLVFADSLQEALPDLVDHPIPSDPQSELQFYLVVAL
FT                   ALISVLFLLAVIFAIALRLRQSSSPSSTGCFGSVLGSKSRPVLPPNYSEGTLPYAYNLC
FT                   VPGDQLKPEFNYFSSVGDCPAAQDILNKDSSSALLASILTPGVEADEKTFNQQAPPNTD
FT                   WRFSQAQRPGTSGSQNGDETGTWPNNQFDTEMLQAMILASASEAADGSSTLGGGAGTMG
FT                   LSARYGPQFTLQHVPDYRQNVYIPGSNATLTNAAGKRDGKAPAGGNGNKKKSGKKEKK"
FT   gene            complement(453071..>478777)
FT                   /locus_tag="mCG_145923"
FT                   /note="gene_id=mCG145923.0"
FT   mRNA            complement(join(453071..453699,456170..457917,
FT                   478469..>478777))
FT                   /locus_tag="mCG_145923"
FT                   /product="mCG145923"
FT                   /note="gene_id=mCG145923.0 transcript_id=mCT186031.0
FT                   created on 04-JUL-2003"
FT   CDS             complement(456359..>456754)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145923"
FT                   /product="mCG145923"
FT                   /note="gene_id=mCG145923.0 transcript_id=mCT186031.0
FT                   protein_id=mCP107756.0"
FT                   /protein_id="EDL10144.1"
FT                   /translation="FAMAGCERYSVRVLRRFNFYLFFRVSFCVYEVPGIPHPKHIPKRT
FT                   EVFLLPELRCVSIHPFRLCVLEIPEKYSIALSSRSPIGQQRRLEPNLIIATLIKTRCLL
FT                   RRKLSHSPFPWILTFVKPTTANNSYVM"
FT   mRNA            join(<456747..459173,535369..535427,543604..543692,
FT                   550253..552222)
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, transcript variant mCT174333"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174333.0
FT                   created on 14-OCT-2002"
FT   CDS             join(456747..459173,535369..535427,543604..543692,
FT                   550253..550479)
FT                   /codon_start=1
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, isoform CRA_b"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174333.0
FT                   protein_id=mCP97275.0 isoform=CRA_b"
FT                   /protein_id="EDL10119.1"
FT                   /translation="MANQSQRLDRRALIPLCIFLGTLLTFGTGQIRYSVPEETDKGFFV
FT                   GNISKDLGLEPWEVAERGVRIISRGQSQLFSLNPRGGSLVTAGRIDREELCDTMPSCML
FT                   NLEILVEETLKIYGVEVEVLDINDNAPSFREEEVEIKVSEHTSPGSRFPLPSARDPDAG
FT                   MNSLQSYQLSPSSYFSLQVRGGTDGDKNPELVLEEGLDREKEASHHLLLTALDGGDPVR
FT                   KGTVPIRVVVLDVNDHIPKFTQPVYRVSIPENLSSGTRVLVVNASDPDEGINGEVIYSF
FT                   RKMKSKASEIFQLNSQTGEVLVGKPLDFEKYRFYEMEIQGQDGGGLLSTTTLLITVEDV
FT                   NDNAPEITVTSASNSVSENSPSGTVIALLNVQDQDSGENGQVSCFIPSGLPFKLEKTYG
FT                   NYYKLITNSELDREQVESYNITLIAKDQGSPPLSTETHLLLKVADANDNPPVFSSSSYS
FT                   AYIPENNPRGSSIFSVTAIDRDSRENAQVTYSLAEYTIQGTPLSSYVSINSDTGVLYAL
FT                   QSFDYEQFQTLQLGVTASDNGDPPLSSNISLTLFVLDQNDNTPEILYPSLPTDGSTGVE
FT                   LAPRSAEPGYLVTKVVAVDRDSGQNAWLSYRLLKASEPGLFSVGLHTGEVRTARAMMDK
FT                   DALKQSLVVTVQDHGQPPLSATVKLTVAVADSIPEVLEDLVSLESPANPDESGLTLYLV
FT                   VAITAVSCIFLIFVMVLLALKLRRWHSLRLLQAASGLAGVPPSHFVGVDGMRAFLQTYS
FT                   HEVSLTADSRKSHLIFPQPNYADTLISQESCGKSEPLLITEDSTTVLGKCEPTDIQQAP
FT                   PNTDWRFSQAQRPGTSGSQNGDETGTWPNNQFDTEMLQAMILASASEAADGSSTLGGGA
FT                   GTMGLSARYGPQFTLQHVPDYRQNVYIPGSNATLTNAAGKRDGKAPAGGNGNKKKSGKK
FT                   EKK"
FT   mRNA            join(459099..459116,535369..535427,543604..543692,
FT                   550253..550790)
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, transcript variant mCT174349"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174349.0
FT                   created on 14-OCT-2002"
FT   mRNA            join(<465793..468212,535369..535427,543604..543692,
FT                   550253..552222)
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, transcript variant mCT174334"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174334.0
FT                   created on 14-OCT-2002"
FT   CDS             465793..467271
FT                   /codon_start=1
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, isoform CRA_p"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174334.0
FT                   protein_id=mCP97269.0 isoform=CRA_p"
FT                   /protein_id="EDL10133.1"
FT                   /translation="MERSSVKLGSRTPWRQVLFPFLLPLFCTGLSEQVRYSIPEEMAMG
FT                   SVVGNLAEDLGLPVQDLLTRNLRVIAEKPYLSVNPENGNIVVSDRIDREFLCFQSPLCV
FT                   LPLEIVAENPLNVFHVSVVIEDINDNPPRFLQNSIVLQINELAIPGTRFGLESAIDADV
FT                   GLNSLQSYQLSLNEHFSLVVKDNTEGKDAPELVLEKPLDREKQSSQLLVLTAVDGGEPV
FT                   LTGTAQIQIEVTDANDNPPVFSQSTYKVSLREDMAAGTSVLTVIATDQDEGVNAEVTYS
FT                   FKSLGEDIRDKFILDHQSGEIKSKGPIDFETKRTYTMNIEAKDGGGMASECKVVVEILD
FT                   ENDNAPEVVFTSVSNSITEDAEPGTVVALFKTYDKDSEENGRVSCFVKETVPFRIESSA
FT                   SNYYKLVTDGILDREQTPEYNVTIIATDKGKPPLSSSTSVTLHVGDINDNAPVFHQTSY
FT                   LIQVAENNPPGASIAQVSAFDPDLGSMVSSPTPS"
FT   mRNA            join(476555..479074,535369..535427,543604..543692,
FT                   550253..552225)
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, transcript variant mCT134754"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT134754.0
FT                   created on 14-OCT-2002"
FT   CDS             join(476660..479074,535369..535427,543604..543692,
FT                   550253..550479)
FT                   /codon_start=1
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, isoform CRA_a"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT134754.0
FT                   protein_id=mCP77563.1 isoform=CRA_a"
FT                   /protein_id="EDL10118.1"
FT                   /translation="MQRREDCKGLVFLGVLLGMLWKAGSTQIRYSVPEELEKGSRVGNI
FT                   SKDLGLKPRELAERGVRIVSRGRAQLFALNPRSGSLVTAGRIDREELCMGSIKCQLNLE
FT                   ILMEDIGKIYGVEIEVRDINDNAPYFRESELEIKMSENAAAGMRFPLPHAWDPDIGKNS
FT                   LQSYQLSPNAHFSLEVQNGADGNKYPELVLESSLDREEKAAHLLVLTASDAGDPVRTGT
FT                   ARIRVTVVDANDNAPAFARSEYRVSVRENVAVGTQLLLVNATDRDEGANAEVIYSFRYV
FT                   DDKAAKVFKLDSNLGTISTIGELNHEESGFYEMEVQATDNAGYSARAKVLVTVLDVNDN
FT                   APEVAITSLTNSVPENSPQGTLIALLNVNDQDSGENGQVICSIQENLPFKLEKSYGNYY
FT                   RLVTDAVLDREEVPSYNITVTATDRGSPPLTTETHLALDIADTNDNSPVFLQASYWAYI
FT                   PENNPRGASIASVTAHDPDSDKNAQVTYSLAEDTHQGVPLSSYVSINSDTGVLYALHSF
FT                   DYEQFPDLQLQVMARDSGDPPLSSNVSLSLFVLDQNDNVPEILYPTLPTDGSTGVELAP
FT                   RSAEPGYLVTKVVAVDRDSGQNAWLSYRLLKASEPGLFSVGLHTGEISTARALMDRDAL
FT                   KQNLVVSVQDHGQPPLSATVTLTVAIADSIPDVLADLDNLESPSTSETSGLTLYLVVAV
FT                   AAVSTVFLVFVLVLLALRLRRWHSLRLLRAGGPGLADVAASHFVGVDGVQAFLQTYSHE
FT                   VSLTAGSRKSHLIFPQPNYADTLISQESCEKTEPLLPSGDSVFSKDNHALNQQAPPNTD
FT                   WRFSQAQRPGTSGSQNGDETGTWPNNQFDTEMLQAMILASASEAADGSSTLGGGAGTMG
FT                   LSARYGPQFTLQHVPDYRQNVYIPGSNATLTNAAGKRDGKAPAGGNGNKKKSGKKEKK"
FT   mRNA            join(<516886..519315,535369..535427,543604..543692,
FT                   550253..552222)
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, transcript variant mCT174336"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174336.0
FT                   created on 14-OCT-2002"
FT   CDS             join(516886..519315,535369..535427,543604..543692,
FT                   550253..550479)
FT                   /codon_start=1
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, isoform CRA_q"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174336.0
FT                   protein_id=mCP97261.0 isoform=CRA_q"
FT                   /protein_id="EDL10134.1"
FT                   /translation="MVAEARSSGLASPWRTVGVLLLLAALTEASTIIHYEILEERERGF
FT                   PVGNVVTDLGLDLGSLSARRLRVVSGASRRFFEVNWETGEMFVNDRLDREELCGTLPSC
FT                   TVTLELVVENPLELFSAEVVVQDINDNNPSFPTGEMKLEISEALAPGTRFPLESAHDPD
FT                   VGSNSLQTYELSHNEYFALRVQTREDGTKYAELVLERALDWEREPSVQLVLTALDGGTP
FT                   ARSATLPIRITVLDANDNAPAFNQSLYRARVREDAPPGTRVAQVLATDLDEGLNGEIVY
FT                   SFGSHNRAGVRELFALDLVTGVLTIKGRLDFEDTKLHEIYIQAKDKGANPEGAHCKVLV
FT                   EVVDVNDNAPEITVTSVYSPVPEDAPLGTVIALLSVTDLDAGENGLVTCEVPPGLPFSL
FT                   TSSLKNYFTLKTSAALDRETMPEYNLSITARDSGIPSLSALTTVKVQVSDINDNPPQSS
FT                   QSSYDVYVEENNLPGVPILNLSVWDPDAPPNARLSFFLLEPGAETGLVSRYFTINRDNG
FT                   VLTTLVPLDYEDQREFQLTAHINDGGTPVLATNISVNVFVTDRNDNAPQVLYPRPGQSS
FT                   VEMLPRGTAAGHVVSRVVGWDADAGHNAWLSYSLLGAPNQSLFAVGLHTGQISTARPIQ
FT                   DTDSPRQILTVLISDSGEPLLSTTATLTVSVTEESPEARAEFPSGSAPREQNKNLTFYL
FT                   LLSLILVSVGFAVTVLGVIIFKVYKWKRSRDLYRAPVSSLYRTPGPSLHADAVRGGLMP
FT                   PHLYHQVYLTTDSRRSDPLLKKPGAASPLASRQNTLRSCDPVFYRQVLGAESAPPGQQA
FT                   PPNTDWRFSQAQRPGTSGSQNGDETGTWPNNQFDTEMLQAMILASASEAADGSSTLGGG
FT                   AGTMGLSARYGPQFTLQHVPDYRQNVYIPGSNATLTNAAGKRDGKAPAGGNGNKKKSGK
FT                   KEKK"
FT   mRNA            join(<525881..528331,535369..535427,543604..543692,
FT                   550253..552222)
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, transcript variant mCT174338"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174338.0
FT                   created on 14-OCT-2002"
FT   CDS             join(525881..528331,535369..535427,543604..543692,
FT                   550253..550479)
FT                   /codon_start=1
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, isoform CRA_r"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174338.0
FT                   protein_id=mCP97259.0 isoform=CRA_r"
FT                   /db_xref="GOA:Q91XX0"
FT                   /db_xref="InterPro:IPR002126"
FT                   /db_xref="InterPro:IPR013164"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR020894"
FT                   /db_xref="MGI:MGI:1935197"
FT                   /db_xref="UniProtKB/TrEMBL:Q91XX0"
FT                   /protein_id="EDL10135.1"
FT                   /translation="MAAMPSTVRSWVEIWWGATLLFLFCHLGYVYGQIRYPVPEESQEG
FT                   TFVGNVAQDFLLDTESLSARRLQVAGEVNQRHFRVDLDSGALLIKNPIDREALCGLSAS
FT                   CIVPLEFVTEGPLEMYRAEVEIVDVNDHAPRFPRQQLDLEIGEAAPPGQRFPLEKAQDA
FT                   DVGSNSISSYRLSSNEHFALDVKKRSDGSLVPELLLEKPLDREKQSDYRLVLTAVDGGN
FT                   PPRSGTAELRVSVLDVNDNAPAFQQSSYRISVLESAPAGMVLIQLNASDPDLGPSGNVT
FT                   FSFSGHTPDRVRNLFSLHPTTGKLTLQGPLDFESENYYEFDVRARDGGSPAMEQHCSLR
FT                   VDLLDVNDNAPHITVTSELGTLPESAEPGTVVALISVQDPDSGSNGDVSLRIPDHLPFA
FT                   LKSAFRNQFSLVTAGPLDREARSSYDIMVTASDAGNPPLSTHRTIFLNISDVNDNPPSF
FT                   FQRSHEVFVPENNRPGDLLCSLAASDPDSGLNALISYSLLEPRNRDVSASSFISLNPQT
FT                   GAVHATRSFDYEQTQTLQFEVQARDRGSPPLSSTVTVRLFVLDLNDNAPAVLRPRARPG
FT                   SLCPQALPPSVGAGHLVTKVTAVDLDSGYNAWVSYQLLEAPDPSLFAVSRYAGEVRTAV
FT                   PIPADLPPQKLVIVVKDSGSPPLSTSVTLLVSLEEDTHPVVPDLRESSAPREGESRLTL
FT                   YLAVSLVAICFVSFGSFVALLSKCLRGAACGVTCFPAGTCACLTRSRRREGLPPSNGIL
FT                   RIQLGSEDPIKFVDVGGHSHGCTPLASAPTRSDSFMMVKSPSAPMAGEPVRPSCPPSDL
FT                   LYGLEQAPPNTDWRFSQAQRPGTSGSQNGDETGTWPNNQFDTEMLQAMILASASEAADG
FT                   SSTLGGGAGTMGLSARYGPQFTLQHVPDYRQNVYIPGSNATLTNAAGKRDGKAPAGGNG
FT                   NKKKSGKKEKK"
FT   mRNA            join(529914..530064,535373..535427,543604..543692,
FT                   550253..552225)
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, transcript variant mCT174348"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174348.0
FT                   created on 14-OCT-2002"
FT   mRNA            join(529999..535427,543604..543692,550253..552225)
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, transcript variant mCT174347"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174347.0
FT                   created on 14-OCT-2002"
FT   mRNA            join(<530023..532482,535369..535427,543604..543692,
FT                   550253..552222)
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, transcript variant mCT174341"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174341.0
FT                   created on 14-OCT-2002"
FT   CDS             join(530023..532482,535369..535427,543604..543692,
FT                   550253..550479)
FT                   /codon_start=1
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, isoform CRA_f"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174341.0
FT                   protein_id=mCP97266.0 isoform=CRA_f"
FT                   /db_xref="GOA:Q91XW9"
FT                   /db_xref="InterPro:IPR002126"
FT                   /db_xref="InterPro:IPR013164"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR020894"
FT                   /db_xref="MGI:MGI:1935197"
FT                   /db_xref="UniProtKB/TrEMBL:Q91XW9"
FT                   /protein_id="EDL10123.1"
FT                   /translation="MRPMASPQVAGKWQVLCMLSLCCCGWVSGQLRYSVVEESEPGTLV
FT                   GNVAQDLGLKGTDLLSRRLRLGSEENGRYFSLSLVSGALAVSQKIDRESLCGASTSCLL
FT                   PVQVVTEHPLELTRVEVEILDLNDNSPSFATPDREMRISESAAPGARFPLDSAQDPDVG
FT                   TNTVSFYTLSPNSHFSLHVKTLKDGKLFPELVLEQQLDRETQARHQLVLTAVDGGTPAR
FT                   SGTSLISVIVLDVNDNAPTFQSSVLRVGLPENTPPGTLLLRLNATDPDEGTNGQLDYSF
FT                   GDHTSETVKNLFGLDPSSGAIHVLGPVDFEESNFYEIHARARDQGQPAMEGHCVIQVDV
FT                   GDANDNPPEVLLASLVNPVLESTPVGTVVGLFNVRDRDSGRNGEVSLKTSPNLPFQIKP
FT                   SENHYSLLTSQPLDREATSHYTIELLASDAGSPPLHTHLTLRLNISDVNDNAPHFTQQL
FT                   YTAYIPENRPPGSLLCTVAASDPDEGDNARLTYSIVGSQIQGAPASSFVYVNPEDGRIF
FT                   AQRTFDYELLQMLQIVVGVRDSGSPRLHANTSLHVFVLDQNDNAPAVLHPRPGREFSAP
FT                   QRLPRSAPPGSLVTKVTAVDADAGHNAWLSYSLLPQSTAPGLFLVSAHTGEVRTARALL
FT                   EDDSDTQQVVVLVRDNGDPSLSSTATVLLVLEDEDAEEMPKSSDFLTHPPERSDLTLYL
FT                   IVALAAVSLLSLVTFTFMSAKCLRRHEDGDRGGGHCCRGQDSPSREFYKQSSPNLQVSS
FT                   DGTLKYMEVTLRPTDSQSHCYRTCFSPASDGSDFTFLRPLSVQQPSALALEPEALRSRS
FT                   STLRERSQQAPPNTDWRFSQAQRPGTSGSQNGDETGTWPNNQFDTEMLQAMILASASEA
FT                   ADGSSTLGGGAGTMGLSARYGPQFTLQHVPDYRQNVYIPGSNATLTNAAGKRDGKAPAG
FT                   GNGNKKKSGKKEKK"
FT   CDS             530023..532638
FT                   /codon_start=1
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, isoform CRA_i"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174347.0
FT                   protein_id=mCP97265.0 isoform=CRA_i"
FT                   /db_xref="GOA:Q8K4A2"
FT                   /db_xref="InterPro:IPR002126"
FT                   /db_xref="InterPro:IPR013164"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR020894"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K4A2"
FT                   /protein_id="EDL10126.1"
FT                   /translation="MRPMASPQVAGKWQVLCMLSLCCCGWVSGQLRYSVVEESEPGTLV
FT                   GNVAQDLGLKGTDLLSRRLRLGSEENGRYFSLSLVSGALAVSQKIDRESLCGASTSCLL
FT                   PVQVVTEHPLELTRVEVEILDLNDNSPSFATPDREMRISESAAPGARFPLDSAQDPDVG
FT                   TNTVSFYTLSPNSHFSLHVKTLKDGKLFPELVLEQQLDRETQARHQLVLTAVDGGTPAR
FT                   SGTSLISVIVLDVNDNAPTFQSSVLRVGLPENTPPGTLLLRLNATDPDEGTNGQLDYSF
FT                   GDHTSETVKNLFGLDPSSGAIHVLGPVDFEESNFYEIHARARDQGQPAMEGHCVIQVDV
FT                   GDANDNPPEVLLASLVNPVLESTPVGTVVGLFNVRDRDSGRNGEVSLKTSPNLPFQIKP
FT                   SENHYSLLTSQPLDREATSHYTIELLASDAGSPPLHTHLTLRLNISDVNDNAPHFTQQL
FT                   YTAYIPENRPPGSLLCTVAASDPDEGDNARLTYSIVGSQIQGAPASSFVYVNPEDGRIF
FT                   AQRTFDYELLQMLQIVVGVRDSGSPRLHANTSLHVFVLDQNDNAPAVLHPRPGREFSAP
FT                   QRLPRSAPPGSLVTKVTAVDADAGHNAWLSYSLLPQSTAPGLFLVSAHTGEVRTARALL
FT                   EDDSDTQQVVVLVRDNGDPSLSSTATVLLVLEDEDAEEMPKSSDFLTHPPERSDLTLYL
FT                   IVALAAVSLLSLVTFTFMSAKCLRRHEDGDRGGGHCCRGQDSPSREFYKQSSPNLQVSS
FT                   DGTLKYMEVTLRPTDSQSHCYRTCFSPASDGSDFTFLRPLSVQQPSALALEPEALRSRS
FT                   STLRERSQVRAGSRHATPGRARWRSCPVHLRGVCSCTLFLFVPSWHTCWMRLKVDNQSG
FT                   "
FT   CDS             join(530058..530064,535373..535427,543604..543692,
FT                   550253..550479)
FT                   /codon_start=1
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, isoform CRA_j"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174348.0
FT                   protein_id=mCP97256.0 isoform=CRA_j"
FT                   /protein_id="EDL10127.1"
FT                   /translation="MATPPNTDWRFSQAQRPGTSGSQNGDETGTWPNNQFDTEMLQAMI
FT                   LASASEAADGSSTLGGGAGTMGLSARYGPQFTLQHVPDYRQNVYIPGSNATLTNAAGKR
FT                   DGKAPAGGNGNKKKSGKKEKK"
FT   CDS             join(543659..543692,550253..550479)
FT                   /codon_start=1
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, isoform CRA_k"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174349.0
FT                   protein_id=mCP97252.0 isoform=CRA_k"
FT                   /protein_id="EDL10128.1"
FT                   /translation="MLQAMILASASEAADGSSTLGGGAGTMGLSARYGPQFTLQHVPDY
FT                   RQNVYIPGSNATLTNAAGKRDGKAPAGGNGNKKKSGKKEKK"
FT   gene            complement(555176..645609)
FT                   /gene="Diap1"
FT                   /locus_tag="mCG_18335"
FT                   /note="gene_id=mCG18335.1"
FT   mRNA            complement(join(555176..555850,561886..561972,
FT                   563638..563773,563879..564041,564813..564939,
FT                   565809..565938,566048..566287,566509..566610,
FT                   566788..566882,570750..570848,600039..600153,
FT                   600818..601510,602134..602313,603690..603754,
FT                   604434..604549,605522..605638,606455..606573,
FT                   606721..606831,607854..607962,610839..610978,
FT                   612287..612350,613266..613352,613529..613659,
FT                   613958..614059,615206..615361,645400..645609))
FT                   /gene="Diap1"
FT                   /locus_tag="mCG_18335"
FT                   /product="diaphanous homolog 1 (Drosophila), transcript
FT                   variant mCT12972"
FT                   /note="gene_id=mCG18335.1 transcript_id=mCT12972.2 created
FT                   on 14-OCT-2002"
FT   mRNA            complement(join(555383..555850,561886..561972,
FT                   563638..563773,563879..564041,564813..564939,
FT                   565809..565938,566048..566482))
FT                   /gene="Diap1"
FT                   /locus_tag="mCG_18335"
FT                   /product="diaphanous homolog 1 (Drosophila), transcript
FT                   variant mCT174389"
FT                   /note="gene_id=mCG18335.1 transcript_id=mCT174389.0 created
FT                   on 14-OCT-2002"
FT   CDS             complement(join(555693..555850,561886..561972,
FT                   563638..563773,563879..564041,564813..564939,
FT                   565809..565938,566048..566287,566509..566610,
FT                   566788..566882,570750..570848,600039..600153,
FT                   600818..601510,602134..602313,603690..603754,
FT                   604434..604549,605522..605638,606455..606573,
FT                   606721..606831,607854..607962,610839..610978,
FT                   612287..612350,613266..613352,613529..613659,
FT                   613958..614059,615206..615361,645400..645516))
FT                   /codon_start=1
FT                   /gene="Diap1"
FT                   /locus_tag="mCG_18335"
FT                   /product="diaphanous homolog 1 (Drosophila), isoform CRA_a"
FT                   /note="gene_id=mCG18335.1 transcript_id=mCT12972.2
FT                   protein_id=mCP8309.2 isoform=CRA_a"
FT                   /protein_id="EDL10115.1"
FT                   /translation="MEPSGGGLGPGRGTRDKKKGRSPDELPATGGDGGKHKKFLERFTS
FT                   MRIKKEKEKPNSAHRNSSASYGDDPTAQSLQDISDEQVLVLFEQMLVDMNLNEEKQQPL
FT                   REKDIVIKREMVSQYLHTSKAGMNQKESSRSAMMYIQELRSGLRDMHLLSCLESLRVSL
FT                   NNNPVSWVQTFGAEGLASLLDILKRLHDEKEETSGNYDSRNQHEIIRCLKAFMNNKFGI
FT                   KTMLETEEGILLLVRAMDPAVPNMMIDAAKLLSALCILPQPEDMNERVLEAMTERAEMD
FT                   EVERFQPLLDGLKSGTSIALKVGCLQLINALITPAEELDFRVHIRSELMRLGLHQVLQE
FT                   LREIENEDMKVQLCVFDEQGDEDFFDLKGRLDDIRMEMDDFGEVFQIILNTVKDSKAEP
FT                   HFLSILQHLLLVRNDYEARPQYYKLIEECVSQIVLHKNGTDPDFKCRHLQIDIERLVDQ
FT                   MIDKTKVEKSEAKATELEKKLDSELTARHELQVEMKKMENDFEQKLQDLQGEKDALDSE
FT                   KQQITAQKQDLEAEVSKLTGEVAKLSKELEDAKNEMASLSAVVVAPSVSSSAAVPPAPP
FT                   LPGDSGTVIPPPPPPPPLPGGVVPPSPPLPPGTCIPPPPPLPGGACIPPPPQLPGSAAI
FT                   PPPPPLPGVASIPPPPPLPGATAIPPPPPLPGATAIPPPPPLPGGTGIPPPPPPLPGSV
FT                   GVPPPPPLPGGPGLPPPPPPFPGAPGIPPPPPGMGVPPPPPFGFGVPAAPVLPFGLTPK
FT                   KVYKPEVQLRRPNWSKFVAEDLSQDCFWTKVKEDRFENNELFAKLTLAFSAQTKTKKDQ
FT                   EGGEEKKSVQKKKVKELKVLDSKTAQNLSIFLGSFRMPYQEIKNVILEVNEAVLTESMI
FT                   QNLIKQMPEPEQLKMLSELKEEYDDLAESEQFGVVMGTVPRLRPRLNAILFKLQFSEQV
FT                   ENIKPEIVSVTAACEELRKSENFSSLLELTLLVGNYMNAGSRNAGAFGFNISFLCKLRD
FT                   TKSADQKMTLLHFLAELCENDHPEVLKFPDELAHVEKASRVSAENLQKSLDQMKKQIAD
FT                   VERDVQNFPAATDEKDKFVEKMTIFVKDAQEQYNKLRMMHSNMETLYKELGDYFVFDPK
FT                   KLSVEEFFMDLHNFRNMFLQAVKENQKRRETEEKMRRAKLAKEKAEKERLEKQQKREQL
FT                   IDMNAEGDETGVMDSLLEALQSGAAFRRKRGPRQVNRKAGCAVTSLLASELTKDDAMAP
FT                   GPVKVPKKSEGVPTILEEAKELVGRAS"
FT   CDS             complement(join(555693..555850,561886..561972,
FT                   563638..563773,563879..564041,564813..564939,
FT                   565809..565938,566048..566287))
FT                   /codon_start=1
FT                   /gene="Diap1"
FT                   /locus_tag="mCG_18335"
FT                   /product="diaphanous homolog 1 (Drosophila), isoform CRA_b"
FT                   /note="gene_id=mCG18335.1 transcript_id=mCT174389.0
FT                   protein_id=mCP97308.0 isoform=CRA_b"
FT                   /protein_id="EDL10116.1"
FT                   /translation="MGTVPRLRPRLNAILFKLQFSEQVENIKPEIVSVTAACEELRKSE
FT                   NFSSLLELTLLVGNYMNAGSRNAGAFGFNISFLCKLRDTKSADQKMTLLHFLAELCEND
FT                   HPEVLKFPDELAHVEKASRVSAENLQKSLDQMKKQIADVERDVQNFPAATDEKDKFVEK
FT                   MTIFVKDAQEQYNKLRMMHSNMETLYKELGDYFVFDPKKLSVEEFFMDLHNFRNMFLQA
FT                   VKENQKRRETEEKMRRAKLAKEKAEKERLEKQQKREQLIDMNAEGDETGVMDSLLEALQ
FT                   SGAAFRRKRGPRQVNRKAGCAVTSLLASELTKDDAMAPGPVKVPKKSEGVPTILEEAKE
FT                   LVGRAS"
FT   mRNA            complement(join(606214..606573,606721..606831,
FT                   607854..608027))
FT                   /gene="Diap1"
FT                   /locus_tag="mCG_18335"
FT                   /product="diaphanous homolog 1 (Drosophila), transcript
FT                   variant mCT174390"
FT                   /note="gene_id=mCG18335.1 transcript_id=mCT174390.0 created
FT                   on 14-OCT-2002"
FT   CDS             complement(join(606430..606573,606721..606831,
FT                   607854..608012))
FT                   /codon_start=1
FT                   /gene="Diap1"
FT                   /locus_tag="mCG_18335"
FT                   /product="diaphanous homolog 1 (Drosophila), isoform CRA_c"
FT                   /note="gene_id=mCG18335.1 transcript_id=mCT174390.0
FT                   protein_id=mCP97309.0 isoform=CRA_c"
FT                   /protein_id="EDL10117.1"
FT                   /translation="MSVSVHLGNSLSVFLGRNERVLEAMTERAEMDEVERFQPLLDGLK
FT                   SGTSIALKVGCLQLINALITPAEELDFRVHIRSELMRLGLHQVLQELREIENEDMKVQL
FT                   CVFDEQGDEDFFDLKGRLDDIRMEMEYPFMTDD"
FT   gene            complement(647176..665162)
FT                   /gene="Hdac3"
FT                   /locus_tag="mCG_128932"
FT                   /note="gene_id=mCG128932.1"
FT   mRNA            complement(join(647176..647880,651151..651308,
FT                   651576..651655,651905..651963,652075..652164,
FT                   653651..653715,653873..653946,654324..654404,
FT                   655083..655216,655531..655586,655702..655758,
FT                   655885..655966,662662..662804,664869..664951,
FT                   665046..665162))
FT                   /gene="Hdac3"
FT                   /locus_tag="mCG_128932"
FT                   /product="histone deacetylase 3, transcript variant
FT                   mCT130237"
FT                   /note="gene_id=mCG128932.1 transcript_id=mCT130237.1
FT                   created on 14-OCT-2002"
FT   mRNA            complement(join(647176..647880,651151..651308,
FT                   651576..651963,652075..652164,653651..653715,
FT                   653873..653946,654324..654404,655083..655216,
FT                   655531..655586,655702..655758,655885..655966,
FT                   662662..662804,664869..664951,665046..665137))
FT                   /gene="Hdac3"
FT                   /locus_tag="mCG_128932"
FT                   /product="histone deacetylase 3, transcript variant
FT                   mCT174331"
FT                   /note="gene_id=mCG128932.1 transcript_id=mCT174331.0
FT                   created on 14-OCT-2002"
FT   mRNA            complement(join(647176..647880,651151..651308,
FT                   651576..651655,651905..651963,652075..652164,
FT                   653651..653703,662739..662804,664869..664951,
FT                   665046..665122))
FT                   /gene="Hdac3"
FT                   /locus_tag="mCG_128932"
FT                   /product="histone deacetylase 3, transcript variant
FT                   mCT174330"
FT                   /note="gene_id=mCG128932.1 transcript_id=mCT174330.0
FT                   created on 14-OCT-2002"
FT   mRNA            complement(join(647276..647880,651151..651308,
FT                   651576..651655,651905..651963,652075..652164,
FT                   653651..653715,653873..653946,654324..654404,
FT                   655083..655216,655531..655586,655702..655758,
FT                   655885..655966,664869..664951,665046..665161))
FT                   /gene="Hdac3"
FT                   /locus_tag="mCG_128932"
FT                   /product="histone deacetylase 3, transcript variant
FT                   mCT174329"
FT                   /note="gene_id=mCG128932.1 transcript_id=mCT174329.0
FT                   created on 14-OCT-2002"
FT   CDS             complement(join(647811..647880,651151..651308,
FT                   651576..651655,651905..651963,652075..652164,
FT                   653651..653703,662739..662804,664869..664951,
FT                   665046..665100))
FT                   /codon_start=1
FT                   /gene="Hdac3"
FT                   /locus_tag="mCG_128932"
FT                   /product="histone deacetylase 3, isoform CRA_b"
FT                   /note="gene_id=mCG128932.1 transcript_id=mCT174330.0
FT                   protein_id=mCP97250.0 isoform=CRA_b"
FT                   /db_xref="GOA:G3X9M4"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR003084"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="MGI:MGI:1343091"
FT                   /db_xref="UniProtKB/TrEMBL:G3X9M4"
FT                   /protein_id="EDL10111.1"
FT                   /translation="MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKM
FT                   IVFKPYQASQHDMCRFHSEDYIDSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGG
FT                   GGYTVRNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQY
FT                   LDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEF
FT                   YDGDHDNDKESDVEI"
FT   CDS             complement(join(647811..647880,651151..651308,
FT                   651576..651655,651905..651963,652075..652164,
FT                   653651..653715,653873..653946,654324..654404,
FT                   655083..655216,655531..655586,655702..655758,
FT                   655885..655966,662662..662804,664869..664951,
FT                   665046..665100))
FT                   /codon_start=1
FT                   /gene="Hdac3"
FT                   /locus_tag="mCG_128932"
FT                   /product="histone deacetylase 3, isoform CRA_a"
FT                   /note="gene_id=mCG128932.1 transcript_id=mCT130237.1
FT                   protein_id=mCP77967.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q3UM33"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR003084"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="MGI:MGI:1343091"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UM33"
FT                   /protein_id="EDL10110.1"
FT                   /translation="MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKM
FT                   IVFKPYQASQHDMCRFHSEDYIDFLQRVSPTNMQGFTKSLNAFNVGDDCPVFPGLFEFC
FT                   SRYTGASLQGATQLNNKICDIAINWAGGLHHAKKFEASGFCYVNDIVIGILELLKYHPR
FT                   VLYIDIDIHHGDGVQEAFYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVP
FT                   LRDGIDDQSYKHLFQPVISQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVE
FT                   YVKSFNIPLLVLGGGGYTVRNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHP
FT                   DVSTRIENQNSRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERG
FT                   PEENYSRPEAPNEFYDGDHDNDKESDVEI"
FT   CDS             complement(join(647811..647880,651151..651308,
FT                   651576..651655,651905..651963,652075..652164,
FT                   653651..653715,653873..653946,654324..654404,
FT                   655083..655131))
FT                   /codon_start=1
FT                   /gene="Hdac3"
FT                   /locus_tag="mCG_128932"
FT                   /product="histone deacetylase 3, isoform CRA_d"
FT                   /note="gene_id=mCG128932.1 transcript_id=mCT174329.0
FT                   protein_id=mCP97251.0 isoform=CRA_d"
FT                   /protein_id="EDL10113.1"
FT                   /translation="MTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSY
FT                   KHLFQPVISQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLL
FT                   VLGGGGYTVRNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQN
FT                   SRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEA
FT                   PNEFYDGDHDNDKESDVEI"
FT   CDS             complement(join(651798..651963,652075..652164,
FT                   653651..653715,653873..653946,654324..654404,
FT                   655083..655216,655531..655586,655702..655758,
FT                   655885..655966,662662..662804,664869..664951,
FT                   665046..665100))
FT                   /codon_start=1
FT                   /gene="Hdac3"
FT                   /locus_tag="mCG_128932"
FT                   /product="histone deacetylase 3, isoform CRA_c"
FT                   /note="gene_id=mCG128932.1 transcript_id=mCT174331.0
FT                   protein_id=mCP97248.0 isoform=CRA_c"
FT                   /protein_id="EDL10112.1"
FT                   /translation="MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKM
FT                   IVFKPYQASQHDMCRFHSEDYIDFLQRVSPTNMQGFTKSLNAFNVGDDCPVFPGLFEFC
FT                   SRYTGASLQGATQLNNKICDIAINWAGGLHHAKKFEASGFCYVNDIVIGILELLKYHPR
FT                   VLYIDIDIHHGDGVQEAFYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVP
FT                   LRDGIDDQSYKHLFQPVISQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVE
FT                   YVKSFNIPLLVLGGGGYTVRNVARCWTYETSLLVEEAISEELPYSGKIHFMMPPQGDTI
FT                   LTSPQNDLVWREIAPSGSSAD"
FT   mRNA            complement(join(651907..651963,652075..652153,
FT                   653641..653715,653873..654404,655083..655216,
FT                   655531..655586,655702..655758,655885..655966,
FT                   662662..662804,664869..664951,665046..665155))
FT                   /gene="Hdac3"
FT                   /locus_tag="mCG_128932"
FT                   /product="histone deacetylase 3, transcript variant
FT                   mCT174332"
FT                   /note="gene_id=mCG128932.1 transcript_id=mCT174332.0
FT                   created on 14-OCT-2002"
FT   CDS             complement(join(654313..654404,655083..655216,
FT                   655531..655586,655702..655758,655885..655966,
FT                   662662..662804,664869..664951,665046..665100))
FT                   /codon_start=1
FT                   /gene="Hdac3"
FT                   /locus_tag="mCG_128932"
FT                   /product="histone deacetylase 3, isoform CRA_e"
FT                   /note="gene_id=mCG128932.1 transcript_id=mCT174332.0
FT                   protein_id=mCP97249.0 isoform=CRA_e"
FT                   /protein_id="EDL10114.1"
FT                   /translation="MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKM
FT                   IVFKPYQASQHDMCRFHSEDYIDFLQRVSPTNMQGFTKSLNAFNVGDDCPVFPGLFEFC
FT                   SRYTGASLQGATQLNNKICDIAINWAGGLHHAKKFEASGFCYVNDIVIGILELLKYHPR
FT                   VLYIDIDIHHGDGVQEAFYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVP
FT                   LRDGIDDQSKF"
FT   gene            665783..669422
FT                   /gene="4631403P03Rik"
FT                   /locus_tag="mCG_18336"
FT                   /note="gene_id=mCG18336.3"
FT   mRNA            join(665783..665862,665934..666166,666585..666824,
FT                   667186..667251,667346..667412,667846..668031,
FT                   668271..668646,668769..668828,669016..669422)
FT                   /gene="4631403P03Rik"
FT                   /locus_tag="mCG_18336"
FT                   /product="RIKEN cDNA 4631403P03, transcript variant
FT                   mCT174391"
FT                   /note="gene_id=mCG18336.3 transcript_id=mCT174391.1 created
FT                   on 13-JUN-2003"
FT   mRNA            join(665783..665862,665934..666166,666585..666824,
FT                   667186..667251,667346..667412,667846..668031,
FT                   668271..669419)
FT                   /gene="4631403P03Rik"
FT                   /locus_tag="mCG_18336"
FT                   /product="RIKEN cDNA 4631403P03, transcript variant
FT                   mCT12934"
FT                   /note="gene_id=mCG18336.3 transcript_id=mCT12934.3 created
FT                   on 13-JUN-2003"
FT   mRNA            join(665783..665862,665934..666166,667186..667251,
FT                   667346..667412,667846..668031,668271..669419)
FT                   /gene="4631403P03Rik"
FT                   /locus_tag="mCG_18336"
FT                   /product="RIKEN cDNA 4631403P03, transcript variant
FT                   mCT174392"
FT                   /note="gene_id=mCG18336.3 transcript_id=mCT174392.1 created
FT                   on 13-JUN-2003"
FT   CDS             join(666641..666824,667186..667251,667346..667412,
FT                   667846..668031,668271..668646,668769..668801)
FT                   /codon_start=1
FT                   /gene="4631403P03Rik"
FT                   /locus_tag="mCG_18336"
FT                   /product="RIKEN cDNA 4631403P03, isoform CRA_a"
FT                   /note="gene_id=mCG18336.3 transcript_id=mCT174391.1
FT                   protein_id=mCP97311.0 isoform=CRA_a"
FT                   /protein_id="EDL10107.1"
FT                   /translation="MSEPQPDLEPPQHGLYMLFLLVLVFFLMGLVGFMICHVLKKKGYR
FT                   CRTSRGSEPDDAQLQPPEDDDVNEDTVERIVRCIIQNEANAEALKEMLGDSEGEGTVQL
FT                   SSVDATSSLQDGAPSHHHTVHLGSAAPCIHCSRSKRPPLVRQGRSKEGKSRPRPGETTV
FT                   FSVGRFRVTHIEKRYGLHEHRDGSPTDRSWGSGGGQEPGGSQAAGGGQPRTGTAAIERL
FT                   LPEPPPSQAAATHSVQNGRLQDASLVPCTLEGTPGTSAELNLGPRGRDPSPGLSSQEAN
FT                   GQPTKLDTSGQQESLPPEAGGM"
FT   CDS             join(666641..666824,667186..667251,667346..667412,
FT                   667846..668031,668271..668652)
FT                   /codon_start=1
FT                   /gene="4631403P03Rik"
FT                   /locus_tag="mCG_18336"
FT                   /product="RIKEN cDNA 4631403P03, isoform CRA_c"
FT                   /note="gene_id=mCG18336.3 transcript_id=mCT12934.3
FT                   protein_id=mCP8358.2 isoform=CRA_c"
FT                   /db_xref="GOA:Q8CFT0"
FT                   /db_xref="InterPro:IPR022248"
FT                   /db_xref="MGI:MGI:1918044"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CFT0"
FT                   /protein_id="EDL10109.1"
FT                   /translation="MSEPQPDLEPPQHGLYMLFLLVLVFFLMGLVGFMICHVLKKKGYR
FT                   CRTSRGSEPDDAQLQPPEDDDVNEDTVERIVRCIIQNEANAEALKEMLGDSEGEGTVQL
FT                   SSVDATSSLQDGAPSHHHTVHLGSAAPCIHCSRSKRPPLVRQGRSKEGKSRPRPGETTV
FT                   FSVGRFRVTHIEKRYGLHEHRDGSPTDRSWGSGGGQEPGGSQAAGGGQPRTGTAAIERL
FT                   LPEPPPSQAAATHSVQNGRLQDASLVPCTLEGTPGTSAELNLGPRGRDPSPGLSSQEAN
FT                   GQPTKLDTSGQQV"
FT   CDS             join(667369..667412,667846..668031,668271..668652)
FT                   /codon_start=1
FT                   /gene="4631403P03Rik"
FT                   /locus_tag="mCG_18336"
FT                   /product="RIKEN cDNA 4631403P03, isoform CRA_b"
FT                   /note="gene_id=mCG18336.3 transcript_id=mCT174392.1
FT                   protein_id=mCP97310.0 isoform=CRA_b"
FT                   /protein_id="EDL10108.1"
FT                   /translation="MLGDSEGEGTVQLSSVDATSSLQDGAPSHHHTVHLGSAAPCIHCS
FT                   RSKRPPLVRQGRSKEGKSRPRPGETTVFSVGRFRVTHIEKRYGLHEHRDGSPTDRSWGS
FT                   GGGQEPGGSQAAGGGQPRTGTAAIERLLPEPPPSQAAATHSVQNGRLQDASLVPCTLEG
FT                   TPGTSAELNLGPRGRDPSPGLSSQEANGQPTKLDTSGQQV"
FT   gene            complement(667689..680025)
FT                   /gene="Fchsd1"
FT                   /locus_tag="mCG_18338"
FT                   /note="gene_id=mCG18338.2"
FT   mRNA            complement(join(667689..669911,670035..670090,
FT                   671502..671589,672828..673048,673175..673292,
FT                   673383..673466,673548..673676,674263..674424,
FT                   674569..674673,675046..675165,675906..676001,
FT                   676154..676276,676696..676824,677618..678008))
FT                   /gene="Fchsd1"
FT                   /locus_tag="mCG_18338"
FT                   /product="FCH and double SH3 domains 1, transcript variant
FT                   mCT174396"
FT                   /note="gene_id=mCG18338.2 transcript_id=mCT174396.0 created
FT                   on 14-OCT-2002"
FT   mRNA            complement(join(667689..669911,670035..670726))
FT                   /gene="Fchsd1"
FT                   /locus_tag="mCG_18338"
FT                   /product="FCH and double SH3 domains 1, transcript variant
FT                   mCT174397"
FT                   /note="gene_id=mCG18338.2 transcript_id=mCT174397.0 created
FT                   on 14-OCT-2002"
FT   mRNA            complement(join(668933..669911,670035..670090,
FT                   671502..671589,672828..673048,673175..673292,
FT                   673383..673466,673548..673676,674263..674424,
FT                   674569..674673,675046..675165,675906..676001,
FT                   676154..676276,676696..676824,677618..677681,
FT                   677793..677929,678015..678156,678469..678536,
FT                   679005..679050,679610..679707,679961..680025))
FT                   /gene="Fchsd1"
FT                   /locus_tag="mCG_18338"
FT                   /product="FCH and double SH3 domains 1, transcript variant
FT                   mCT12416"
FT                   /note="gene_id=mCG18338.2 transcript_id=mCT12416.2 created
FT                   on 14-OCT-2002"
FT   mRNA            complement(join(669382..669911,670035..670090,
FT                   671502..671589,672828..673048,673175..673292,
FT                   673383..673466,673548..673676,674263..674424,
FT                   674569..674673,675046..675165,675906..676001,
FT                   676154..676276,676696..676824,677618..677681,
FT                   677793..677929,678015..678150,678469..678536,
FT                   679005..679050,679610..679707,679961..>680005))
FT                   /gene="Fchsd1"
FT                   /locus_tag="mCG_18338"
FT                   /product="FCH and double SH3 domains 1, transcript variant
FT                   mCT190268"
FT                   /note="gene_id=mCG18338.2 transcript_id=mCT190268.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(669846..669911,670035..670090,
FT                   671502..671589,672828..673048,673175..673292,
FT                   673383..673466,673548..673676,674263..674424,
FT                   674569..674673,675046..675165,675906..676001,
FT                   676154..676276,676696..676824,677618..677681,
FT                   677793..677929,678015..678150,678469..678536,
FT                   679005..679050,679610..679707,679961..>680005))
FT                   /codon_start=1
FT                   /gene="Fchsd1"
FT                   /locus_tag="mCG_18338"
FT                   /product="FCH and double SH3 domains 1, isoform CRA_f"
FT                   /note="gene_id=mCG18338.2 transcript_id=mCT190268.0
FT                   protein_id=mCP111279.0 isoform=CRA_f"
FT                   /protein_id="EDL10106.1"
FT                   /translation="LAAFAGAAMQPPPRKVKPAQEVKLRFLEQLSILQTRQQREADLLE
FT                   DIRSYSKQRAAIEREYGQALQKLAGPFLKREGQRSGEADSRTVFGAWRCLLDATVAGGQ
FT                   TRLQASDRYRDLAGGTGRSAKEQVLRKGTESLQQAQAEVLQSVRELSRSRKLYGQRQRV
FT                   WALAQEKAADVQARLNRSDHGIFHSRTSLQKLSTKLSAQSAQYSQQLRAARNEYLLNLV
FT                   ATNAHLAHYYQEELPALLKVLVSELSEYLRDPLTLLGHTELEAAEMILEHARHGGKATS
FT                   QVNWEQDVKLFLQGPGVFSPTPPQQFQPAGADQVCGLEWGAGGMAGESGLEKEVQRWTS
FT                   RAARDYKIQHHGHRVLQRLEQRRQQAPGREAPGVEQRLQEVRENIRRAQVSQVKGAARL
FT                   ALLQEAGLDVQRWLKPAMTQAQDEVEQERRLSEARLSQRDLSPTAEDAELSDFDECEEA
FT                   GELFEEPAPPALATRPLPCPAHVVFGYQAGREDELTITEGEWLEVIEEGDADEWVKARN
FT                   QHGEAGFVPERYLNFPDLSLPESCHGIDNPSGGEPTAFLARALYSYTGQSEEELSFPEG
FT                   ALIRLLPRAQDGVDDGFWRGEFGGHVGVFPSLLVEELLGPPGPPELSDPEQMLPSPSPP
FT                   SFSPPAPTCALDGSTAPALPSDKVLDCPGPLDMMVPRLRPMRPPPPPPAKAPDPGHPDP
FT                   LT"
FT   CDS             complement(join(669846..669911,670035..670090,
FT                   671502..671589,672828..673048,673175..673292,
FT                   673383..673466,673548..673676,674263..674424,
FT                   674569..674673,675046..675165,675906..676001,
FT                   676154..676276,676696..676824,677618..677681,
FT                   677793..677929,678015..678156,678469..678536,
FT                   679005..679050,679610..679707,679961..679981))
FT                   /codon_start=1
FT                   /gene="Fchsd1"
FT                   /locus_tag="mCG_18338"
FT                   /product="FCH and double SH3 domains 1, isoform CRA_a"
FT                   /note="gene_id=mCG18338.2 transcript_id=mCT12416.2
FT                   protein_id=mCP8376.2 isoform=CRA_a"
FT                   /protein_id="EDL10101.1"
FT                   /translation="MQPPPRKVKPAQEVKLRFLEQLSILQTRQQREADLLEDIRSYSKQ
FT                   RAAIEREYGQALQKLAGPFLKREGQRSGEADSRGRTVFGAWRCLLDATVAGGQTRLQAS
FT                   DRYRDLAGGTGRSAKEQVLRKGTESLQQAQAEVLQSVRELSRSRKLYGQRQRVWALAQE
FT                   KAADVQARLNRSDHGIFHSRTSLQKLSTKLSAQSAQYSQQLRAARNEYLLNLVATNAHL
FT                   AHYYQEELPALLKVLVSELSEYLRDPLTLLGHTELEAAEMILEHARHGGKATSQVNWEQ
FT                   DVKLFLQGPGVFSPTPPQQFQPAGADQVCGLEWGAGGMAGESGLEKEVQRWTSRAARDY
FT                   KIQHHGHRVLQRLEQRRQQAPGREAPGVEQRLQEVRENIRRAQVSQVKGAARLALLQEA
FT                   GLDVQRWLKPAMTQAQDEVEQERRLSEARLSQRDLSPTAEDAELSDFDECEEAGELFEE
FT                   PAPPALATRPLPCPAHVVFGYQAGREDELTITEGEWLEVIEEGDADEWVKARNQHGEAG
FT                   FVPERYLNFPDLSLPESCHGIDNPSGGEPTAFLARALYSYTGQSEEELSFPEGALIRLL
FT                   PRAQDGVDDGFWRGEFGGHVGVFPSLLVEELLGPPGPPELSDPEQMLPSPSPPSFSPPA
FT                   PTCALDGSTAPALPSDKVLDCPGPLDMMVPRLRPMRPPPPPPAKAPDPGHPDPLT"
FT   CDS             complement(join(669846..669911,670035..670090,
FT                   671502..671589,672828..673048,673175..673292,
FT                   673383..673466,673548..673676,674263..674424,
FT                   674569..674673,675046..675165,675906..676001,
FT                   676154..676198))
FT                   /codon_start=1
FT                   /gene="Fchsd1"
FT                   /locus_tag="mCG_18338"
FT                   /product="FCH and double SH3 domains 1, isoform CRA_c"
FT                   /note="gene_id=mCG18338.2 transcript_id=mCT174396.0
FT                   protein_id=mCP97314.0 isoform=CRA_c"
FT                   /protein_id="EDL10103.1"
FT                   /translation="MILEHARHGGKATSQVNWEQDVKLFLQGPGVFSPTPPQQFQPAGA
FT                   DQVCGLEWGAGGMAGESGLEKEVQRWTSRAARDYKIQHHGHRVLQRLEQRRQQAPGREA
FT                   PGVEQRLQEVRENIRRAQVSQVKGAARLALLQEAGLDVQRWLKPAMTQAQDEVEQERRL
FT                   SEARLSQRDLSPTAEDAELSDFDECEEAGELFEEPAPPALATRPLPCPAHVVFGYQAGR
FT                   EDELTITEGEWLEVIEEGDADEWVKARNQHGEAGFVPERYLNFPDLSLPESCHGIDNPS
FT                   GGEPTAFLARALYSYTGQSEEELSFPEGALIRLLPRAQDGVDDGFWRGEFGGHVGVFPS
FT                   LLVEELLGPPGPPELSDPEQMLPSPSPPSFSPPAPTCALDGSTAPALPSDKVLDCPGPL
FT                   DMMVPRLRPMRPPPPPPAKAPDPGHPDPLT"
FT   CDS             complement(join(669846..669911,670035..670145))
FT                   /codon_start=1
FT                   /gene="Fchsd1"
FT                   /locus_tag="mCG_18338"
FT                   /product="FCH and double SH3 domains 1, isoform CRA_d"
FT                   /note="gene_id=mCG18338.2 transcript_id=mCT174397.0
FT                   protein_id=mCP97315.0 isoform=CRA_d"
FT                   /protein_id="EDL10104.1"
FT                   /translation="MQYGADQSLRIDFWFLFLDKVLDCPGPLDMMVPRLRPMRPPPPPP
FT                   AKAPDPGHPDPLT"
FT   mRNA            complement(join(673219..673292,673383..673676,
FT                   674263..674424,674569..674673,675046..675165,
FT                   675906..676001,676154..676276,676696..676824,
FT                   677618..677681,677793..677929,678015..678156,
FT                   678469..678536,679005..679050,679610..679707,
FT                   679961..680025))
FT                   /gene="Fchsd1"
FT                   /locus_tag="mCG_18338"
FT                   /product="FCH and double SH3 domains 1, transcript variant
FT                   mCT174395"
FT                   /note="gene_id=mCG18338.2 transcript_id=mCT174395.0 created
FT                   on 14-OCT-2002"
FT   CDS             complement(join(673542..673676,674263..674424,
FT                   674569..674673,675046..675165,675906..676001,
FT                   676154..676276,676696..676824,677618..677681,
FT                   677793..677929,678015..678156,678469..678536,
FT                   679005..679050,679610..679707,679961..679981))
FT                   /codon_start=1
FT                   /gene="Fchsd1"
FT                   /locus_tag="mCG_18338"
FT                   /product="FCH and double SH3 domains 1, isoform CRA_b"
FT                   /note="gene_id=mCG18338.2 transcript_id=mCT174395.0
FT                   protein_id=mCP97317.0 isoform=CRA_b"
FT                   /protein_id="EDL10102.1"
FT                   /translation="MQPPPRKVKPAQEVKLRFLEQLSILQTRQQREADLLEDIRSYSKQ
FT                   RAAIEREYGQALQKLAGPFLKREGQRSGEADSRGRTVFGAWRCLLDATVAGGQTRLQAS
FT                   DRYRDLAGGTGRSAKEQVLRKGTESLQQAQAEVLQSVRELSRSRKLYGQRQRVWALAQE
FT                   KAADVQARLNRSDHGIFHSRTSLQKLSTKLSAQSAQYSQQLRAARNEYLLNLVATNAHL
FT                   AHYYQEELPALLKVLVSELSEYLRDPLTLLGHTELEAAEMILEHARHGGKATSQVNWEQ
FT                   DVKLFLQGPGVFSPTPPQQFQPAGADQVCGLEWGAGGMAGESGLEKEVQRWTSRAARDY
FT                   KIQHHGHRVLQRLEQRRQQAPGREAPGVEQRLQEVRENIRRAQVSQVKGAARLALLQEA
FT                   GLDVQRWLKPAMTQAQDEVEQERRLSEARLSQRDLSPTAEDAELSDFDECEEAGELFEE
FT                   PAPPALATRPLPCPAHVVFGYQV"
FT   mRNA            complement(join(677895..678156,678469..678536,
FT                   679005..679050,679610..679707,679961..680014))
FT                   /gene="Fchsd1"
FT                   /locus_tag="mCG_18338"
FT                   /product="FCH and double SH3 domains 1, transcript variant
FT                   mCT174398"
FT                   /note="gene_id=mCG18338.2 transcript_id=mCT174398.0 created
FT                   on 14-OCT-2002"
FT   CDS             complement(join(677970..678156,678469..678536,
FT                   679005..679050,679610..679707,679961..679981))
FT                   /codon_start=1
FT                   /gene="Fchsd1"
FT                   /locus_tag="mCG_18338"
FT                   /product="FCH and double SH3 domains 1, isoform CRA_e"
FT                   /note="gene_id=mCG18338.2 transcript_id=mCT174398.0
FT                   protein_id=mCP97316.0 isoform=CRA_e"
FT                   /protein_id="EDL10105.1"
FT                   /translation="MQPPPRKVKPAQEVKLRFLEQLSILQTRQQREADLLEDIRSYSKQ
FT                   RAAIEREYGQALQKLAGPFLKREGQRSGEADSRGRTVFGAWRCLLDATVAGGQTRLQAS
FT                   DRYRDLAGGTGRSAKEQVLRKVCVRGWGRGTSSSD"
FT   gene            complement(682880..>707352)
FT                   /gene="Centd3"
FT                   /locus_tag="mCG_128930"
FT                   /note="gene_id=mCG128930.1"
FT   mRNA            complement(join(682880..683906,684357..684395,
FT                   684620..684757,684873..684936,685642..685677,
FT                   685771..685853,686078..686211,686295..686423,
FT                   688607..688721,688804..688878,690091..690159,
FT                   690441..690588,691568..691673,692220..692432,
FT                   694505..694668,694860..694923,695584..695803,
FT                   697826..697928,698025..698172,698586..698699,
FT                   699330..699465,699634..699816,699957..700042,
FT                   700147..700346,700783..700889,700973..701157,
FT                   701239..701359,701599..701668,701810..702001,
FT                   706446..706557,706656..706717,706823..>707352))
FT                   /gene="Centd3"
FT                   /locus_tag="mCG_128930"
FT                   /product="centaurin, delta 3, transcript variant mCT130235"
FT                   /note="gene_id=mCG128930.1 transcript_id=mCT130235.1
FT                   created on 14-OCT-2002"
FT   CDS             complement(join(683427..683906,684357..684395,
FT                   684620..684757,684873..684936,685642..685677,
FT                   685771..685853,686078..686211,686295..686423,
FT                   688607..688721,688804..688878,690091..690159,
FT                   690441..690588,691568..691673,692220..692432,
FT                   694505..694668,694860..694923,695584..695803,
FT                   697826..697928,698025..698172,698586..698699,
FT                   699330..699465,699634..699816,699957..700042,
FT                   700147..700346,700783..700889,700973..701157,
FT                   701239..701359,701599..701668,701810..702001,
FT                   706446..706557,706656..706717,706823..>707349))
FT                   /codon_start=1
FT                   /gene="Centd3"
FT                   /locus_tag="mCG_128930"
FT                   /product="centaurin, delta 3, isoform CRA_b"
FT                   /note="gene_id=mCG128930.1 transcript_id=mCT130235.1
FT                   protein_id=mCP77625.1 isoform=CRA_b"
FT                   /protein_id="EDL10100.1"
FT                   /translation="KPMAAPQDLDIAVWLALVHLEQYADTFRRHGLATAGAAQHLGHEE
FT                   LRHLGISATGHRKRILRLLRAGSAEGFLDSHLDNTMEPTPSPAPDAQPPKPVPKPRTVF
FT                   GLSNPATAQRPGLSPIFWDPEVSRNSECTQRSSPLLPSSSEQPSVPNTMEMMPNAIYFG
FT                   LDLRGQAQAAQDVTPDSSQATVPTPAFRPTTGTVHIMDPGCLYYGVQPVGIPGASDRRD
FT                   GRGVCQERAEHRQDLETREDAGYASLELPGDSILSLPTQDAETSDDLISPYASFSSTAD
FT                   RPVPLLSGWLDKLSPQGNYVFQRRFVQFNGRSLMYFGSDKDPFPKGVIPLTAIEMTRSS
FT                   KDNKFQVITGQRVFVFRTESEAQRDLWCSTLQSCLKEQRLLGHPRPPHPPRPLRTGTLE
FT                   LRGHKAKVFAALIPGELALYKSEQAFSLGIGICFIELQGCSVRETKSRSFDLLTPHRCF
FT                   SFTAESGGARQSWAAALQEAVTETLSDYEVAEKVWSNPANRHCADCRASRPDWAAVNLG
FT                   VVICKQCAGQHRALGSGISKVQSLKLDTSVWSNEIVQLFIVLGNDRANCFWAGALPPGE
FT                   GLHPDSAPGPRGEFISRKYKLGLFRKPHPRHPDHSQLLQALCAAMAGPNLLKNMAQLLC
FT                   VETSEGEEPLSPSALNGSLLSLLPSDSPGVYNEVVVPATYRGFLYCGSISNKAGAPPLR
FT                   RGRDAPPRLWCVLGAALEMFASESSPEPLSLLQPQDIVCLGVSPPPADPGDLDRFPFSF
FT                   ELILTGGRIQHFATDGADSLEAWISAVGKWFSPLSCHQLLGPGLLRMGRLWLRSPSHAG
FT                   LAPGLWLSGFGLLRGDHLFLCPAPGPGPPAPEDMVHLRRLQEISVVSAADTPDKKEHLV
FT                   LVETGRTLYLQGEGRLDFAAWNTAIGGAAGGGGTGLQEQQMSRGDIPIIVDACISFVTQ
FT                   HGLRLEGVYRKGGARARSLRLLAEFRRDARSVKLRPREHFVEDVTDTLKRFFRELDDPV
FT                   TSARLLPRWREAAELSQKNQRLEKYKEVISCLPRVNRRTLATLIGHLYRVQKCASLNQM
FT                   CTRNLALLFAPSVFQTDGRGEHEVRVLQELIDGYISVFDIDSDQAAQIDLEVSLITTWK
FT                   DVQLSQAGDLIMEVYIEQQLPDNCVTLKVSPTLTAEELTNQVLEMRGAASGTDLWVTFE
FT                   ILEHGELERPLHPKEKVLEQALQWCQLPEPCSASLLLRKVSMAHAGCLFTGVRRESPRV
FT                   GLLRCREEPPRLLGNRFQERFFLVRGRCLLLLKEKKSSKPEREWSLEGAKVYLGIRKKL
FT                   KPPTLWGFTLILEKMHLCLSCMDEEEMWDWTTSILKAQHDDQQSVVLRRRSSSDLARQK
FT                   FGTMPLLPIRGDDSGATLLSANQTLRRLHNRRTLSMFFPMKSPQGSVEEQDELEEPVYE
FT                   EPVYEEVGAFPELTKDTTFSSTWEWSAKSDPSLTSQRSFDQPPLSKASMLGHEERIPDP
FT                   PPGPPSKSSSQARGSLEEQLLQELNNLILRKGEPASCPESSSQPTSPQAPSPTSLPTPT
FT                   PSLPTQPPCTSNPPSSQPLT"
FT   mRNA            complement(join(693067..693428,694505..694668,
FT                   694860..694923,695584..695803,697826..697928,
FT                   698025..698172,698586..698699,699330..699465,
FT                   699634..699816,699957..700042,700147..700346,
FT                   700783..700889,700973..701157,701239..701359,
FT                   701599..701668,701810..702001,706446..706557,
FT                   706656..706717,706823..707352))
FT                   /gene="Centd3"
FT                   /locus_tag="mCG_128930"
FT                   /product="centaurin, delta 3, transcript variant mCT174328"
FT                   /note="gene_id=mCG128930.1 transcript_id=mCT174328.0
FT                   created on 14-OCT-2002"
FT   CDS             complement(join(693409..693428,694505..694668,
FT                   694860..694923,695584..695803,697826..697928,
FT                   698025..698172,698586..698699,699330..699465,
FT                   699634..699816,699957..700042,700147..700346,
FT                   700783..700889,700973..701157,701239..701359,
FT                   701599..701668,701810..702001,706446..706557,
FT                   706656..706717,706823..707343))
FT                   /codon_start=1
FT                   /gene="Centd3"
FT                   /locus_tag="mCG_128930"
FT                   /product="centaurin, delta 3, isoform CRA_a"
FT                   /note="gene_id=mCG128930.1 transcript_id=mCT174328.0
FT                   protein_id=mCP97247.0 isoform=CRA_a"
FT                   /protein_id="EDL10099.1"
FT                   /translation="MAAPQDLDIAVWLALVHLEQYADTFRRHGLATAGAAQHLGHEELR
FT                   HLGISATGHRKRILRLLRAGSAEGFLDSHLDNTMEPTPSPAPDAQPPKPVPKPRTVFGL
FT                   SNPATAQRPGLSPIFWDPEVSRNSECTQRSSPLLPSSSEQPSVPNTMEMMPNAIYFGLD
FT                   LRGQAQAAQDVTPDSSQATVPTPAFRPTTGTVHIMDPGCLYYGVQPVGIPGASDRRDGR
FT                   GVCQERAEHRQDLETREDAGYASLELPGDSILSLPTQDAETSDDLISPYASFSSTADRP
FT                   VPLLSGWLDKLSPQGNYVFQRRFVQFNGRSLMYFGSDKDPFPKGVIPLTAIEMTRSSKD
FT                   NKFQVITGQRVFVFRTESEAQRDLWCSTLQSCLKEQRLLGHPRPPHPPRPLRTGTLELR
FT                   GHKAKVFAALIPGELALYKSEQAFSLGIGICFIELQGCSVRETKSRSFDLLTPHRCFSF
FT                   TAESGGARQSWAAALQEAVTETLSDYEVAEKVWSNPANRHCADCRASRPDWAAVNLGVV
FT                   ICKQCAGQHRALGSGISKVQSLKLDTSVWSNEIVQLFIVLGNDRANCFWAGALPPGEGL
FT                   HPDSAPGPRGEFISRKYKLGLFRKPHPRHPDHSQLLQALCAAMAGPNLLKNMAQLLCVE
FT                   TSEGEEPLSPSALNGSLLSLLPSDSPGVYNEVVVPATYRGFLYCGSISNKAGAPPLRRG
FT                   RDAPPRLWCVLGAALEMFASESSPEPLSLLQPQDIVCLGVSPPPADPGDLDRFPFSFEL
FT                   ILTGGRIQHFATDGADSLEAWISAVGKWFSPLSCHQLLGPGLLRMGRLWLRSPSHAGLA
FT                   PGLWLSGFGLLRGDHLFLCPAPGPGPPAPEDMVHLRRLQEISVVSAADTPDKKEHLVLV
FT                   ETGRTLYLQGEGRLDFAAWNTAIGGAAGGGGTGLQEQQMSRGDIPIIVDACISFVTQHA
FT                   SLAFI"
FT   gene            complement(907823..920891)
FT                   /gene="Pcdh1"
FT                   /locus_tag="mCG_142244"
FT                   /note="gene_id=mCG142244.0"
FT   mRNA            complement(join(907823..910656,913876..914738,
FT                   920688..920891))
FT                   /gene="Pcdh1"
FT                   /locus_tag="mCG_142244"
FT                   /product="protocadherin 1"
FT                   /note="gene_id=mCG142244.0 transcript_id=mCT179463.0
FT                   created on 06-FEB-2003"
FT   CDS             complement(join(908377..910656,913876..914712))
FT                   /codon_start=1
FT                   /gene="Pcdh1"
FT                   /locus_tag="mCG_142244"
FT                   /product="protocadherin 1"
FT                   /note="gene_id=mCG142244.0 transcript_id=mCT179463.0
FT                   protein_id=mCP102385.0 partial"
FT                   /protein_id="EDL10098.1"
FT                   /translation="MGPLRPSPGXXXXXXXSPPLLLALLLLLAPSASHTTQVVYKVPEE
FT                   QPPNTLIGSLAADYGLPDVGHLYKLEVGAPYLRVDGKTGDIFTTETSIDREGLRECQNQ
FT                   IPGNPCILEFEVSITDLVQNGSPRLLEGQIEVQDINDNTPNFASPVITLAIPENTNIGS
FT                   LFPIPLATDRDAGPNGVASYELQAGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWD
FT                   SYDLTIKVQDGGNPPRASSALLRVTVLDTNDNAPKFERPTYEAELSENSPIGHSVIQVK
FT                   ANDSDQGANAEIDYTFHQAPEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDR
FT                   GATPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSD
FT                   RDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVD
FT                   SGNPPLSSTNSLKVQVVDVNDNAPVFTQSITEVAFPENNKPGEVVAEVTASDADSGSNA
FT                   ELVYSLEPEPAAQGLFTISPENGEIRVKTSLDREQRDSYELKVVAADRGSPSLQGTATV
FT                   LVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENARVQLSVEQDNGD
FT                   FVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPFIT
FT                   APSNTSHRLLTPQTRLGETVSQVTAEDIDSGINAELTYSIAGGNPYGLFQIGSHSGAIT
FT                   LEKEIERRHHGLHRLVVKVSDRGKPPRYGTALVHLYVNETLANRTLLETLLVHSLDTPL
FT                   DIDIAGDPEYERSKQRGNILFGVVAGVVAVALLIALAVLVRYCRQREAKSGYQAGKKET
FT                   KDLYAPKPSGKAAKGSKSKGKKSKSPKPVKPVEDEDDTGLQKSLKFNLMSDAPGDSPRI
FT                   HLPLNYPPGSPDLGRHYRSNSPLPSIQLQPQSPSASKKHQVVQDLPPANTFVGTGDTTS
FT                   TGSEQYSDYSYRTNPPKYPSKQVGQPFRLSTPQPPPHPYHGAIWTEVWE"
FT   gene            complement(<950031..>961393)
FT                   /locus_tag="mCG_145146"
FT                   /note="gene_id=mCG145146.0"
FT   mRNA            complement(join(<950031..950162,950546..950724,
FT                   951812..951926,960934..>961393))
FT                   /locus_tag="mCG_145146"
FT                   /product="mCG145146"
FT                   /note="gene_id=mCG145146.0 transcript_id=mCT184570.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(<950031..950162,950546..>950639))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145146"
FT                   /product="mCG145146"
FT                   /note="gene_id=mCG145146.0 transcript_id=mCT184570.0
FT                   protein_id=mCP106250.0"
FT                   /protein_id="EDL10097.1"
FT                   /translation="IQTSGLSTFPTKIPLWSSQRTKCKRATISTAARKRGKATPRIHSK
FT                   RKTKRRRGSSQMLMFCFFDINLRTHMGVFI"
FT   gene            961457..973732
FT                   /gene="0610009O20Rik"
FT                   /locus_tag="mCG_18332"
FT                   /note="gene_id=mCG18332.2"
FT   mRNA            join(961457..961619,962306..962420,962503..962620,
FT                   964039..964183,965122..965283,965494..965582,
FT                   965684..965780,968484..968626,969254..969412,
FT                   969496..969588,971117..971276,972284..972505,
FT                   972986..973732)
FT                   /gene="0610009O20Rik"
FT                   /locus_tag="mCG_18332"
FT                   /product="RIKEN cDNA 0610009O20, transcript variant
FT                   mCT174387"
FT                   /note="gene_id=mCG18332.2 transcript_id=mCT174387.0 created
FT                   on 13-JUN-2003"
FT   mRNA            join(961457..961619,962306..962420,962503..962620,
FT                   964039..964183,965122..965283,965494..965582,
FT                   965684..966776)
FT                   /gene="0610009O20Rik"
FT                   /locus_tag="mCG_18332"
FT                   /product="RIKEN cDNA 0610009O20, transcript variant
FT                   mCT12932"
FT                   /note="gene_id=mCG18332.2 transcript_id=mCT12932.2 created
FT                   on 13-JUN-2003"
FT   mRNA            join(961457..961619,962306..962420,962503..962620,
FT                   964039..964427)
FT                   /gene="0610009O20Rik"
FT                   /locus_tag="mCG_18332"
FT                   /product="RIKEN cDNA 0610009O20, transcript variant
FT                   mCT174388"
FT                   /note="gene_id=mCG18332.2 transcript_id=mCT174388.1 created
FT                   on 13-JUN-2003"
FT   mRNA            join(961457..961619,962306..962420,962503..963070)
FT                   /gene="0610009O20Rik"
FT                   /locus_tag="mCG_18332"
FT                   /product="RIKEN cDNA 0610009O20, transcript variant
FT                   mCT174386"
FT                   /note="gene_id=mCG18332.2 transcript_id=mCT174386.1 created
FT                   on 13-JUN-2003"
FT   CDS             join(961589..961619,962306..962420,962503..962620,
FT                   964039..964183,965122..965283,965494..965582,
FT                   965684..965780,968484..968626,969254..969412,
FT                   969496..969588,971117..971276,972284..972504)
FT                   /codon_start=1
FT                   /gene="0610009O20Rik"
FT                   /locus_tag="mCG_18332"
FT                   /product="RIKEN cDNA 0610009O20, isoform CRA_c"
FT                   /note="gene_id=mCG18332.2 transcript_id=mCT174387.0
FT                   protein_id=mCP97305.0 isoform=CRA_c"
FT                   /protein_id="EDL10095.1"
FT                   /translation="MWRLTGILGRALPRLLGPGFRGITPKPTSSDGSQTTSPTLPLTRL
FT                   SFDRSGSHGSKRSRDPKCCGWKDAFHWMSAHVSPNTLRDAISWGTLAVLALHLARQIHF
FT                   HAPLVAGPQPAERSWHSPLYRFLSSSWWHPHSSLRRHVLPRPDCPAPRNTGLREPRQGQ
FT                   EDHPSAPSQCLPSDSSLRSGLLNLPEEEPSDFDFLHASRDFASQAKAAEAHPPGGKNEQ
FT                   DKAKALPLEEAVTSIQQLFQLSVAITFNFLGTENIKTGDYTAAFSYFQKAADRGYSKAQ
FT                   YNVGLCLEHGRGTPRDLSKAILFYHLAAVQGHSLAQYRYARCLLQSPGSLSDPERERAV
FT                   SLLKQAADSGLTEAQAFLGVLFTKEPHLDEQRAVKYLWLAASNGDSQSRFHLGICYEKG
FT                   LGAQRNLGEAVKCYQQAAAMGNEPARERLRTLFNVEAAGPSHLATTGLKSFSSPSLCSL
FT                   NTLLAGASGLPHASSTGNLGLLCRSGHLGASHGAPSRTIPSLERSLVRLGFG"
FT   CDS             join(961589..961619,962306..962420,962503..962620,
FT                   964039..964183,965122..965283,965494..965582,
FT                   965684..965962)
FT                   /codon_start=1
FT                   /gene="0610009O20Rik"
FT                   /locus_tag="mCG_18332"
FT                   /product="RIKEN cDNA 0610009O20, isoform CRA_a"
FT                   /note="gene_id=mCG18332.2 transcript_id=mCT12932.2
FT                   protein_id=mCP8390.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q99M18"
FT                   /db_xref="MGI:MGI:1914089"
FT                   /db_xref="UniProtKB/TrEMBL:Q99M18"
FT                   /protein_id="EDL10093.1"
FT                   /translation="MWRLTGILGRALPRLLGPGFRGITPKPTSSDGSQTTSPTLPLTRL
FT                   SFDRSGSHGSKRSRDPKCCGWKDAFHWMSAHVSPNTLRDAISWGTLAVLALHLARQIHF
FT                   HAPLVAGPQPAERSWHSPLYRFLSSSWWHPHSSLRRHVLPRPDCPAPRNTGLREPRQGQ
FT                   EDHPSAPSQCLPSDSSLRSGLLNLPEEEPSDFDFLHASRDFASQAKAAEAHPPGGKNEQ
FT                   DKAKALPLEEAVTSIQQLFQLSVAITFNFLGTCFLPRGRGMRIEKGGWDAVRVESGLNE
FT                   RFLFSWVGRPDVAWWFSGVRDPSLLIKVQPI"
FT   CDS             join(961589..961619,962306..962420,962503..962620,
FT                   964039..964419)
FT                   /codon_start=1
FT                   /gene="0610009O20Rik"
FT                   /locus_tag="mCG_18332"
FT                   /product="RIKEN cDNA 0610009O20, isoform CRA_d"
FT                   /note="gene_id=mCG18332.2 transcript_id=mCT174388.1
FT                   protein_id=mCP97306.0 isoform=CRA_d"
FT                   /db_xref="GOA:Q8CBJ7"
FT                   /db_xref="MGI:MGI:1914089"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CBJ7"
FT                   /protein_id="EDL10096.1"
FT                   /translation="MWRLTGILGRALPRLLGPGFRGITPKPTSSDGSQTTSPTLPLTRL
FT                   SFDRSGSHGSKRSRDPKCCGWKDAFHWMSAHVSPNTLRDAISWGTLAVLALHLARQIHF
FT                   HAPLVAGPQPAERSWHSPLYRFLSSSWWHPHSCEFSVLKGQLGQAGSFLWARKYLWLHL
FT                   RKKAISGCLRFLSKVRGREVGKCCPHWVWALPPLSVPQCPSVTSQRGSPKT"
FT   CDS             join(961589..961619,962306..962420,962503..962641)
FT                   /codon_start=1
FT                   /gene="0610009O20Rik"
FT                   /locus_tag="mCG_18332"
FT                   /product="RIKEN cDNA 0610009O20, isoform CRA_b"
FT                   /note="gene_id=mCG18332.2 transcript_id=mCT174386.1
FT                   protein_id=mCP97307.0 isoform=CRA_b"
FT                   /protein_id="EDL10094.1"
FT                   /translation="MWRLTGILGRALPRLLGPGFRGITPKPTSSDGSQTTSPTLPLTRL
FT                   SFDRSGSHGSKRSRDPKCCGWKDAFHWMSAHVSPNTLRDAISWVRLPQA"
FT   gene            complement(978288..995311)
FT                   /gene="Pcdh12"
FT                   /locus_tag="mCG_18330"
FT                   /note="gene_id=mCG18330.2"
FT   mRNA            complement(join(978288..980388,986235..986389,
FT                   988739..988839,994987..995311))
FT                   /gene="Pcdh12"
FT                   /locus_tag="mCG_18330"
FT                   /product="protocadherin 12, transcript variant mCT174385"
FT                   /note="gene_id=mCG18330.2 transcript_id=mCT174385.0 created
FT                   on 14-MAR-2003"
FT   mRNA            complement(join(978288..980388,986235..986389,
FT                   988739..988839,992101..995267))
FT                   /gene="Pcdh12"
FT                   /locus_tag="mCG_18330"
FT                   /product="protocadherin 12, transcript variant mCT12931"
FT                   /note="gene_id=mCG18330.2 transcript_id=mCT12931.1 created
FT                   on 14-MAR-2003"
FT   CDS             complement(join(979982..980388,986235..986389,
FT                   988739..988839,992101..994980))
FT                   /codon_start=1
FT                   /gene="Pcdh12"
FT                   /locus_tag="mCG_18330"
FT                   /product="protocadherin 12, isoform CRA_a"
FT                   /note="gene_id=mCG18330.2 transcript_id=mCT12931.1
FT                   protein_id=mCP8380.1 isoform=CRA_a"
FT                   /db_xref="GOA:O55134"
FT                   /db_xref="InterPro:IPR002126"
FT                   /db_xref="InterPro:IPR013164"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR020894"
FT                   /db_xref="MGI:MGI:1855700"
FT                   /db_xref="UniProtKB/Swiss-Prot:O55134"
FT                   /protein_id="EDL10091.1"
FT                   /translation="MMLLLPFLLGLLGPGSYLFISGDCQEVATVMVKFQVTEEVPSGTV
FT                   IGKLSQELRVEERRGKAGDAFQILQLPQALPVQMNSEDGLLSTSSRLDREKLCRQEDPC
FT                   LVSFDVLATGASALIHVEIQVLDINDHQPQFPKDEQELEISESASLHTRIPLDRALDQD
FT                   TGPNSLYSYSLSPSEHFALDVIVGPDETKHAELVVVKELDRELHSYFDLVLTAYDNGNP
FT                   PKSGISVVKVNVLDSNDNSPVFAESSLALEIPEDTVPGTLLINLTATDPDQGPNGEVEF
FT                   FFGKHVSPEVMNTFGIDAKTGQIILRQALDYEKNPAYEVDVQARDLGPNSIPGHCKVLI
FT                   KVLDVNDNAPSILITWASQTSLVSEDLPRDSFIALVSANDLDSGNNGLVHCWLNQELGH
FT                   FRLKRTNGNTYMLLTNATLDREQWPIYTLTVFAQDQGPQPLSAEKELQIQVSDVNDNAP
FT                   VFEKSRYEVSTWENNPPSLHLITLKAHDADLGSNGKVSYRIKDSPVSHLVIIDFETGEV
FT                   TAQRSLDYEQMAGFEFQVIAEDRGQPQLASSISVWVSLLDANDNAPEVIQPVLSEGKAT
FT                   LSVLVNASTGHLLLPIENPSGMDPAGTGIPPKATHSPWSFLLLTIVARDADSGANGELF
FT                   YSIQSGNDAHLFFLSPSLGQLFINVTNASSLIGSQWDLGIVVEDQGSPSLQTQVSLKVV
FT                   FVTSVDHLRDSAHEPGVLSTPALALICLAVLLAIFGLLLALFVSICRTERKDNRAYNCR
FT                   EAESSYRHQPKRPQKHIQKADIHLVPVLRAHENETDEVRPSHKDTSKETLMEAGWDSCL
FT                   QAPFHLTPTLYRTLRNQGNQGELAESQEVLQDTFNFLFNHPRQRNASRENLNLPESPPA
FT                   VRQPLLRPLKVPGSPIARATGDQDKEEAPQSPPASSATLRRQRNFNGKVSPRGESGPHQ
FT                   ILRSLVRLSVAAFAERNPVEEPAGDSPPVQQISQLLSLLHQGQFQPKPNHRGNKYLAKP
FT                   GGSSRGTIPDTEGLVGLKPSGQAEPDLEEGPPSPEEDLSVKRLLEEELSSLLDPNTGLA
FT                   LDKLSPPDPAWMARLSLPLTTNYRDNLSSPDATTSEEPRTFQTFGKTVGPGPELSPTGT
FT                   RLASTFVSEMSSLLEMLLGQHTVPVEAASAALRRLSVCGRTLSLDLATSGASASEAQGR
FT                   KKAAESRLGCGRNL"
FT   CDS             complement(979982..980347)
FT                   /codon_start=1
FT                   /gene="Pcdh12"
FT                   /locus_tag="mCG_18330"
FT                   /product="protocadherin 12, isoform CRA_b"
FT                   /note="gene_id=mCG18330.2 transcript_id=mCT174385.0
FT                   protein_id=mCP97304.0 isoform=CRA_b"
FT                   /db_xref="GOA:A0JNZ2"
FT                   /db_xref="MGI:MGI:1855700"
FT                   /db_xref="UniProtKB/TrEMBL:A0JNZ2"
FT                   /protein_id="EDL10092.1"
FT                   /translation="MARLSLPLTTNYRDNLSSPDATTSEEPRTFQTFGKTVGPGPELSP
FT                   TGTRLASTFVSEMSSLLEMLLGQHTVPVEAASAALRRLSVCGRTLSLDLATSGASASEA
FT                   QGRKKAAESRLGCGRNL"
FT   gene            1007425..1028648
FT                   /gene="Rnf14"
FT                   /locus_tag="mCG_18329"
FT                   /note="gene_id=mCG18329.2"
FT   mRNA            join(1007425..1007546,1010502..1010674,1011177..1011338,
FT                   1018613..1019143,1020233..1020461,1023961..1024133,
FT                   1025422..1025552,1027274..1028648)
FT                   /gene="Rnf14"
FT                   /locus_tag="mCG_18329"
FT                   /product="ring finger protein 14, transcript variant
FT                   mCT174377"
FT                   /note="gene_id=mCG18329.2 transcript_id=mCT174377.0 created
FT                   on 14-OCT-2002"
FT   mRNA            join(1007425..1007546,1010502..1010674,1011177..1011338,
FT                   1012404..1012555,1014840..1014977)
FT                   /gene="Rnf14"
FT                   /locus_tag="mCG_18329"
FT                   /product="ring finger protein 14, transcript variant
FT                   mCT174379"
FT                   /note="gene_id=mCG18329.2 transcript_id=mCT174379.0 created
FT                   on 14-OCT-2002"
FT   mRNA            join(1007437..1007546,1010502..1010674,1011177..1011232,
FT                   1018613..1019143,1020233..1020461,1023961..1024133,
FT                   1025422..1025552,1027274..1028648)
FT                   /gene="Rnf14"
FT                   /locus_tag="mCG_18329"
FT                   /product="ring finger protein 14, transcript variant
FT                   mCT174383"
FT                   /note="gene_id=mCG18329.2 transcript_id=mCT174383.0 created
FT                   on 14-OCT-2002"
FT   mRNA            join(1007437..1007546,1010502..1010674,1011177..1011338,
FT                   1012404..1012555,1018613..1019143,1020233..1020461,
FT                   1023961..1024133,1025422..1025552,1027274..1028552)
FT                   /gene="Rnf14"
FT                   /locus_tag="mCG_18329"
FT                   /product="ring finger protein 14, transcript variant
FT                   mCT12240"
FT                   /note="gene_id=mCG18329.2 transcript_id=mCT12240.0 created
FT                   on 14-OCT-2002"
FT   mRNA            join(1007458..1007546,1008248..1008323,1010502..1010674,
FT                   1011177..1011338,1012404..1012555,1018613..1019143,
FT                   1020233..1020461,1023961..1024133,1025422..1025552,
FT                   1027274..1027935)
FT                   /gene="Rnf14"
FT                   /locus_tag="mCG_18329"
FT                   /product="ring finger protein 14, transcript variant
FT                   mCT174378"
FT                   /note="gene_id=mCG18329.2 transcript_id=mCT174378.0 created
FT                   on 14-OCT-2002"
FT   mRNA            join(1007474..1007546,1008248..1008323,1009057..1009143,
FT                   1010502..1010674,1011177..1011338,1012404..1012555,
FT                   1018613..1019143,1020233..1020461,1023961..1024133,
FT                   1025422..1025552,1027274..1028590)
FT                   /gene="Rnf14"
FT                   /locus_tag="mCG_18329"
FT                   /product="ring finger protein 14, transcript variant
FT                   mCT174381"
FT                   /note="gene_id=mCG18329.2 transcript_id=mCT174381.0 created
FT                   on 14-OCT-2002"
FT   mRNA            join(1007501..1007546,1010502..1010674,1011177..1011205,
FT                   1018842..1019143,1020233..1020461,1023961..1024133,
FT                   1025422..1025552,1027274..1028648)
FT                   /gene="Rnf14"
FT                   /locus_tag="mCG_18329"
FT                   /product="ring finger protein 14, transcript variant
FT                   mCT174384"
FT                   /note="gene_id=mCG18329.2 transcript_id=mCT174384.0 created
FT                   on 14-OCT-2002"
FT   mRNA            join(<1007553..1007953,1008248..1008323,1010502..1010674,
FT                   1011177..1011338,1012404..1012555,1018613..1019143,
FT                   1020233..1020461,1023961..1024133,1025422..1025552,
FT                   1027274..1028584)
FT                   /gene="Rnf14"
FT                   /locus_tag="mCG_18329"
FT                   /product="ring finger protein 14, transcript variant
FT                   mCT190286"
FT                   /note="gene_id=mCG18329.2 transcript_id=mCT190286.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(1007779..1007963,1008214..1008323,1009057..1009143,
FT                   1010502..1010674,1011177..1011338,1012404..1012555,
FT                   1018613..1019143,1020233..1020461,1023961..1024133,
FT                   1025422..1025552,1027274..1028648)
FT                   /gene="Rnf14"
FT                   /locus_tag="mCG_18329"
FT                   /product="ring finger protein 14, transcript variant
FT                   mCT174380"
FT                   /note="gene_id=mCG18329.2 transcript_id=mCT174380.0 created
FT                   on 14-OCT-2002"
FT   mRNA            join(1008214..1008323,1010502..1010674,1011177..1011338,
FT                   1012404..1012555,1018613..1019143,1020233..1020461,
FT                   1023961..1024133,1025422..1025552,1027274..1027642)
FT                   /gene="Rnf14"
FT                   /locus_tag="mCG_18329"
FT                   /product="ring finger protein 14, transcript variant
FT                   mCT174382"
FT                   /note="gene_id=mCG18329.2 transcript_id=mCT174382.0 created
FT                   on 14-OCT-2002"
FT   CDS             join(<1010623..1010674,1011177..1011338,1012404..1012555,
FT                   1018613..1019143,1020233..1020461,1023961..1024133,
FT                   1025422..1025552,1027274..1027361)
FT                   /codon_start=1
FT                   /gene="Rnf14"
FT                   /locus_tag="mCG_18329"
FT                   /product="ring finger protein 14, isoform CRA_c"
FT                   /note="gene_id=mCG18329.2 transcript_id=mCT190286.0
FT                   protein_id=mCP111277.0 isoform=CRA_c"
FT                   /protein_id="EDL10086.1"
FT                   /translation="NTDCSSINILFSWLLLTASSMSAEDLEAQEDELLALASIYDADEF
FT                   RKAESVQGGETRIYLDLPQNFKIFVSGNSNESLQNSGFEYTICFLPPLVLNFELPPDYP
FT                   SSSPPSFTLSGKWLSPTQLSALCKHLDNLWEEHRGRVVLFAWMQFLKEETLTYLNIVSP
FT                   FELKMGSQKKVQRRATAQASSSTELGVGGAAAADVDQEETVDERAVQDVESLSSLIQEI
FT                   LDFNQARQTKCFNSKLFLCSICFCEKLGSDCMYFLECKHVYCKACLKDYFEIQIKDGQV
FT                   KCLNCPEPQCPSVATPGQVKELVEADLFARYDRLLLQSTLDLMADVVYCPRPCCQLPVM
FT                   QEPGGTMAICSSCNFAFCTLCRLTYHGLSPCKVTAEKLIDLRNEYLQADEATKRFLEQR
FT                   YGKRVIQKALEEMESKDWLEKNSKSCPCCGTPIQKLDGCNKMTCTGCMQYFCWICMGSL
FT                   SRANPYRHFTDSESPCFNRLFHAVDINGDMWEDEIEEDDDDEDDDDD"
FT   CDS             join(1011185..1011338,1012404..1012555,1018613..1019143,
FT                   1020233..1020461,1023961..1024133,1025422..1025552,
FT                   1027274..1027361)
FT                   /codon_start=1
FT                   /gene="Rnf14"
FT                   /locus_tag="mCG_18329"
FT                   /product="ring finger protein 14, isoform CRA_a"
FT                   /note="gene_id=mCG18329.2 transcript_id=mCT174378.0
FT                   protein_id=mCP97298.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q9JI90"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR002867"
FT                   /db_xref="InterPro:IPR006575"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="MGI:MGI:1929668"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JI90"
FT                   /protein_id="EDL10081.1"
FT                   /translation="MSAEDLEAQEDELLALASIYDADEFRKAESVQGGETRIYLDLPQN
FT                   FKIFVSGNSNESLQNSGFEYTICFLPPLVLNFELPPDYPSSSPPSFTLSGKWLSPTQLS
FT                   ALCKHLDNLWEEHRGRVVLFAWMQFLKEETLTYLNIVSPFELKMGSQKKVQRRATAQAS
FT                   SSTELGVGGAAAADVDQEETVDERAVQDVESLSSLIQEILDFNQARQTKCFNSKLFLCS
FT                   ICFCEKLGSDCMYFLECKHVYCKACLKDYFEIQIKDGQVKCLNCPEPQCPSVATPGQVK
FT                   ELVEADLFARYDRLLLQSTLDLMADVVYCPRPCCQLPVMQEPGGTMAICSSCNFAFCTL
FT                   CRLTYHGLSPCKVTAEKLIDLRNEYLQADEATKRFLEQRYGKRVIQKALEEMESKDWLE
FT                   KNSKSCPCCGTPIQKLDGCNKMTCTGCMQYFCWICMGSLSRANPYRHFTDSESPCFNRL
FT                   FHAVDINGDMWEDEIEEDDDDEDDDDD"
FT   CDS             join(1011185..1011338,1012404..1012555,1018613..1019143,
FT                   1020233..1020461,1023961..1024133,1025422..1025552,
FT                   1027274..1027361)
FT                   /codon_start=1
FT                   /gene="Rnf14"
FT                   /locus_tag="mCG_18329"
FT                   /product="ring finger protein 14, isoform CRA_a"
FT                   /note="gene_id=mCG18329.2 transcript_id=mCT174380.0
FT                   protein_id=mCP97297.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q9JI90"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR002867"
FT                   /db_xref="InterPro:IPR006575"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="MGI:MGI:1929668"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JI90"
FT                   /protein_id="EDL10082.1"
FT                   /translation="MSAEDLEAQEDELLALASIYDADEFRKAESVQGGETRIYLDLPQN
FT                   FKIFVSGNSNESLQNSGFEYTICFLPPLVLNFELPPDYPSSSPPSFTLSGKWLSPTQLS
FT                   ALCKHLDNLWEEHRGRVVLFAWMQFLKEETLTYLNIVSPFELKMGSQKKVQRRATAQAS
FT                   SSTELGVGGAAAADVDQEETVDERAVQDVESLSSLIQEILDFNQARQTKCFNSKLFLCS
FT                   ICFCEKLGSDCMYFLECKHVYCKACLKDYFEIQIKDGQVKCLNCPEPQCPSVATPGQVK
FT                   ELVEADLFARYDRLLLQSTLDLMADVVYCPRPCCQLPVMQEPGGTMAICSSCNFAFCTL
FT                   CRLTYHGLSPCKVTAEKLIDLRNEYLQADEATKRFLEQRYGKRVIQKALEEMESKDWLE
FT                   KNSKSCPCCGTPIQKLDGCNKMTCTGCMQYFCWICMGSLSRANPYRHFTDSESPCFNRL
FT                   FHAVDINGDMWEDEIEEDDDDEDDDDD"
FT   CDS             join(1011185..1011338,1012404..1012555,1018613..1019143,
FT                   1020233..1020461,1023961..1024133,1025422..1025552,
FT                   1027274..1027361)
FT                   /codon_start=1
FT                   /gene="Rnf14"
FT                   /locus_tag="mCG_18329"
FT                   /product="ring finger protein 14, isoform CRA_a"
FT                   /note="gene_id=mCG18329.2 transcript_id=mCT174381.0
FT                   protein_id=mCP97303.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q9JI90"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR002867"
FT                   /db_xref="InterPro:IPR006575"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="MGI:MGI:1929668"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JI90"
FT                   /protein_id="EDL10083.1"
FT                   /translation="MSAEDLEAQEDELLALASIYDADEFRKAESVQGGETRIYLDLPQN
FT                   FKIFVSGNSNESLQNSGFEYTICFLPPLVLNFELPPDYPSSSPPSFTLSGKWLSPTQLS
FT                   ALCKHLDNLWEEHRGRVVLFAWMQFLKEETLTYLNIVSPFELKMGSQKKVQRRATAQAS
FT                   SSTELGVGGAAAADVDQEETVDERAVQDVESLSSLIQEILDFNQARQTKCFNSKLFLCS
FT                   ICFCEKLGSDCMYFLECKHVYCKACLKDYFEIQIKDGQVKCLNCPEPQCPSVATPGQVK
FT                   ELVEADLFARYDRLLLQSTLDLMADVVYCPRPCCQLPVMQEPGGTMAICSSCNFAFCTL
FT                   CRLTYHGLSPCKVTAEKLIDLRNEYLQADEATKRFLEQRYGKRVIQKALEEMESKDWLE
FT                   KNSKSCPCCGTPIQKLDGCNKMTCTGCMQYFCWICMGSLSRANPYRHFTDSESPCFNRL
FT                   FHAVDINGDMWEDEIEEDDDDEDDDDD"
FT   CDS             join(1011185..1011338,1012404..1012555,1018613..1019143,
FT                   1020233..1020461,1023961..1024133,1025422..1025552,
FT                   1027274..1027361)
FT                   /codon_start=1
FT                   /gene="Rnf14"
FT                   /locus_tag="mCG_18329"
FT                   /product="ring finger protein 14, isoform CRA_a"
FT                   /note="gene_id=mCG18329.2 transcript_id=mCT174382.0
FT                   protein_id=mCP97300.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q9JI90"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR002867"
FT                   /db_xref="InterPro:IPR006575"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="MGI:MGI:1929668"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JI90"
FT                   /protein_id="EDL10084.1"
FT                   /translation="MSAEDLEAQEDELLALASIYDADEFRKAESVQGGETRIYLDLPQN
FT                   FKIFVSGNSNESLQNSGFEYTICFLPPLVLNFELPPDYPSSSPPSFTLSGKWLSPTQLS
FT                   ALCKHLDNLWEEHRGRVVLFAWMQFLKEETLTYLNIVSPFELKMGSQKKVQRRATAQAS
FT                   SSTELGVGGAAAADVDQEETVDERAVQDVESLSSLIQEILDFNQARQTKCFNSKLFLCS
FT                   ICFCEKLGSDCMYFLECKHVYCKACLKDYFEIQIKDGQVKCLNCPEPQCPSVATPGQVK
FT                   ELVEADLFARYDRLLLQSTLDLMADVVYCPRPCCQLPVMQEPGGTMAICSSCNFAFCTL
FT                   CRLTYHGLSPCKVTAEKLIDLRNEYLQADEATKRFLEQRYGKRVIQKALEEMESKDWLE
FT                   KNSKSCPCCGTPIQKLDGCNKMTCTGCMQYFCWICMGSLSRANPYRHFTDSESPCFNRL
FT                   FHAVDINGDMWEDEIEEDDDDEDDDDD"
FT   CDS             join(1011185..1011338,1012404..1012555,1018613..1019143,
FT                   1020233..1020461,1023961..1024133,1025422..1025552,
FT                   1027274..1027361)
FT                   /codon_start=1
FT                   /gene="Rnf14"
FT                   /locus_tag="mCG_18329"
FT                   /product="ring finger protein 14, isoform CRA_a"
FT                   /note="gene_id=mCG18329.2 transcript_id=mCT12240.0
FT                   protein_id=mCP8368.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q9JI90"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR002867"
FT                   /db_xref="InterPro:IPR006575"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="MGI:MGI:1929668"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JI90"
FT                   /protein_id="EDL10087.1"
FT                   /translation="MSAEDLEAQEDELLALASIYDADEFRKAESVQGGETRIYLDLPQN
FT                   FKIFVSGNSNESLQNSGFEYTICFLPPLVLNFELPPDYPSSSPPSFTLSGKWLSPTQLS
FT                   ALCKHLDNLWEEHRGRVVLFAWMQFLKEETLTYLNIVSPFELKMGSQKKVQRRATAQAS
FT                   SSTELGVGGAAAADVDQEETVDERAVQDVESLSSLIQEILDFNQARQTKCFNSKLFLCS
FT                   ICFCEKLGSDCMYFLECKHVYCKACLKDYFEIQIKDGQVKCLNCPEPQCPSVATPGQVK
FT                   ELVEADLFARYDRLLLQSTLDLMADVVYCPRPCCQLPVMQEPGGTMAICSSCNFAFCTL
FT                   CRLTYHGLSPCKVTAEKLIDLRNEYLQADEATKRFLEQRYGKRVIQKALEEMESKDWLE
FT                   KNSKSCPCCGTPIQKLDGCNKMTCTGCMQYFCWICMGSLSRANPYRHFTDSESPCFNRL
FT                   FHAVDINGDMWEDEIEEDDDDEDDDDD"
FT   CDS             join(1011185..1011232,1018613..1019143,1020233..1020461,
FT                   1023961..1024133,1025422..1025552,1027274..1027361)
FT                   /codon_start=1
FT                   /gene="Rnf14"
FT                   /locus_tag="mCG_18329"
FT                   /product="ring finger protein 14, isoform CRA_f"
FT                   /note="gene_id=mCG18329.2 transcript_id=mCT174383.0
FT                   protein_id=mCP97299.0 isoform=CRA_f"
FT                   /protein_id="EDL10090.1"
FT                   /translation="MSAEDLEAQEDELLALLSALCKHLDNLWEEHRGRVVLFAWMQFLK
FT                   EETLTYLNIVSPFELKMGSQKKVQRRATAQASSSTELGVGGAAAADVDQEETVDERAVQ
FT                   DVESLSSLIQEILDFNQARQTKCFNSKLFLCSICFCEKLGSDCMYFLECKHVYCKACLK
FT                   DYFEIQIKDGQVKCLNCPEPQCPSVATPGQVKELVEADLFARYDRLLLQSTLDLMADVV
FT                   YCPRPCCQLPVMQEPGGTMAICSSCNFAFCTLCRLTYHGLSPCKVTAEKLIDLRNEYLQ
FT                   ADEATKRFLEQRYGKRVIQKALEEMESKDWLEKNSKSCPCCGTPIQKLDGCNKMTCTGC
FT                   MQYFCWICMGSLSRANPYRHFTDSESPCFNRLFHAVDINGDMWEDEIEEDDDDEDDDDD
FT                   "
FT   CDS             join(1011185..1011338,1012404..1012555,1014840..1014854)
FT                   /codon_start=1
FT                   /gene="Rnf14"
FT                   /locus_tag="mCG_18329"
FT                   /product="ring finger protein 14, isoform CRA_e"
FT                   /note="gene_id=mCG18329.2 transcript_id=mCT174379.0
FT                   protein_id=mCP97302.0 isoform=CRA_e"
FT                   /protein_id="EDL10089.1"
FT                   /translation="MSAEDLEAQEDELLALASIYDADEFRKAESVQGGETRIYLDLPQN
FT                   FKIFVSGNSNESLQNSGFEYTICFLPPLVLNFELPPDYPSSSPPSFTLSGKWLSPTQGT
FT                   LV"
FT   CDS             join(1018685..1019143,1020233..1020461,1023961..1024133,
FT                   1025422..1025552,1027274..1027361)
FT                   /codon_start=1
FT                   /gene="Rnf14"
FT                   /locus_tag="mCG_18329"
FT                   /product="ring finger protein 14, isoform CRA_d"
FT                   /note="gene_id=mCG18329.2 transcript_id=mCT174377.0
FT                   protein_id=mCP97301.0 isoform=CRA_d"
FT                   /db_xref="GOA:G3XA54"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR002867"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="MGI:MGI:1929668"
FT                   /db_xref="UniProtKB/TrEMBL:G3XA54"
FT                   /protein_id="EDL10088.1"
FT                   /translation="MQFLKEETLTYLNIVSPFELKMGSQKKVQRRATAQASSSTELGVG
FT                   GAAAADVDQEETVDERAVQDVESLSSLIQEILDFNQARQTKCFNSKLFLCSICFCEKLG
FT                   SDCMYFLECKHVYCKACLKDYFEIQIKDGQVKCLNCPEPQCPSVATPGQVKELVEADLF
FT                   ARYDRLLLQSTLDLMADVVYCPRPCCQLPVMQEPGGTMAICSSCNFAFCTLCRLTYHGL
FT                   SPCKVTAEKLIDLRNEYLQADEATKRFLEQRYGKRVIQKALEEMESKDWLEKNSKSCPC
FT                   CGTPIQKLDGCNKMTCTGCMQYFCWICMGSLSRANPYRHFTDSESPCFNRLFHAVDING
FT                   DMWEDEIEEDDDDEDDDDD"
FT   CDS             join(1019006..1019143,1020233..1020461,1023961..1024133,
FT                   1025422..1025552,1027274..1027361)
FT                   /codon_start=1
FT                   /gene="Rnf14"
FT                   /locus_tag="mCG_18329"
FT                   /product="ring finger protein 14, isoform CRA_b"
FT                   /note="gene_id=mCG18329.2 transcript_id=mCT174384.0
FT                   protein_id=mCP97296.0 isoform=CRA_b"
FT                   /protein_id="EDL10085.1"
FT                   /translation="MYFLECKHVYCKACLKDYFEIQIKDGQVKCLNCPEPQCPSVATPG
FT                   QVKELVEADLFARYDRLLLQSTLDLMADVVYCPRPCCQLPVMQEPGGTMAICSSCNFAF
FT                   CTLCRLTYHGLSPCKVTAEKLIDLRNEYLQADEATKRFLEQRYGKRVIQKALEEMESKD
FT                   WLEKNSKSCPCCGTPIQKLDGCNKMTCTGCMQYFCWICMGSLSRANPYRHFTDSESPCF
FT                   NRLFHAVDINGDMWEDEIEEDDDDEDDDDD"
FT   gene            complement(1038325..1049718)
FT                   /gene="Gnpda1"
FT                   /locus_tag="mCG_18341"
FT                   /note="gene_id=mCG18341.1"
FT   mRNA            complement(join(1038325..1039740,1041253..1041427,
FT                   1042735..1042919,1043921..1044103,1045783..1045884,
FT                   1048858..1048989,1049675..1049718))
FT                   /gene="Gnpda1"
FT                   /locus_tag="mCG_18341"
FT                   /product="glucosamine-6-phosphate deaminase 1, transcript
FT                   variant mCT11744"
FT                   /note="gene_id=mCG18341.1 transcript_id=mCT11744.1 created
FT                   on 14-OCT-2002"
FT   mRNA            complement(join(1039301..1039740,1042735..1042919,
FT                   1043921..1044103,1045783..1045884,1048858..1048989,
FT                   1049675..1049701))
FT                   /gene="Gnpda1"
FT                   /locus_tag="mCG_18341"
FT                   /product="glucosamine-6-phosphate deaminase 1, transcript
FT                   variant mCT174400"
FT                   /note="gene_id=mCG18341.1 transcript_id=mCT174400.0 created
FT                   on 14-OCT-2002"
FT   CDS             complement(join(1039640..1039740,1041253..1041427,
FT                   1042735..1042919,1043921..1044103,1045783..1045884,
FT                   1048858..1048981))
FT                   /codon_start=1
FT                   /gene="Gnpda1"
FT                   /locus_tag="mCG_18341"
FT                   /product="glucosamine-6-phosphate deaminase 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG18341.1 transcript_id=mCT11744.1
FT                   protein_id=mCP8367.1 isoform=CRA_a"
FT                   /db_xref="GOA:O88958"
FT                   /db_xref="InterPro:IPR004547"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="InterPro:IPR018321"
FT                   /db_xref="MGI:MGI:1347054"
FT                   /db_xref="UniProtKB/Swiss-Prot:O88958"
FT                   /protein_id="EDL10078.1"
FT                   /translation="MKLIILEHYSQASEWAAKYIRNRIIQFNPGPDKYFTLGLPTGSTP
FT                   LGCYQKLIEYYKNGDLSFQYVKTFNMDEYVGLPRDHPESYHSFMWNNFFKHIDIHPENT
FT                   HILDGNAADLQAECDAFEEKIQAAGGIELFVGGIGPDGHIAFNEPGSSLVSRTRVKTLA
FT                   MDTILANARFFDGDLAKVPTMALTVGVGTVMDAKEVMILITGAHKAFALYKAIEEGVNH
FT                   MWTVSAFQQHPRTVFVCDEDATLELKVKTVKYFKGLMLVHNKLVDPLYSIKEKEIQKSQ
FT                   SAKKPYSD"
FT   CDS             complement(join(1039735..1039740,1042735..1042919,
FT                   1043921..1044103,1045783..1045884,1048858..1048981))
FT                   /codon_start=1
FT                   /gene="Gnpda1"
FT                   /locus_tag="mCG_18341"
FT                   /product="glucosamine-6-phosphate deaminase 1, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG18341.1 transcript_id=mCT174400.0
FT                   protein_id=mCP97319.0 isoform=CRA_c"
FT                   /protein_id="EDL10080.1"
FT                   /translation="MKLIILEHYSQASEWAAKYIRNRIIQFNPGPDKYFTLGLPTGSTP
FT                   LGCYQKLIEYYKNGDLSFQYVKTFNMDEYVGLPRDHPESYHSFMWNNFFKHIDIHPENT
FT                   HILDGNAADLQAECDAFEEKIQAAGGIELFVGGIGPDGHIAFNEPGSSLVSRTRVKTLA
FT                   MDTILANARFFDGDLAKVPTMALTVGVGTVMDAKEV"
FT   mRNA            complement(join(1043806..1044103,1045783..1045884,
FT                   1048858..1048989,1049675..1049701))
FT                   /gene="Gnpda1"
FT                   /locus_tag="mCG_18341"
FT                   /product="glucosamine-6-phosphate deaminase 1, transcript
FT                   variant mCT174399"
FT                   /note="gene_id=mCG18341.1 transcript_id=mCT174399.0 created
FT                   on 14-OCT-2002"
FT   CDS             complement(join(1043871..1044103,1045783..1045884,
FT                   1048858..1048981))
FT                   /codon_start=1
FT                   /gene="Gnpda1"
FT                   /locus_tag="mCG_18341"
FT                   /product="glucosamine-6-phosphate deaminase 1, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG18341.1 transcript_id=mCT174399.0
FT                   protein_id=mCP97318.0 isoform=CRA_b"
FT                   /protein_id="EDL10079.1"
FT                   /translation="MKLIILEHYSQASEWAAKYIRNRIIQFNPGPDKYFTLGLPTGSTP
FT                   LGCYQKLIEYYKNGDLSFQYVKTFNMDEYVGLPRDHPESYHSFMWNNFFKHIDIHPENT
FT                   HILDGNAADLQAECDAFEEKIQAAGGIELFVGGKHGTFHGVYPGPCLE"
FT   gene            complement(1070175..1071478)
FT                   /pseudo
FT                   /locus_tag="mCG_50627"
FT                   /note="gene_id=mCG50627.2"
FT   mRNA            complement(1070175..1071478)
FT                   /pseudo
FT                   /locus_tag="mCG_50627"
FT                   /note="gene_id=mCG50627.2 transcript_id=mCT50810.2 created
FT                   on 16-OCT-2002"
FT   gene            <1128333..1174473
FT                   /locus_tag="mCG_18343"
FT                   /note="gene_id=mCG18343.2"
FT   mRNA            join(<1128333..1128445,1152186..1152273,1156960..1157090,
FT                   1160824..1160911,1161574..1161698,1165324..1165390,
FT                   1169814..1169919,1173531..1174109)
FT                   /locus_tag="mCG_18343"
FT                   /product="mCG18343, transcript variant mCT190283"
FT                   /note="gene_id=mCG18343.2 transcript_id=mCT190283.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(<1128333..1128445,1152186..1152215,1173634..1173954)
FT                   /locus_tag="mCG_18343"
FT                   /product="mCG18343, transcript variant mCT174401"
FT                   /note="gene_id=mCG18343.2 transcript_id=mCT174401.0 created
FT                   on 10-FEB-2003"
FT   CDS             join(<1128333..1128445,1152186..1152215,1173634..1173652)
FT                   /codon_start=1
FT                   /locus_tag="mCG_18343"
FT                   /product="mCG18343, isoform CRA_b"
FT                   /note="gene_id=mCG18343.2 transcript_id=mCT174401.0
FT                   protein_id=mCP97320.0 isoform=CRA_b"
FT                   /protein_id="EDL10074.1"
FT                   /translation="RPISSLARPPSLRPAAPWPWRWRRWRPWSRPAAAGTSSCRMKRSL
FT                   GNLNSHLL"
FT   mRNA            join(<1128333..1128445,1152186..1152273,1156960..1157090,
FT                   1160824..1160911,1165324..1165399)
FT                   /locus_tag="mCG_18343"
FT                   /product="mCG18343, transcript variant mCT179955"
FT                   /note="gene_id=mCG18343.2 transcript_id=mCT179955.0 created
FT                   on 10-FEB-2003"
FT   mRNA            join(<1128334..1128445,1152186..1152273,1156960..1157090,
FT                   1160824..1160911,1161574..1161698,1165324..1165390,
FT                   1169814..1169919,1173547..1174473)
FT                   /locus_tag="mCG_18343"
FT                   /product="mCG18343, transcript variant mCT12974"
FT                   /note="gene_id=mCG18343.2 transcript_id=mCT12974.2 created
FT                   on 10-FEB-2003"
FT   CDS             join(<1128335..1128445,1152186..1152273,1156960..1157090,
FT                   1160824..1160911,1161574..1161698,1165324..1165390,
FT                   1169814..1169917)
FT                   /codon_start=1
FT                   /locus_tag="mCG_18343"
FT                   /product="mCG18343, isoform CRA_a"
FT                   /note="gene_id=mCG18343.2 transcript_id=mCT12974.2
FT                   protein_id=mCP8384.2 isoform=CRA_a"
FT                   /protein_id="EDL10073.1"
FT                   /translation="PDQLSRSPSFPEARCAMALALAALAAVEPACGSGYQQLQNEEEPG
FT                   EPEQTAGDAPPPYSSITAESAAYFDYKDESGFPKPPSYNVATTLPSYDEAERTKTEATI
FT                   PLVPGRDEDFVGRDDFDDTDQLRIGNDGIFMLTFFMAFLFNWIGFFLSFCLTTSAAGRY
FT                   GAISGFGLSLIKWILIVRFSTYFPGYFDGQYWLWWVFLVLGFLLFLRGFINYAKVRKMP
FT                   ETFSNLPRTRVLFIY"
FT   CDS             join(<1128335..1128445,1152186..1152273,1156960..1157090,
FT                   1160824..1160911,1161574..1161698,1165324..1165390,
FT                   1169814..1169917)
FT                   /codon_start=1
FT                   /locus_tag="mCG_18343"
FT                   /product="mCG18343, isoform CRA_a"
FT                   /note="gene_id=mCG18343.2 transcript_id=mCT190283.0
FT                   protein_id=mCP111280.0 isoform=CRA_a"
FT                   /protein_id="EDL10076.1"
FT                   /translation="PDQLSRSPSFPEARCAMALALAALAAVEPACGSGYQQLQNEEEPG
FT                   EPEQTAGDAPPPYSSITAESAAYFDYKDESGFPKPPSYNVATTLPSYDEAERTKTEATI
FT                   PLVPGRDEDFVGRDDFDDTDQLRIGNDGIFMLTFFMAFLFNWIGFFLSFCLTTSAAGRY
FT                   GAISGFGLSLIKWILIVRFSTYFPGYFDGQYWLWWVFLVLGFLLFLRGFINYAKVRKMP
FT                   ETFSNLPRTRVLFIY"
FT   CDS             join(<1128335..1128445,1152186..1152273,1156960..1157090,
FT                   1160824..1160911,1165324..1165352)
FT                   /codon_start=1
FT                   /locus_tag="mCG_18343"
FT                   /product="mCG18343, isoform CRA_d"
FT                   /note="gene_id=mCG18343.2 transcript_id=mCT179955.0
FT                   protein_id=mCP102877.0 isoform=CRA_d"
FT                   /protein_id="EDL10077.1"
FT                   /translation="PDQLSRSPSFPEARCAMALALAALAAVEPACGSGYQQLQNEEEPG
FT                   EPEQTAGDAPPPYSSITAESAAYFDYKDESGFPKPPSYNVATTLPSYDEAERTKTEATI
FT                   PLVPGRDEDFVGRDDFDDTDQLRIGNDGIFMLTFFIFHLFPWIL"
FT   mRNA            join(<1132361..1132377,1161609..1161698,1165324..1165390,
FT                   1169814..1169919,1173547..1174024)
FT                   /locus_tag="mCG_18343"
FT                   /product="mCG18343, transcript variant mCT174402"
FT                   /note="gene_id=mCG18343.2 transcript_id=mCT174402.0 created
FT                   on 10-FEB-2003"
FT   CDS             join(<1132366..1132377,1161609..1161698,1165324..1165390,
FT                   1169814..1169917)
FT                   /codon_start=1
FT                   /locus_tag="mCG_18343"
FT                   /product="mCG18343, isoform CRA_c"
FT                   /note="gene_id=mCG18343.2 transcript_id=mCT174402.0
FT                   protein_id=mCP97321.0 isoform=CRA_c"
FT                   /protein_id="EDL10075.1"
FT                   /translation="AFFFSFCLTTSAAGRYGAISGFGLSLIKWILIVRFSTYFPGYFDG
FT                   QYWLWWVFLVLGFLLFLRGFINYAKVRKMPETFSNLPRTRVLFIY"
FT   gene            complement(1295766..1310894)
FT                   /gene="Spry4"
FT                   /locus_tag="mCG_18339"
FT                   /note="gene_id=mCG18339.2"
FT   mRNA            complement(join(1295766..1300241,1310645..1310894))
FT                   /gene="Spry4"
FT                   /locus_tag="mCG_18339"
FT                   /product="sprouty homolog 4 (Drosophila)"
FT                   /note="gene_id=mCG18339.2 transcript_id=mCT12417.1 created
FT                   on 14-OCT-2002"
FT   CDS             complement(1299292..1300194)
FT                   /codon_start=1
FT                   /gene="Spry4"
FT                   /locus_tag="mCG_18339"
FT                   /product="sprouty homolog 4 (Drosophila)"
FT                   /note="gene_id=mCG18339.2 transcript_id=mCT12417.1
FT                   protein_id=mCP8353.1"
FT                   /db_xref="GOA:Q9WTP2"
FT                   /db_xref="InterPro:IPR007875"
FT                   /db_xref="MGI:MGI:1345144"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9WTP2"
FT                   /protein_id="EDL10072.1"
FT                   /translation="MEPPVPQSSVPVNPSSVMVQPLLDSRAPHSRLQHPLTILPIDQMK
FT                   TSHVENDYIDNPSLAPATGPKRPRGGPPELAPTPARCDQDITHHWISFSGRPSSVSSSS
FT                   STSSDQRLLDHMAPPPVAEQASPRAVRLQPKVVHCKPLDLKGPTAPPELDKHFLLCEAC
FT                   GKCKCKECASPRTLPSCWVCNQECLCSAQTLVNYGTCMCLVQGIFYHCTNEDDEGSCAD
FT                   HPCSCSGSNCCARWSFMGALSVVLPCLLCYLPATGCVKLAQRGYDRLRRPGCRCKHTNS
FT                   VICKAASGDTKTSRSDKPF"
FT   gene            1428977..1509803
FT                   /pseudo
FT                   /locus_tag="mCG_49017"
FT                   /note="gene_id=mCG49017.2"
FT   mRNA            join(1428977..1429416,1509770..1509803)
FT                   /pseudo
FT                   /locus_tag="mCG_49017"
FT                   /note="gene_id=mCG49017.2 transcript_id=mCT49200.1 created
FT                   on 10-MAR-2003"
FT   gene            complement(1554220..1643466)
FT                   /gene="Fgf1"
FT                   /locus_tag="mCG_18337"
FT                   /note="gene_id=mCG18337.3"
FT   mRNA            complement(join(1554220..1557195,1562121..1562224,
FT                   1569195..1569284,1572787..1572989,1643325..1643466))
FT                   /gene="Fgf1"
FT                   /locus_tag="mCG_18337"
FT                   /product="fibroblast growth factor 1, transcript variant
FT                   mCT181042"
FT                   /note="gene_id=mCG18337.3 transcript_id=mCT181042.1 created
FT                   on 13-JUN-2003"
FT   mRNA            complement(join(1554220..1557195,1562121..1562224,
FT                   1572787..1572989,1632623..1632773,1643165..1643412))
FT                   /gene="Fgf1"
FT                   /locus_tag="mCG_18337"
FT                   /product="fibroblast growth factor 1, transcript variant
FT                   mCT174393"
FT                   /note="gene_id=mCG18337.3 transcript_id=mCT174393.1 created
FT                   on 13-JUN-2003"
FT   mRNA            complement(join(1554220..1557195,1562121..1562224,
FT                   1572787..1572989,1632623..1632849))
FT                   /gene="Fgf1"
FT                   /locus_tag="mCG_18337"
FT                   /product="fibroblast growth factor 1, transcript variant
FT                   mCT12973"
FT                   /note="gene_id=mCG18337.3 transcript_id=mCT12973.3 created
FT                   on 13-JUN-2003"
FT   mRNA            complement(join(1554220..1554546,1554582..1557195,
FT                   1562121..1562224,1572787..1572989,1632623..>1632776))
FT                   /gene="Fgf1"
FT                   /locus_tag="mCG_18337"
FT                   /product="fibroblast growth factor 1, transcript variant
FT                   mCT190265"
FT                   /note="gene_id=mCG18337.3 transcript_id=mCT190265.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(1554220..1557195,1562121..1562224,
FT                   1572787..1572989,1580932..1581063))
FT                   /gene="Fgf1"
FT                   /locus_tag="mCG_18337"
FT                   /product="fibroblast growth factor 1, transcript variant
FT                   mCT181041"
FT                   /note="gene_id=mCG18337.3 transcript_id=mCT181041.1 created
FT                   on 13-JUN-2003"
FT   mRNA            complement(join(1554220..1557195,1562121..1562224,
FT                   1572787..1572989,1580648..1580799))
FT                   /gene="Fgf1"
FT                   /locus_tag="mCG_18337"
FT                   /product="fibroblast growth factor 1, transcript variant
FT                   mCT174394"
FT                   /note="gene_id=mCG18337.3 transcript_id=mCT174394.1 created
FT                   on 13-JUN-2003"
FT   CDS             complement(join(1557001..1557195,1562121..1562224,
FT                   1572787..1572989,1632623..>1632756))
FT                   /codon_start=1
FT                   /gene="Fgf1"
FT                   /locus_tag="mCG_18337"
FT                   /product="fibroblast growth factor 1, isoform CRA_c"
FT                   /note="gene_id=mCG18337.3 transcript_id=mCT190265.0
FT                   protein_id=mCP111278.0 isoform=CRA_c"
FT                   /protein_id="EDL10070.1"
FT                   /translation="GSESRLERQLQPRHPVTAQRLPSGLHSRLVIKWSEESPPACQFFS
FT                   AEPTTAACCRAMAEGEITTFAALTERFNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDG
FT                   TRDRSDQHIQLQLSAESAGEVYIKGTETGQYLAMDTEGLLYGSQTPNEECLFLERLEEN
FT                   HYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD"
FT   CDS             complement(join(1557001..1557195,1562121..1562224,
FT                   1572787..1572955))
FT                   /codon_start=1
FT                   /gene="Fgf1"
FT                   /locus_tag="mCG_18337"
FT                   /product="fibroblast growth factor 1, isoform CRA_a"
FT                   /note="gene_id=mCG18337.3 transcript_id=mCT12973.3
FT                   protein_id=mCP8351.3 isoform=CRA_a partial"
FT                   /db_xref="GOA:Q6ZWS1"
FT                   /db_xref="InterPro:IPR002209"
FT                   /db_xref="InterPro:IPR008996"
FT                   /db_xref="InterPro:IPR028142"
FT                   /db_xref="InterPro:IPR028210"
FT                   /db_xref="MGI:MGI:95515"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ZWS1"
FT                   /protein_id="EDL10065.1"
FT                   /translation="MAEGEITTFAALTERFNLPLGNYKKPKLLYCSNGGHFLRILPDGT
FT                   VDGTRDRSDQHIQLQLSAESAGEVYIKGTETGQYLAMDTEGLLYGSQTPNEECLFLERL
FT                   EENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD"
FT   CDS             complement(join(1557001..1557195,1562121..1562224,
FT                   1572787..1572955))
FT                   /codon_start=1
FT                   /gene="Fgf1"
FT                   /locus_tag="mCG_18337"
FT                   /product="fibroblast growth factor 1, isoform CRA_a"
FT                   /note="gene_id=mCG18337.3 transcript_id=mCT174393.1
FT                   protein_id=mCP97313.1 isoform=CRA_a partial"
FT                   /db_xref="GOA:Q6ZWS1"
FT                   /db_xref="InterPro:IPR002209"
FT                   /db_xref="InterPro:IPR008996"
FT                   /db_xref="InterPro:IPR028142"
FT                   /db_xref="InterPro:IPR028210"
FT                   /db_xref="MGI:MGI:95515"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ZWS1"
FT                   /protein_id="EDL10066.1"
FT                   /translation="MAEGEITTFAALTERFNLPLGNYKKPKLLYCSNGGHFLRILPDGT
FT                   VDGTRDRSDQHIQLQLSAESAGEVYIKGTETGQYLAMDTEGLLYGSQTPNEECLFLERL
FT                   EENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD"
FT   CDS             complement(join(1557001..1557195,1562121..1562224,
FT                   1572787..1572955))
FT                   /codon_start=1
FT                   /gene="Fgf1"
FT                   /locus_tag="mCG_18337"
FT                   /product="fibroblast growth factor 1, isoform CRA_a"
FT                   /note="gene_id=mCG18337.3 transcript_id=mCT174394.1
FT                   protein_id=mCP97312.1 isoform=CRA_a partial"
FT                   /db_xref="GOA:Q6ZWS1"
FT                   /db_xref="InterPro:IPR002209"
FT                   /db_xref="InterPro:IPR008996"
FT                   /db_xref="InterPro:IPR028142"
FT                   /db_xref="InterPro:IPR028210"
FT                   /db_xref="MGI:MGI:95515"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ZWS1"
FT                   /protein_id="EDL10067.1"
FT                   /translation="MAEGEITTFAALTERFNLPLGNYKKPKLLYCSNGGHFLRILPDGT
FT                   VDGTRDRSDQHIQLQLSAESAGEVYIKGTETGQYLAMDTEGLLYGSQTPNEECLFLERL
FT                   EENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD"
FT   CDS             complement(join(1557001..1557195,1562121..1562224,
FT                   1572787..1572955))
FT                   /codon_start=1
FT                   /gene="Fgf1"
FT                   /locus_tag="mCG_18337"
FT                   /product="fibroblast growth factor 1, isoform CRA_a"
FT                   /note="gene_id=mCG18337.3 transcript_id=mCT181041.1
FT                   protein_id=mCP103965.1 isoform=CRA_a partial"
FT                   /db_xref="GOA:Q6ZWS1"
FT                   /db_xref="InterPro:IPR002209"
FT                   /db_xref="InterPro:IPR008996"
FT                   /db_xref="InterPro:IPR028142"
FT                   /db_xref="InterPro:IPR028210"
FT                   /db_xref="MGI:MGI:95515"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ZWS1"
FT                   /protein_id="EDL10068.1"
FT                   /translation="MAEGEITTFAALTERFNLPLGNYKKPKLLYCSNGGHFLRILPDGT
FT                   VDGTRDRSDQHIQLQLSAESAGEVYIKGTETGQYLAMDTEGLLYGSQTPNEECLFLERL
FT                   EENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD"
FT   mRNA            complement(join(1562121..1562219,1572780..1572989,
FT                   1643165..1643412))
FT                   /gene="Fgf1"
FT                   /locus_tag="mCG_18337"
FT                   /product="fibroblast growth factor 1, transcript variant
FT                   mCT181043"
FT                   /note="gene_id=mCG18337.3 transcript_id=mCT181043.1 created
FT                   on 13-JUN-2003"
FT   CDS             complement(join(1562180..1562219,1572780..1572955))
FT                   /codon_start=1
FT                   /gene="Fgf1"
FT                   /locus_tag="mCG_18337"
FT                   /product="fibroblast growth factor 1, isoform CRA_b"
FT                   /note="gene_id=mCG18337.3 transcript_id=mCT181043.1
FT                   protein_id=mCP103964.1 isoform=CRA_b"
FT                   /protein_id="EDL10069.1"
FT                   /translation="MAEGEITTFAALTERFNLPLGNYKKPKLLYCSNGGHFLRILPDGT
FT                   VDGTRDRSDQHSKHCSSVRKVRAKCI"
FT   CDS             complement(join(1569217..1569284,1572787..1572955))
FT                   /codon_start=1
FT                   /gene="Fgf1"
FT                   /locus_tag="mCG_18337"
FT                   /product="fibroblast growth factor 1, isoform CRA_d"
FT                   /note="gene_id=mCG18337.3 transcript_id=mCT181042.1
FT                   protein_id=mCP103963.1 isoform=CRA_d"
FT                   /db_xref="GOA:D6RCX9"
FT                   /db_xref="InterPro:IPR002209"
FT                   /db_xref="InterPro:IPR008996"
FT                   /db_xref="InterPro:IPR028210"
FT                   /db_xref="MGI:MGI:95515"
FT                   /db_xref="UniProtKB/TrEMBL:D6RCX9"
FT                   /protein_id="EDL10071.1"
FT                   /translation="MAEGEITTFAALTERFNLPLGNYKKPKLLYCSNGGHFLRILPDGT
FT                   VDGTRDRSDQHRPPEYKDSGSLCSALQLLCPAY"
FT   gene            complement(1665854..1666459)
FT                   /locus_tag="mCG_13633"
FT                   /note="gene_id=mCG13633.0"
FT   mRNA            complement(1665854..1666459)
FT                   /locus_tag="mCG_13633"
FT                   /product="mCG13633"
FT                   /note="gene_id=mCG13633.0 transcript_id=mCT16038.0 created
FT                   on 14-OCT-2002"
FT   CDS             complement(1666083..1666391)
FT                   /codon_start=1
FT                   /locus_tag="mCG_13633"
FT                   /product="mCG13633"
FT                   /note="gene_id=mCG13633.0 transcript_id=mCT16038.0
FT                   protein_id=mCP12698.1"
FT                   /protein_id="EDL10064.1"
FT                   /translation="MGSKMASATRVVQVVKPHAPLIKFPSRRDKPKLSASEALGSAVLP
FT                   SHSSAISQHSKGSTSPDLLMHQGPPDTAEIIKSLPQKYRRKPMSQEEMEFIQRGGPE"
FT   gene            1709706..2087271
FT                   /gene="Arhgap26"
FT                   /locus_tag="mCG_13636"
FT                   /note="gene_id=mCG13636.2"
FT   mRNA            join(1709706..1710184,1814211..1814306,1816153..1816214,
FT                   1818751..1818822,1827012..1827113,1828358..1828468,
FT                   1836736..1836840,1838391..1838520,1843441..1843541,
FT                   1848657..1848751,1866650..1866728,1922003..1922039,
FT                   1944064..1944129,1946591..1946665,1960240..1960327,
FT                   1961923..1961981,1963459..1963564,2003530..2003689,
FT                   2013806..2013944,2023727..2023877,2077768..2077878,
FT                   2078014..2078043,2083322..2083413,2087082..2087271)
FT                   /gene="Arhgap26"
FT                   /locus_tag="mCG_13636"
FT                   /product="Rho GTPase activating protein 26"
FT                   /note="gene_id=mCG13636.2 transcript_id=mCT16287.2 created
FT                   on 14-OCT-2002"
FT   CDS             join(1710031..1710184,1814211..1814306,1816153..1816214,
FT                   1818751..1818822,1827012..1827113,1828358..1828468,
FT                   1836736..1836840,1838391..1838520,1843441..1843541,
FT                   1848657..1848751,1866650..1866728,1922003..1922039,
FT                   1944064..1944129,1946591..1946665,1960240..1960327,
FT                   1961923..1961981,1963459..1963564,2003530..2003689,
FT                   2013806..2013944,2023727..2023877,2077768..2077878,
FT                   2078014..2078043,2083322..2083413,2087082..2087146)
FT                   /codon_start=1
FT                   /gene="Arhgap26"
FT                   /locus_tag="mCG_13636"
FT                   /product="Rho GTPase activating protein 26"
FT                   /note="gene_id=mCG13636.2 transcript_id=mCT16287.2
FT                   protein_id=mCP12701.1"
FT                   /protein_id="EDL10063.1"
FT                   /translation="MGLPALEFSDCCLDSPHFRETLKSHEAELDKTNKFIKELIKDGKS
FT                   LISALKNLSSAKRKFADSLNEFKFQCIGDAETDDEMCIARSLQEFAAVLRNLEDERSRM
FT                   IENASEVLITPLEKFRKEQIGAAREAKKKYDKETEKYCGTLEKHLNLSSKKKESQLQEA
FT                   DSQVDLVRQHFYEVSLEYVFKVQEVQERKMFEFVEPLLAFLQGLFTFYHHGYELAKDFG
FT                   DFKTQLTISIQNTRNRFEGTRSEVESLMKKMKENPLEHKTISPYTMEGYLYVQEKRHFG
FT                   TSWVKHYCTYQRDSKQITMVPFDQKSGGKGGEDESVTLKSCTRRKTDSIEKRFCFDVEA
FT                   VDRPGVITMQALSEEDRRLWMEAMDGREPVYNSNRDSQSEGTAQLDSIGFSIIRKCIHA
FT                   VETRGINEQGLYRIVGVNSRVQKLLSVLMDPKAASETETDICAEWEIKTVTSALKTYLR
FT                   MLPGPLMMYQFQRSFIKAAKLENQETRVSEIHSLVHRLPEKNRQMLQLLMNHLANVANN
FT                   HKQNLMTVANLGVVFGPTLLRPQEETVAAIMDIKFQNIVIEILIENHEKIFNTVPDVPL
FT                   TNAQLHLSRKKSSDSKPPSCSERPLTLFHAVPSTEKQEQRNSIINSSLESVSSSANSIL
FT                   NSSSSLQPNLNSSDSNLDVVKPSRPSSLPPNPSPTSPLSPSWPMFSAPSSPMPTSSTSS
FT                   DSSPIRPEEAVREDSSTPFRKAKALYACQAEHDSELSFTAGTVFDNDSMGDPVSRNKVE
FT                   SDQGRHQY"
FT   gene            complement(2128294..2208330)
FT                   /gene="Nr3c1"
FT                   /locus_tag="mCG_13634"
FT                   /note="gene_id=mCG13634.2"
FT   mRNA            complement(join(2128294..2132367,2133429..2133586,
FT                   2138302..2138432,2139133..2139277,2140214..2140489,
FT                   2142109..2142225,2146326..2146489,2203679..2204899,
FT                   2208222..2208330))
FT                   /gene="Nr3c1"
FT                   /locus_tag="mCG_13634"
FT                   /product="nuclear receptor subfamily 3, group C, member 1,
FT                   transcript variant mCT16039"
FT                   /note="gene_id=mCG13634.2 transcript_id=mCT16039.1 created
FT                   on 14-OCT-2002"
FT   CDS             complement(join(2132215..2132367,2133429..2133586,
FT                   2138302..2138432,2139133..2139277,2140214..2140489,
FT                   2142109..2142225,2146326..2146489,2203679..2204886))
FT                   /codon_start=1
FT                   /gene="Nr3c1"
FT                   /locus_tag="mCG_13634"
FT                   /product="nuclear receptor subfamily 3, group C, member 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG13634.2 transcript_id=mCT16039.1
FT                   protein_id=mCP12699.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q3U2M7"
FT                   /db_xref="InterPro:IPR000536"
FT                   /db_xref="InterPro:IPR001409"
FT                   /db_xref="InterPro:IPR001628"
FT                   /db_xref="InterPro:IPR001723"
FT                   /db_xref="InterPro:IPR008946"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="MGI:MGI:95824"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U2M7"
FT                   /protein_id="EDL10061.1"
FT                   /translation="MDSKESLAPPGRDEVPSSLLGRGRGSVMDLYKTLRGGATVKVSAS
FT                   SPSVAAASQADSKQQRILLDFSKGSASNAQQQQQQQQPQPDLSKAVSLSMGLYMGETET
FT                   KVMGNDLGYPQQGQLGLSSGETDFRLLEESIANLNRSTSRPENPKSSTPAAGCATPTEK
FT                   EFPQTHSDPSSEQQNRKSQPGTNGGSVKLYTTDQSTFDILQDLEFSAGSPGKETNESPW
FT                   RSDLLIDENLLSPLAGEDDPFLLEGDVNEDCKPLILPDTKPKIQDTGDTILSSPSSVAL
FT                   PQVKTEKDDFIELCTPGVIKQEKLGPVYCQASFSGTNIIGNKMSAISVHGVSTSGGQMY
FT                   HYDMNTASLSQQQDQKPVFNVIPPIPVGSENWNRCQGSGEDNLTSLGAMNFAGRSVFSN
FT                   GYSSPGMRPDVSSPPSSSSTATGPPPKLCLVCSDEASGCHYGVLTCGSCKVFFKRAVEG
FT                   QHNYLCAGRNDCIIDKIRRKNCPACRYRKCLQAGMNLEARKTKKKIKGIQQATAGVSQD
FT                   TSENANKTIVPAALPQLTPTLVSLLEVIEPEVLYAGYDSSVPDSAWRIMTTLNMLGGRQ
FT                   VIAAVKWAKAIPGFRNLHLDDQMTLLQYSWMFLMAFALGWRSYRQASGNLLCFAPDLII
FT                   NEQRMTLPCMYDQCKHMLFISTELQRLQVSYEEYLCMKTLLLLSSVPKEGLKSQELFDE
FT                   IRMTYIKELGKAIVKREGNSSQNWQRFYQLTKLLDSMHDVVENLLSYCFQTFLDKSMSI
FT                   EFPEMLAEIITNQIPKYSNGNIKKLLFHQK"
FT   mRNA            complement(join(<2132302..2132367,2133429..2133586,
FT                   2138302..2138432,2139133..2139277,2140214..2140489,
FT                   2142109..2142225,2146323..2146489,2203679..>2204886))
FT                   /gene="Nr3c1"
FT                   /locus_tag="mCG_13634"
FT                   /product="nuclear receptor subfamily 3, group C, member 1,
FT                   transcript variant mCT190276"
FT                   /note="gene_id=mCG13634.2 transcript_id=mCT190276.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(<2132302..2132367,2133429..2133586,
FT                   2138302..2138432,2139133..2139277,2140214..2140489,
FT                   2142109..2142225,2146323..2146489,2203679..2204886))
FT                   /codon_start=1
FT                   /gene="Nr3c1"
FT                   /locus_tag="mCG_13634"
FT                   /product="nuclear receptor subfamily 3, group C, member 1,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG13634.2 transcript_id=mCT190276.0
FT                   protein_id=mCP111266.0 isoform=CRA_b"
FT                   /protein_id="EDL10062.1"
FT                   /translation="MDSKESLAPPGRDEVPSSLLGRGRGSVMDLYKTLRGGATVKVSAS
FT                   SPSVAAASQADSKQQRILLDFSKGSASNAQQQQQQQQPQPDLSKAVSLSMGLYMGETET
FT                   KVMGNDLGYPQQGQLGLSSGETDFRLLEESIANLNRSTSRPENPKSSTPAAGCATPTEK
FT                   EFPQTHSDPSSEQQNRKSQPGTNGGSVKLYTTDQSTFDILQDLEFSAGSPGKETNESPW
FT                   RSDLLIDENLLSPLAGEDDPFLLEGDVNEDCKPLILPDTKPKIQDTGDTILSSPSSVAL
FT                   PQVKTEKDDFIELCTPGVIKQEKLGPVYCQASFSGTNIIGNKMSAISVHGVSTSGGQMY
FT                   HYDMNTASLSQQQDQKPVFNVIPPIPVGSENWNRCQGSGEDNLTSLGAMNFAGRSVFSN
FT                   GYSSPGMRPDVSSPPSSSSTATGPPPKLCLVCSDEASGCHYGVLTCGSCKVFFKRAVEG
FT                   RQHNYLCAGRNDCIIDKIRRKNCPACRYRKCLQAGMNLEARKTKKKIKGIQQATAGVSQ
FT                   DTSENANKTIVPAALPQLTPTLVSLLEVIEPEVLYAGYDSSVPDSAWRIMTTLNMLGGR
FT                   QVIAAVKWAKAIPGFRNLHLDDQMTLLQYSWMFLMAFALGWRSYRQASGNLLCFAPDLI
FT                   INEQRMTLPCMYDQCKHMLFISTELQRLQVSYEEYLCMKTLLLLSSVPKEGLKSQELFD
FT                   EIRMTYIKELGKAIVKREGNSSQNWQRFYQLTKLLDSMHDVVENLLSYCFQTFLDKSMS
FT                   IEF"
FT   gene            2492275..2494412
FT                   /gene="Pabpc2"
FT                   /locus_tag="mCG_13635"
FT                   /note="gene_id=mCG13635.0"
FT   mRNA            2492275..2494412
FT                   /gene="Pabpc2"
FT                   /locus_tag="mCG_13635"
FT                   /product="poly A binding protein, cytoplasmic 2"
FT                   /note="gene_id=mCG13635.0 transcript_id=mCT16040.0 created
FT                   on 14-OCT-2002"
FT   CDS             2492441..2494327
FT                   /codon_start=1
FT                   /gene="Pabpc2"
FT                   /locus_tag="mCG_13635"
FT                   /product="poly A binding protein, cytoplasmic 2"
FT                   /note="gene_id=mCG13635.0 transcript_id=mCT16040.0
FT                   protein_id=mCP12700.1"
FT                   /db_xref="GOA:Q62029"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR002004"
FT                   /db_xref="InterPro:IPR006515"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="MGI:MGI:1349723"
FT                   /db_xref="UniProtKB/TrEMBL:Q62029"
FT                   /protein_id="EDL10060.1"
FT                   /translation="MNSSDPGCPMASLYVGDLHPDVTEAMLYEKFSSAGPILSIRVYRD
FT                   VITRRSLGYASVNFEQPADAERALDTMNFDVIKGKPVRIMWSQRDPSLRRSGVGNVFIK
FT                   NLNKTIDNKALYDTFSAFGNILSCKVVSDENGSKGHGFVHFETEEAAERAIEKMNGMLL
FT                   NDRKVFVGRFKSQKEREAELGTGTKEFTNVYIKNFGDRMDDETLNGLFGRFGQILSVKV
FT                   MTDEGGKSKGFGFVSFERHEDAQKAVDEMNGKELNGKHIYVGRAQKKDDRHTELKHKFE
FT                   QVTQDKSIRYQGINLYVKNLDDGIDDERLQKEFSPFGTITSTKVMTEGGRSKGFGFVCF
FT                   SSPEEATKAVSEMNGRIVATKPLYVALAQRKEERQAHLTNQYIQRMASVRSGPNPVNPY
FT                   QPASSSYSVAAVPQTQNCVPCCPSQIAQPRPSARWIAQGSRPHPFPNVPGAIHPAAPRS
FT                   SLTTVRPSSSHVQVTTAHRITNTSAQITGQRPAPASSATATPVHSIPQYKYAAGVQNSQ
FT                   QHLNAQLAQQPAVCIQGQEPWTASMLVTAPQEPKQMLGERLFPLIQAMHPTLAGKITGM
FT                   LLDIDNSEPLRMLESPVSRCSRAEEAVATLQAHQVKEAAQKAVGSTSGVPTV"
FT   gene            complement(2923492..2938915)
FT                   /gene="Yipf5"
FT                   /locus_tag="mCG_10357"
FT                   /note="gene_id=mCG10357.2"
FT   mRNA            complement(join(2923492..2925953,2927242..2927423,
FT                   2930303..2930448,2931598..2931770,2938301..2938420,
FT                   2938783..2938915))
FT                   /gene="Yipf5"
FT                   /locus_tag="mCG_10357"
FT                   /product="Yip1 domain family, member 5, transcript variant
FT                   mCT179470"
FT                   /note="gene_id=mCG10357.2 transcript_id=mCT179470.0 created
FT                   on 05-FEB-2003"
FT   mRNA            complement(join(2923492..2925955,2927242..2927423,
FT                   2930303..2930448,2931598..2931766,2938301..2938420,
FT                   2938783..2938890))
FT                   /gene="Yipf5"
FT                   /locus_tag="mCG_10357"
FT                   /product="Yip1 domain family, member 5, transcript variant
FT                   mCT174314"
FT                   /note="gene_id=mCG10357.2 transcript_id=mCT174314.0 created
FT                   on 05-FEB-2003"
FT   mRNA            complement(join(2924420..2925955,2927242..2927423,
FT                   2930303..2930448,2931598..2931770,2938301..2938420,
FT                   2938783..2938915))
FT                   /gene="Yipf5"
FT                   /locus_tag="mCG_10357"
FT                   /product="Yip1 domain family, member 5, transcript variant
FT                   mCT10371"
FT                   /note="gene_id=mCG10357.2 transcript_id=mCT10371.1 created
FT                   on 05-FEB-2003"
FT   mRNA            complement(join(2924420..2925955,2927242..2927423,
FT                   2930303..2930448,2931598..2931770,2938301..2938420,
FT                   2938788..2938900))
FT                   /gene="Yipf5"
FT                   /locus_tag="mCG_10357"
FT                   /product="Yip1 domain family, member 5, transcript variant
FT                   mCT179472"
FT                   /note="gene_id=mCG10357.2 transcript_id=mCT179472.0 created
FT                   on 05-FEB-2003"
FT   mRNA            complement(join(2924420..2925955,2927242..2927423,
FT                   2930303..2930448,2931598..2931770,2938459..2938784))
FT                   /gene="Yipf5"
FT                   /locus_tag="mCG_10357"
FT                   /product="Yip1 domain family, member 5, transcript variant
FT                   mCT179471"
FT                   /note="gene_id=mCG10357.2 transcript_id=mCT179471.0 created
FT                   on 05-FEB-2003"
FT   CDS             complement(join(2925793..2925955,2927242..2927423,
FT                   2930303..2930448,2931598..2931770,2938301..2938410))
FT                   /codon_start=1
FT                   /gene="Yipf5"
FT                   /locus_tag="mCG_10357"
FT                   /product="Yip1 domain family, member 5, isoform CRA_c"
FT                   /note="gene_id=mCG10357.2 transcript_id=mCT10371.1
FT                   protein_id=mCP12703.0 isoform=CRA_c"
FT                   /protein_id="EDL10058.1"
FT                   /translation="MSGFDNLNSGFYQTSYSIDEQSQQSYDYGGSGGPYSKQYAGCDYS
FT                   QQGRFVPPDMMQPQQTYTGQIYQPTQAYPPTTPQPFYGDSFEEEPPLLEELGINFDHIW
FT                   QKTLTVLHPLRAADGSIMNETDLAGPVVFCLAFGATLLLAGKIQFGYVYGISAIGCLGM
FT                   FCLLNLMSMTGVSFGCVASVLGYCLLPMILLSSFAVVFSLQGMVGILLTATIIGWCSFS
FT                   ASKIFISALAMDGQQLLVAYPCALLYGVFALISVF"
FT   CDS             complement(join(2925793..2925955,2927242..2927423,
FT                   2930303..2930448,2931598..2931770,2938301..2938410))
FT                   /codon_start=1
FT                   /gene="Yipf5"
FT                   /locus_tag="mCG_10357"
FT                   /product="Yip1 domain family, member 5, isoform CRA_c"
FT                   /note="gene_id=mCG10357.2 transcript_id=mCT179472.0
FT                   protein_id=mCP102393.0 isoform=CRA_c"
FT                   /protein_id="EDL10059.1"
FT                   /translation="MSGFDNLNSGFYQTSYSIDEQSQQSYDYGGSGGPYSKQYAGCDYS
FT                   QQGRFVPPDMMQPQQTYTGQIYQPTQAYPPTTPQPFYGDSFEEEPPLLEELGINFDHIW
FT                   QKTLTVLHPLRAADGSIMNETDLAGPVVFCLAFGATLLLAGKIQFGYVYGISAIGCLGM
FT                   FCLLNLMSMTGVSFGCVASVLGYCLLPMILLSSFAVVFSLQGMVGILLTATIIGWCSFS
FT                   ASKIFISALAMDGQQLLVAYPCALLYGVFALISVF"
FT   CDS             complement(join(2925793..2925955,2927242..2927423,
FT                   2930303..2930448,2931598..2931718))
FT                   /codon_start=1
FT                   /gene="Yipf5"
FT                   /locus_tag="mCG_10357"
FT                   /product="Yip1 domain family, member 5, isoform CRA_a"
FT                   /note="gene_id=mCG10357.2 transcript_id=mCT174314.0
FT                   protein_id=mCP97233.0 isoform=CRA_a"
FT                   /protein_id="EDL10055.1"
FT                   /translation="MMQPQQTYTGQIYQPTQAYPPTTPQPFYGDSFEEEPPLLEELGIN
FT                   FDHIWQKTLTVLHPLRAADGSIMNETDLAGPVVFCLAFGATLLLAGKIQFGYVYGISAI
FT                   GCLGMFCLLNLMSMTGVSFGCVASVLGYCLLPMILLSSFAVVFSLQGMVGILLTATIIG
FT                   WCSFSASKIFISALAMDGQQLLVAYPCALLYGVFALISVF"
FT   CDS             complement(join(2925793..2925955,2927242..2927423,
FT                   2930303..2930448,2931598..2931718))
FT                   /codon_start=1
FT                   /gene="Yipf5"
FT                   /locus_tag="mCG_10357"
FT                   /product="Yip1 domain family, member 5, isoform CRA_a"
FT                   /note="gene_id=mCG10357.2 transcript_id=mCT179471.0
FT                   protein_id=mCP102392.0 isoform=CRA_a"
FT                   /protein_id="EDL10057.1"
FT                   /translation="MMQPQQTYTGQIYQPTQAYPPTTPQPFYGDSFEEEPPLLEELGIN
FT                   FDHIWQKTLTVLHPLRAADGSIMNETDLAGPVVFCLAFGATLLLAGKIQFGYVYGISAI
FT                   GCLGMFCLLNLMSMTGVSFGCVASVLGYCLLPMILLSSFAVVFSLQGMVGILLTATIIG
FT                   WCSFSASKIFISALAMDGQQLLVAYPCALLYGVFALISVF"
FT   CDS             complement(join(2925908..2925953,2927242..2927423,
FT                   2930303..2930448,2931598..2931770,2938301..2938410))
FT                   /codon_start=1
FT                   /gene="Yipf5"
FT                   /locus_tag="mCG_10357"
FT                   /product="Yip1 domain family, member 5, isoform CRA_b"
FT                   /note="gene_id=mCG10357.2 transcript_id=mCT179470.0
FT                   protein_id=mCP102394.0 isoform=CRA_b"
FT                   /protein_id="EDL10056.1"
FT                   /translation="MSGFDNLNSGFYQTSYSIDEQSQQSYDYGGSGGPYSKQYAGCDYS
FT                   QQGRFVPPDMMQPQQTYTGQIYQPTQAYPPTTPQPFYGDSFEEEPPLLEELGINFDHIW
FT                   QKTLTVLHPLRAADGSIMNETDLAGPVVFCLAFGATLLLAGKIQFGYVYGISAIGCLGM
FT                   FCLLNLMSMTGVSFGCVASVLGYCLLPMILLSSFAVVFSLQNGRNSSHCHNYWMV"
FT   gene            complement(2962427..>2977866)
FT                   /locus_tag="mCG_146101"
FT                   /note="gene_id=mCG146101.0"
FT   mRNA            complement(join(2962427..2962567,2964888..2965016,
FT                   2976911..2977053,2977650..>2977866))
FT                   /locus_tag="mCG_146101"
FT                   /product="mCG146101"
FT                   /note="gene_id=mCG146101.0 transcript_id=mCT186204.0
FT                   created on 14-JUL-2003"
FT   CDS             complement(join(2962545..2962567,2964888..2965016,
FT                   2976911..>2977010))
FT                   /codon_start=1
FT                   /locus_tag="mCG_146101"
FT                   /product="mCG146101"
FT                   /note="gene_id=mCG146101.0 transcript_id=mCT186204.0
FT                   protein_id=mCP107761.0"
FT                   /protein_id="EDL10053.1"
FT                   /translation="VLETQFLRRNNLFQSNQKPQPHTEPGRLVKSQTAKQWDTMIKGVS
FT                   FEIRQCELHHLPHVSHLCSNSCFYLYCGVRTSSGGARL"
FT   gene            2976335..2977059
FT                   /locus_tag="mCG_49005"
FT                   /note="gene_id=mCG49005.2"
FT   mRNA            2976335..2977059
FT                   /locus_tag="mCG_49005"
FT                   /product="mCG49005"
FT                   /note="gene_id=mCG49005.2 transcript_id=mCT49188.2 created
FT                   on 16-OCT-2002"
FT   CDS             2976350..2976784
FT                   /codon_start=1
FT                   /locus_tag="mCG_49005"
FT                   /product="mCG49005"
FT                   /note="gene_id=mCG49005.2 transcript_id=mCT49188.2
FT                   protein_id=mCP34259.2"
FT                   /protein_id="EDL10054.1"
FT                   /translation="MVSCLHCSHNSIRTAPGTVGPLSFGAQAPQASLAFPAAFPSHLAG
FT                   TWASLCPCLQVGWLLQPWGAHLSVALPLGSLNASKSRYLLQLFQVQRIYLFYKVWISFF
FT                   LFFLRKLWLNIYIFFPLLHFFDSASSRFNFFPPRFVLARD"
FT   gene            complement(3089714..3104473)
FT                   /locus_tag="mCG_147316"
FT                   /note="gene_id=mCG147316.0"
FT   mRNA            complement(join(3089714..3090003,3104319..3104473))
FT                   /locus_tag="mCG_147316"
FT                   /product="mCG147316"
FT                   /note="gene_id=mCG147316.0 transcript_id=mCT187579.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(3089815..3089955)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147316"
FT                   /product="mCG147316"
FT                   /note="gene_id=mCG147316.0 transcript_id=mCT187579.0
FT                   protein_id=mCP109704.0"
FT                   /protein_id="EDL10052.1"
FT                   /translation="MATLVYGSSHHPHPKDVTSTSWDDWLGGVEPMTQLRHQRISPANL
FT                   G"
FT   gene            complement(3155941..>3158875)
FT                   /locus_tag="mCG_145137"
FT                   /note="gene_id=mCG145137.0"
FT   mRNA            complement(join(3155941..3156555,3157041..3157305,
FT                   3158762..>3158875))
FT                   /locus_tag="mCG_145137"
FT                   /product="mCG145137"
FT                   /note="gene_id=mCG145137.0 transcript_id=mCT184561.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(3156351..3156555,3157041..>3157108))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145137"
FT                   /product="mCG145137"
FT                   /note="gene_id=mCG145137.0 transcript_id=mCT184561.0
FT                   protein_id=mCP106247.0"
FT                   /protein_id="EDL10051.1"
FT                   /translation="PTGEKYAHLGYTKVRQNFLATPKYFHMLEDSKSHVYRKSNYGCSL
FT                   KKIIQIGFVVTTMFGSLVYVTVPKIVSCQKPLNIVLGQKLRIINN"
FT   gene            <3235183..3254291
FT                   /locus_tag="mCG_51668"
FT                   /note="gene_id=mCG51668.2"
FT   mRNA            join(3235183..3235354,3241077..3241136,3253046..3254291)
FT                   /locus_tag="mCG_51668"
FT                   /product="mCG51668, transcript variant mCT174422"
FT                   /note="gene_id=mCG51668.2 transcript_id=mCT174422.0 created
FT                   on 06-FEB-2003"
FT   mRNA            join(<3235183..3235350,3253046..3254291)
FT                   /locus_tag="mCG_51668"
FT                   /product="mCG51668, transcript variant mCT179600"
FT                   /note="gene_id=mCG51668.2 transcript_id=mCT179600.0 created
FT                   on 06-FEB-2003"
FT   mRNA            join(3235184..3235354,3253046..3254291)
FT                   /locus_tag="mCG_51668"
FT                   /product="mCG51668, transcript variant mCT51851"
FT                   /note="gene_id=mCG51668.2 transcript_id=mCT51851.2 created
FT                   on 06-FEB-2003"
FT   CDS             join(<3235266..3235350,3253046..3253497)
FT                   /codon_start=1
FT                   /locus_tag="mCG_51668"
FT                   /product="mCG51668, isoform CRA_a"
FT                   /note="gene_id=mCG51668.2 transcript_id=mCT179600.0
FT                   protein_id=mCP102522.0 isoform=CRA_a"
FT                   /protein_id="EDL10048.1"
FT                   /translation="QFIGSLYLAVARLVTLNLQSQSGEVDAGGEPSRWSSSHCDCCCKN
FT                   GKGDKGESGTSCNDLSTSSCDSQSEASSPQETVICGPVTRQSNIQTLDRPIKKGPVQLI
FT                   QQSEMRRKSDLLRTLTSGSRESNISSKKKAAKEKLSIEEELEKCIQDFLKIKIPDRFPE
FT                   RKHPWQSELLRKYHL"
FT   CDS             join(3235342..3235354,3241077..3241136,3253046..3253497)
FT                   /codon_start=1
FT                   /locus_tag="mCG_51668"
FT                   /product="mCG51668, isoform CRA_c"
FT                   /note="gene_id=mCG51668.2 transcript_id=mCT174422.0
FT                   protein_id=mCP97341.0 isoform=CRA_c"
FT                   /protein_id="EDL10050.1"
FT                   /translation="MLEVSHLSNYLKECLSELSKEGMVGEPSRWSSSHCDCCCKNGKGD
FT                   KGESGTSCNDLSTSSCDSQSEASSPQETVICGPVTRQSNIQTLDRPIKKGPVQLIQQSE
FT                   MRRKSDLLRTLTSGSRESNISSKKKAAKEKLSIEEELEKCIQDFLKIKIPDRFPERKHP
FT                   WQSELLRKYHL"
FT   CDS             join(3235342..3235354,3253046..3253497)
FT                   /codon_start=1
FT                   /locus_tag="mCG_51668"
FT                   /product="mCG51668, isoform CRA_b"
FT                   /note="gene_id=mCG51668.2 transcript_id=mCT51851.2
FT                   protein_id=mCP34273.2 isoform=CRA_b"
FT                   /protein_id="EDL10049.1"
FT                   /translation="MLEVCEPSRWSSSHCDCCCKNGKGDKGESGTSCNDLSTSSCDSQS
FT                   EASSPQETVICGPVTRQSNIQTLDRPIKKGPVQLIQQSEMRRKSDLLRTLTSGSRESNI
FT                   SSKKKAAKEKLSIEEELEKCIQDFLKIKIPDRFPERKHPWQSELLRKYHL"
FT   gene            complement(4605106..4680651)
FT                   /locus_tag="mCG_140804"
FT                   /note="gene_id=mCG140804.0"
FT   mRNA            complement(join(4605106..4605358,4610717..4610789,
FT                   4641825..4641930,4662054..4662214,4664621..4664694,
FT                   4667087..4667144,4680530..4680651))
FT                   /locus_tag="mCG_140804"
FT                   /product="mCG140804"
FT                   /note="gene_id=mCG140804.0 transcript_id=mCT171602.0
FT                   created on 06-AUG-2002"
FT   CDS             complement(join(4610730..4610789,4641825..4641930,
FT                   4662054..4662214,4664621..4664694,4667087..4667144,
FT                   4680530..4680604))
FT                   /codon_start=1
FT                   /locus_tag="mCG_140804"
FT                   /product="mCG140804"
FT                   /note="gene_id=mCG140804.0 transcript_id=mCT171602.0
FT                   protein_id=mCP94521.0"
FT                   /protein_id="EDL10047.1"
FT                   /translation="MGVTVDVHQVFQYPFEQVVACFLRKYPNPMDKNVISVKTVEEKKD
FT                   ESTGLIYRKRIAICQNVVPEILRKVSILKVPDIQLEEESWLSLQKRNMAIRSHCLTWTQ
FT                   YASMREESVFRESVENPNWTEFIQTGRISITGAGFLNCILETFASTFLRQGAQKGIRIM
FT                   EMLLKEQCGSPLVE"
FT   gene            <4782161..4886780
FT                   /gene="Sh3rf2"
FT                   /locus_tag="mCG_13025"
FT                   /note="gene_id=mCG13025.3"
FT   mRNA            join(<4782161..4782690,4829987..4830256,4832517..4832612,
FT                   4839572..4839892,4867792..4867883,4869202..4869372,
FT                   4877866..4878110,4881268..4881626,4884203..4886107)
FT                   /gene="Sh3rf2"
FT                   /locus_tag="mCG_13025"
FT                   /product="SH3 domain containing ring finger 2, transcript
FT                   variant mCT190285"
FT                   /note="gene_id=mCG13025.3 transcript_id=mCT190285.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(4782165..4782690,4829987..4830256,4832517..4832612,
FT                   4839572..4839892,4867792..4867883,4869202..4869384,
FT                   4877866..4878110,4881268..4881626,4884203..4886780)
FT                   /gene="Sh3rf2"
FT                   /locus_tag="mCG_13025"
FT                   /product="SH3 domain containing ring finger 2, transcript
FT                   variant mCT13770"
FT                   /note="gene_id=mCG13025.3 transcript_id=mCT13770.2 created
FT                   on 14-OCT-2002"
FT   mRNA            join(<4782204..4782690,4829987..4830256,4839572..4839892,
FT                   4867792..4867883,4869202..4869372,4877866..4878110,
FT                   4881268..4881626,4884203..4886703)
FT                   /gene="Sh3rf2"
FT                   /locus_tag="mCG_13025"
FT                   /product="SH3 domain containing ring finger 2, transcript
FT                   variant mCT190284"
FT                   /note="gene_id=mCG13025.3 transcript_id=mCT190284.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<4782307..4782690,4829987..4830256,4832517..4832612,
FT                   4839572..4839892,4867792..4867883,4869202..4869372,
FT                   4877866..4878110,4881268..4881626,4884203..4884478)
FT                   /codon_start=1
FT                   /gene="Sh3rf2"
FT                   /locus_tag="mCG_13025"
FT                   /product="SH3 domain containing ring finger 2, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG13025.3 transcript_id=mCT190285.0
FT                   protein_id=mCP111263.0 isoform=CRA_c"
FT                   /protein_id="EDL10046.1"
FT                   /translation="NKMDDLTLLDLLECPVCFEKLDVTAKVLPCQHTFCKPCLQRIFKA
FT                   HKELRCPECRTLVFCSIEALPANLLLVRLLDGVRSGQSSWKGGSFRRPRILTLQDNRKA
FT                   KSSPRSLQASPFRLVPSVRIHMDGVPRAKALCNYRGKNPGDLKFNKGDVILLRRQLDEN
FT                   WYQGEINGVSGIFPASSVEVIKQLPQPPPLCRALYNFDLRDKDKSENQDCLTFLKDDVI
FT                   TVISRVDENWAEGKLGDKVGIFPILFVEPNVSARHLLENKGHQLSRTRHLSLMSSPSRG
FT                   KATNTSSLRKSPGSRRKGSGQFSMTTALNTLNRTVHSPEGHQMVEISTPMLISSNSPSV
FT                   LTQHGDKADFPTSSTGQVSSSQPAPASPGHSTAMVSVPSSQQHLSNNMFVALHTYSAHR
FT                   PEELDLQKGEGIRVLGKYQDGWLKGLSLLTGRTGIFPSDYVIPVFSSTARKTSSFPDSR
FT                   SPTVCTTWALSTSSVSSQGSFAEGDPRQSGPFKSVFVPTAVVNPSRSTPGPGSSGQGSL
FT                   RKVRSSMRKNGSLQRPVQSGIPTFMVGSLRCSPTMVIRPQRFQFYPPQGMTPSPTPIMV
FT                   EMGSKSIYTGEPALTCINRGSKTRIHSAGNSIIMEGKETPIKSEPPPKPPASAPPSILV
FT                   KPENSKNGTEKQVKTVRFQNYSPPPTKHSASSPTSGKHDHPATLKGSQHEAVSSGGEMT
FT                   ILFAHRSGCHSGQQTDLRRKSAFGKTMPLLSTASATQTLFPSK"
FT   CDS             join(<4782307..4782690,4829987..4830256,4839572..4839892,
FT                   4867792..4867883,4869202..4869372,4877866..4878110,
FT                   4881268..4881626,4884203..4884478)
FT                   /codon_start=1
FT                   /gene="Sh3rf2"
FT                   /locus_tag="mCG_13025"
FT                   /product="SH3 domain containing ring finger 2, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG13025.3 transcript_id=mCT190284.0
FT                   protein_id=mCP111262.0 isoform=CRA_b"
FT                   /protein_id="EDL10045.1"
FT                   /translation="NKMDDLTLLDLLECPVCFEKLDVTAKVLPCQHTFCKPCLQRIFKA
FT                   HKELRCPECRTLVFCSIEALPANLLLVRLLDGVRSGQSSWKGGSFRRPRILTLQDNRKA
FT                   KSSPRSLQASPFRLVPSVRIHMDGVPRAKALCNYRGKNPGDLKFNKGDVILLRRQLDEN
FT                   WYQGEINGVSGIFPASSVEVIKQLPQPPPLCRALYNFDLRDKDKSENQDCLTFLKPNVS
FT                   ARHLLENKGHQLSRTRHLSLMSSPSRGKATNTSSLRKSPGSRRKGSGQFSMTTALNTLN
FT                   RTVHSPEGHQMVEISTPMLISSNSPSVLTQHGDKADFPTSSTGQVSSSQPAPASPGHST
FT                   AMVSVPSSQQHLSNNMFVALHTYSAHRPEELDLQKGEGIRVLGKYQDGWLKGLSLLTGR
FT                   TGIFPSDYVIPVFSSTARKTSSFPDSRSPTVCTTWALSTSSVSSQGSFAEGDPRQSGPF
FT                   KSVFVPTAVVNPSRSTPGPGSSGQGSLRKVRSSMRKNGSLQRPVQSGIPTFMVGSLRCS
FT                   PTMVIRPQRFQFYPPQGMTPSPTPIMVEMGSKSIYTGEPALTCINRGSKTRIHSAGNSI
FT                   IMEGKETPIKSEPPPKPPASAPPSILVKPENSKNGTEKQVKTVRFQNYSPPPTKHSASS
FT                   PTSGKHDHPATLKGSQHEAVSSGGEMTILFAHRSGCHSGQQTDLRRKSAFGKTMPLLST
FT                   ASATQTLFPSK"
FT   CDS             join(4782313..4782690,4829987..4830256,4832517..4832612,
FT                   4839572..4839892,4867792..4867883,4869202..4869384,
FT                   4877866..4878110,4881268..4881626,4884203..4884478)
FT                   /codon_start=1
FT                   /gene="Sh3rf2"
FT                   /locus_tag="mCG_13025"
FT                   /product="SH3 domain containing ring finger 2, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG13025.3 transcript_id=mCT13770.2
FT                   protein_id=mCP22540.2 isoform=CRA_a"
FT                   /protein_id="EDL10044.1"
FT                   /translation="MDDLTLLDLLECPVCFEKLDVTAKVLPCQHTFCKPCLQRIFKAHK
FT                   ELRCPECRTLVFCSIEALPANLLLVRLLDGVRSGQSSWKGGSFRRPRILTLQDNRKAKS
FT                   SPRSLQASPFRLVPSVRIHMDGVPRAKALCNYRGKNPGDLKFNKGDVILLRRQLDENWY
FT                   QGEINGVSGIFPASSVEVIKQLPQPPPLCRALYNFDLRDKDKSENQDCLTFLKDDVITV
FT                   ISRVDENWAEGKLGDKVGIFPILFVEPNVSARHLLENKGHQLSRTRHLSLMSSPSRGKA
FT                   TNTSSLRKSPGSRRKGSGQFSMTTALNTLNRTVHSPEGHQMVEISTPMLISSNSPSVLT
FT                   QHGDKADFPTSSTGQVSSSQPAPASPGHSTAMVSVPSSQQHLSNNMFVALHTYSAHRPE
FT                   ELDLQKGEGIRVLGKYQDGWLKGLSLLTGRTGIFPSDYVIPVFRYVSSSTARKTSSFPD
FT                   SRSPTVCTTWALSTSSVSSQGSFAEGDPRQSGPFKSVFVPTAVVNPSRSTPGPGSSGQG
FT                   SLRKVRSSMRKNGSLQRPVQSGIPTFMVGSLRCSPTMVIRPQRFQFYPPQGMTPSPTPI
FT                   MVEMGSKSIYTGEPALTCINRGSKTRIHSAGNSIIMEGKETPIKSEPPPKPPASAPPSI
FT                   LVKPENSKNGTEKQVKTVRFQNYSPPPTKHSASSPTSGKHDHPATLKGSQHEAVSSGGE
FT                   MTILFAHRSGCHSGQQTDLRRKSAFGKTMPLLSTASATQTLFPSK"
FT   gene            complement(4906938..>4924918)
FT                   /locus_tag="mCG_144591"
FT                   /note="gene_id=mCG144591.0"
FT   mRNA            complement(join(4906938..4907214,4908530..4908666,
FT                   4920828..4920964,4924737..>4924918))
FT                   /locus_tag="mCG_144591"
FT                   /product="mCG144591"
FT                   /note="gene_id=mCG144591.0 transcript_id=mCT184015.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(4907074..4907214,4908530..4908666,
FT                   4920828..4920964,4924737..>4924882))
FT                   /codon_start=1
FT                   /locus_tag="mCG_144591"
FT                   /product="mCG144591"
FT                   /note="gene_id=mCG144591.0 transcript_id=mCT184015.0
FT                   protein_id=mCP106234.0"
FT                   /protein_id="EDL10042.1"
FT                   /translation="PGGKKTLLTMSWMGHHFSRWCKDISVLSSHLPLFSPMPSEDEHLI
FT                   SNLRSHVPARVVVKQPIRGAIGRTTVAAIVQTGGDWSTGLFSVCRDRKICFWGLLCPMC
FT                   LECDIARHYGECLCWPLLPGSTFALRIGTRERHRIQGTLCEDCVVVHCCWPFSICQVAR
FT                   ELKMRTSQLYEICEVPELKNTLV"
FT   gene            4912250..4914358
FT                   /locus_tag="mCG_63350"
FT                   /note="gene_id=mCG63350.2"
FT   mRNA            join(4912250..4912644,4912845..4914214,4914326..4914358)
FT                   /locus_tag="mCG_63350"
FT                   /product="mCG63350"
FT                   /note="gene_id=mCG63350.2 transcript_id=mCT63533.2 created
FT                   on 16-OCT-2002"
FT   CDS             join(4912601..4912644,4912845..4913169)
FT                   /codon_start=1
FT                   /locus_tag="mCG_63350"
FT                   /product="mCG63350"
FT                   /note="gene_id=mCG63350.2 transcript_id=mCT63533.2
FT                   protein_id=mCP42475.2"
FT                   /protein_id="EDL10043.1"
FT                   /translation="MPPQQPSMGRPSVRSENLTLILTPQMDTQVIEVMVSLPRGIVSIS
FT                   PGDRQDQVLTWARGSVCVFPQDQTEPLWVPERLVRRCKNEAPDPVAPVDVVDGPTNTND
FT                   GAKMGDPFSVPEADTSST"
FT   gene            4928895..4929689
FT                   /pseudo
FT                   /locus_tag="mCG_49696"
FT                   /note="gene_id=mCG49696.2"
FT   mRNA            4928895..4929689
FT                   /pseudo
FT                   /locus_tag="mCG_49696"
FT                   /note="gene_id=mCG49696.2 transcript_id=mCT49879.2 created
FT                   on 17-OCT-2002"
FT   gene            complement(4930578..4990399)
FT                   /locus_tag="mCG_127948"
FT                   /note="gene_id=mCG127948.0"
FT   mRNA            complement(join(4930578..4930961,4938243..4938375,
FT                   4939386..4939481,4940735..4940839,4943017..4943127,
FT                   4945107..4945217,4945723..4945863,4946759..4946899,
FT                   4948113..4948203,4949732..4949915,4954007..4954070,
FT                   4955489..4955546,4956259..4956471,4956911..4957049,
FT                   4957882..4957964,4958044..4958109,4958195..4958280,
FT                   4962134..4962211,4962915..4963055,4963819..4963872,
FT                   4964917..4964993,4965073..4965160,4970231..4970456,
FT                   4971023..4971090,4971286..4971349,4972096..4972208,
FT                   4973068..4973229,4974265..4974402,4979148..4979228,
FT                   4979612..4979699,4985303..4985427,4990231..4990399))
FT                   /locus_tag="mCG_127948"
FT                   /product="mCG127948"
FT                   /note="gene_id=mCG127948.0 transcript_id=mCT129240.1
FT                   created on 14-OCT-2002"
FT   CDS             complement(join(4930756..4930961,4938243..4938375,
FT                   4939386..4939481,4940735..4940839,4943017..4943127,
FT                   4945107..4945217,4945723..4945863,4946759..4946899,
FT                   4948113..4948203,4949732..4949915,4954007..4954070,
FT                   4955489..4955546,4956259..4956471,4956911..4957049,
FT                   4957882..4957964,4958044..4958109,4958195..4958280,
FT                   4962134..4962211,4962915..4963055,4963819..4963872,
FT                   4964917..4964993,4965073..4965160,4970231..4970456,
FT                   4971023..4971090,4971286..4971349,4972096..4972208,
FT                   4973068..4973229,4974265..4974402,4979148..4979228,
FT                   4979612..4979699,4985303..4985427,4990231..4990236))
FT                   /codon_start=1
FT                   /locus_tag="mCG_127948"
FT                   /product="mCG127948"
FT                   /note="gene_id=mCG127948.0 transcript_id=mCT129240.1
FT                   protein_id=mCP77816.1"
FT                   /db_xref="GOA:Q7TSZ3"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR004493"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="MGI:MGI:1913808"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TSZ3"
FT                   /protein_id="EDL10039.1"
FT                   /translation="MAGRKGTAKVDFLKEIEKEAQQKWEAEKVFEVSASRLEKQKQSSK
FT                   GKYFVTFPYPYMNGRLHLGHTFSLSKCEFAVGYQRLKGKSCLFPFGLHCTGMPIKACAD
FT                   KLKREIELYGCPPDFPEEEEEEEESSAKPGDIVVRDKAKGKKSKAAAKAGSSKYQWDIM
FT                   KSLGLSDDDIVKFSEAEHWLDYFPPLAVQDLKTIGLKVDWRRSFITTDVNPYYDSFVRW
FT                   QFLTLRERNKIKFGKRYTIYSPKDGQPCMDHDRQTGEGVGPQEYTLVKLKVLEPYPSKL
FT                   SGLKGKNIFLVAATLRPETMFGQTNCWVRPDMKYIGFETANGDIFICTQRAARNMSYQG
FT                   FTKHNGVVPVVKELMGEEILGASLSAPLTCYKVVYVLPMLTIKEDKGTGVVTSVPSDSP
FT                   DDLAALRDLKKKQALRTKFGIRDDMVLPFEPVPVLEIPGIGNLPAVTVCDELKIQSQND
FT                   REKLAEAKEKLYLRGFYDGVMLVDGFKGQKIQHVKKTIQKNMIDAGDALIYMEPEKQVM
FT                   SRSADECVVALCDQWYLDYGDENWKKQTFQCLKNMETFCEESRKNFEASLDWLQEHACS
FT                   RTYGLGTRLPWDEQWLIESLSDSTIYMAFYTVAHLLQGGDLNGQAESPLGIRPQQMTKD
FT                   VWDYVFFKDAPFPKTQIPKEKLDQLKQEFEFWYPVDLRASGKDLIPNHLSYYIYNHVAM
FT                   WPEQSDKWPVSVRANGHLLLNSEKMSKSTGNFLTLSQAVDKFSADGMRLALADAGDTVE
FT                   DANFVEAMADAGILRLYTWVEWVKEMLASCSSLRSGPADSFNDRVFASEMNAGIIKTDQ
FT                   NYEKMMFKEALKTGFFEFQAAKDKYRELATEGMHRELVFRFIEVQTILLTPFCPHLCEH
FT                   IWTLLGKPDSIMHASWPVAGPVDESLIRSSQYLMEVAHDLRLRLKNYMMPAKGKKTDKQ
FT                   PAQRPSHCTIYVAKNYPVWQHITLTTLRSHFEANNGKLPDNKVIASELGSLPELKKYMK
FT                   KVMPFVAMIKENMEKKGPRVLDLELEFDEQAVLMENIVYLTNSLELEHIEVKFASEAED
FT                   KVREECCPGKPLNVFRTEPGVPVSLVNPQPSSGHFSTKIDIRQGDSCESIIRRLMKTDR
FT                   GIKDLSKVKLMRFDDPLLGPRRVPVLGREHSEKTLISENAVFHVDLVSKKVHLTENGLR
FT                   TDIGDTMVYLVH"
FT   gene            <4958797..4961523
FT                   /locus_tag="mCG_145134"
FT                   /note="gene_id=mCG145134.0"
FT   mRNA            join(<4958797..4959127,4959169..4959183,4959211..4961523)
FT                   /locus_tag="mCG_145134"
FT                   /product="mCG145134"
FT                   /note="gene_id=mCG145134.0 transcript_id=mCT184558.0
FT                   created on 05-JUN-2003"
FT   CDS             <4960232..4960564
FT                   /codon_start=1
FT                   /locus_tag="mCG_145134"
FT                   /product="mCG145134"
FT                   /note="gene_id=mCG145134.0 transcript_id=mCT184558.0
FT                   protein_id=mCP106244.0"
FT                   /protein_id="EDL10041.1"
FT                   /translation="VGETERSHRIKARRTDLRSREIYNGQEISAPAEQQQPIQRTCCSG
FT                   WECILRCNQSHTETRDKLRKMQGCNFWDDMLRAWQVLILGKNKNWIRKYSLHTTVRLAM
FT                   SQKYKQ"
FT   gene            4980695..4981190
FT                   /locus_tag="mCG_11587"
FT                   /note="gene_id=mCG11587.0"
FT   mRNA            4980695..4981190
FT                   /locus_tag="mCG_11587"
FT                   /product="mCG11587"
FT                   /note="gene_id=mCG11587.0 transcript_id=mCT11906.0 created
FT                   on 14-OCT-2002"
FT   CDS             4980718..4981155
FT                   /codon_start=1
FT                   /locus_tag="mCG_11587"
FT                   /product="mCG11587"
FT                   /note="gene_id=mCG11587.0 transcript_id=mCT11906.0
FT                   protein_id=mCP22519.1"
FT                   /protein_id="EDL10040.1"
FT                   /translation="MPGVTVKDVNQQEFTRALAAFLKKSGKLKVPEWVDTVKLAKHKEL
FT                   APYDENWFYTRAASTAWHVYLRGGAGVGSMTKIYGGRQRNGVRPSHFSRGSKSVARQVL
FT                   QALEGLKMVEKDQDGGRKLTPQGQRDLDRIAGQVAAANKKH"
FT   gene            complement(5002732..5003536)
FT                   /locus_tag="mCG_1033463"
FT                   /note="gene_id=mCG1033463.0"
FT   mRNA            complement(join(5002732..5002893,5003300..5003536))
FT                   /locus_tag="mCG_1033463"
FT                   /product="mCG1033463"
FT                   /note="gene_id=mCG1033463.0 transcript_id=mCT151167.0
FT                   created on 10-MAR-2003"
FT   CDS             complement(join(5002806..5002893,5003300..5003346))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1033463"
FT                   /product="mCG1033463"
FT                   /note="gene_id=mCG1033463.0 transcript_id=mCT151167.0
FT                   protein_id=mCP77690.1"
FT                   /protein_id="EDL10038.1"
FT                   /translation="MSRNDSAVVNLQHNVRRNFHQQTSFKRKLMAKMGHWETMGEGGD"
FT   gene            5003736..5068451
FT                   /locus_tag="mCG_11586"
FT                   /note="gene_id=mCG11586.2"
FT   mRNA            join(5003736..5003868,5030251..5030430,5034094..5034228,
FT                   5042391..5042555,5046021..5046170,5048224..5048368,
FT                   5049186..5049339,5050334..5050630,5052477..5052620,
FT                   5054327..5054446,5055586..5055660,5055776..5055940,
FT                   5061126..5061230,5061555..5061743,5065309..5065419,
FT                   5066738..5067363)
FT                   /locus_tag="mCG_11586"
FT                   /product="mCG11586, transcript variant mCT174315"
FT                   /note="gene_id=mCG11586.2 transcript_id=mCT174315.0 created
FT                   on 14-OCT-2002"
FT   mRNA            join(5027525..5027750,5028664..5028924,5030137..5030430,
FT                   5034094..5034228,5042391..5042555,5046021..5046170,
FT                   5048224..5048368,5049186..5049339,5050334..5050630,
FT                   5052477..5052620,5054327..5054446,5055586..5055660,
FT                   5055776..5055940,5061126..5061230,5061555..5061743,
FT                   5065309..5065419,5066738..5068451)
FT                   /locus_tag="mCG_11586"
FT                   /product="mCG11586, transcript variant mCT11907"
FT                   /note="gene_id=mCG11586.2 transcript_id=mCT11907.2 created
FT                   on 14-OCT-2002"
FT   CDS             join(5027531..5027750,5028664..5028924,5030137..5030430,
FT                   5034094..5034228,5042391..5042555,5046021..5046170,
FT                   5048224..5048368,5049186..5049339,5050334..5050630,
FT                   5052477..5052620,5054327..5054446,5055586..5055660,
FT                   5055776..5055940,5061126..5061230,5061555..5061743,
FT                   5065309..5065419,5066738..5066821)
FT                   /codon_start=1
FT                   /locus_tag="mCG_11586"
FT                   /product="mCG11586, isoform CRA_b"
FT                   /note="gene_id=mCG11586.2 transcript_id=mCT11907.2
FT                   protein_id=mCP22518.2 isoform=CRA_b"
FT                   /protein_id="EDL10037.1"
FT                   /translation="MAFISVYYRTREKKREDGKWRDYERYYERNELYREKYDWRRGRSK
FT                   SRSKSRGLSRSRSRSRGRSKDRDPNRNVEHRERSKFKSERNDLESSYVPVSAPPPSSSE
FT                   QYSSGAQSIPSTVTVIAPAHHSENTTESWSNYYNNHSSSNSFGRNPPPKRRCRDYDERG
FT                   FCVLGDLCQFDHGNDPLVVDEVALPSMIPFPPPPPGLPPPPPPGMLMPPMPGPGPGPGP
FT                   GPGPGPGPGPGPGHSMRLPVPQGHGQPPPSVVLPIPRPPISQSSLINSRDQPGTSAVPN
FT                   LAPVGARLPPPLPQNLLYTVSERQPMYSREHGAAASERLQLGTPPPLLAARLVPPRNLM
FT                   GSSIGYHTSVSSPTPLVPDTYEPDGYNPEAPSITSSGRSQYRQFFSRAQTQRPNLIGLT
FT                   SGDMDANPRAANIVIQTEPPVPVSVNSNVTRVVLEPESRKRAISGLEGPLTKKPWLGKQ
FT                   GNNNQSKPGFLRKNHYTNTKLEVKKIPQELNNITKLNEHFSKFGTIVNIQVAFKGDPEA
FT                   ALIQYLTNEEARKAISSTEAVLNNRFIRVLWHRENNEQPALQSSAQILLQQQHTLSHLS
FT                   QQHHSLPQHLHPQQVMVTQSSPSSVHGGIQKMMGKPQTSGAYVLNKVPVKHRLGHASTN
FT                   QSDTSHLLNQTGGSSGEDCPVFSTPGHPKTIYSSSNLKAPSKLCSGSKSHDVQEVLKKK
FT                   QEAMKLQQDMRKKKQEMLEKQIECQKMLISKLEKNKNMKPEERANIMKTLKELGEKISQ
FT                   LKDELKTSSTVSTPSKVKTKTEAQKELLDTELDLHKRLSSGEDTTELRKKLSQLQVEAA
FT                   RLGILPVGRGKTISSQGRGRGRGRGRGRGSLNHMVVDHRPKALPGGGFIEEEKDELLQH
FT                   FSATNQASKFKDRRLQISWHKPKVPSISTETEEEEVKEEETETSDLFLHDDDDEDEDEY
FT                   ESRSWRR"
FT   CDS             join(5030277..5030430,5034094..5034228,5042391..5042555,
FT                   5046021..5046170,5048224..5048368,5049186..5049339,
FT                   5050334..5050630,5052477..5052620,5054327..5054446,
FT                   5055586..5055660,5055776..5055940,5061126..5061230,
FT                   5061555..5061743,5065309..5065419,5066738..5066821)
FT                   /codon_start=1
FT                   /locus_tag="mCG_11586"
FT                   /product="mCG11586, isoform CRA_a"
FT                   /note="gene_id=mCG11586.2 transcript_id=mCT174315.0
FT                   protein_id=mCP97234.0 isoform=CRA_a"
FT                   /protein_id="EDL10036.1"
FT                   /translation="MLMPPMPGPGPGPGPGPGPGPGPGPGPGHSMRLPVPQGHGQPPPS
FT                   VVLPIPRPPISQSSLINSRDQPGTSAVPNLAPVGARLPPPLPQNLLYTVSERQPMYSRE
FT                   HGAAASERLQLGTPPPLLAARLVPPRNLMGSSIGYHTSVSSPTPLVPDTYEPDGYNPEA
FT                   PSITSSGRSQYRQFFSRAQTQRPNLIGLTSGDMDANPRAANIVIQTEPPVPVSVNSNVT
FT                   RVVLEPESRKRAISGLEGPLTKKPWLGKQGNNNQSKPGFLRKNHYTNTKLEVKKIPQEL
FT                   NNITKLNEHFSKFGTIVNIQVAFKGDPEAALIQYLTNEEARKAISSTEAVLNNRFIRVL
FT                   WHRENNEQPALQSSAQILLQQQHTLSHLSQQHHSLPQHLHPQQVMVTQSSPSSVHGGIQ
FT                   KMMGKPQTSGAYVLNKVPVKHRLGHASTNQSDTSHLLNQTGGSSGEDCPVFSTPGHPKT
FT                   IYSSSNLKAPSKLCSGSKSHDVQEVLKKKQEAMKLQQDMRKKKQEMLEKQIECQKMLIS
FT                   KLEKNKNMKPEERANIMKTLKELGEKISQLKDELKTSSTVSTPSKVKTKTEAQKELLDT
FT                   ELDLHKRLSSGEDTTELRKKLSQLQVEAARLGILPVGRGKTISSQGRGRGRGRGRGRGS
FT                   LNHMVVDHRPKALPGGGFIEEEKDELLQHFSATNQASKFKDRRLQISWHKPKVPSISTE
FT                   TEEEEVKEEETETSDLFLHDDDDEDEDEYESRSWRR"
FT   gene            <5123014..5125613
FT                   /gene="Pou4f3"
FT                   /locus_tag="mCG_142213"
FT                   /note="gene_id=mCG142213.0"
FT   mRNA            join(<5123014..5123133,5123477..5125613)
FT                   /gene="Pou4f3"
FT                   /locus_tag="mCG_142213"
FT                   /product="POU domain, class 4, transcription factor 3"
FT                   /note="gene_id=mCG142213.0 transcript_id=mCT179419.0
FT                   created on 06-FEB-2003"
FT   CDS             join(5123014..5123133,5123477..5124373)
FT                   /codon_start=1
FT                   /gene="Pou4f3"
FT                   /locus_tag="mCG_142213"
FT                   /product="POU domain, class 4, transcription factor 3"
FT                   /note="gene_id=mCG142213.0 transcript_id=mCT179419.0
FT                   protein_id=mCP102341.0"
FT                   /db_xref="GOA:Q63955"
FT                   /db_xref="InterPro:IPR000327"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR013847"
FT                   /db_xref="InterPro:IPR017970"
FT                   /db_xref="MGI:MGI:102523"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q63955"
FT                   /protein_id="EDL10035.1"
FT                   /translation="MMAMNAKQPFGMHPVLQEPKFSSLHSGSEAMRRVCLPAPQLQGNI
FT                   FGSFDESLLARAEALAAVDIVSHGKNHPFKPDATYHTMSSVPCTSTSPTVPISHPAALT
FT                   SHPHHAVHQGLEGDLLEHISPTLSVSGLGAPEHSVMPAQIHPHHLGAMGHLHQAMGMSH
FT                   PHAVAPHSAMPACLSDVESDPRELEAFAERFKQRRIKLGVTQADVGAALANLKIPGVGS
FT                   LSQSTICRFESLTLSHNNMIALKPVLQAWLEEAEAAYREKNSKPELFNGSERKRKRTSI
FT                   AAPEKRSLEAYFAIQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKYSAVH"
FT   gene            5170941..5171514
FT                   /locus_tag="mCG_11578"
FT                   /note="gene_id=mCG11578.1"
FT   mRNA            5170941..5171514
FT                   /locus_tag="mCG_11578"
FT                   /product="mCG11578"
FT                   /note="gene_id=mCG11578.1 transcript_id=mCT11898.1 created
FT                   on 14-OCT-2002"
FT   CDS             5170976..5171464
FT                   /codon_start=1
FT                   /locus_tag="mCG_11578"
FT                   /product="mCG11578"
FT                   /note="gene_id=mCG11578.1 transcript_id=mCT11898.1
FT                   protein_id=mCP22523.1"
FT                   /protein_id="EDL10034.1"
FT                   /translation="MTNTKGKQRGTRYMFSRLFRKHGVVPLATYMRIYKKGDIVDIKGM
FT                   GMGTVQKGMPHKCYHGKTGRVYNVTQHAMGIIVNKQVKGKILAKRINVRIEHIKHSKSR
FT                   DSFLKRVKENDQKKKEAKEKGTWVQLKRQPVPPREAHFVRTNGKEPELLEPIPYEFMA"
FT   gene            5246126..5312044
FT                   /locus_tag="mCG_127945"
FT                   /note="gene_id=mCG127945.1"
FT   mRNA            join(5246126..5246208,5253645..5253870,5257209..5257361,
FT                   5258188..5258647,5264988..5265230,5269429..5269491,
FT                   5270522..5270722,5271206..5271318,5272312..5272400,
FT                   5285359..5285519,5286800..5286856,5287004..5287070,
FT                   5289452..5289587,5290368..5290457,5297192..5297310,
FT                   5300339..5300489,5304128..5304292,5304685..5304867,
FT                   5307272..5307451,5308081..5308164,5309517..5309617,
FT                   5310417..5310510,5310775..5311101)
FT                   /locus_tag="mCG_127945"
FT                   /product="mCG127945, transcript variant mCT129237"
FT                   /note="gene_id=mCG127945.1 transcript_id=mCT129237.1
FT                   created on 14-OCT-2002"
FT   mRNA            join(5246126..5246208,5253645..5253870,5257209..5257361,
FT                   5258188..5258647,5264988..5265230,5269429..5269491,
FT                   5270522..5270722,5271206..5271318,5272312..5272400,
FT                   5285359..5285519,5286800..5286856,5287004..5287070,
FT                   5289452..5289587,5290368..5290457,5297192..5297310,
FT                   5300339..5300489,5304128..5304292,5304685..5304867,
FT                   5307272..5307451,5308081..5308164,5309517..5309617,
FT                   5310775..5311101)
FT                   /locus_tag="mCG_127945"
FT                   /product="mCG127945, transcript variant mCT174100"
FT                   /note="gene_id=mCG127945.1 transcript_id=mCT174100.0
FT                   created on 14-OCT-2002"
FT   mRNA            join(5246126..5246208,5253645..5253870,5257209..5257361,
FT                   5258188..5258647,5264988..5265230,5269429..5269491,
FT                   5270522..5270722,5271206..5271318,5272312..5272400,
FT                   5285359..5285519,5286800..5286856,5287004..5287070,
FT                   5289452..5290457)
FT                   /locus_tag="mCG_127945"
FT                   /product="mCG127945, transcript variant mCT174101"
FT                   /note="gene_id=mCG127945.1 transcript_id=mCT174101.0
FT                   created on 14-OCT-2002"
FT   mRNA            join(<5246147..5246208,5253645..5253870,5257209..5257361,
FT                   5258188..5258647,5264988..5265230,5270522..5270722,
FT                   5271206..5271318,5272312..5272400,5285359..5285519,
FT                   5286800..5286856,5287004..5287070,5289452..5289587,
FT                   5290368..5290457,5297192..5297310,5300339..5300489,
FT                   5304128..5304292,5304685..5304867,5307272..5307451,
FT                   5308081..5308164,5309517..5309617,5310775..5311810)
FT                   /locus_tag="mCG_127945"
FT                   /product="mCG127945, transcript variant mCT190275"
FT                   /note="gene_id=mCG127945.1 transcript_id=mCT190275.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<5246147..5246208,5253645..5253870,5257209..5257361,
FT                   5258188..5258647,5264988..5265230,5270522..5270722,
FT                   5271206..5271318,5272312..5272400,5285359..5285519,
FT                   5286800..5286856,5287004..5287070,5289452..5289587,
FT                   5290368..5290457,5297192..5297310,5300339..5300489,
FT                   5304128..5304292,5304685..5304867,5307272..5307451,
FT                   5308081..5308164,5309517..5309617,5310775..5310976)
FT                   /codon_start=1
FT                   /locus_tag="mCG_127945"
FT                   /product="mCG127945, isoform CRA_b"
FT                   /note="gene_id=mCG127945.1 transcript_id=mCT190275.0
FT                   protein_id=mCP111261.0 isoform=CRA_b"
FT                   /protein_id="EDL10030.1"
FT                   /translation="VMAERGGDGGEGERFNPGELRMAQQQALRFRGPAPPPNAVMRGPP
FT                   PLMRPPPPFGMMRGPPPPPRPPFGRPPFDPNMPPMPPPGGIPPPMGPPHLQRPPFMPPP
FT                   MGAMPPPPGMMFPPGMPPGTAPGAPALPPTEEIWVENKTPDGKVYYYNARTRESAWTKP
FT                   DGVKVIQQSELTPMLAAQAQVQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQA
FT                   QAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQVQAQAVGAPTPTTSSPAPAVSTSTPTST
FT                   PSSTTATTTTATSVAQTVSTPTTQDQTPSSAVSVATPTVSVSAPAPTATPVQTVPQPHP
FT                   QTLPPAVPHSVPQPAAAIPAFPPVMVPPFRVPLPGMPIPLPGVLPGMAPPIVPMIHPQV
FT                   AIAASPATLAGATAVSEWTEYKTADGKTYYYNNRTLESTWEKPQELKEKEKLDEKIKEP
FT                   IKEASEEPLPMETEEEDPKEEPVKEIKEEPKEEEMTEEEKAAQKAKPVATTPIPGTPWC
FT                   VVWTGDERVFFYNPTTRLSMWDRPDDLIGRADVDKIIQEPPHKKGLEDMKKLRHPAPTM
FT                   LSIQKWQFSMSAIKEEQELMEEMNEDEPIKAKKRKRDDNKDIDSEKEAAMEAEIKAARE
FT                   RAIVPLEARMKQFKDMLLERGVSAFSTWEKELHKIVFDPRYLLLNPKERKQVFDQYVKT
FT                   RAEEERREKKNKIMQAKEDFKKMMEEAKFNPRATFSEFAAKHAKDSRFKAIEKMKDREA
FT                   LFNEFVAAARKKEKEDSKTRGEKIKSDFFELLSNHHLDSQSRWSKVKDKVESDPRYKAV
FT                   DSSSMREDLFKQYIEKIAKNLDSEKEKELERQARIEASLREREREVQKARSEQTKEIDR
FT                   EREQHKREEAIQNFKALLSDMVRSSDVSWSDTRRTLRKDHRWESGSLLEREEKEKLFNE
FT                   HIEALTKKKREHFRQLLDETSAITLTSTWKEVKKIIKEDPRCIKFSSSDRKKQREFEEY
FT                   IRDKYITAKADFRTLLKETKFITYRSKKLIQESDQHLKDVEKILQNDKRYLVLDCVPEE
FT                   RRKLIVAYVDDLDRRGPPPPPTASEPTRRSTK"
FT   CDS             join(5246150..5246208,5253645..5253870,5257209..5257361,
FT                   5258188..5258647,5264988..5265230,5269429..5269491,
FT                   5270522..5270722,5271206..5271318,5272312..5272400,
FT                   5285359..5285519,5286800..5286856,5287004..5287070,
FT                   5289452..5289587,5290368..5290457,5297192..5297310,
FT                   5300339..5300489,5304128..5304292,5304685..5304867,
FT                   5307272..5307451,5308081..5308164,5309517..5309617,
FT                   5310775..5310976)
FT                   /codon_start=1
FT                   /locus_tag="mCG_127945"
FT                   /product="mCG127945, isoform CRA_a"
FT                   /note="gene_id=mCG127945.1 transcript_id=mCT174100.0
FT                   protein_id=mCP97020.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q3TH57"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="InterPro:IPR002713"
FT                   /db_xref="MGI:MGI:1926421"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TH57"
FT                   /protein_id="EDL10029.1"
FT                   /translation="MAERGGDGGEGERFNPGELRMAQQQALRFRGPAPPPNAVMRGPPP
FT                   LMRPPPPFGMMRGPPPPPRPPFGRPPFDPNMPPMPPPGGIPPPMGPPHLQRPPFMPPPM
FT                   GAMPPPPGMMFPPGMPPGTAPGAPALPPTEEIWVENKTPDGKVYYYNARTRESAWTKPD
FT                   GVKVIQQSELTPMLAAQAQVQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQ
FT                   AQAQAQAQAQAQAQAQAQAQAQAQAQAQAQVQAQAVGAPTPTTSSPAPAVSTSTPTSTP
FT                   SSTTATTTTATSVAQTVSTPTTQDQTPSSAVSVATPTVSVSAPAPTATPVQTVPQPHPQ
FT                   TLPPAVPHSVPQPAAAIPAFPPVMVPPFRVPLPGMPIPLPGVAMMQIVSCPYVKTVATT
FT                   KTGVLPGMAPPIVPMIHPQVAIAASPATLAGATAVSEWTEYKTADGKTYYYNNRTLEST
FT                   WEKPQELKEKEKLDEKIKEPIKEASEEPLPMETEEEDPKEEPVKEIKEEPKEEEMTEEE
FT                   KAAQKAKPVATTPIPGTPWCVVWTGDERVFFYNPTTRLSMWDRPDDLIGRADVDKIIQE
FT                   PPHKKGLEDMKKLRHPAPTMLSIQKWQFSMSAIKEEQELMEEMNEDEPIKAKKRKRDDN
FT                   KDIDSEKEAAMEAEIKAARERAIVPLEARMKQFKDMLLERGVSAFSTWEKELHKIVFDP
FT                   RYLLLNPKERKQVFDQYVKTRAEEERREKKNKIMQAKEDFKKMMEEAKFNPRATFSEFA
FT                   AKHAKDSRFKAIEKMKDREALFNEFVAAARKKEKEDSKTRGEKIKSDFFELLSNHHLDS
FT                   QSRWSKVKDKVESDPRYKAVDSSSMREDLFKQYIEKIAKNLDSEKEKELERQARIEASL
FT                   REREREVQKARSEQTKEIDREREQHKREEAIQNFKALLSDMVRSSDVSWSDTRRTLRKD
FT                   HRWESGSLLEREEKEKLFNEHIEALTKKKREHFRQLLDETSAITLTSTWKEVKKIIKED
FT                   PRCIKFSSSDRKKQREFEEYIRDKYITAKADFRTLLKETKFITYRSKKLIQESDQHLKD
FT                   VEKILQNDKRYLVLDCVPEERRKLIVAYVDDLDRRGPPPPPTASEPTRRSTK"
FT   CDS             join(5246150..5246208,5253645..5253870,5257209..5257361,
FT                   5258188..5258647,5264988..5265230,5269429..5269491,
FT                   5270522..5270722,5271206..5271318,5272312..5272400,
FT                   5285359..5285519,5286800..5286856,5287004..5287070,
FT                   5289452..5289587,5290368..5290457,5297192..5297310,
FT                   5300339..5300489,5304128..5304292,5304685..5304867,
FT                   5307272..5307451,5308081..5308164,5309517..5309617,
FT                   5310417..5310420)
FT                   /codon_start=1
FT                   /locus_tag="mCG_127945"
FT                   /product="mCG127945, isoform CRA_c"
FT                   /note="gene_id=mCG127945.1 transcript_id=mCT129237.1
FT                   protein_id=mCP77670.1 isoform=CRA_c"
FT                   /protein_id="EDL10031.1"
FT                   /translation="MAERGGDGGEGERFNPGELRMAQQQALRFRGPAPPPNAVMRGPPP
FT                   LMRPPPPFGMMRGPPPPPRPPFGRPPFDPNMPPMPPPGGIPPPMGPPHLQRPPFMPPPM
FT                   GAMPPPPGMMFPPGMPPGTAPGAPALPPTEEIWVENKTPDGKVYYYNARTRESAWTKPD
FT                   GVKVIQQSELTPMLAAQAQVQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQ
FT                   AQAQAQAQAQAQAQAQAQAQAQAQAQAQAQVQAQAVGAPTPTTSSPAPAVSTSTPTSTP
FT                   SSTTATTTTATSVAQTVSTPTTQDQTPSSAVSVATPTVSVSAPAPTATPVQTVPQPHPQ
FT                   TLPPAVPHSVPQPAAAIPAFPPVMVPPFRVPLPGMPIPLPGVAMMQIVSCPYVKTVATT
FT                   KTGVLPGMAPPIVPMIHPQVAIAASPATLAGATAVSEWTEYKTADGKTYYYNNRTLEST
FT                   WEKPQELKEKEKLDEKIKEPIKEASEEPLPMETEEEDPKEEPVKEIKEEPKEEEMTEEE
FT                   KAAQKAKPVATTPIPGTPWCVVWTGDERVFFYNPTTRLSMWDRPDDLIGRADVDKIIQE
FT                   PPHKKGLEDMKKLRHPAPTMLSIQKWQFSMSAIKEEQELMEEMNEDEPIKAKKRKRDDN
FT                   KDIDSEKEAAMEAEIKAARERAIVPLEARMKQFKDMLLERGVSAFSTWEKELHKIVFDP
FT                   RYLLLNPKERKQVFDQYVKTRAEEERREKKNKIMQAKEDFKKMMEEAKFNPRATFSEFA
FT                   AKHAKDSRFKAIEKMKDREALFNEFVAAARKKEKEDSKTRGEKIKSDFFELLSNHHLDS
FT                   QSRWSKVKDKVESDPRYKAVDSSSMREDLFKQYIEKIAKNLDSEKEKELERQARIEASL
FT                   REREREVQKARSEQTKEIDREREQHKREEAIQNFKALLSDMVRSSDVSWSDTRRTLRKD
FT                   HRWESGSLLEREEKEKLFNEHIEALTKKKREHFRQLLDETSAITLTSTWKEVKKIIKED
FT                   PRCIKFSSSDRKKQREFEEYIRDKYITAKADFRTLLKETKFITYS"
FT   CDS             join(5246150..5246208,5253645..5253870,5257209..5257361,
FT                   5258188..5258647,5264988..5265230,5269429..5269491,
FT                   5270522..5270722,5271206..5271318,5272312..5272400,
FT                   5285359..5285519,5286800..5286856,5287004..5287070,
FT                   5289452..5289653)
FT                   /codon_start=1
FT                   /locus_tag="mCG_127945"
FT                   /product="mCG127945, isoform CRA_e"
FT                   /note="gene_id=mCG127945.1 transcript_id=mCT174101.0
FT                   protein_id=mCP97019.0 isoform=CRA_e"
FT                   /protein_id="EDL10033.1"
FT                   /translation="MAERGGDGGEGERFNPGELRMAQQQALRFRGPAPPPNAVMRGPPP
FT                   LMRPPPPFGMMRGPPPPPRPPFGRPPFDPNMPPMPPPGGIPPPMGPPHLQRPPFMPPPM
FT                   GAMPPPPGMMFPPGMPPGTAPGAPALPPTEEIWVENKTPDGKVYYYNARTRESAWTKPD
FT                   GVKVIQQSELTPMLAAQAQVQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQ
FT                   AQAQAQAQAQAQAQAQAQAQAQAQAQAQAQVQAQAVGAPTPTTSSPAPAVSTSTPTSTP
FT                   SSTTATTTTATSVAQTVSTPTTQDQTPSSAVSVATPTVSVSAPAPTATPVQTVPQPHPQ
FT                   TLPPAVPHSVPQPAAAIPAFPPVMVPPFRVPLPGMPIPLPGVAMMQIVSCPYVKTVATT
FT                   KTGVLPGMAPPIVPMIHPQVAIAASPATLAGATAVSEWTEYKTADGKTYYYNNRTLEST
FT                   WEKPQELKEKEKLDEKIKEPIKEASEEPLPMETEEEDPKEEPVKEIKEEPKEEEMTEEE
FT                   KAAQKAKPVATTPIPGTPWCVVWTGDERVFFYNPTTRLSMWDRPDDLIGRADVDKIIQE
FT                   PPHKKGLEDMKKLRHPAPTMLSIQKWQFSMSAIKEEQELMEEMNEDEPIKAKKRKRDDN
FT                   KDIDSEKEAAMEAEIKAARERAIVPLEARMKQFKDMLLERGVRKQSLGEIFLFYISNIN
FT                   MSC"
FT   mRNA            join(5289802..5290457,5297192..5297310,5300339..5300489,
FT                   5304128..5304292,5304685..5304867,5307272..5307451,
FT                   5308081..5308164,5309517..5309617,5310775..5312044)
FT                   /locus_tag="mCG_127945"
FT                   /product="mCG127945, transcript variant mCT174102"
FT                   /note="gene_id=mCG127945.1 transcript_id=mCT174102.0
FT                   created on 14-OCT-2002"
FT   CDS             join(5290308..5290457,5297192..5297310,5300339..5300489,
FT                   5304128..5304292,5304685..5304867,5307272..5307451,
FT                   5308081..5308164,5309517..5309617,5310775..5310976)
FT                   /codon_start=1
FT                   /locus_tag="mCG_127945"
FT                   /product="mCG127945, isoform CRA_d"
FT                   /note="gene_id=mCG127945.1 transcript_id=mCT174102.0
FT                   protein_id=mCP97021.0 isoform=CRA_d"
FT                   /protein_id="EDL10032.1"
FT                   /translation="MTFLELSILIMRQCFLFILKVSAFSTWEKELHKIVFDPRYLLLNP
FT                   KERKQVFDQYVKTRAEEERREKKNKIMQAKEDFKKMMEEAKFNPRATFSEFAAKHAKDS
FT                   RFKAIEKMKDREALFNEFVAAARKKEKEDSKTRGEKIKSDFFELLSNHHLDSQSRWSKV
FT                   KDKVESDPRYKAVDSSSMREDLFKQYIEKIAKNLDSEKEKELERQARIEASLREREREV
FT                   QKARSEQTKEIDREREQHKREEAIQNFKALLSDMVRSSDVSWSDTRRTLRKDHRWESGS
FT                   LLEREEKEKLFNEHIEALTKKKREHFRQLLDETSAITLTSTWKEVKKIIKEDPRCIKFS
FT                   SSDRKKQREFEEYIRDKYITAKADFRTLLKETKFITYRSKKLIQESDQHLKDVEKILQN
FT                   DKRYLVLDCVPEERRKLIVAYVDDLDRRGPPPPPTASEPTRRSTK"
FT   gene            complement(5314140..5315896)
FT                   /gene="Gpr151"
FT                   /locus_tag="mCG_142727"
FT                   /note="gene_id=mCG142727.0"
FT   mRNA            complement(5314140..5315896)
FT                   /gene="Gpr151"
FT                   /locus_tag="mCG_142727"
FT                   /product="G protein-coupled receptor 151"
FT                   /note="gene_id=mCG142727.0 transcript_id=mCT181969.0
FT                   created on 17-APR-2003"
FT   CDS             complement(5314602..5315870)
FT                   /codon_start=1
FT                   /gene="Gpr151"
FT                   /locus_tag="mCG_142727"
FT                   /product="G protein-coupled receptor 151"
FT                   /note="gene_id=mCG142727.0 transcript_id=mCT181969.0
FT                   protein_id=mCP104891.0"
FT                   /protein_id="EDL10028.1"
FT                   /translation="MGKAMLRAGFADTNSSNMNESFARLHFAGGYLPSDSKDWRTIIPS
FT                   LLMAVCLVGLVGNLCVIGILLHGVWKRKPSTIHSLILNLSLADFSLLLFSAPVRAAAYS
FT                   KGVWDLGWFICKSSDWFTHVCMAAKSLTFVVVAKACFAYASDPAKQESIHSRTIWSVLA
FT                   GIWVVASLLPLPEWLFSTTRRHAGVEMCLVDVPAVAEEFMSMFGKLYPLLVFCLPLLLA
FT                   GVYFWRAYDQCKTRCTKTRNLRDQMRSKQLTVMLLSTAIISALLWLPEWIAWLWVWHVK
FT                   AGGPMPPQGFIALSQVLMFFTSTANPLIFLVMSEEFKAGLKGLWKWMITRKPAVTSEVQ
FT                   EAPAGNTEALPGKAPSPETQTCILDTDGRGSPDDSKEKSGKVVAPILPDVEQFWHERDA
FT                   VPSAQDNDPIPWEHEGQETEGCN"
FT   gene            complement(5351522..5353812)
FT                   /locus_tag="mCG_147293"
FT                   /note="gene_id=mCG147293.0"
FT   mRNA            complement(join(5351522..5351828,5353093..5353812))
FT                   /locus_tag="mCG_147293"
FT                   /product="mCG147293"
FT                   /note="gene_id=mCG147293.0 transcript_id=mCT187556.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(join(5351823..5351828,5353093..5353209))
FT                   /codon_start=1
FT                   /locus_tag="mCG_147293"
FT                   /product="mCG147293"
FT                   /note="gene_id=mCG147293.0 transcript_id=mCT187556.0
FT                   protein_id=mCP109680.0"
FT                   /protein_id="EDL10027.1"
FT                   /translation="MKKGEILWHESYKQLDNGRSRRNRLPWGRGPNPEVVYIQE"
FT   gene            complement(5373354..5797608)
FT                   /gene="Ppp2r2b"
FT                   /locus_tag="mCG_5620"
FT                   /note="gene_id=mCG5620.2"
FT   mRNA            complement(join(5373354..5373849,5384449..5384540,
FT                   5398882..5399051,5424292..5424456,5437505..5437682,
FT                   5467801..5467913,5473919..5474084,5477117..5477214,
FT                   5634621..5634865))
FT                   /gene="Ppp2r2b"
FT                   /locus_tag="mCG_5620"
FT                   /product="protein phosphatase 2 (formerly 2A), regulatory
FT                   subunit B (PR 52), beta isoform, transcript variant
FT                   mCT174148"
FT                   /note="gene_id=mCG5620.2 transcript_id=mCT174148.0 created
FT                   on 14-OCT-2002"
FT   CDS             complement(join(5373561..5373849,5384449..5384540,
FT                   5398882..5399051,5424292..5424456,5437505..5437682,
FT                   5467801..5467913,5473919..5474084,5477117..5477214,
FT                   5634621..5634690))
FT                   /codon_start=1
FT                   /gene="Ppp2r2b"
FT                   /locus_tag="mCG_5620"
FT                   /product="protein phosphatase 2 (formerly 2A), regulatory
FT                   subunit B (PR 52), beta isoform, isoform CRA_a"
FT                   /note="gene_id=mCG5620.2 transcript_id=mCT174148.0
FT                   protein_id=mCP97067.0 isoform=CRA_a"
FT                   /protein_id="EDL10023.1"
FT                   /translation="MEEDIDTRKINNSFLRDHSYATEADIISTVEFNHTGELLATGDKG
FT                   GRVVIFQREQESKNQVHRRGEYNVYSTFQSHEPEFDYLKSLEIEEKINKIRWLPQQNAA
FT                   YFLLSTNDKTVKLWKVSERDKRPEGYNLKDEEGRLRDPATITTLRVPVLRPMDLMVEAT
FT                   PRRVFANAHTYHINSISVNSDYETYMSADDLRINLWNFEITNQSFNIVDIKPANMEELT
FT                   EVITAAEFHPHHCNTFVYSSSKGTIRLCDMRASALCDRHTKFFEEPEDPSNRSFFSEII
FT                   SSISDVKFSHSGRYIMTRDYLTVKVWDLNMENRPIETYQVHDYLRSKLCSLYENDCIFD
FT                   KFECVWNGSDRQGLITSHVTAVGDKMAWNAKMSAFIGDWTDVPEIACPPQKKKVYFQET
FT                   LTFLSTEIMPPLQGWNSISASLLPAPRGLNHSITLMCPRRDSGDPPA"
FT   mRNA            complement(join(5381001..5381782,5384449..5384540,
FT                   5398882..5399051,5424292..5424456,5433462..5433467,
FT                   5437505..5437682,5467801..5467913,5473919..5474084,
FT                   5477117..5477214,5634621..5634865))
FT                   /gene="Ppp2r2b"
FT                   /locus_tag="mCG_5620"
FT                   /product="protein phosphatase 2 (formerly 2A), regulatory
FT                   subunit B (PR 52), beta isoform, transcript variant
FT                   mCT4818"
FT                   /note="gene_id=mCG5620.2 transcript_id=mCT4818.2 created on
FT                   14-OCT-2002"
FT   mRNA            complement(join(5381198..5381782,5384449..5384540,
FT                   5398882..5399051,5424292..5424456,5437505..5437682,
FT                   5467801..5467913,5473919..5474084,5477117..5477214,
FT                   5797323..5797608))
FT                   /gene="Ppp2r2b"
FT                   /locus_tag="mCG_5620"
FT                   /product="protein phosphatase 2 (formerly 2A), regulatory
FT                   subunit B (PR 52), beta isoform, transcript variant
FT                   mCT174147"
FT                   /note="gene_id=mCG5620.2 transcript_id=mCT174147.0 created
FT                   on 14-OCT-2002"
FT   CDS             complement(join(5381503..5381782,5384449..5384540,
FT                   5398882..5399051,5424292..5424456,5437505..5437682,
FT                   5467801..5467913,5473919..5474084,5477117..5477214,
FT                   5797323..5797401))
FT                   /codon_start=1
FT                   /gene="Ppp2r2b"
FT                   /locus_tag="mCG_5620"
FT                   /product="protein phosphatase 2 (formerly 2A), regulatory
FT                   subunit B (PR 52), beta isoform, isoform CRA_c"
FT                   /note="gene_id=mCG5620.2 transcript_id=mCT174147.0
FT                   protein_id=mCP97066.0 isoform=CRA_c"
FT                   /db_xref="GOA:Q6ZWR4"
FT                   /db_xref="InterPro:IPR000009"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR018067"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="MGI:MGI:1920180"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6ZWR4"
FT                   /protein_id="EDL10025.1"
FT                   /translation="MKCFSRYLPYIFRPPNTILSSSCHTEADIISTVEFNHTGELLATG
FT                   DKGGRVVIFQREQESKNQVHRRGEYNVYSTFQSHEPEFDYLKSLEIEEKINKIRWLPQQ
FT                   NAAYFLLSTNDKTVKLWKVSERDKRPEGYNLKDEEGRLRDPATITTLRVPVLRPMDLMV
FT                   EATPRRVFANAHTYHINSISVNSDYETYMSADDLRINLWNFEITNQSFNIVDIKPANME
FT                   ELTEVITAAEFHPHHCNTFVYSSSKGTIRLCDMRASALCDRHTKFFEEPEDPSNRSFFS
FT                   EIISSISDVKFSHSGRYIMTRDYLTVKVWDLNMENRPIETYQVHDYLRSKLCSLYENDC
FT                   IFDKFECVWNGSDSVIMTGSYNNFFRMFDRNTKRDVTLEASRENSKPRAILKPRKVCVG
FT                   GKRRKDEISVDSLDFSKKILHTAWHPSENIIAVAATNNLYIFQDKVN"
FT   CDS             complement(join(5381503..5381782,5384449..5384540,
FT                   5398882..5399051,5424292..5424456,5433462..5433467,
FT                   5437505..5437682,5467801..5467913,5473919..5474084,
FT                   5477117..5477214,5634621..5634690))
FT                   /codon_start=1
FT                   /gene="Ppp2r2b"
FT                   /locus_tag="mCG_5620"
FT                   /product="protein phosphatase 2 (formerly 2A), regulatory
FT                   subunit B (PR 52), beta isoform, isoform CRA_b"
FT                   /note="gene_id=mCG5620.2 transcript_id=mCT4818.2
FT                   protein_id=mCP13143.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q6ZWR4"
FT                   /db_xref="InterPro:IPR000009"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR018067"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="MGI:MGI:1920180"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6ZWR4"
FT                   /protein_id="EDL10024.1"
FT                   /translation="MEEDIDTRKINNSFLRDHSYATEADIISTVEFNHTGELLATGDKG
FT                   GRVVIFQREQESKNQVHRRGEYNVYSTFQSHEPEFDYLKSLEIEEKINKIRWLPQQNAA
FT                   YFLLSTNDKTVKLWKVSERDKRPEGYNLKDEEGRLRDPATITTLRVPVLRPMDLMVEAT
FT                   PRRVFANAHTYHINSISVNSDYETYMSADDLRINLWNFEITNQSFMPDIVDIKPANMEE
FT                   LTEVITAAEFHPHHCNTFVYSSSKGTIRLCDMRASALCDRHTKFFEEPEDPSNRSFFSE
FT                   IISSISDVKFSHSGRYIMTRDYLTVKVWDLNMENRPIETYQVHDYLRSKLCSLYENDCI
FT                   FDKFECVWNGSDSVIMTGSYNNFFRMFDRNTKRDVTLEASRENSKPRAILKPRKVCVGG
FT                   KRRKDEISVDSLDFSKKILHTAWHPSENIIAVAATNNLYIFQDKVN"
FT   gene            5671298..5674724
FT                   /locus_tag="mCG_147295"
FT                   /note="gene_id=mCG147295.0"
FT   mRNA            join(5671298..5671490,5673615..5674724)
FT                   /locus_tag="mCG_147295"
FT                   /product="mCG147295"
FT                   /note="gene_id=mCG147295.0 transcript_id=mCT187558.0
FT                   created on 13-JAN-2004"
FT   CDS             5673749..5673988
FT                   /codon_start=1
FT                   /locus_tag="mCG_147295"
FT                   /product="mCG147295"
FT                   /note="gene_id=mCG147295.0 transcript_id=mCT187558.0
FT                   protein_id=mCP109683.0"
FT                   /protein_id="EDL10026.1"
FT                   /translation="MAKEVADIGKSCTLICSFCLCVRSSHDVKGYHLHREDWFSKSVWE
FT                   SSSYLFVILVNINISPGLSISVRMIFTIGLFYPL"
FT   gene            complement(5776667..5912425)
FT                   /locus_tag="mCG_62349"
FT                   /note="gene_id=mCG62349.2"
FT   mRNA            complement(join(5776667..5776738,5806842..5807029,
FT                   5812815..5812898,5820927..5821001,5825705..5825860,
FT                   5827275..5827618,5828513..5828610,5829053..5829179,
FT                   5837049..5837089,5912286..5912425))
FT                   /locus_tag="mCG_62349"
FT                   /product="mCG62349"
FT                   /note="gene_id=mCG62349.2 transcript_id=mCT62532.2 created
FT                   on 14-OCT-2002"
FT   CDS             complement(join(5827583..5827618,5828513..5828610,
FT                   5829053..5829179,5837049..5837051))
FT                   /codon_start=1
FT                   /locus_tag="mCG_62349"
FT                   /product="mCG62349"
FT                   /note="gene_id=mCG62349.2 transcript_id=mCT62532.2
FT                   protein_id=mCP34683.2"
FT                   /protein_id="EDL10022.1"
FT                   /translation="MVLYKPEELALQMGESRKKREASHRHLEIGDKGEKEGGLESKKEP
FT                   EVELSATSPAPCLPACHHASLPGNNGLNLRNRETSLAADPRK"
FT   gene            <5912294..5915870
FT                   /locus_tag="mCG_126946"
FT                   /note="gene_id=mCG126946.1"
FT   mRNA            join(<5912294..5912423,5912710..5913361,5913395..5913490,
FT                   5913726..5915870)
FT                   /locus_tag="mCG_126946"
FT                   /product="mCG126946"
FT                   /note="gene_id=mCG126946.1 transcript_id=mCT128222.1
FT                   created on 30-OCT-2002"
FT   CDS             <5912742..5913029
FT                   /codon_start=1
FT                   /locus_tag="mCG_126946"
FT                   /product="mCG126946"
FT                   /note="gene_id=mCG126946.1 transcript_id=mCT128222.1
FT                   protein_id=mCP77327.1"
FT                   /protein_id="EDL10021.1"
FT                   /translation="KPNIYTQKQEPPKKVMMTKRTKDMGKFSSVTVSTIDEEEEEIEAR
FT                   EVADSYAQNAKVIEKQLERKGLSKRRLQELAELEAKKAKMKGTLIDNQFK"
FT   gene            5949056..6067766
FT                   /gene="Stk32a"
FT                   /locus_tag="mCG_126942"
FT                   /note="gene_id=mCG126942.2"
FT   mRNA            join(5949056..5949313,5953297..5953445,5983514..5983569,
FT                   5984511..5984662,6002935..6003108,6005272..6005357)
FT                   /gene="Stk32a"
FT                   /locus_tag="mCG_126942"
FT                   /product="serine/threonine kinase 32A, transcript variant
FT                   mCT174099"
FT                   /note="gene_id=mCG126942.2 transcript_id=mCT174099.0
FT                   created on 16-JUN-2003"
FT   mRNA            join(5949168..5949313,5953297..5953445,5983514..5983569,
FT                   5984511..5984662,6002935..6003108,6031730..6031767,
FT                   6039192..6039281,6047463..6047560,6060257..6060373,
FT                   6061757..6061882,6063348..6063476,6063970..6064034,
FT                   6065215..6065764,6065929..6067766)
FT                   /gene="Stk32a"
FT                   /locus_tag="mCG_126942"
FT                   /product="serine/threonine kinase 32A, transcript variant
FT                   mCT128218"
FT                   /note="gene_id=mCG126942.2 transcript_id=mCT128218.2
FT                   created on 16-JUN-2003"
FT   CDS             join(5953394..5953445,5983514..5983569,5984511..5984662,
FT                   6002935..6003108,6031730..6031767,6039192..6039281,
FT                   6047463..6047560,6060257..6060373,6061757..6061882,
FT                   6063348..6063476,6063970..6064034,6065215..6065314)
FT                   /codon_start=1
FT                   /gene="Stk32a"
FT                   /locus_tag="mCG_126942"
FT                   /product="serine/threonine kinase 32A, isoform CRA_a"
FT                   /note="gene_id=mCG126942.2 transcript_id=mCT128218.2
FT                   protein_id=mCP77759.2 isoform=CRA_a"
FT                   /protein_id="EDL10019.1"
FT                   /translation="MGANTSSKAPVFDENEDVNFDHFEILRAIGKGSFGKVCIVRKNDT
FT                   KKMYAMKYMNKQKCVERNEVRNVFKELQIMQGLEHPFLVNLWYSFQDEEDMFMVVDLLL
FT                   GGDLRYHLQQNVHFQEDTVKLFICELAMALDYLQSQRIIHRDMKPDNILLDEHGHVHIT
FT                   DFNIAAMLPKETRITTVAGTKPYMAPEMFTSRKETGYSFAVDWWSLGVTAYELLRGRRP
FT                   YHIRSSTSSKEIVNMFETAIVTYPSAWSQEMVSLLKKLLEPNPDQRFSHLTDIQNFPYM
FT                   SDMNWDAVLQKRLIPGFIPTKGRLNCDPTFELEEMILESKPLHKKKKRLAKREKEMKKS
FT                   DSSQTCLLQEHLDAVQKEFIIFNREKVKSDFNQRQANLALEQTKNNTEEEEDGQNNNL"
FT   CDS             join(5953394..5953445,5983514..5983569,5984511..5984662,
FT                   6002935..6003108,6005272..6005335)
FT                   /codon_start=1
FT                   /gene="Stk32a"
FT                   /locus_tag="mCG_126942"
FT                   /product="serine/threonine kinase 32A, isoform CRA_b"
FT                   /note="gene_id=mCG126942.2 transcript_id=mCT174099.0
FT                   protein_id=mCP97018.0 isoform=CRA_b"
FT                   /protein_id="EDL10020.1"
FT                   /translation="MGANTSSKAPVFDENEDVNFDHFEILRAIGKGSFGKVCIVRKNDT
FT                   KKMYAMKYMNKQKCVERNEVRNVFKELQIMQGLEHPFLVNLWYSFQDEEDMFMVVDLLL
FT                   GGDLRYHLQQNVHFQEDTVKLFICELAMALDYLQSQRIIHRSKAMAASLPFASPLLVRK
FT                   MK"
FT   gene            complement(6075023..6185894)
FT                   /gene="Dpysl3"
FT                   /locus_tag="mCG_5618"
FT                   /note="gene_id=mCG5618.2"
FT   mRNA            complement(join(6075023..6076478,6077783..6077945,
FT                   6080305..6080484,6081671..6081841,6084852..6084993,
FT                   6085861..6086017,6093722..6093842,6096586..6096639,
FT                   6101321..6101401,6102182..6102243,6105692..6105856,
FT                   6108417..6108601,6110970..6111058,6140443..6140784))
FT                   /gene="Dpysl3"
FT                   /locus_tag="mCG_5618"
FT                   /product="dihydropyrimidinase-like 3, transcript variant
FT                   mCT4817"
FT                   /note="gene_id=mCG5618.2 transcript_id=mCT4817.2 created on
FT                   11-OCT-2002"
FT   mRNA            complement(join(6075710..6076478,6077783..6077945,
FT                   6080305..6080484,6081671..6081841,6084852..6084993,
FT                   6085861..6086017,6093722..6093842,6096586..6096639,
FT                   6101321..6101401,6102182..6102243,6105692..6105856,
FT                   6108417..6108601,6110970..6111058,6185459..6185894))
FT                   /gene="Dpysl3"
FT                   /locus_tag="mCG_5618"
FT                   /product="dihydropyrimidinase-like 3, transcript variant
FT                   mCT174145"
FT                   /note="gene_id=mCG5618.2 transcript_id=mCT174145.0 created
FT                   on 11-OCT-2002"
FT   mRNA            complement(join(6075946..6076478,6077783..6077945,
FT                   6080305..6080484,6081671..6081841,6084852..6084993,
FT                   6085861..6086017,6093722..6093842,6096586..6096639,
FT                   6101321..6101401,6102182..6102243,6105692..6105856,
FT                   6108417..6108601,6110970..6111058,6120517..6120710))
FT                   /gene="Dpysl3"
FT                   /locus_tag="mCG_5618"
FT                   /product="dihydropyrimidinase-like 3, transcript variant
FT                   mCT174146"
FT                   /note="gene_id=mCG5618.2 transcript_id=mCT174146.0 created
FT                   on 11-OCT-2002"
FT   CDS             complement(join(6076390..6076478,6077783..6077945,
FT                   6080305..6080484,6081671..6081841,6084852..6084993,
FT                   6085861..6086017,6093722..6093842,6096586..6096639,
FT                   6101321..6101401,6102182..6102243,6105692..6105856,
FT                   6108417..6108601,6110970..6111058,6185459..6185836))
FT                   /codon_start=1
FT                   /gene="Dpysl3"
FT                   /locus_tag="mCG_5618"
FT                   /product="dihydropyrimidinase-like 3, isoform CRA_a"
FT                   /note="gene_id=mCG5618.2 transcript_id=mCT174145.0
FT                   protein_id=mCP97064.0 isoform=CRA_a"
FT                   /protein_id="EDL10016.1"
FT                   /translation="MASGRRGWDSSHEDDLPVYLARPGTTDQVPRQKYGGMFCNVEGAF
FT                   ESKTLDFDALSVGQRGAKTPRSSQGSGRGAGNRPGMEVDARRGPGREESREPAPESPKP
FT                   AGVEIRSATGKEVLQNLGPKDKSDRLLIKGGRIVNDDQSFYADIYMEDGLIKQIGDNLI
FT                   VPGGVKTIEANGKMVIPGGIDVHTHFQMPYKGMTTVDDFFQGTKAALAGGTTMIIDHVV
FT                   PEPESSLTEAYEKWREWADGKSCCDYALHVDITHWNDSVKQEVQSLSKEKGVNSFMVYM
FT                   AYKDLYQVSNTELYEIFTCLGELGAIAQVHAENGDIIAQAGNGDNRPRRPVLSRPEELE
FT                   AEAVFRAITVASQTNCPLYVTKVMSKSAADLISQARKKGNVVFGEPITASLGIDGTHYW
FT                   SKNWAKAAAFVTSPPLSPDPTTPDYINSLLASGDLQLSGSAHCTFSTAQKAIGKDNFTA
FT                   IPEGTNGVEERMSVIWDKAVATGKMDENQFVAVTSTNAAKIFNLYPRKGRIAVGSDSDL
FT                   VIWDPDALKIVSAKNHQSVAEYNIFEGMELRGAPLVVICQGKIMLEDGNLHVTQGAGRF
FT                   IPCSPFSDYVYKRIKARRKMADLHAVPRGMYDGPVFDLTTTPKGGTPAGSTRGSPTRPN
FT                   PPVRNLHQSGFSLSGTQVDEGVRSASKRIVAPPGGRSNITSLS"
FT   CDS             complement(join(6076390..6076478,6077783..6077945,
FT                   6080305..6080484,6081671..6081841,6084852..6084993,
FT                   6085861..6086017,6093722..6093842,6096586..6096639,
FT                   6101321..6101401,6102182..6102243,6105692..6105856,
FT                   6108417..6108601,6110970..6111058,6140443..6140481))
FT                   /codon_start=1
FT                   /gene="Dpysl3"
FT                   /locus_tag="mCG_5618"
FT                   /product="dihydropyrimidinase-like 3, isoform CRA_c"
FT                   /note="gene_id=mCG5618.2 transcript_id=mCT4817.2
FT                   protein_id=mCP13146.2 isoform=CRA_c"
FT                   /protein_id="EDL10018.1"
FT                   /translation="MSYQGKKNIPRITSDRLLIKGGRIVNDDQSFYADIYMEDGLIKQI
FT                   GDNLIVPGGVKTIEANGKMVIPGGIDVHTHFQMPYKGMTTVDDFFQGTKAALAGGTTMI
FT                   IDHVVPEPESSLTEAYEKWREWADGKSCCDYALHVDITHWNDSVKQEVQSLSKEKGVNS
FT                   FMVYMAYKDLYQVSNTELYEIFTCLGELGAIAQVHAENGDIIAQAGNGDNRPRRPVLSR
FT                   PEELEAEAVFRAITVASQTNCPLYVTKVMSKSAADLISQARKKGNVVFGEPITASLGID
FT                   GTHYWSKNWAKAAAFVTSPPLSPDPTTPDYINSLLASGDLQLSGSAHCTFSTAQKAIGK
FT                   DNFTAIPEGTNGVEERMSVIWDKAVATGKMDENQFVAVTSTNAAKIFNLYPRKGRIAVG
FT                   SDSDLVIWDPDALKIVSAKNHQSVAEYNIFEGMELRGAPLVVICQGKIMLEDGNLHVTQ
FT                   GAGRFIPCSPFSDYVYKRIKARRKMADLHAVPRGMYDGPVFDLTTTPKGGTPAGSTRGS
FT                   PTRPNPPVRNLHQSGFSLSGTQVDEGVRSASKRIVAPPGGRSNITSLS"
FT   CDS             complement(join(6076390..6076478,6077783..6077945,
FT                   6080305..6080484,6081671..6081841,6084852..6084993,
FT                   6085861..6086017,6093722..6093842,6096586..6096639,
FT                   6101321..6101401,6102182..6102243,6105692..6105856,
FT                   6108417..6108601,6110970..6111058,6120517..6120549))
FT                   /codon_start=1
FT                   /gene="Dpysl3"
FT                   /locus_tag="mCG_5618"
FT                   /product="dihydropyrimidinase-like 3, isoform CRA_b"
FT                   /note="gene_id=mCG5618.2 transcript_id=mCT174146.0
FT                   protein_id=mCP97065.0 isoform=CRA_b"
FT                   /protein_id="EDL10017.1"
FT                   /translation="MYSPSRNKIRQSDRLLIKGGRIVNDDQSFYADIYMEDGLIKQIGD
FT                   NLIVPGGVKTIEANGKMVIPGGIDVHTHFQMPYKGMTTVDDFFQGTKAALAGGTTMIID
FT                   HVVPEPESSLTEAYEKWREWADGKSCCDYALHVDITHWNDSVKQEVQSLSKEKGVNSFM
FT                   VYMAYKDLYQVSNTELYEIFTCLGELGAIAQVHAENGDIIAQAGNGDNRPRRPVLSRPE
FT                   ELEAEAVFRAITVASQTNCPLYVTKVMSKSAADLISQARKKGNVVFGEPITASLGIDGT
FT                   HYWSKNWAKAAAFVTSPPLSPDPTTPDYINSLLASGDLQLSGSAHCTFSTAQKAIGKDN
FT                   FTAIPEGTNGVEERMSVIWDKAVATGKMDENQFVAVTSTNAAKIFNLYPRKGRIAVGSD
FT                   SDLVIWDPDALKIVSAKNHQSVAEYNIFEGMELRGAPLVVICQGKIMLEDGNLHVTQGA
FT                   GRFIPCSPFSDYVYKRIKARRKMADLHAVPRGMYDGPVFDLTTTPKGGTPAGSTRGSPT
FT                   RPNPPVRNLHQSGFSLSGTQVDEGVRSASKRIVAPPGGRSNITSLS"
FT   gene            complement(6221457..6428406)
FT                   /locus_tag="mCG_4624"
FT                   /note="gene_id=mCG4624.2"
FT   mRNA            complement(join(6221457..6222194,6287975..6288178,
FT                   6290657..6290734,6293199..6293267,6297522..6297587,
FT                   6298371..6298424,6299181..6299279,6300135..6300233,
FT                   6303574..6303636,6304312..6304395,6306912..6307040,
FT                   6308140..6308259,6309117..6309173,6312102..6312242,
FT                   6312890..6313036,6316499..6316597,6318338..6318547,
FT                   6322867..6323364,6331583..6331861,6428272..6428316))
FT                   /locus_tag="mCG_4624"
FT                   /product="mCG4624, transcript variant mCT174142"
FT                   /note="gene_id=mCG4624.2 transcript_id=mCT174142.0 created
FT                   on 11-OCT-2002"
FT   mRNA            complement(join(6221457..6222194,6281621..6281686,
FT                   6287975..6288178,6290657..6290734,6293199..6293267,
FT                   6297522..6297587,6298371..6298424,6299181..6299279,
FT                   6300135..6300233,6303574..6303636,6304312..6304395,
FT                   6306912..6307040,6308140..6308259,6309117..6309173,
FT                   6312102..6312242,6312890..6313036,6316499..6316597,
FT                   6318338..6318547,6322867..6323364,6331583..6331861,
FT                   6428272..6428316))
FT                   /locus_tag="mCG_4624"
FT                   /product="mCG4624, transcript variant mCT174141"
FT                   /note="gene_id=mCG4624.2 transcript_id=mCT174141.0 created
FT                   on 11-OCT-2002"
FT   CDS             complement(join(6222147..6222194,6287975..6288178,
FT                   6290657..6290734,6293199..6293267,6297522..6297587,
FT                   6298371..6298424,6299181..6299279,6300135..6300233,
FT                   6303574..6303636,6304312..6304395,6306912..6307040,
FT                   6308140..6308259,6309117..6309173,6312102..6312242,
FT                   6312890..6313036,6316499..6316597,6318338..6318547,
FT                   6322867..6323364,6331583..6331711))
FT                   /codon_start=1
FT                   /locus_tag="mCG_4624"
FT                   /product="mCG4624, isoform CRA_b"
FT                   /note="gene_id=mCG4624.2 transcript_id=mCT174142.0
FT                   protein_id=mCP97061.0 isoform=CRA_b"
FT                   /protein_id="EDL10014.1"
FT                   /translation="MSKKGRNKGEKPEALIVALQAANEDLRTKLTDIQIELHQEKSKVS
FT                   KLEREKTQEAKRIRELEQRKHTVLVTELKAKLHEEKMKELQAVRENLIKQHEQEMSRTV
FT                   KVRDGEIQRLKSALCALRDGSSDKVRTALTIEAREEARKQFDAERLKLLQEITDLKTAK
FT                   KQVDEALSNMIQADKIKAGDLRSEHQSHQEAISKIKWESERDIRRLMDEIKAKDRIIFS
FT                   LEKELETQTGYVQKLQLQKEALDEQLFLVKEAECNMSSPKREIPGRAGDGSEHCSSPDL
FT                   RRNQKRIAELNATIRKLEDRNTLLGDERNELLKRVRETEKQCKPLLERNKCLAKRNDEL
FT                   MVSLQRMEEKLKAVTKENSEMREKITSHPPLKKLKSLNDLDQANEEQETEFLKLQVIEQ
FT                   QNIIDELTRDREKLIRRRKHRRSSKPIKRPVLDPFIGYDEDSMDSETSSMTSFRTDRTP
FT                   ATPDDDLDESLAAEESELRFRQLTKEYQALQRAYALLQEQTGGIIDAEREAKAQEQLQA
FT                   EVLRYRAKIEDLEATLAQKGQDSHWVEDKQLFIKRNQELLEKIEKQEAENHRLQQELQD
FT                   ARDQNELLEFRNLELEERERRSPPFNLQIHPFSDGVSALQIYCMKEGVKDVNIPDLIKQ
FT                   LDILGDNGNLRNEEQVAIIQASTVLSLAEKWIQQIEGAEAALHQKMMELESDMEQFCKI
FT                   KGYLEEELDYRKQALDQAYMRIQELEATLYNALQQETVIKFGELLSDKQQEELRTAVEK
FT                   LRRQMLRKSREYDCQILQERMELLQQAHQSRPSSCQVPCSHSCP"
FT   CDS             complement(join(6222147..6222194,6281621..6281686,
FT                   6287975..6288178,6290657..6290734,6293199..6293267,
FT                   6297522..6297587,6298371..6298424,6299181..6299279,
FT                   6300135..6300233,6303574..6303636,6304312..6304395,
FT                   6306912..6307040,6308140..6308259,6309117..6309173,
FT                   6312102..6312242,6312890..6313036,6316499..6316597,
FT                   6318338..6318547,6322867..6323364,6331583..6331711))
FT                   /codon_start=1
FT                   /locus_tag="mCG_4624"
FT                   /product="mCG4624, isoform CRA_a"
FT                   /note="gene_id=mCG4624.2 transcript_id=mCT174141.0
FT                   protein_id=mCP97060.0 isoform=CRA_a"
FT                   /protein_id="EDL10013.1"
FT                   /translation="MSKKGRNKGEKPEALIVALQAANEDLRTKLTDIQIELHQEKSKVS
FT                   KLEREKTQEAKRIRELEQRKHTVLVTELKAKLHEEKMKELQAVRENLIKQHEQEMSRTV
FT                   KVRDGEIQRLKSALCALRDGSSDKVRTALTIEAREEARKQFDAERLKLLQEITDLKTAK
FT                   KQVDEALSNMIQADKIKAGDLRSEHQSHQEAISKIKWESERDIRRLMDEIKAKDRIIFS
FT                   LEKELETQTGYVQKLQLQKEALDEQLFLVKEAECNMSSPKREIPGRAGDGSEHCSSPDL
FT                   RRNQKRIAELNATIRKLEDRNTLLGDERNELLKRVRETEKQCKPLLERNKCLAKRNDEL
FT                   MVSLQRMEEKLKAVTKENSEMREKITSHPPLKKLKSLNDLDQANEEQETEFLKLQVIEQ
FT                   QNIIDELTRDREKLIRRRKHRRSSKPIKRPVLDPFIGYDEDSMDSETSSMTSFRTDRTP
FT                   ATPDDDLDESLAAEESELRFRQLTKEYQALQRAYALLQEQTGGIIDAEREAKAQEQLQA
FT                   EVLRYRAKIEDLEATLAQKGQDSHWVEDKQLFIKRNQELLEKIEKQEAENHRLQQELQD
FT                   ARDQNELLEFRNLELEERERRSPPFNLQIHPFSDGVSALQIYCMKEGVKDVNIPDLIKQ
FT                   LDILGDNGNLRNEEQVAIIQASTVLSLAEKWIQQIEGAEAALHQKMMELESDMEQFCKI
FT                   KGYLEEELDYRKQALDQAYMRIQELEATLYNALQQETVIKFGELLSDKQQEELRTAVEK
FT                   LRRQMLRKSREYDCQILQERMELLQQAHQRIRDLEDKTDIQKRQIKDLEEKSRPSSCQV
FT                   PCSHSCP"
FT   mRNA            complement(join(6272444..6272999,6278691..6278761,
FT                   6281621..6281686,6287975..6288178,6290657..6290734,
FT                   6293199..6293267,6297522..6297587,6298371..6298424,
FT                   6299181..6299279,6300135..6300233,6303574..6303636,
FT                   6304312..6304395,6306912..6307040,6308140..6308259,
FT                   6309117..6309173,6312102..6312242,6312890..6313036,
FT                   6316499..6316597,6318338..6318547,6322867..6323364,
FT                   6331583..6331861,6428272..6428406))
FT                   /locus_tag="mCG_4624"
FT                   /product="mCG4624, transcript variant mCT4015"
FT                   /note="gene_id=mCG4624.2 transcript_id=mCT4015.2 created on
FT                   11-OCT-2002"
FT   CDS             complement(join(6278711..6278761,6281621..6281686,
FT                   6287975..6288178,6290657..6290734,6293199..6293267,
FT                   6297522..6297587,6298371..6298424,6299181..6299279,
FT                   6300135..6300233,6303574..6303636,6304312..6304395,
FT                   6306912..6307040,6308140..6308259,6309117..6309173,
FT                   6312102..6312242,6312890..6313036,6316499..6316597,
FT                   6318338..6318547,6322867..6323364,6331583..6331711))
FT                   /codon_start=1
FT                   /locus_tag="mCG_4624"
FT                   /product="mCG4624, isoform CRA_c"
FT                   /note="gene_id=mCG4624.2 transcript_id=mCT4015.2
FT                   protein_id=mCP13142.2 isoform=CRA_c"
FT                   /db_xref="GOA:D3YXK0"
FT                   /db_xref="InterPro:IPR024836"
FT                   /db_xref="MGI:MGI:1923467"
FT                   /db_xref="UniProtKB/TrEMBL:D3YXK0"
FT                   /protein_id="EDL10015.1"
FT                   /translation="MSKKGRNKGEKPEALIVALQAANEDLRTKLTDIQIELHQEKSKVS
FT                   KLEREKTQEAKRIRELEQRKHTVLVTELKAKLHEEKMKELQAVRENLIKQHEQEMSRTV
FT                   KVRDGEIQRLKSALCALRDGSSDKVRTALTIEAREEARKQFDAERLKLLQEITDLKTAK
FT                   KQVDEALSNMIQADKIKAGDLRSEHQSHQEAISKIKWESERDIRRLMDEIKAKDRIIFS
FT                   LEKELETQTGYVQKLQLQKEALDEQLFLVKEAECNMSSPKREIPGRAGDGSEHCSSPDL
FT                   RRNQKRIAELNATIRKLEDRNTLLGDERNELLKRVRETEKQCKPLLERNKCLAKRNDEL
FT                   MVSLQRMEEKLKAVTKENSEMREKITSHPPLKKLKSLNDLDQANEEQETEFLKLQVIEQ
FT                   QNIIDELTRDREKLIRRRKHRRSSKPIKRPVLDPFIGYDEDSMDSETSSMTSFRTDRTP
FT                   ATPDDDLDESLAAEESELRFRQLTKEYQALQRAYALLQEQTGGIIDAEREAKAQEQLQA
FT                   EVLRYRAKIEDLEATLAQKGQDSHWVEDKQLFIKRNQELLEKIEKQEAENHRLQQELQD
FT                   ARDQNELLEFRNLELEERERRSPPFNLQIHPFSDGVSALQIYCMKEGVKDVNIPDLIKQ
FT                   LDILGDNGNLRNEEQVAIIQASTVLSLAEKWIQQIEGAEAALHQKMMELESDMEQFCKI
FT                   KGYLEEELDYRKQALDQAYMRIQELEATLYNALQQETVIKFGELLSDKQQEELRTAVEK
FT                   LRRQMLRKSREYDCQILQERMELLQQAHQRIRDLEDKTDIQKRQIKDLEEKFLFLFLFF
FT                   SLAFILWP"
FT   gene            complement(6463053..6478395)
FT                   /gene="Spink3"
FT                   /locus_tag="mCG_4621"
FT                   /note="gene_id=mCG4621.1"
FT   mRNA            complement(join(6463053..6463175,6474687..6474793,
FT                   6476365..6476399,6478296..6478395))
FT                   /gene="Spink3"
FT                   /locus_tag="mCG_4621"
FT                   /product="serine peptidase inhibitor, Kazal type 3"
FT                   /note="gene_id=mCG4621.1 transcript_id=mCT4017.1 created on
FT                   11-OCT-2002"
FT   CDS             complement(join(6463130..6463175,6474687..6474793,
FT                   6476365..6476399,6478296..6478350))
FT                   /codon_start=1
FT                   /gene="Spink3"
FT                   /locus_tag="mCG_4621"
FT                   /product="serine peptidase inhibitor, Kazal type 3"
FT                   /note="gene_id=mCG4621.1 transcript_id=mCT4017.1
FT                   protein_id=mCP13134.2"
FT                   /protein_id="EDL10012.1"
FT                   /translation="MKVAVIFLLSALALLSLAGNTFSAKVTGKEASCHDAVAGCPRIYD
FT                   PVCGTDGITYANECVLCFENRKRIEPVLIRKGGPC"
FT   gene            6511432..6514508
FT                   /gene="Scgb3a2"
FT                   /locus_tag="mCG_4629"
FT                   /note="gene_id=mCG4629.2"
FT   mRNA            join(6511432..6511581,6513814..6514010,6514341..6514496)
FT                   /gene="Scgb3a2"
FT                   /locus_tag="mCG_4629"
FT                   /product="secretoglobin, family 3A, member 2, transcript
FT                   variant mCT4014"
FT                   /note="gene_id=mCG4629.2 transcript_id=mCT4014.1 created on
FT                   11-OCT-2002"
FT   mRNA            join(6511436..6511581,6513814..6514508)
FT                   /gene="Scgb3a2"
FT                   /locus_tag="mCG_4629"
FT                   /product="secretoglobin, family 3A, member 2, transcript
FT                   variant mCT174144"
FT                   /note="gene_id=mCG4629.2 transcript_id=mCT174144.0 created
FT                   on 11-OCT-2002"
FT   mRNA            join(6511436..6511581,6513814..6514076,6514341..6514508)
FT                   /gene="Scgb3a2"
FT                   /locus_tag="mCG_4629"
FT                   /product="secretoglobin, family 3A, member 2, transcript
FT                   variant mCT174143"
FT                   /note="gene_id=mCG4629.2 transcript_id=mCT174143.0 created
FT                   on 11-OCT-2002"
FT   CDS             join(6511527..6511581,6513814..6514076,6514341..6514364)
FT                   /codon_start=1
FT                   /gene="Scgb3a2"
FT                   /locus_tag="mCG_4629"
FT                   /product="secretoglobin, family 3A, member 2, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG4629.2 transcript_id=mCT174143.0
FT                   protein_id=mCP97063.0 isoform=CRA_a"
FT                   /protein_id="EDL10009.1"
FT                   /translation="MKLVSIFLLVTIGICGYSATALLINRLPVVDKLPVPLDDIIPSFD
FT                   PLKMLLKTLGISVEHLVTGLKKCVDELGPEASEAVKKLLVIIICSYFPGRSLCYVNNLP
FT                   SFEALSHLV"
FT   CDS             join(6511527..6511581,6513814..6514010,6514341..6514364)
FT                   /codon_start=1
FT                   /gene="Scgb3a2"
FT                   /locus_tag="mCG_4629"
FT                   /product="secretoglobin, family 3A, member 2, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG4629.2 transcript_id=mCT4014.1
FT                   protein_id=mCP13150.1 isoform=CRA_c"
FT                   /db_xref="GOA:Q5D060"
FT                   /db_xref="InterPro:IPR016126"
FT                   /db_xref="MGI:MGI:2153470"
FT                   /db_xref="UniProtKB/TrEMBL:Q5D060"
FT                   /protein_id="EDL10011.1"
FT                   /translation="MKLVSIFLLVTIGICGYSATALLINRLPVVDKLPVPLDDIIPSFD
FT                   PLKMLLKTLGISVEHLVTGLKKCVDELGPEASEAVKKLLEALSHLV"
FT   CDS             join(6511527..6511581,6513814..6514178)
FT                   /codon_start=1
FT                   /gene="Scgb3a2"
FT                   /locus_tag="mCG_4629"
FT                   /product="secretoglobin, family 3A, member 2, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG4629.2 transcript_id=mCT174144.0
FT                   protein_id=mCP97062.0 isoform=CRA_b"
FT                   /protein_id="EDL10010.1"
FT                   /translation="MKLVSIFLLVTIGICGYSATALLINRLPVVDKLPVPLDDIIPSFD
FT                   PLKMLLKTLGISVEHLVTGLKKCVDELGPEASEAVKKLLVIIICSYFPGRSLCYVNNLP
FT                   SFVSVLFLPMICAYPRDSKKQTFAFIERVFEQSKL"
FT   gene            complement(6524808..6541525)
FT                   /locus_tag="mCG_4626"
FT                   /note="gene_id=mCG4626.2"
FT   mRNA            complement(join(6524808..6525214,6528800..6528858,
FT                   6532167..6532320,6541371..6541525))
FT                   /locus_tag="mCG_4626"
FT                   /product="mCG4626"
FT                   /note="gene_id=mCG4626.2 transcript_id=mCT4020.2 created on
FT                   11-OCT-2002"
FT   CDS             complement(join(6528801..6528858,6532167..6532320,
FT                   6541371..6541440))
FT                   /codon_start=1
FT                   /locus_tag="mCG_4626"
FT                   /product="mCG4626"
FT                   /note="gene_id=mCG4626.2 transcript_id=mCT4020.2
FT                   protein_id=mCP13147.2"
FT                   /db_xref="GOA:B2RV94"
FT                   /db_xref="InterPro:IPR027950"
FT                   /db_xref="MGI:MGI:2684940"
FT                   /db_xref="UniProtKB/TrEMBL:B2RV94"
FT                   /protein_id="EDL10008.1"
FT                   /translation="MAVSVLRLMVVLGLSALILTCRADDNPNENDNPDSKPDDSSKNPE
FT                   PGFPKFLSILGSEIIENAVDFILRSMSRGSSFMELEGDPGQQPSKVTS"
FT   gene            6706287..6765498
FT                   /locus_tag="mCG_127182"
FT                   /note="gene_id=mCG127182.0"
FT   mRNA            join(6706287..6706406,6707475..6707500,6710031..6710158,
FT                   6712322..6712397,6720663..6720790,6724141..6724204,
FT                   6725189..6725316,6726555..6726621,6729303..6729430,
FT                   6730788..6730875,6732365..6732492,6733661..6733739,
FT                   6735159..6735286,6735876..6735924,6739618..6739745,
FT                   6741785..6741866,6742808..6742932,6743515..6743575,
FT                   6746199..6746326,6749387..6749480,6750645..6750772,
FT                   6752198..6752270,6752925..6753052,6753216..6753294,
FT                   6755852..6755979,6756933..6757002,6757698..6757787,
FT                   6757894..6758021,6758599..6758695,6759378..6759508,
FT                   6761711..6761844,6763834..6765498)
FT                   /locus_tag="mCG_127182"
FT                   /product="mCG127182"
FT                   /note="gene_id=mCG127182.0 transcript_id=mCT128464.1
FT                   created on 11-OCT-2002"
FT   CDS             join(6706352..6706406,6707475..6707500,6710031..6710158,
FT                   6712322..6712397,6720663..6720790,6724141..6724204,
FT                   6725189..6725316,6726555..6726621,6729303..6729430,
FT                   6730788..6730875,6732365..6732492,6733661..6733739,
FT                   6735159..6735286,6735876..6735924,6739618..6739745,
FT                   6741785..6741866,6742808..6742932,6743515..6743575,
FT                   6746199..6746326,6749387..6749480,6750645..6750772,
FT                   6752198..6752270,6752925..6753052,6753216..6753294,
FT                   6755852..6755979,6756933..6757002,6757698..6757787,
FT                   6757894..6758021,6758599..6758695,6759378..6759508,
FT                   6761711..6761844,6763834..6763952)
FT                   /codon_start=1
FT                   /locus_tag="mCG_127182"
FT                   /product="mCG127182"
FT                   /note="gene_id=mCG127182.0 transcript_id=mCT128464.1
FT                   protein_id=mCP77912.1"
FT                   /protein_id="EDL10007.1"
FT                   /translation="MKTATVPMLLTLAFYLTQDAAGEKGNQDPCMKFQAQMKNGTLTCP
FT                   KGNNSSQSLNDIIFQSECILCKRALEQGAPTKIMNVKVLSRANRATDPAKLNCESFKQR
FT                   RKDGDFICPSDTSSVCGTDGKTYRSRCELCAENAKSQNHVDVKSEGECGSSHLETDMCS
FT                   DFRAYVQDGRLGCTRESDPILGPDGRTHGNRCAMCAELFLKEAKENATRNRESRIRRDA
FT                   EKELCKEFENQVRNGRLFCTRESDPIRGPDGKMHGNKCALCAEIFMRQFTEEKGKAEKN
FT                   QKDAEERAKAKMEIQKRCSEFQDRARNGTLFCTRENDPIRGLDGKTHGNLCSMCQAFFK
FT                   TEAEEKKAEAGSRNRRGSEESETYAKLCDEYRKARKNGQLYCTRENAPIRGPDGKIHGN
FT                   TCSMCQAFFIQEDKARAKVKREAAKEMCSEFRNQARNGMLMCTRENDPVVGPDGKRHSN
FT                   KCAMCASVFLLEEEEKKKDDKTEKVDAGKAKKEAVQLCRKYHTQLRNGPLRCTRRNNPI
FT                   EGLDGKMYKNACFMCWAFFQQEAKKSGAGFRPKVKREVKVDCSEYLALSKRGEIFCTRE
FT                   NDPVRGPDGKTHGNKCAMCKAVFKKENEERKRKEGENQRITSGESSSGGNPKAKDECAQ
FT                   YRESMKHGQLSCTRESDPVRGVDGEHYNNKCVMCKELLQKEMEETNKNSASRSNGTGSA
FT                   TGKDVCDQFRSQMKNGKLLCTRESDPTRGPDGAMHGNKCAMCKERLEKEAAEKKKKEDE
FT                   EKRNTETNKSDKEDKCHEYRSMQLDGRLICTRENDPVRDADGKMHVNKCAMCQMMFERE
FT                   ANERKMREENSRSQPTNEAKDQCGEVHNSVEDAKPRPARSSLPSIRGISKDECSEFQNL
FT                   MKNEKLTCPETDDPVRGADGTFYQNKCHMCRDVLKNEAMKRSGLQEKSSDIRSTKEGDP
FT                   EFSSSSRDSDMCKNYRILPRMGYLCPKNLNPVCGDDGQTYSNPCMLCHENLMRQTNTRI
FT                   HKQGACEESSNLKTVSTGTPASVSALAFGVKVVVVEGKNDAMIGEITEKKLSLDSELPA
FT                   FTICVYKEFFKLIFLL"
FT   gene            6771701..6775183
FT                   /locus_tag="mCG_1033458"
FT                   /note="gene_id=mCG1033458.0"
FT   mRNA            join(6771701..6771829,6772552..6772595,6773848..6773984,
FT                   6774838..6774883,6774998..6775183)
FT                   /locus_tag="mCG_1033458"
FT                   /product="mCG1033458"
FT                   /note="gene_id=mCG1033458.0 transcript_id=mCT151162.0
FT                   created on 10-MAR-2003"
FT   CDS             join(6771766..6771829,6772552..6772595,6773848..6773984,
FT                   6774838..6774883)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1033458"
FT                   /product="mCG1033458"
FT                   /note="gene_id=mCG1033458.0 transcript_id=mCT151162.0
FT                   protein_id=mCP77316.1"
FT                   /db_xref="GOA:B9EJP9"
FT                   /db_xref="InterPro:IPR002350"
FT                   /db_xref="MGI:MGI:3646952"
FT                   /db_xref="UniProtKB/TrEMBL:B9EJP9"
FT                   /protein_id="EDL10006.1"
FT                   /translation="MVKYFQCSVLFSIMLHLVILAAPGARVWWPTHGLIKIKCPYKKVN
FT                   LSWFNKTVDPCPDLKQPICGTNFVTYDNPCILCVESLKSGGRIRYYYNGRC"
FT   gene            6811974..6812709
FT                   /pseudo
FT                   /locus_tag="mCG_4622"
FT                   /note="gene_id=mCG4622.2"
FT   mRNA            6811974..6812709
FT                   /pseudo
FT                   /locus_tag="mCG_4622"
FT                   /note="gene_id=mCG4622.2 transcript_id=mCT4018.2 created on
FT                   17-OCT-2002"
FT   gene            6821904..6834113
FT                   /locus_tag="mCG_58554"
FT                   /note="gene_id=mCG58554.1"
FT   mRNA            join(6821904..6822036,6824913..6824935,6830623..6830697,
FT                   6832758..6832873,6833875..6834113)
FT                   /locus_tag="mCG_58554"
FT                   /product="mCG58554, transcript variant mCT58737"
FT                   /note="gene_id=mCG58554.1 transcript_id=mCT58737.1 created
FT                   on 11-OCT-2002"
FT   CDS             join(6821979..6822036,6824913..6824935,6830623..6830697,
FT                   6832758..6832873,6833875..6833920)
FT                   /codon_start=1
FT                   /locus_tag="mCG_58554"
FT                   /product="mCG58554, isoform CRA_b"
FT                   /note="gene_id=mCG58554.1 transcript_id=mCT58737.1
FT                   protein_id=mCP34668.2 isoform=CRA_b"
FT                   /protein_id="EDL10005.1"
FT                   /translation="MKVAGVFLLLSLALLCFFSGAFSQGGQDKRGWITRSEGRFPGKGV
FT                   LRHRLFQINCGEFRDPKVFCTRESDPLCGSDGQTYGNKCAFCKALEKSSGKINLKHRGK
FT                   C"
FT   mRNA            join(6824361..6824466,6824913..6824935,6832758..6832873,
FT                   6833875..6834111)
FT                   /locus_tag="mCG_58554"
FT                   /product="mCG58554, transcript variant mCT174149"
FT                   /note="gene_id=mCG58554.1 transcript_id=mCT174149.0 created
FT                   on 11-OCT-2002"
FT   CDS             join(6824367..6824466,6824913..6824935,6832758..6832873,
FT                   6833875..6833920)
FT                   /codon_start=1
FT                   /locus_tag="mCG_58554"
FT                   /product="mCG58554, isoform CRA_a"
FT                   /note="gene_id=mCG58554.1 transcript_id=mCT174149.0
FT                   protein_id=mCP97068.0 isoform=CRA_a"
FT                   /protein_id="EDL10004.1"
FT                   /translation="MRRELHKKPSSGIQRNREGTKNEGSERGGNQSLSAFSQGGQINCG
FT                   EFRDPKVFCTRESDPLCGSDGQTYGNKCAFCKALEKSSGKINLKHRGKC"
FT   gene            6855072..6859188
FT                   /gene="9230117E20Rik"
FT                   /locus_tag="mCG_4966"
FT                   /note="gene_id=mCG4966.1"
FT   mRNA            join(6855072..6855435,6857178..6857203,6858336..6858463,
FT                   6858702..6859188)
FT                   /gene="9230117E20Rik"
FT                   /locus_tag="mCG_4966"
FT                   /product="RIKEN cDNA 9230117E20"
FT                   /note="gene_id=mCG4966.1 transcript_id=mCT4024.1 created on
FT                   11-OCT-2002"
FT   CDS             join(6855321..6855435,6857178..6857203,6858336..6858463,
FT                   6858702..6858750)
FT                   /codon_start=1
FT                   /gene="9230117E20Rik"
FT                   /locus_tag="mCG_4966"
FT                   /product="RIKEN cDNA 9230117E20"
FT                   /note="gene_id=mCG4966.1 transcript_id=mCT4024.1
FT                   protein_id=mCP13145.1"
FT                   /protein_id="EDL10003.1"
FT                   /translation="MFNAPNISVFSDLKILSAMKPAGAFLLLISLACLFLSVDAVSQGG
FT                   FQAFCSNYEKTLAPDGKSCPKTHKPVCGTDGKTYQNRCAFCQTAMERSLGKLGFKHEGK
FT                   C"
FT   gene            complement(6913902..>6922600)
FT                   /gene="9530002K18Rik"
FT                   /locus_tag="mCG_144595"
FT                   /note="gene_id=mCG144595.0"
FT   mRNA            complement(join(6913902..6914216,6915590..6915705,
FT                   6916659..6916705,6922058..6922128,6922556..>6922600))
FT                   /gene="9530002K18Rik"
FT                   /locus_tag="mCG_144595"
FT                   /product="RIKEN cDNA 9530002K18"
FT                   /note="gene_id=mCG144595.0 transcript_id=mCT184019.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(6914168..6914216,6915590..6915705,
FT                   6916659..6916705,6922058..6922128,6922556..>6922563))
FT                   /codon_start=1
FT                   /gene="9530002K18Rik"
FT                   /locus_tag="mCG_144595"
FT                   /product="RIKEN cDNA 9530002K18"
FT                   /note="gene_id=mCG144595.0 transcript_id=mCT184019.0
FT                   protein_id=mCP106237.0"
FT                   /protein_id="EDL10002.1"
FT                   /translation="AQRFDKMSSTWIKFLFILTLVLLPYSVFSVNIFAGPENVIKEPNC
FT                   TMYKSKSECSNIAENPVCADDRNTYYNECYFCIEKVVEKLKYRYHGICIYK"
FT   gene            7016765..7024339
FT                   /gene="Npy6r"
FT                   /locus_tag="mCG_4623"
FT                   /note="gene_id=mCG4623.2"
FT   mRNA            join(7016765..7016973,7021981..7024339)
FT                   /gene="Npy6r"
FT                   /locus_tag="mCG_4623"
FT                   /product="neuropeptide Y receptor Y6"
FT                   /note="gene_id=mCG4623.2 transcript_id=mCT4019.2 created on
FT                   12-JUN-2003"
FT   CDS             7022153..7023268
FT                   /codon_start=1
FT                   /gene="Npy6r"
FT                   /locus_tag="mCG_4623"
FT                   /product="neuropeptide Y receptor Y6"
FT                   /note="gene_id=mCG4623.2 transcript_id=mCT4019.2
FT                   protein_id=mCP13135.0"
FT                   /protein_id="EDL10001.1"
FT                   /translation="MEVLTNQPTPNKTSGKSNNSAFFYFESCQPPFLAILLLLIAYTVI
FT                   LIMGIFGNLSLIIIIFKKQREAQNVTNILIANLSLSDILVCVMCIPFTVIYTLMDHWVF
FT                   GNTMCKLTSYVQSVSVSVSIFSLVLIAIERYQLIVNPRGWKPRVAHAYWGIILIWLISL
FT                   TLSIPLFLSYHLTNEPFHNLSLPTDIYTHQVACVEIWPSKLNQLLFSTSLFMLQYFVPL
FT                   GFILICYLKIVLCLRKRTRQVDRRKENKSRLNENKRVNVMLISIVVTFGACWLPLNIFN
FT                   VIFDWYHEMLMSCHHDLVFVVCHLIAMVSTCINPLFYGFLNKNFQKDLMMLIHHCWCGE
FT                   PQESYENIAMSTMHTDESKGSLKLAHIPTGI"
FT   gene            7080653..7102287
FT                   /locus_tag="mCG_4625"
FT                   /note="gene_id=mCG4625.1"
FT   mRNA            join(7080653..7080735,7083346..7083889,7087882..7088056,
FT                   7088921..7089022,7091023..7091069,7091593..7091725,
FT                   7092579..7092786,7100681..7100846,7101367..7101500,
FT                   7101673..7102287)
FT                   /locus_tag="mCG_4625"
FT                   /product="mCG4625"
FT                   /note="gene_id=mCG4625.1 transcript_id=mCT4012.1 created on
FT                   11-OCT-2002"
FT   CDS             join(7083537..7083889,7087882..7088056,7088921..7089022,
FT                   7091023..7091069,7091593..7091725,7092579..7092786,
FT                   7100681..7100846,7101367..7101500,7101673..7101845)
FT                   /codon_start=1
FT                   /locus_tag="mCG_4625"
FT                   /product="mCG4625"
FT                   /note="gene_id=mCG4625.1 transcript_id=mCT4012.1
FT                   protein_id=mCP13137.2"
FT                   /db_xref="GOA:A0A509"
FT                   /db_xref="InterPro:IPR003598"
FT                   /db_xref="InterPro:IPR003599"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013098"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="MGI:MGI:1889800"
FT                   /db_xref="UniProtKB/TrEMBL:A0A509"
FT                   /protein_id="EDL10000.1"
FT                   /translation="MFNYERPKHFIQPQNPCGSRLQPPGPEVSGFPSQTKQSSIVIQPR
FT                   QCTEQRFSASSTVSSHITVSSSAYPAPQQLAGPNPGQKVTATYNQSPASFLSSILPSQP
FT                   DYCNSKIPSTVDSNYQQSSVNQPVNAMSSQAANARPTPKTPDHEIQGSKEALIQDLERK
FT                   LKCKDTLLHNGNQRLTYEEKMARRLLGPQNAAAVFQAQNSDVQDSPQHNPEQARLHVPT
FT                   SQVRSRSSSRAEANDQDAIQEKFYPPRFIQVPENMSIEEGRFCRMDFKVSGLPAPDVSW
FT                   YLNGRPVQSDELHKMIVSEKGFHSLIFEVVRASDAGPYACVARNRAGEATFTVQLDVLA
FT                   KEHKRAPMFIFKPQSKKVFEGETVKLECQISAIPPPKLFWKRNNEMVQFNTDRISLYHD
FT                   NAGRVTLLIKDVNKKDAGWYTVSAVNEAGVTTCNTRLDVTARPIQTLPAPKQLRVRPTF
FT                   SKYLALNGRGLDVKQAFNPEGEFQRLAAQSGLYESEEL"
FT   gene            7128296..7168139
FT                   /locus_tag="mCG_4968"
FT                   /note="gene_id=mCG4968.2"
FT   mRNA            join(7128296..7128479,7145248..7145399,7148999..7149126,
FT                   7149696..7149794,7154585..7154737,7154832..7154944,
FT                   7155028..7155135,7159494..7159629,7161911..7162021,
FT                   7164770..7164821,7166952..7168139)
FT                   /locus_tag="mCG_4968"
FT                   /product="mCG4968, transcript variant mCT4021"
FT                   /note="gene_id=mCG4968.2 transcript_id=mCT4021.2 created on
FT                   06-FEB-2003"
FT   mRNA            join(7128301..7128479,7145248..7145395,7148993..7149126,
FT                   7149696..7149794,7154585..7154737,7154832..7154944,
FT                   7155028..7155135,7159494..7159629,7161911..7162021,
FT                   7164770..7164821,7166952..7167336)
FT                   /locus_tag="mCG_4968"
FT                   /product="mCG4968, transcript variant mCT179597"
FT                   /note="gene_id=mCG4968.2 transcript_id=mCT179597.0 created
FT                   on 06-FEB-2003"
FT   CDS             join(7149076..7149126,7149696..7149794,7154585..7154737,
FT                   7154832..7154944,7155028..7155135,7159494..7159629,
FT                   7161911..7162021,7164770..7164821,7166952..7167115)
FT                   /codon_start=1
FT                   /locus_tag="mCG_4968"
FT                   /product="mCG4968, isoform CRA_a"
FT                   /note="gene_id=mCG4968.2 transcript_id=mCT4021.2
FT                   protein_id=mCP13129.2 isoform=CRA_a"
FT                   /protein_id="EDL09998.1"
FT                   /translation="MGVPTYGAIILDETLENVLLVQGYLAKSGWGFPKGKVNKEEAPHD
FT                   CAAREVFEETGFDIKDYICKDDYIELRINDQLARLYIIPGVPKDTKFNPKTRREIRNIE
FT                   WFSIEKLPCHRNDMTPKSKLGLAPNKFFMAIPFIRPLRDWLSRRFGDSSDSDNGFSSAG
FT                   STPARPTVEKLSRTKFRHSQQLFPEGSPSDQWVKHRQPLQQKPHSNHGEVSDLLKAKNQ
FT                   NMRGNGRKQYQDSPNQKKRANGVHGQPAKQQNPLVKCEKKLHPRKLQDNFETDATCDLP
FT                   CSGEEPSVEHAEGHSVACNGHCKFPFSSRAFLSFKFDQNAIMKILDL"
FT   CDS             join(7149076..7149126,7149696..7149794,7154585..7154737,
FT                   7154832..7154944,7155028..7155135,7159494..7159629,
FT                   7161911..7162021,7164770..7164821,7166952..7167115)
FT                   /codon_start=1
FT                   /locus_tag="mCG_4968"
FT                   /product="mCG4968, isoform CRA_a"
FT                   /note="gene_id=mCG4968.2 transcript_id=mCT179597.0
FT                   protein_id=mCP102519.0 isoform=CRA_a"
FT                   /protein_id="EDL09999.1"
FT                   /translation="MGVPTYGAIILDETLENVLLVQGYLAKSGWGFPKGKVNKEEAPHD
FT                   CAAREVFEETGFDIKDYICKDDYIELRINDQLARLYIIPGVPKDTKFNPKTRREIRNIE
FT                   WFSIEKLPCHRNDMTPKSKLGLAPNKFFMAIPFIRPLRDWLSRRFGDSSDSDNGFSSAG
FT                   STPARPTVEKLSRTKFRHSQQLFPEGSPSDQWVKHRQPLQQKPHSNHGEVSDLLKAKNQ
FT                   NMRGNGRKQYQDSPNQKKRANGVHGQPAKQQNPLVKCEKKLHPRKLQDNFETDATCDLP
FT                   CSGEEPSVEHAEGHSVACNGHCKFPFSSRAFLSFKFDQNAIMKILDL"
FT   gene            complement(7178932..7411175)
FT                   /locus_tag="mCG_4620"
FT                   /note="gene_id=mCG4620.3"
FT   mRNA            complement(join(7178932..7179386,7180654..7180776,
FT                   7192209..7192306,7195042..7195248,7198474..7198708,
FT                   7209013..7209196,7213051..7213154,7217689..7217829,
FT                   7222929..7223077,7224440..7224529,7225544..7225690,
FT                   7239859..7240065,7242114..7242277,7258901..7259043,
FT                   7268302..7268444,7282952..7283065,7410572..7411175))
FT                   /locus_tag="mCG_4620"
FT                   /product="mCG4620, transcript variant mCT4016"
FT                   /note="gene_id=mCG4620.3 transcript_id=mCT4016.2 created on
FT                   19-JUN-2003"
FT   mRNA            complement(join(7178932..7179386,7180654..7180776,
FT                   7192209..7192306,7195042..7195248,7198474..7198708,
FT                   7209013..7209196,7213051..7213154,7217689..7217829,
FT                   7222929..7223077,7224440..7224529,7225544..7225690,
FT                   7239859..7240065,7242114..7242277,7258901..7259043,
FT                   7268302..7268444,7282952..7283065,7323341..7323444))
FT                   /locus_tag="mCG_4620"
FT                   /product="mCG4620, transcript variant mCT174140"
FT                   /note="gene_id=mCG4620.3 transcript_id=mCT174140.0 created
FT                   on 19-JUN-2003"
FT   CDS             complement(join(7179206..7179386,7180654..7180776,
FT                   7192209..7192306,7195042..7195248,7198474..7198708,
FT                   7209013..7209196,7213051..7213154,7217689..7217829,
FT                   7222929..7223077,7224440..7224529,7225544..7225690,
FT                   7239859..7240065,7242114..7242277,7258901..7259043,
FT                   7268302..7268444,7282952..7283065,7410572..7410628))
FT                   /codon_start=1
FT                   /locus_tag="mCG_4620"
FT                   /product="mCG4620, isoform CRA_b"
FT                   /note="gene_id=mCG4620.3 transcript_id=mCT4016.2
FT                   protein_id=mCP13132.2 isoform=CRA_b"
FT                   /db_xref="InterPro:IPR019536"
FT                   /db_xref="MGI:MGI:96930"
FT                   /db_xref="UniProtKB/TrEMBL:G3UW40"
FT                   /protein_id="EDL09997.1"
FT                   /translation="MNSGVAVKYGNDSSAELSELHLAALASLKGDIVELNKRLQQTERE
FT                   RDLLEKKLAKAQCEQSHLMREHEDVQERTTLRYEERITELHSIIAELNKKIDRLQGTTI
FT                   REEDEYSELRSELSQSQQEVNEDSRSVDQDQTSVSIPENQSTMVTADMDNCSDLNSELQ
FT                   RVLTGLESVVCGRKKSSCSLSVADVDRHIEQLTTASEHCDLAIKTVEEIEGVLGRDLYP
FT                   NLAEERSRWEKELAGLREENESLTAMLCSKEEELNRTKATMNAIREERDRLRRRVRELQ
FT                   TRLQSVQATGPSSPGRLTPANRPINPSTGELSTSSSSNDIPIAKIAERVKLSKTRSESS
FT                   SSDRPVLGSEISSIGVSSSVAEHLAHSLQDCSNIQEIFQTLYSHGSAISESKIREFEVE
FT                   TERLNSRIEHLKSQNDLLTITLEECKSNAERMSMLVGKYESNATALRLALQYSEQCIEA
FT                   YELLLALAESEQSLILGQFRAAGVGSSPGDQSGDENITQMLKRAHDCRKTAENAAKALL
FT                   MKLDGSCGGAFAVAGCSVQPWESLSSNSHTSTTSSTASSCDTEFTKEDEQRLKDYIQQL
FT                   KNDRAAVKLTMLELESIHIDPLSYDVKPRGDSQRLDLENAVLMQELMAMKEEMAELKAQ
FT                   LYLLEKEKKALELKLSTREAQEQAYLVHIEHLKSEVEEQKEQRTRSLSSTSSSGKEKPG
FT                   KECADAASPALSLAELRTNSDSELATEFANAIRREKKLKARVQELVSALERLTKSSEIR
FT                   HQQSAEFVNDLKRANSNLVAAYEKAKKKHQNKLKKLESQMMAMVERHETQVRMLKQRIA
FT                   LLEEENSRPHTNETSL"
FT   CDS             complement(join(7179206..7179386,7180654..7180776,
FT                   7192209..7192306,7195042..7195248,7198474..7198708,
FT                   7209013..7209196,7213051..7213154,7217689..7217829,
FT                   7222929..7223077,7224440..7224529,7225544..7225690,
FT                   7239859..7240065,7242114..7242277,7258901..7259043,
FT                   7268302..7268426))
FT                   /codon_start=1
FT                   /locus_tag="mCG_4620"
FT                   /product="mCG4620, isoform CRA_a"
FT                   /note="gene_id=mCG4620.3 transcript_id=mCT174140.0
FT                   protein_id=mCP97059.0 isoform=CRA_a"
FT                   /protein_id="EDL09996.1"
FT                   /translation="MREHEDVQERTTLRYEERITELHSIIAELNKKIDRLQGTTIREED
FT                   EYSELRSELSQSQQEVNEDSRSVDQDQTSVSIPENQSTMVTADMDNCSDLNSELQRVLT
FT                   GLESVVCGRKKSSCSLSVADVDRHIEQLTTASEHCDLAIKTVEEIEGVLGRDLYPNLAE
FT                   ERSRWEKELAGLREENESLTAMLCSKEEELNRTKATMNAIREERDRLRRRVRELQTRLQ
FT                   SVQATGPSSPGRLTPANRPINPSTGELSTSSSSNDIPIAKIAERVKLSKTRSESSSSDR
FT                   PVLGSEISSIGVSSSVAEHLAHSLQDCSNIQEIFQTLYSHGSAISESKIREFEVETERL
FT                   NSRIEHLKSQNDLLTITLEECKSNAERMSMLVGKYESNATALRLALQYSEQCIEAYELL
FT                   LALAESEQSLILGQFRAAGVGSSPGDQSGDENITQMLKRAHDCRKTAENAAKALLMKLD
FT                   GSCGGAFAVAGCSVQPWESLSSNSHTSTTSSTASSCDTEFTKEDEQRLKDYIQQLKNDR
FT                   AAVKLTMLELESIHIDPLSYDVKPRGDSQRLDLENAVLMQELMAMKEEMAELKAQLYLL
FT                   EKEKKALELKLSTREAQEQAYLVHIEHLKSEVEEQKEQRTRSLSSTSSSGKEKPGKECA
FT                   DAASPALSLAELRTNSDSELATEFANAIRREKKLKARVQELVSALERLTKSSEIRHQQS
FT                   AEFVNDLKRANSNLVAAYEKAKKKHQNKLKKLESQMMAMVERHETQVRMLKQRIALLEE
FT                   ENSRPHTNETSL"
FT   gene            <7410536..7425084
FT                   /locus_tag="mCG_145926"
FT                   /note="gene_id=mCG145926.0"
FT   mRNA            join(<7410536..7411156,7417640..7417735,7421078..7421218,
FT                   7421826..7422438,7424189..7425084)
FT                   /locus_tag="mCG_145926"
FT                   /product="mCG145926"
FT                   /note="gene_id=mCG145926.0 transcript_id=mCT186034.0
FT                   created on 04-JUL-2003"
FT   CDS             join(<7410537..7411156,7417640..7417649)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145926"
FT                   /product="mCG145926"
FT                   /note="gene_id=mCG145926.0 transcript_id=mCT186034.0
FT                   protein_id=mCP107758.0"
FT                   /protein_id="EDL09995.1"
FT                   /translation="RNPSSGPQQFLTSLSSAEESLPYFTATPEFMPALFRAGLVPRPRS
FT                   VGAGLRLDSLGLLPAGTFQSRQPFSPRTAARPERMEKLDTVSQAGISPASHSCRRLGRG
FT                   LRSQQLQRPSRRRDPPARPPRSPGVMPPSAPPRPSYGTTQIPITRQAGSSRRRPAELGY
FT                   PPGEAWAPVRERYVPPVPGRKELERAGAEQHFTPKFPPLNRLELVL"
FT   gene            7588786..7642252
FT                   /locus_tag="mCG_11938"
FT                   /note="gene_id=mCG11938.2"
FT   mRNA            join(7588786..7588985,7591668..7591834,7594515..7594617,
FT                   7595593..7595745,7609279..7609408,7609619..7609715,
FT                   7609798..7609885,7609971..7610051,7611623..7611708,
FT                   7612804..7612909,7614504..7614623,7614908..7615180,
FT                   7617134..7617260,7618794..7618999,7619390..7619585,
FT                   7625971..7626080,7627362..7627654,7632139..7632316,
FT                   7639589..7639792,7640706..7640888,7642074..7642252)
FT                   /locus_tag="mCG_11938"
FT                   /product="mCG11938"
FT                   /note="gene_id=mCG11938.2 transcript_id=mCT12219.2 created
FT                   on 11-OCT-2002"
FT   CDS             join(7588797..7588985,7591668..7591834,7594515..7594617,
FT                   7595593..7595745,7609279..7609408,7609619..7609715,
FT                   7609798..7609885,7609971..7610051,7611623..7611708,
FT                   7612804..7612909,7614504..7614623,7614908..7615180,
FT                   7617134..7617260,7618794..7618999,7619390..7619585,
FT                   7625971..7626080,7627362..7627654,7632139..7632316,
FT                   7639589..7639792,7640706..7640888,7642074..7642154)
FT                   /codon_start=1
FT                   /locus_tag="mCG_11938"
FT                   /product="mCG11938"
FT                   /note="gene_id=mCG11938.2 transcript_id=mCT12219.2
FT                   protein_id=mCP13131.2"
FT                   /protein_id="EDL09994.1"
FT                   /translation="MSKTSGRLNNGIPQVPVKRGESEFDSFRQSLPVFEKQEEIVKIIK
FT                   ENKVVLIVGETGSGKTTQIPQFLLDDCFKNGIPCRIFCTQPRRLAAIAVAERVAAERRE
FT                   RIGQTIGYQIRLESRVSPKTLLTFCTNGVLLRTLMAGDSTLSTVTHVIVDEVHERDRFS
FT                   DFLLTKLRDLLQKHPTLKLILSSAALDVNLFIRYFGSCPVINGNDLSAEDRELLKAYHH
FT                   SFDDEKVDLDLIMHLLYNICHSCDAGAILIFLPGYDEIVGLRDRILFDDKRFADNTHRY
FT                   QVFMLHSNMQTSDQKKVLKNPPAGVRKIILSTNIAETSITVNDVVFVIDSGKVKEQKSF
FT                   DALNFVTMLKMVWISKASAIQRKGRAGRCRPGICFRLFSRLRFQNMLEFQTPELLRMPL
FT                   QELCLHTKLLAPVNCTIADFLMKAPEPPPALIVRNAVQMLKTIDAMDAWEDLTELGYHL
FT                   ADLPVEPHLGKMVLCAVVLKCLDPILTIACTLAYRDPFVLPTQASQKRAAMLCRKRFTA
FT                   GTFSDHMALLRAFQAWQKARSDGWERAFCEKNFLSQATMEIIIGMRTQLLGQLRASGFV
FT                   RARGGGDIRDVNTNSENWAVVKAALVAGMYPNLVHVDRENVILTGPKEKKVRFHPTSVL
FT                   SQPQYKKIPPANGQAAAIQALPTDWLIYDEMTRAHRIANIRCCSAVTPVTVLVFCGPAR
FT                   LASNALQEPSSFRADGIPNDSSDSEMEDRTTANLAALKLDEWLNFKLEPEAASLLLQLR
FT                   QKWHSLFLRRMRAPSKPWSQVDEATIRAIIAVLSTEEQSAGLQQPSGIGQRPRPMSSEE
FT                   LPLASSWRSNNSRKSTADTEFADGSTTGERVLMKSPSPALHPPQKYKDRGILHPKRSTD
FT                   DRSDQSSVKSTDSSSYPSPCASPSPPSSGKGSKSPSPRPNMPIRYFIMKSSNLRNLEIS
FT                   QQKGIWSTTPSNERKLNRAFWESSMVYLVFSVQGSGHFQGFSRMSSEIGREKSQDWGSA
FT                   GLGGVFKVEWIRKESLPFQFAHHLLNPWNDNKKVQISRDGQELEPQVGEQLLQLWERLP
FT                   LGEKTTSD"
FT   gene            complement(7807815..7809521)
FT                   /pseudo
FT                   /locus_tag="mCG_3420"
FT                   /note="gene_id=mCG3420.1"
FT   mRNA            complement(7807815..7809521)
FT                   /pseudo
FT                   /locus_tag="mCG_3420"
FT                   /note="gene_id=mCG3420.1 transcript_id=mCT2530.1 created on
FT                   17-APR-2003"
FT   gene            complement(7888293..7889431)
FT                   /pseudo
FT                   /locus_tag="mCG_3421"
FT                   /note="gene_id=mCG3421.2"
FT   mRNA            complement(join(7888293..7888777,7888835..7889431))
FT                   /pseudo
FT                   /locus_tag="mCG_3421"
FT                   /note="gene_id=mCG3421.2 transcript_id=mCT2531.2 created on
FT                   11-OCT-2002"
FT   gene            8012005..>8032879
FT                   /locus_tag="mCG_147299"
FT                   /note="gene_id=mCG147299.0"
FT   mRNA            join(8012005..8012562,8031092..>8032879)
FT                   /locus_tag="mCG_147299"
FT                   /product="mCG147299"
FT                   /note="gene_id=mCG147299.0 transcript_id=mCT187562.0
FT                   created on 13-JAN-2004"
FT   gene            complement(8028313..8029289)
FT                   /pseudo
FT                   /locus_tag="mCG_56293"
FT                   /note="gene_id=mCG56293.2"
FT   mRNA            complement(8028313..8029289)
FT                   /pseudo
FT                   /locus_tag="mCG_56293"
FT                   /note="gene_id=mCG56293.2 transcript_id=mCT56476.2 created
FT                   on 17-OCT-2002"
FT   CDS             8032675..>8032879
FT                   /codon_start=1
FT                   /locus_tag="mCG_147299"
FT                   /product="mCG147299"
FT                   /note="gene_id=mCG147299.0 transcript_id=mCT187562.0
FT                   protein_id=mCP109687.0"
FT                   /protein_id="EDL09993.1"
FT                   /translation="MDSKLGHSLDHLSLSLFSSFVPAVLLDRNNSGSEFLTVEWQAQRV
FT                   GRLGGEEEFWEGSSGRGNDWIVK"
FT   gene            <8298647..8424459
FT                   /gene="Kcnn2"
FT                   /locus_tag="mCG_3422"
FT                   /note="gene_id=mCG3422.3"
FT   mRNA            join(<8298647..8299803,8300400..8300495,8331161..8331579,
FT                   8393611..8393752,8408652..8409685)
FT                   /gene="Kcnn2"
FT                   /locus_tag="mCG_3422"
FT                   /product="potassium intermediate/small conductance
FT                   calcium-activated channel, subfamily N, member 2,
FT                   transcript variant mCT190310"
FT                   /note="gene_id=mCG3422.3 transcript_id=mCT190310.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<8298649..8299803,8300400..8300495,8331161..8331579,
FT                   8393611..8393752,8408652..8408846)
FT                   /codon_start=1
FT                   /gene="Kcnn2"
FT                   /locus_tag="mCG_3422"
FT                   /product="potassium intermediate/small conductance
FT                   calcium-activated channel, subfamily N, member 2, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG3422.3 transcript_id=mCT190310.0
FT                   protein_id=mCP111283.0 isoform=CRA_b"
FT                   /protein_id="EDL09991.1"
FT                   /translation="THCAGCTTAWSPCSFNSSDMETPLQFQRGFFPEQPPPPPRSSHLH
FT                   CQQQQQSQDKPCAPFAPLPHPHHHPHLAHQQPGSGGSSPCLRCNSCASSGAPAAGAGAG
FT                   DNLSLLLRTSSPGGAFRTRTSSPLSGSSCCCCCSSRRGSQLNVSELTPSSHASALRQQY
FT                   AQQPASASQYHQCHSLQPATSPTGSLGSLGSGPPLSHHHHHPHPAHHQHHQPQARRESN
FT                   PFTEIAMSSCRYNGGVMRPLSNLSSSRRNLQEMDSEAQPLQPPASVVGGGGGASSPSAA
FT                   AAASSSAPEIVVSKPEHNNSNNLALYGTGGGGSTGGGGGGSGHGSSSGTKSSKKKNQNI
FT                   GYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSWGAYDKASLYSLALKCLISL
FT                   STIILLGLIIVYHAREIQLFMVDNGADDWRIAMTYERIFFICLEILVCAIHPIPGNYTF
FT                   TWTARLAFSYAPSTTTADVDIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKI
FT                   NFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRACERYHDQQDVTSNFLGAMWLIS
FT                   ITFLSIGYGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMD
FT                   TQLTKRVSRPPHIVQDDVTVHCDIPTLRNMGFH"
FT   mRNA            join(8299077..8299803,8300400..8300495,8331161..8331579,
FT                   8393611..8393752,8408652..8408762,8415373..8415500,
FT                   8421505..8421574,8423709..8424459)
FT                   /gene="Kcnn2"
FT                   /locus_tag="mCG_3422"
FT                   /product="potassium intermediate/small conductance
FT                   calcium-activated channel, subfamily N, member 2,
FT                   transcript variant mCT2532"
FT                   /note="gene_id=mCG3422.3 transcript_id=mCT2532.2 created on
FT                   11-OCT-2002"
FT   CDS             join(8299333..8299803,8300400..8300495,8331161..8331579,
FT                   8393611..8393752,8408652..8408762,8415373..8415500,
FT                   8421505..8421574,8423709..8423996)
FT                   /codon_start=1
FT                   /gene="Kcnn2"
FT                   /locus_tag="mCG_3422"
FT                   /product="potassium intermediate/small conductance
FT                   calcium-activated channel, subfamily N, member 2, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG3422.3 transcript_id=mCT2532.2
FT                   protein_id=mCP12539.2 isoform=CRA_c"
FT                   /db_xref="GOA:P58390"
FT                   /db_xref="InterPro:IPR004178"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="InterPro:IPR015449"
FT                   /db_xref="MGI:MGI:2153182"
FT                   /db_xref="UniProtKB/Swiss-Prot:P58390"
FT                   /protein_id="EDL09992.1"
FT                   /translation="MSSCRYNGGVMRPLSNLSSSRRNLQEMDSEAQPLQPPASVVGGGG
FT                   GASSPSAAAAASSSAPEIVVSKPEHNNSNNLALYGTGGGGSTGGGGGGSGHGSSSGTKS
FT                   SKKKNQNIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSWGAYDKASLYSL
FT                   ALKCLISLSTIILLGLIIVYHAREIQLFMVDNGADDWRIAMTYERIFFICLEILVCAIH
FT                   PIPGNYTFTWTARLAFSYAPSTTTADVDIILSIPMFLRLYLIARVMLLHSKLFTDASSR
FT                   SIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRACERYHDQQDVTSNF
FT                   LGAMWLISITFLSIGYGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEK
FT                   HVHNFMMDTQLTKRVKNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLR
FT                   SVKMEQRKLNDQANTLVDLAKTQNIMYDMISDLNERSEDFEKRIVTLETKLETLIGSIH
FT                   ALPGLISQTIRQQQRDFIETQMENYDKHVSYNAERSRSSSRRRRSSSTAPPTSSESS"
FT   mRNA            join(<8299333..8299803,8300400..8300495,8331161..8331579,
FT                   8393611..8393752,8408652..8408762,8413691..8413798)
FT                   /gene="Kcnn2"
FT                   /locus_tag="mCG_3422"
FT                   /product="potassium intermediate/small conductance
FT                   calcium-activated channel, subfamily N, member 2,
FT                   transcript variant mCT190309"
FT                   /note="gene_id=mCG3422.3 transcript_id=mCT190309.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(8299333..8299803,8300400..8300495,8331161..8331579,
FT                   8393611..8393752,8408652..8408762,8413691..8413750)
FT                   /codon_start=1
FT                   /gene="Kcnn2"
FT                   /locus_tag="mCG_3422"
FT                   /product="potassium intermediate/small conductance
FT                   calcium-activated channel, subfamily N, member 2, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG3422.3 transcript_id=mCT190309.0
FT                   protein_id=mCP111282.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q80X11"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="InterPro:IPR015449"
FT                   /db_xref="MGI:MGI:2153182"
FT                   /db_xref="UniProtKB/TrEMBL:Q80X11"
FT                   /protein_id="EDL09990.1"
FT                   /translation="MSSCRYNGGVMRPLSNLSSSRRNLQEMDSEAQPLQPPASVVGGGG
FT                   GASSPSAAAAASSSAPEIVVSKPEHNNSNNLALYGTGGGGSTGGGGGGSGHGSSSGTKS
FT                   SKKKNQNIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSWGAYDKASLYSL
FT                   ALKCLISLSTIILLGLIIVYHAREIQLFMVDNGADDWRIAMTYERIFFICLEILVCAIH
FT                   PIPGNYTFTWTARLAFSYAPSTTTADVDIILSIPMFLRLYLIARVMLLHSKLFTDASSR
FT                   SIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRACERYHDQQDVTSNF
FT                   LGAMWLISITFLSIGYGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEK
FT                   HVHNFMMDTQLTKRTGICTKSVAMFNARVMAQH"
FT   gene            complement(8421921..>8627233)
FT                   /locus_tag="mCG_146103"
FT                   /note="gene_id=mCG146103.0"
FT   mRNA            complement(join(8421921..8423992,8440314..8440368,
FT                   8575886..8575991,8627140..>8627233))
FT                   /locus_tag="mCG_146103"
FT                   /product="mCG146103"
FT                   /note="gene_id=mCG146103.0 transcript_id=mCT186206.0
FT                   created on 14-JUL-2003"
FT   CDS             complement(8422546..>8422776)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146103"
FT                   /product="mCG146103"
FT                   /note="gene_id=mCG146103.0 transcript_id=mCT186206.0
FT                   protein_id=mCP107763.0"
FT                   /protein_id="EDL09989.1"
FT                   /translation="GDGEICSTQSTATFSKSQTPWAARTSCLSCSLSASQLFKDNKGTH
FT                   RSSHSEPRHFLLFEPQTQGALILALLHSWEN"
FT   gene            complement(8893756..>8939216)
FT                   /gene="Trim36"
FT                   /locus_tag="mCG_3456"
FT                   /note="gene_id=mCG3456.1"
FT   mRNA            complement(join(8893756..8894530,8895912..8896209,
FT                   8899198..8899488,8902372..8902496,8902695..8902948,
FT                   8905227..8905322,8912946..8913092,8915215..8915540,
FT                   8922904..8923138,8939154..>8939216))
FT                   /gene="Trim36"
FT                   /locus_tag="mCG_3456"
FT                   /product="tripartite motif-containing 36"
FT                   /note="gene_id=mCG3456.1 transcript_id=mCT2429.2 created on
FT                   11-OCT-2002"
FT   CDS             complement(join(8894176..8894530,8895912..8896209,
FT                   8899198..8899488,8902372..8902496,8902695..8902948,
FT                   8905227..8905322,8912946..8913092,8915215..8915540,
FT                   8922904..8923138,8939154..8939216))
FT                   /codon_start=1
FT                   /gene="Trim36"
FT                   /locus_tag="mCG_3456"
FT                   /product="tripartite motif-containing 36"
FT                   /note="gene_id=mCG3456.1 transcript_id=mCT2429.2
FT                   protein_id=mCP12526.1"
FT                   /protein_id="EDL09987.1"
FT                   /translation="MSESEEISEFGYIMELLAKGKVTIKNIEKELICPACKELFTHPLI
FT                   LPCQHSVCHKCVKELLLSLDDSFNDVASDSSNQSSPRLRLTSPSMDKIDKINRPGWKRN
FT                   SLTPRPTTFPCPGCEHDVDLGERGVSGLFRNFTLETIVERYRQAARAATAIMCDLCKPP
FT                   PQESTKSCMDCSASYCNECFKIYHPWGTVKAQHEYVGPTTNFRPKVLMCPEHETERINM
FT                   YCELCRRPVCHLCKLGGNHSNHRVTTMSSAYKTLKEKLSKDIDFLIGKESQVKSQISEL
FT                   NLLMKETECNGERAKEEALAHFEKLFEILEDRKSSVLKAIDASKKLRLDKFHTQMEEYQ
FT                   GLLENNGLVGYAQEVLKETDQSCFVQTAKQLHLRIQKATESLKSFRPAAQASFEDYVVN
FT                   ISKQTEVLGELSFFSSGIDIPEINEEQSKVYNNALIDWHHPEKDKADSYVLEYRKINRD
FT                   EEMISWNEIEVHGTSKVVSNLESNSPYAFRVRAYRGSICSPCSRELILHTPPAPVFSFL
FT                   FDEKCGYNTEHLLLNLKRDRVESRAGFNVLLAAERIQVGHYTSLDYIIGDVGVTKGKHF
FT                   WACRVEPYSYLVKVGVASSDKLQEWLRSPRDAASPRYEQDSGHDSGSEDACFDSSQPFT
FT                   LVTIGMKKFFIPKSPTSSNEPENRVLPMPTSIGIFLDCDKGKVSFYDMDHMKCLYERQV
FT                   DCSHTMYPAFALMGSGGIQLEEAITAKYLEYEEDV"
FT   gene            8925852..8926564
FT                   /locus_tag="mCG_147291"
FT                   /note="gene_id=mCG147291.0"
FT   mRNA            8925852..8926564
FT                   /locus_tag="mCG_147291"
FT                   /product="mCG147291"
FT                   /note="gene_id=mCG147291.0 transcript_id=mCT187554.0
FT                   created on 13-JAN-2004"
FT   CDS             8926209..8926544
FT                   /codon_start=1
FT                   /locus_tag="mCG_147291"
FT                   /product="mCG147291"
FT                   /note="gene_id=mCG147291.0 transcript_id=mCT187554.0
FT                   protein_id=mCP109673.0"
FT                   /db_xref="GOA:G3X950"
FT                   /db_xref="MGI:MGI:1916641"
FT                   /db_xref="UniProtKB/TrEMBL:G3X950"
FT                   /protein_id="EDL09988.1"
FT                   /translation="MFRFLLNPGLAPHATQEPGVTGTAGGSRDCIPGCWPRIGIKILRQ
FT                   SPRPSPAHSHLVVPHLKSVDRGSEMPRQPHQACTGQGSRWAHFACFLRTGRTEQGSLLL
FT                   SGANITR"
FT   gene            complement(8964340..9013067)
FT                   /gene="Pggt1b"
FT                   /locus_tag="mCG_3458"
FT                   /note="gene_id=mCG3458.1"
FT   mRNA            complement(join(8964340..8968535,8973396..8973504,
FT                   8975705..8975889,8981135..8981180,8984973..8985105,
FT                   8986492..8986643,8989785..8989852,9002695..9002813,
FT                   9012749..9013067))
FT                   /gene="Pggt1b"
FT                   /locus_tag="mCG_3458"
FT                   /product="protein geranylgeranyltransferase type I, beta
FT                   subunit"
FT                   /note="gene_id=mCG3458.1 transcript_id=mCT2431.1 created on
FT                   11-OCT-2002"
FT   CDS             complement(join(8968354..8968535,8973396..8973504,
FT                   8975705..8975889,8981135..8981180,8984973..8985105,
FT                   8986492..8986643,8989785..8989852,9002695..9002813,
FT                   9012749..9012888))
FT                   /codon_start=1
FT                   /gene="Pggt1b"
FT                   /locus_tag="mCG_3458"
FT                   /product="protein geranylgeranyltransferase type I, beta
FT                   subunit"
FT                   /note="gene_id=mCG3458.1 transcript_id=mCT2431.1
FT                   protein_id=mCP12527.2"
FT                   /protein_id="EDL09986.1"
FT                   /translation="MATTEDDRLAGSGEGERLDFLRDRHVRFFQRCLQVLPERYSSLET
FT                   SRLTIAFFALSGLDMLDSLDVVNKDDIIEWIYSLQVLPTEDRSNLSRCGFRGSSYLGIP
FT                   FNPSKNPGAAHPYDSGHIAMTYTGLSCLIILGDDLGRVDKEACLAGLRALQLEDGSFCA
FT                   VPEGSENDMRFVYCASCICYMLNNWSGMDMKKAISYIRRSMSYDNGLAQGAGLESHGGS
FT                   TFCGIASLCLMGKLEEVFSEKELNRIKRWCIMRQQNGYHGRPNKPVDTCYSFWVGATLK
FT                   LLKIFQYTNFEKNRNYILSTQDRLVGGFAKWPDSHPDALHAYFGICGLSLMEESGICKV
FT                   HPALNVSTRTSERLRDLHQSWKTKDSKQCSDNVHIAT"
FT   gene            complement(9015120..9044006)
FT                   /locus_tag="mCG_3462"
FT                   /note="gene_id=mCG3462.2"
FT   mRNA            complement(join(9015120..9015360,9015751..9015869,
FT                   9017728..9017823,9019465..9019878,9022867..9023257,
FT                   9023639..9023714,9025520..9025609,9028380..9028501,
FT                   9031385..9031506,9043806..9044006))
FT                   /locus_tag="mCG_3462"
FT                   /product="mCG3462, transcript variant mCT2423"
FT                   /note="gene_id=mCG3462.2 transcript_id=mCT2423.2 created on
FT                   11-OCT-2002"
FT   CDS             complement(join(9015330..9015360,9015751..9015869,
FT                   9017728..9017823,9019465..9019878,9022867..9023257,
FT                   9023639..9023714,9025520..9025609,9028380..9028501,
FT                   9031385..9031506,9043806..9043922))
FT                   /codon_start=1
FT                   /locus_tag="mCG_3462"
FT                   /product="mCG3462, isoform CRA_b"
FT                   /note="gene_id=mCG3462.2 transcript_id=mCT2423.2
FT                   protein_id=mCP12530.2 isoform=CRA_b"
FT                   /db_xref="GOA:D3Z1J2"
FT                   /db_xref="MGI:MGI:1918800"
FT                   /db_xref="UniProtKB/TrEMBL:D3Z1J2"
FT                   /protein_id="EDL09985.1"
FT                   /translation="MAALTTVVVAAAATAVAGAVAGAGAAAGTGVGAAPTPQQSDGGCS
FT                   ASGGIRSFQLQNWKQKVSRTKKAEFIRTAEKFKNQVIVIEKDKHSHFYNQRGDFRTEYN
FT                   MLEELENKLINSRKTERAKIQQQLAKIHNNVKKLQNQLKDVKPTPDFVEKLREMMEEIE
FT                   NAINTFKEEQRLIYEELIQEEKTTNNELSAVSRRIESWALGNSETEKAFRAISSKVPVD
FT                   RVTQRTLPEQVVEFEKFLQQTGGRQGGWDALDHQNFVKVRNKHKGKPTFMKEVVEHLPG
FT                   RTLDEVQQHEKWYQKFLTLEEKKKESIQNWKTKKQQKKEEILKLKEKVDTVPLPSQSKA
FT                   EDSPKQREEQRKKQKLAVEAWKKRKSLEMSAKLASQLREEEEKERKQQRERQRQSKLKL
FT                   LLESYTQQRREQEEFLRLEQEIKEKAEKAEKRKTAADELARFQERDLHKLELKILDRQA
FT                   KEEEKAEKQRRLTKLKEKVENNVSRDPSRLYKPTKGWEERTKKIGPSGSGPLLHIPHRA
FT                   IPTWRQGI"
FT   mRNA            complement(join(9041053..9041410,9043806..9044005))
FT                   /locus_tag="mCG_3462"
FT                   /product="mCG3462, transcript variant mCT174132"
FT                   /note="gene_id=mCG3462.2 transcript_id=mCT174132.0 created
FT                   on 11-OCT-2002"
FT   CDS             complement(9041187..9041408)
FT                   /codon_start=1
FT                   /locus_tag="mCG_3462"
FT                   /product="mCG3462, isoform CRA_a"
FT                   /note="gene_id=mCG3462.2 transcript_id=mCT174132.0
FT                   protein_id=mCP97051.0 isoform=CRA_a"
FT                   /protein_id="EDL09984.1"
FT                   /translation="MGWMAHMLRALVLQEDLGLISSTHILTHKHLYLQFQEIQSSHLAF
FT                   TDNSTYMMHRHTYKQNTRTHKMNLKINK"
FT   gene            complement(9090193..9159828)
FT                   /locus_tag="mCG_147321"
FT                   /note="gene_id=mCG147321.0"
FT   mRNA            complement(join(9090193..9090390,9159638..9159828))
FT                   /locus_tag="mCG_147321"
FT                   /product="mCG147321"
FT                   /note="gene_id=mCG147321.0 transcript_id=mCT187584.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(join(9090343..9090390,9159638..9159796))
FT                   /codon_start=1
FT                   /locus_tag="mCG_147321"
FT                   /product="mCG147321"
FT                   /note="gene_id=mCG147321.0 transcript_id=mCT187584.0
FT                   protein_id=mCP109709.0"
FT                   /protein_id="EDL09983.1"
FT                   /translation="MSVIMSVCSEGYFRKMWGLVFYICSEAWRQPAEGLRRGVRIAQEA
FT                   GRVQTGFQKEDGKFGIKWEQANW"
FT   gene            complement(9192120..9192943)
FT                   /locus_tag="mCG_56291"
FT                   /note="gene_id=mCG56291.2"
FT   mRNA            complement(9192120..9192943)
FT                   /locus_tag="mCG_56291"
FT                   /product="mCG56291"
FT                   /note="gene_id=mCG56291.2 transcript_id=mCT56474.2 created
FT                   on 18-OCT-2002"
FT   CDS             complement(9192341..9192916)
FT                   /codon_start=1
FT                   /locus_tag="mCG_56291"
FT                   /product="mCG56291"
FT                   /note="gene_id=mCG56291.2 transcript_id=mCT56474.2
FT                   protein_id=mCP34139.1"
FT                   /db_xref="GOA:Q9D8A4"
FT                   /db_xref="InterPro:IPR000535"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="MGI:MGI:1919326"
FT                   /db_xref="UniProtKB/TrEMBL:Q9D8A4"
FT                   /protein_id="EDL09982.1"
FT                   /translation="MASTSRAPAKPQQVLVLDPPTDLKFKGPFTGLLTAHLKLRNPSAR
FT                   KVCFKVKSTSPRRYCVRPNNGVIDPGCTVTVAATMQPSCCGPSKEVKHKFMVQTVFAPP
FT                   DISDLEAVWREAHPGELMDSKLRCVFEPPTESDKLEDGLRLRKATHPDKPRPSSSTSLK
FT                   PARSTPLPVVLLVIGAVFFGFFLGKFVL"
FT   gene            complement(9228891..9252906)
FT                   /gene="Fem1c"
FT                   /locus_tag="mCG_3467"
FT                   /note="gene_id=mCG3467.1"
FT   mRNA            complement(join(9228891..9233530,9251281..9252008,
FT                   9252797..9252906))
FT                   /gene="Fem1c"
FT                   /locus_tag="mCG_3467"
FT                   /product="fem-1 homolog c (C.elegans)"
FT                   /note="gene_id=mCG3467.1 transcript_id=mCT2417.1 created on
FT                   11-OCT-2002"
FT   CDS             complement(join(9232221..9233530,9251281..9251824))
FT                   /codon_start=1
FT                   /gene="Fem1c"
FT                   /locus_tag="mCG_3467"
FT                   /product="fem-1 homolog c (C.elegans)"
FT                   /note="gene_id=mCG3467.1 transcript_id=mCT2417.1
FT                   protein_id=mCP12545.0"
FT                   /db_xref="GOA:B2RRW5"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="MGI:MGI:2444737"
FT                   /db_xref="UniProtKB/TrEMBL:B2RRW5"
FT                   /protein_id="EDL09981.1"
FT                   /translation="MDLKTAVFNAARDGKLRLLTKLLASKSKAEVSSLISEKTNGATPL
FT                   LMAARYGHLDMVEFLLEQCSASIEVGGSVNFDGETIEGAPPLWAASAAGHLKVVQSLLN
FT                   HGASVNNTTLTNSTPLRAACFDGHLEIVKYLVEHKADLEVSNRHGHTCLMISCYKGHKE
FT                   IAQYLLEKGADVNRKSVKGNTALHDCAESGSLDIMKMLLMYCAKMEKDGYGMTPLLSAS
FT                   VTGHTNIVDFLTHHAQTSKTERINALELLGATFVDKKRDLLGALKYWKKAMNMRYSDRT
FT                   NIISKPVPQTLIMAYDYAKEVNSAEELEGLIADPDEMRMQALLIRERILGPSHPDTSYY
FT                   IRYRGAVYADSGNFKRCINLWKYALDMQQSNLDPLSPMTASSLLSFAELFSFMLQDRAK
FT                   GLLGTTVTFDDLMGILCKSVLEIERAIKQTQCPADPLQLNKALSIILHLICLLEKVPCT
FT                   VEQDHFKKQTIYRFLKLHPRGKNNFSPLHLAVDKNTTCVGRYPVCKFPSLQVTAILIEC
FT                   GADVNVRDSDDNSPLHIAALNNHPDIMNLLIKSGAHFDATNLHKQTASDLLDEKEIAKN
FT                   LIQPINHTTLQCLAARVIVNHRIYYKGNIPEKLETFVSLHR"
FT   gene            complement(9284812..9300956)
FT                   /gene="Ticam2"
FT                   /locus_tag="mCG_1033370"
FT                   /note="gene_id=mCG1033370.1"
FT   mRNA            complement(join(9284812..9287653,9299301..9299403,
FT                   9300715..9300956))
FT                   /gene="Ticam2"
FT                   /locus_tag="mCG_1033370"
FT                   /product="toll-like receptor adaptor molecule 2"
FT                   /note="gene_id=mCG1033370.1 transcript_id=mCT151074.1
FT                   created on 10-MAR-2003"
FT   CDS             complement(9286901..9287599)
FT                   /codon_start=1
FT                   /gene="Ticam2"
FT                   /locus_tag="mCG_1033370"
FT                   /product="toll-like receptor adaptor molecule 2"
FT                   /note="gene_id=mCG1033370.1 transcript_id=mCT151074.1
FT                   protein_id=mCP78085.1"
FT                   /protein_id="EDL09980.1"
FT                   /translation="MGVGKSKLDKCPLSWHKKDSVDADQDGHESDSKNSEEACLRGFVE
FT                   QSSGSEPPTGEQDQPEAKGAGPEEQDEEEFLKFVILHAEDDTDEALRVQDLLQNDFGIR
FT                   PGIVFAEMPCGRLHLQNLDDAVNGSAWTILLLTENFLRDTWCNFQFYTSLMNSVSRQHK
FT                   YNSVIPMRPLNSPLPRERTPLALQTINALEEESQGFSTQVERIFRESVFERQQSIWKET
FT                   RSVSQKQFIA"
FT   gene            9298375..9342842
FT                   /gene="Eif1a"
FT                   /locus_tag="mCG_3464"
FT                   /note="gene_id=mCG3464.2"
FT   mRNA            join(9298375..9298409,9324216..9324283,9325125..9325184,
FT                   9333898..9336613)
FT                   /gene="Eif1a"
FT                   /locus_tag="mCG_3464"
FT                   /product="eukaryotic translation initiation factor 1A,
FT                   transcript variant mCT174133"
FT                   /note="gene_id=mCG3464.2 transcript_id=mCT174133.0 created
FT                   on 11-OCT-2002"
FT   gene            complement(9312459..9324033)
FT                   /locus_tag="mCG_3463"
FT                   /note="gene_id=mCG3463.2"
FT   mRNA            complement(join(9312459..9315189,9319750..9319995,
FT                   9323589..9324033))
FT                   /locus_tag="mCG_3463"
FT                   /product="mCG3463"
FT                   /note="gene_id=mCG3463.2 transcript_id=mCT2424.2 created on
FT                   11-OCT-2002"
FT   CDS             complement(join(9314953..9315189,9319750..9319923))
FT                   /codon_start=1
FT                   /locus_tag="mCG_3463"
FT                   /product="mCG3463"
FT                   /note="gene_id=mCG3463.2 transcript_id=mCT2424.2
FT                   protein_id=mCP12540.2"
FT                   /protein_id="EDL09979.1"
FT                   /translation="MKKQYDSFTFTASRNGTYKFCFSNEFSTFTHKTVYFDFQVGEDPP
FT                   LFPSENRVSALTQMESACVSIHEALKSVIDYQTHFRLREAQGRSRAEDLNTRVAYWSVG
FT                   EALILLVVSVGQVFLLKSFFSDKRTTTTRVGS"
FT   mRNA            join(9324208..9325184,9333898..9335567)
FT                   /gene="Eif1a"
FT                   /locus_tag="mCG_3464"
FT                   /product="eukaryotic translation initiation factor 1A,
FT                   transcript variant mCT174135"
FT                   /note="gene_id=mCG3464.2 transcript_id=mCT174135.0 created
FT                   on 11-OCT-2002"
FT   mRNA            join(9324225..9324283,9325125..9325184,9333958..9336613)
FT                   /gene="Eif1a"
FT                   /locus_tag="mCG_3464"
FT                   /product="eukaryotic translation initiation factor 1A,
FT                   transcript variant mCT2420"
FT                   /note="gene_id=mCG3464.2 transcript_id=mCT2420.2 created on
FT                   11-OCT-2002"
FT   mRNA            join(9324355..9324640,9325125..9325184,9333898..9334136,
FT                   9342195..9342329,9342663..9342842)
FT                   /gene="Eif1a"
FT                   /locus_tag="mCG_3464"
FT                   /product="eukaryotic translation initiation factor 1A,
FT                   transcript variant mCT174134"
FT                   /note="gene_id=mCG3464.2 transcript_id=mCT174134.0 created
FT                   on 11-OCT-2002"
FT   CDS             join(9324567..9324640,9325125..9325184,9333898..9334136,
FT                   9342195..9342329,9342663..9342736)
FT                   /codon_start=1
FT                   /gene="Eif1a"
FT                   /locus_tag="mCG_3464"
FT                   /product="eukaryotic translation initiation factor 1A,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG3464.2 transcript_id=mCT174134.0
FT                   protein_id=mCP97053.0 isoform=CRA_a"
FT                   /protein_id="EDL09975.1"
FT                   /translation="MRIITRFSVGKRQLGESGWHVVSTRLRRRPHLPENQARTEVLFCS
FT                   SQKPGLCNTVCCLWIFYIHSVPVASDLPLLDTSATHPKSIVVLGKESQLLSAGVPHSTP
FT                   VVALSIMPKNKGKGGKNRRRGRISVSLWAVAVFSSVSHLFPVILPEHRIPISTFAPANR
FT                   STLRPPGGTHGDRRTAVSGASSLLPSSGFH"
FT   CDS             9334094..9334528
FT                   /codon_start=1
FT                   /gene="Eif1a"
FT                   /locus_tag="mCG_3464"
FT                   /product="eukaryotic translation initiation factor 1A,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG3464.2 transcript_id=mCT174135.0
FT                   protein_id=mCP97054.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q4FJR7"
FT                   /db_xref="InterPro:IPR001253"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018104"
FT                   /db_xref="MGI:MGI:95298"
FT                   /db_xref="UniProtKB/TrEMBL:Q4FJR7"
FT                   /protein_id="EDL09976.1"
FT                   /translation="MPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNG
FT                   RLEAMCFDGVRRLCHIRGKLRKKVWINTSDIILIGLRDYQDNKADVILKYNADEARSLK
FT                   AYGELPEHAKINETDTFGPGDDDEIQFDDIGDDDEDIDDI"
FT   CDS             9334094..9334528
FT                   /codon_start=1
FT                   /gene="Eif1a"
FT                   /locus_tag="mCG_3464"
FT                   /product="eukaryotic translation initiation factor 1A,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG3464.2 transcript_id=mCT2420.2
FT                   protein_id=mCP12542.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q4FJR7"
FT                   /db_xref="InterPro:IPR001253"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018104"
FT                   /db_xref="MGI:MGI:95298"
FT                   /db_xref="UniProtKB/TrEMBL:Q4FJR7"
FT                   /protein_id="EDL09977.1"
FT                   /translation="MPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNG
FT                   RLEAMCFDGVRRLCHIRGKLRKKVWINTSDIILIGLRDYQDNKADVILKYNADEARSLK
FT                   AYGELPEHAKINETDTFGPGDDDEIQFDDIGDDDEDIDDI"
FT   CDS             9334094..9334528
FT                   /codon_start=1
FT                   /gene="Eif1a"
FT                   /locus_tag="mCG_3464"
FT                   /product="eukaryotic translation initiation factor 1A,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG3464.2 transcript_id=mCT174133.0
FT                   protein_id=mCP97052.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q4FJR7"
FT                   /db_xref="InterPro:IPR001253"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018104"
FT                   /db_xref="MGI:MGI:95298"
FT                   /db_xref="UniProtKB/TrEMBL:Q4FJR7"
FT                   /protein_id="EDL09978.1"
FT                   /translation="MPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNG
FT                   RLEAMCFDGVRRLCHIRGKLRKKVWINTSDIILIGLRDYQDNKADVILKYNADEARSLK
FT                   AYGELPEHAKINETDTFGPGDDDEIQFDDIGDDDEDIDDI"
FT   gene            complement(9439323..9454475)
FT                   /gene="Cdo1"
FT                   /locus_tag="mCG_3466"
FT                   /note="gene_id=mCG3466.3"
FT   mRNA            complement(join(9439323..9440017,9446479..9446560,
FT                   9449437..9449514,9454092..9454452))
FT                   /gene="Cdo1"
FT                   /locus_tag="mCG_3466"
FT                   /product="cysteine dioxygenase 1, cytosolic, transcript
FT                   variant mCT179596"
FT                   /note="gene_id=mCG3466.3 transcript_id=mCT179596.0 created
FT                   on 05-FEB-2003"
FT   mRNA            complement(join(9439324..9440079,9441715..9441884,
FT                   9446406..9446560,9449437..9449514,9454092..9454475))
FT                   /gene="Cdo1"
FT                   /locus_tag="mCG_3466"
FT                   /product="cysteine dioxygenase 1, cytosolic, transcript
FT                   variant mCT2419"
FT                   /note="gene_id=mCG3466.3 transcript_id=mCT2419.2 created on
FT                   05-FEB-2003"
FT   mRNA            complement(join(9439324..9440079,9441715..9441933,
FT                   9446406..9446560,9449437..9449514,9454092..9454462))
FT                   /gene="Cdo1"
FT                   /locus_tag="mCG_3466"
FT                   /product="cysteine dioxygenase 1, cytosolic, transcript
FT                   variant mCT179595"
FT                   /note="gene_id=mCG3466.3 transcript_id=mCT179595.0 created
FT                   on 05-FEB-2003"
FT   mRNA            complement(join(9439325..9440079,9441715..9441884,
FT                   9446406..9446557,9449437..9449514,9454092..9454475))
FT                   /gene="Cdo1"
FT                   /locus_tag="mCG_3466"
FT                   /product="cysteine dioxygenase 1, cytosolic, transcript
FT                   variant mCT179594"
FT                   /note="gene_id=mCG3466.3 transcript_id=mCT179594.0 created
FT                   on 05-FEB-2003"
FT   mRNA            complement(join(9439797..9439872,9446406..9446560,
FT                   9449437..9449514,9454092..9454221,9454377..9454438))
FT                   /gene="Cdo1"
FT                   /locus_tag="mCG_3466"
FT                   /product="cysteine dioxygenase 1, cytosolic, transcript
FT                   variant mCT174136"
FT                   /note="gene_id=mCG3466.3 transcript_id=mCT174136.0 created
FT                   on 05-FEB-2003"
FT   CDS             complement(join(9439847..9439872,9446406..9446560,
FT                   9449437..9449468))
FT                   /codon_start=1
FT                   /gene="Cdo1"
FT                   /locus_tag="mCG_3466"
FT                   /product="cysteine dioxygenase 1, cytosolic, isoform CRA_a"
FT                   /note="gene_id=mCG3466.3 transcript_id=mCT174136.0
FT                   protein_id=mCP97055.0 isoform=CRA_a"
FT                   /protein_id="EDL09968.1"
FT                   /translation="MILCWGEGHGSSIHDHTDSHCFLKLLQGNLKETLFDWPDKKSNEM
FT                   IKKSERTLRENQCAYINDPTKEKVT"
FT   CDS             complement(join(9439889..9440017,9446479..9446560,
FT                   9449437..9449514,9454092..9454261))
FT                   /codon_start=1
FT                   /gene="Cdo1"
FT                   /locus_tag="mCG_3466"
FT                   /product="cysteine dioxygenase 1, cytosolic, isoform CRA_d"
FT                   /note="gene_id=mCG3466.3 transcript_id=mCT179596.0
FT                   protein_id=mCP102518.0 isoform=CRA_d"
FT                   /protein_id="EDL09971.1"
FT                   /translation="MERTELLKPRTLADLIRILHELFAGDEVNVEEVQAVLEAYESNPA
FT                   EWALYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTDSHCFLKLLQGNLKE
FT                   TLFDWPDPLNVFPWTERPPTICCPVTQLNKGYAQFYCKGCVLRKQTIP"
FT   mRNA            complement(join(9440036..9440079,9441715..9441884,
FT                   9446406..9446560,9449437..9449477,9454393..9454473))
FT                   /gene="Cdo1"
FT                   /locus_tag="mCG_3466"
FT                   /product="cysteine dioxygenase 1, cytosolic, transcript
FT                   variant mCT174137"
FT                   /note="gene_id=mCG3466.3 transcript_id=mCT174137.0 created
FT                   on 05-FEB-2003"
FT   CDS             complement(join(9440050..9440079,9441715..9441884,
FT                   9446406..9446557,9449437..9449514,9454092..9454261))
FT                   /codon_start=1
FT                   /gene="Cdo1"
FT                   /locus_tag="mCG_3466"
FT                   /product="cysteine dioxygenase 1, cytosolic, isoform CRA_f"
FT                   /note="gene_id=mCG3466.3 transcript_id=mCT179594.0
FT                   protein_id=mCP102516.0 isoform=CRA_f"
FT                   /protein_id="EDL09973.1"
FT                   /translation="MERTELLKPRTLADLIRILHELFAGDEVNVEEVQAVLEAYESNPA
FT                   EWALYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSIHDHTDSHCFLKLLQGNLKET
FT                   LFDWPDKKSNEMIKKSERTLRENQCAYINDSIGLHRVENVSHTEPAVSLHLYSPPFDTC
FT                   HAFDQRTGHKNKVTMTFHSKFGIRTPFTTSGSLENN"
FT   CDS             complement(join(9440050..9440079,9441715..9441884,
FT                   9446406..9446560,9449437..9449514,9454092..9454261))
FT                   /codon_start=1
FT                   /gene="Cdo1"
FT                   /locus_tag="mCG_3466"
FT                   /product="cysteine dioxygenase 1, cytosolic, isoform CRA_g"
FT                   /note="gene_id=mCG3466.3 transcript_id=mCT2419.2
FT                   protein_id=mCP12547.1 isoform=CRA_g"
FT                   /protein_id="EDL09974.1"
FT                   /translation="MERTELLKPRTLADLIRILHELFAGDEVNVEEVQAVLEAYESNPA
FT                   EWALYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTDSHCFLKLLQGNLKE
FT                   TLFDWPDKKSNEMIKKSERTLRENQCAYINDSIGLHRVENVSHTEPAVSLHLYSPPFDT
FT                   CHAFDQRTGHKNKVTMTFHSKFGIRTPFTTSGSLENN"
FT   CDS             complement(join(9440050..9440079,9441715..9441884,
FT                   9446406..9446560,9449437..9449468))
FT                   /codon_start=1
FT                   /gene="Cdo1"
FT                   /locus_tag="mCG_3466"
FT                   /product="cysteine dioxygenase 1, cytosolic, isoform CRA_e"
FT                   /note="gene_id=mCG3466.3 transcript_id=mCT174137.0
FT                   protein_id=mCP97057.0 isoform=CRA_e"
FT                   /protein_id="EDL09972.1"
FT                   /translation="MILCWGEGHGSSIHDHTDSHCFLKLLQGNLKETLFDWPDKKSNEM
FT                   IKKSERTLRENQCAYINDSIGLHRVENVSHTEPAVSLHLYSPPFDTCHAFDQRTGHKNK
FT                   VTMTFHSKFGIRTPFTTSGSLENN"
FT   mRNA            complement(join(9441844..9441884,9446406..9446465,
FT                   9449497..9449514,9454092..9454467))
FT                   /gene="Cdo1"
FT                   /locus_tag="mCG_3466"
FT                   /product="cysteine dioxygenase 1, cytosolic, transcript
FT                   variant mCT174138"
FT                   /note="gene_id=mCG3466.3 transcript_id=mCT174138.0 created
FT                   on 05-FEB-2003"
FT   CDS             complement(join(9441887..9441933,9446406..9446560,
FT                   9449437..9449514,9454092..9454261))
FT                   /codon_start=1
FT                   /gene="Cdo1"
FT                   /locus_tag="mCG_3466"
FT                   /product="cysteine dioxygenase 1, cytosolic, isoform CRA_c"
FT                   /note="gene_id=mCG3466.3 transcript_id=mCT179595.0
FT                   protein_id=mCP102517.0 isoform=CRA_c"
FT                   /protein_id="EDL09970.1"
FT                   /translation="MERTELLKPRTLADLIRILHELFAGDEVNVEEVQAVLEAYESNPA
FT                   EWALYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTDSHCFLKLLQGNLKE
FT                   TLFDWPDKKSNEMIKKSERTLRENQCAYINATVLIPSLFSVLFGL"
FT   CDS             complement(join(9446444..9446465,9449497..9449514,
FT                   9454092..9454261))
FT                   /codon_start=1
FT                   /gene="Cdo1"
FT                   /locus_tag="mCG_3466"
FT                   /product="cysteine dioxygenase 1, cytosolic, isoform CRA_b"
FT                   /note="gene_id=mCG3466.3 transcript_id=mCT174138.0
FT                   protein_id=mCP97056.0 isoform=CRA_b"
FT                   /protein_id="EDL09969.1"
FT                   /translation="MERTELLKPRTLADLIRILHELFAGDEVNVEEVQAVLEAYESNPA
FT                   EWALYAKFDQYRYTRNLVRDDQEV"
FT   gene            complement(9458546..9467683)
FT                   /gene="Atg12"
FT                   /locus_tag="mCG_3468"
FT                   /note="gene_id=mCG3468.1"
FT   mRNA            complement(join(9458546..9460628,9461374..9461436,
FT                   9463512..9463648,9467500..9467677))
FT                   /gene="Atg12"
FT                   /locus_tag="mCG_3468"
FT                   /product="autophagy-related 12 (yeast), transcript variant
FT                   mCT2413"
FT                   /note="gene_id=mCG3468.1 transcript_id=mCT2413.0 created on
FT                   11-OCT-2002"
FT   CDS             complement(join(9460569..9460628,9461374..9461436,
FT                   9463512..9463648,9467500..9467665))
FT                   /codon_start=1
FT                   /gene="Atg12"
FT                   /locus_tag="mCG_3468"
FT                   /product="autophagy-related 12 (yeast), isoform CRA_b"
FT                   /note="gene_id=mCG3468.1 transcript_id=mCT2413.0
FT                   protein_id=mCP12528.1 isoform=CRA_b"
FT                   /protein_id="EDL09967.1"
FT                   /translation="MSEDSEVVLQLPSAPVGAGGESLPELSPETATPEPPSSAAVSPGT
FT                   EEPPGDTKKKIDILLKAVGDTPIMKTKKWAVERTRTIQGLIDFIKKFLKLVASEQLFIY
FT                   VNQSFAPSPDQEVGTLYECFGSDGKLVLHYCKSQAWG"
FT   mRNA            complement(join(9463199..9463648,9467500..9467683))
FT                   /gene="Atg12"
FT                   /locus_tag="mCG_3468"
FT                   /product="autophagy-related 12 (yeast), transcript variant
FT                   mCT174139"
FT                   /note="gene_id=mCG3468.1 transcript_id=mCT174139.0 created
FT                   on 11-OCT-2002"
FT   CDS             complement(join(9463506..9463648,9467500..9467665))
FT                   /codon_start=1
FT                   /gene="Atg12"
FT                   /locus_tag="mCG_3468"
FT                   /product="autophagy-related 12 (yeast), isoform CRA_a"
FT                   /note="gene_id=mCG3468.1 transcript_id=mCT174139.0
FT                   protein_id=mCP97058.0 isoform=CRA_a"
FT                   /protein_id="EDL09966.1"
FT                   /translation="MSEDSEVVLQLPSAPVGAGGESLPELSPETATPEPPSSAAVSPGT
FT                   EEPPGDTKKKIDILLKAVGDTPIMKTKKWAVERTRTIQGLIDFIKKFLKLVASEQLV"
FT   gene            9468087..9516823
FT                   /locus_tag="mCG_3457"
FT                   /note="gene_id=mCG3457.2"
FT   mRNA            join(9468087..9468219,9480552..9480643,9484184..9484295,
FT                   9505402..9505473,9506875..9506982,9516103..9516823)
FT                   /locus_tag="mCG_3457"
FT                   /product="mCG3457, transcript variant mCT2430"
FT                   /note="gene_id=mCG3457.2 transcript_id=mCT2430.2 created on
FT                   11-OCT-2002"
FT   mRNA            join(9468087..9468219,9480552..9480643,9483563..9483616,
FT                   9484184..9484295,9505402..9505420)
FT                   /locus_tag="mCG_3457"
FT                   /product="mCG3457, transcript variant mCT174418"
FT                   /note="gene_id=mCG3457.2 transcript_id=mCT174418.0 created
FT                   on 14-OCT-2002"
FT   CDS             join(9468151..9468219,9480552..9480643,9484184..9484295,
FT                   9505402..9505473,9506875..9506982,9516103..9516231)
FT                   /codon_start=1
FT                   /locus_tag="mCG_3457"
FT                   /product="mCG3457, isoform CRA_b"
FT                   /note="gene_id=mCG3457.2 transcript_id=mCT2430.2
FT                   protein_id=mCP12531.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q3U8S0"
FT                   /db_xref="InterPro:IPR000804"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="InterPro:IPR016635"
FT                   /db_xref="InterPro:IPR022775"
FT                   /db_xref="MGI:MGI:1337062"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U8S0"
FT                   /protein_id="EDL09965.1"
FT                   /translation="MIKAILIFNNHGKPRLSKFYQPYSEDTQQQIIRETFHLVSKRDEN
FT                   VCNFLEGGLLIGGSDNKLIYRHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENV
FT                   CELDLIFHVDKVHNILAEMVMGGMVLETNMNEIVTQIDAQNKLEKSEAGLAGAPARAVS
FT                   AVKNMNLPEIPRNINIGDISIKVPNLPSFK"
FT   CDS             join(9468151..9468219,9480552..9480643,9483563..9483566)
FT                   /codon_start=1
FT                   /locus_tag="mCG_3457"
FT                   /product="mCG3457, isoform CRA_a"
FT                   /note="gene_id=mCG3457.2 transcript_id=mCT174418.0
FT                   protein_id=mCP97337.0 isoform=CRA_a"
FT                   /protein_id="EDL09964.1"
FT                   /translation="MIKAILIFNNHGKPRLSKFYQPYSEDTQQQIIRETFHLVSKRDEN
FT                   VCNFLEGGF"
FT   gene            9574734..9608248
FT                   /locus_tag="mCG_3461"
FT                   /note="gene_id=mCG3461.2"
FT   mRNA            join(9574734..9575572,9589397..9589539,9591119..9591258,
FT                   9600624..9600750,9603397..9603551,9604743..9604856,
FT                   9607130..9607273,9607770..9607835,9607924..9608248)
FT                   /locus_tag="mCG_3461"
FT                   /product="mCG3461"
FT                   /note="gene_id=mCG3461.2 transcript_id=mCT2422.2 created on
FT                   11-OCT-2002"
FT   CDS             join(9574887..9575572,9589397..9589539,9591119..9591258,
FT                   9600624..9600750,9603397..9603551,9604743..9604856,
FT                   9607130..9607273,9607770..9607835,9607924..9608028)
FT                   /codon_start=1
FT                   /locus_tag="mCG_3461"
FT                   /product="mCG3461"
FT                   /note="gene_id=mCG3461.2 transcript_id=mCT2422.2
FT                   protein_id=mCP12538.2"
FT                   /protein_id="EDL09963.1"
FT                   /translation="MSRPFSSGVYVSRGVALLLAALTAVLLLVLVALASLYGSCAHVQP
FT                   SEQGNSRVKNTSLWPPGGQEWALPTPAQEPTVGTSQDLGPPSGPWDHLRLPPWLVPLHY
FT                   DLELWPWLQPDKLSPPNLTFTGRVNITVRCTVASSRLLLHSFLLNYKQVEVWGPLAQDT
FT                   RNATVGRVQVEKVWFAPDMQFVVLDLGQSLEPGSRYELSFHFSGQVLQVGLEGLFLNLY
FT                   HDEDELRALVATQMEPTFARHVFPCFDEPALKATFNITVIHHPGYAALSNMPQLGQSER
FT                   IDVNGSRWTVTTFHTTPRMPTYLVALVVCDLDHISRTERGKEIRVWARKDDIASGYLDF
FT                   AANITGPIFSFLEDLFNISYRLPKTDIVALPIFASGAMENWGLLIFDESSLLLEPEDEL
FT                   TEKRAMILSIIAHEVGHQWFGNLVTMSWWNNIWLNEGFASYFELELTNYFYPKVPMNMI
FT                   FFFTVLHGILGEDHALESRAVSTAVENFTETSEINRLFDLYTYKKGACMAWMLASFLSP
FT                   HLFINALKSYLETFSYSNAEQDDLWRHIQMVIVPFRHFLAEH"
FT   gene            9595534..9596004
FT                   /pseudo
FT                   /locus_tag="mCG_127875"
FT                   /note="gene_id=mCG127875.1"
FT   mRNA            9595534..9596004
FT                   /pseudo
FT                   /locus_tag="mCG_127875"
FT                   /note="gene_id=mCG127875.1 transcript_id=mCT129166.1
FT                   created on 11-OCT-2002"
FT   gene            9620003..9633771
FT                   /locus_tag="mCG_141257"
FT                   /note="gene_id=mCG141257.0"
FT   mRNA            join(9620003..9620026,9620805..9620981,9621156..9621293,
FT                   9626724..9626799,9633541..9633771)
FT                   /locus_tag="mCG_141257"
FT                   /product="mCG141257"
FT                   /note="gene_id=mCG141257.0 transcript_id=mCT174174.0
FT                   created on 11-OCT-2002"
FT   CDS             join(9620947..9620981,9621156..9621293,9626724..9626799,
FT                   9633541..9633681)
FT                   /codon_start=1
FT                   /locus_tag="mCG_141257"
FT                   /product="mCG141257"
FT                   /note="gene_id=mCG141257.0 transcript_id=mCT174174.0
FT                   protein_id=mCP97093.0"
FT                   /protein_id="EDL09962.1"
FT                   /translation="MSCSKDPWILNRFMEYAITAVSSNFSETNIIVVVATSEVGRYIAK
FT                   DFLMDNWVAVTERYGMDWLDALVPVLGRTVSTDQQVTELQHFFSTVLEEHQRVVVQAKL
FT                   QAMKTKNLQNKKRIARVVEWLRKNT"
FT   gene            complement(9669959..9670551)
FT                   /pseudo
FT                   /locus_tag="mCG_126149"
FT                   /note="gene_id=mCG126149.1"
FT   mRNA            complement(9669959..9670551)
FT                   /pseudo
FT                   /locus_tag="mCG_126149"
FT                   /note="gene_id=mCG126149.1 transcript_id=mCT127416.1
FT                   created on 11-OCT-2002"
FT   gene            9687436..9817453
FT                   /gene="Commd10"
FT                   /locus_tag="mCG_3460"
FT                   /note="gene_id=mCG3460.1"
FT   mRNA            join(9687436..9687495,9688983..9689073,9692227..9692337,
FT                   9696307..9696462,9719105..9719215,9815709..9815768,
FT                   9816485..9817453)
FT                   /gene="Commd10"
FT                   /locus_tag="mCG_3460"
FT                   /product="COMM domain containing 10, transcript variant
FT                   mCT2421"
FT                   /note="gene_id=mCG3460.1 transcript_id=mCT2421.1 created on
FT                   11-OCT-2002"
FT   mRNA            join(9687444..9687495,9688983..9689073,9692227..9692337,
FT                   9719105..9719215,9815709..9815768,9816485..9816611)
FT                   /gene="Commd10"
FT                   /locus_tag="mCG_3460"
FT                   /product="COMM domain containing 10, transcript variant
FT                   mCT174130"
FT                   /note="gene_id=mCG3460.1 transcript_id=mCT174130.0 created
FT                   on 11-OCT-2002"
FT   mRNA            join(9687445..9687495,9688983..9689073,9719105..9719215,
FT                   9815709..9815768,9816485..9816665)
FT                   /gene="Commd10"
FT                   /locus_tag="mCG_3460"
FT                   /product="COMM domain containing 10, transcript variant
FT                   mCT174131"
FT                   /note="gene_id=mCG3460.1 transcript_id=mCT174131.0 created
FT                   on 11-OCT-2002"
FT   CDS             join(9687455..9687495,9688983..9689073,9692227..9692337,
FT                   9696307..9696462,9719105..9719215,9815709..9815768,
FT                   9816485..9816523)
FT                   /codon_start=1
FT                   /gene="Commd10"
FT                   /locus_tag="mCG_3460"
FT                   /product="COMM domain containing 10, isoform CRA_c"
FT                   /note="gene_id=mCG3460.1 transcript_id=mCT2421.1
FT                   protein_id=mCP12529.2 isoform=CRA_c"
FT                   /db_xref="GOA:Q3TKN7"
FT                   /db_xref="InterPro:IPR009886"
FT                   /db_xref="InterPro:IPR017920"
FT                   /db_xref="MGI:MGI:1916706"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TKN7"
FT                   /protein_id="EDL09961.1"
FT                   /translation="MAASAALILPESPSMKKAVPLINAIDTGRFPRLLSRILQKLHLKA
FT                   ESSFSEEEEEKLQAAFSLEKQELHLVLETISFVLEQAVYHNVKPAALQQQLEMIHLRKD
FT                   KAEAFASAWSAMGQETVEKFRQRILGPHKLETVGWQLNLQMAHSAQAKLQSPQAVLQLG
FT                   VSKEDAKNVEKVLVEFNHKELFDFYNKLETIQAQLDSLT"
FT   CDS             join(9687455..9687495,9688983..9689073,9692227..9692337,
FT                   9719105..9719215,9815709..9815768,9816485..9816523)
FT                   /codon_start=1
FT                   /gene="Commd10"
FT                   /locus_tag="mCG_3460"
FT                   /product="COMM domain containing 10, isoform CRA_a"
FT                   /note="gene_id=mCG3460.1 transcript_id=mCT174130.0
FT                   protein_id=mCP97049.0 isoform=CRA_a"
FT                   /protein_id="EDL09959.1"
FT                   /translation="MAASAALILPESPSMKKAVPLINAIDTGRFPRLLSRILQKLHLKA
FT                   ESSFSEEEEEKLQAAFSLEKQELHLVLETISFVLEQLETVGWQLNLQMAHSAQAKLQSP
FT                   QAVLQLGVSKEDAKNVEKVLVEFNHKELFDFYNKLETIQAQLDSLT"
FT   CDS             join(9687455..9687495,9688983..9689073,9719105..9719215,
FT                   9815709..9815768,9816485..9816523)
FT                   /codon_start=1
FT                   /gene="Commd10"
FT                   /locus_tag="mCG_3460"
FT                   /product="COMM domain containing 10, isoform CRA_b"
FT                   /note="gene_id=mCG3460.1 transcript_id=mCT174131.0
FT                   protein_id=mCP97050.0 isoform=CRA_b"
FT                   /protein_id="EDL09960.1"
FT                   /translation="MAASAALILPESPSMKKAVPLINAIDTGRFPRLLSRILQKLHLKL
FT                   ETVGWQLNLQMAHSAQAKLQSPQAVLQLGVSKEDAKNVEKVLVEFNHKELFDFYNKLET
FT                   IQAQLDSLT"
FT   gene            9836347..9838800
FT                   /locus_tag="mCG_147308"
FT                   /note="gene_id=mCG147308.0"
FT   mRNA            9836347..9838800
FT                   /locus_tag="mCG_147308"
FT                   /product="mCG147308"
FT                   /note="gene_id=mCG147308.0 transcript_id=mCT187571.0
FT                   created on 13-JAN-2004"
FT   CDS             9837239..9837502
FT                   /codon_start=1
FT                   /locus_tag="mCG_147308"
FT                   /product="mCG147308"
FT                   /note="gene_id=mCG147308.0 transcript_id=mCT187571.0
FT                   protein_id=mCP109696.0"
FT                   /protein_id="EDL09958.1"
FT                   /translation="MCLGVFVCLCAAYVPDAGAGGGQKRVLHPLKLKLWTVVDYHVDAG
FT                   IEHGSEKAANTLFFLLLFWFLFCFCFFETGFLCIALAVLELT"
FT   gene            9841572..9841995
FT                   /locus_tag="mCG_8024"
FT                   /note="gene_id=mCG8024.0"
FT   mRNA            9841572..9841995
FT                   /locus_tag="mCG_8024"
FT                   /product="mCG8024"
FT                   /note="gene_id=mCG8024.0 transcript_id=mCT7171.0 created on
FT                   11-OCT-2002"
FT   CDS             9841612..9841920
FT                   /codon_start=1
FT                   /locus_tag="mCG_8024"
FT                   /product="mCG8024"
FT                   /note="gene_id=mCG8024.0 transcript_id=mCT7171.0
FT                   protein_id=mCP12544.1"
FT                   /db_xref="GOA:Q9JI95"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="UniProtKB/TrEMBL:Q9JI95"
FT                   /protein_id="EDL09957.1"
FT                   /translation="MAGQAFRKFLLLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQAT
FT                   VVAVGSGGKGKSGEIEPVSVKVGDKVLLPEYGGTKVVLDDKDYFLFRDSDILGKYVN"
FT   gene            9845986..9846808
FT                   /pseudo
FT                   /locus_tag="mCG_51938"
FT                   /note="gene_id=mCG51938.2"
FT   mRNA            9845986..9846808
FT                   /pseudo
FT                   /locus_tag="mCG_51938"
FT                   /note="gene_id=mCG51938.2 transcript_id=mCT52121.2 created
FT                   on 10-MAR-2003"
FT   gene            complement(<9972441..10092547)
FT                   /gene="Sema6a"
FT                   /locus_tag="mCG_8025"
FT                   /note="gene_id=mCG8025.2"
FT   mRNA            complement(join(<9972441..9973642,9994805..9994969,
FT                   10000778..10000798,10003308..10003366,10005312..10005392,
FT                   10005484..10005624,10005987..10006012,10006091..10006163,
FT                   10007501..10007656,10011615..10011746,10014166..10014383,
FT                   10015286..10015374,10016078..10016197,10018210..10018300,
FT                   10022376..10022477,10023267..10023329,10024274..10024334,
FT                   10028294..10028411,10030546..10030683,10092513..10092547))
FT                   /gene="Sema6a"
FT                   /locus_tag="mCG_8025"
FT                   /product="sema domain, transmembrane domain (TM), and
FT                   cytoplasmic domain, (semaphorin) 6A, transcript variant
FT                   mCT174467"
FT                   /note="gene_id=mCG8025.2 transcript_id=mCT174467.0 created
FT                   on 08-NOV-2002"
FT   mRNA            complement(join(<9972441..9973642,9994805..9994969,
FT                   10000778..10000798,10003308..10003366,10005312..10005392,
FT                   10005484..10005624,10005987..10006163,10007501..10007656,
FT                   10011615..10011746,10014166..10014383,10015286..10015374,
FT                   10016078..10016197,10018210..10018300,10022376..10022477,
FT                   10023267..10023329,10024274..10024334,10028294..10028411,
FT                   10030546..10030683,10092513..10092547))
FT                   /gene="Sema6a"
FT                   /locus_tag="mCG_8025"
FT                   /product="sema domain, transmembrane domain (TM), and
FT                   cytoplasmic domain, (semaphorin) 6A, transcript variant
FT                   mCT7168"
FT                   /note="gene_id=mCG8025.2 transcript_id=mCT7168.2 created on
FT                   08-NOV-2002"
FT   CDS             complement(join(9972441..9973642,9994805..9994969,
FT                   10000778..10000798,10003308..10003366,10005312..10005392,
FT                   10005484..10005624,10005987..10006012,10006091..10006163,
FT                   10007501..10007656,10011615..10011746,10014166..10014383,
FT                   10015286..10015374,10016078..10016197,10018210..10018300,
FT                   10022376..10022477,10023267..10023329,10024274..10024334,
FT                   10028294..10028411,10030546..10030645))
FT                   /codon_start=1
FT                   /gene="Sema6a"
FT                   /locus_tag="mCG_8025"
FT                   /product="sema domain, transmembrane domain (TM), and
FT                   cytoplasmic domain, (semaphorin) 6A, isoform CRA_a"
FT                   /note="gene_id=mCG8025.2 transcript_id=mCT174467.0
FT                   protein_id=mCP97386.0 isoform=CRA_a"
FT                   /protein_id="EDL09954.1"
FT                   /translation="MRPAALLLCLTLLHCAGAGFPEDSEPISISHGNYTKQYPVFVGHK
FT                   PGRNTTQRHRLDIQMIMIMNRTLYVAARDHIYTVDIDTSHTEEIYCSKKLTWKSRQADV
FT                   DTCRMKGKHKDECHNFIKVLLKKNDDTLFVCGTNAFNPSCRNYRVDTLETFGDEFSGMA
FT                   RCPYDAKHANIALFADGKLYSATVTDFLAIDAVIYRSLGDSPTLRTVKHDSKWLKEPYF
FT                   VQAVDYGDYIYFFFREIAVEYNTMGKVVFPRVAQVCKNDMGGSQRVLEKQWTSFLKARL
FT                   NCSVPGDSHFYFNILQAVTDVIRINGRDVVLATFSTPYNSIPGSAVCAYDMLDIANVFT
FT                   GRFKEQKSPDSTWTPVPDERVPKPRPGCCAGSSSLEKYATSNEFPDDTLNFIKTHPLMD
FT                   EAVPSIINRPWFLRTMVRYRLTKIAVDNAAGPYQNHTVVFLGEMNVYNPEKCSYDGVED
FT                   KRIMGMQLDRASGSLYVAFSTCVIKVPLGRCERHGKCKKTCIASRDPYCGWVRESGSCA
FT                   HLSPLSRLTFEQDIERGNTDGLGDCHNSFVALNGHASSLYPSTTTSDSASRDGYESRGG
FT                   MLDWNDLLEAPGSTDPLGAVSSHNHQDKKGVIRESYLKSNDQLVPVTLLAIAVILAFVM
FT                   GAVFSGIIVYCVCDHRRKDVAVVQRKEKELTHSRRGSMSSVTKLSGLFGDTQSKDPKPE
FT                   AILTPLMHNGKLATPSNTAKMLIKADQHHLDLTALPTPESTPTLQQKRKPNRGSREWER
FT                   NQNIINACTKDMPPMGSPVIPTDLPLRASPSHIPSVVVLPITQQGYQHEYVDQPKMSEV
FT                   VAQMALEDQAATLEYKTIKEHLSSKSPNHGVNLVENLDSLPPKVPQREASLGPPGTSLS
FT                   QTGLSKRLEMQHSSSYGLEYKRSYPTNSLTRSHQTTTLKRNNTNSSNSSHLSRNQSFGR
FT                   GDNPPPAPQRVDSIQVHSSQPSGQAVTVSRQPSLNAYNSLTRSGLKRTPSLKPDVPPKP
FT                   SFAPLSTSMKPNDACT"
FT   CDS             complement(join(9972441..9973642,9994805..9994969,
FT                   10000778..10000798,10003308..10003366,10005312..10005392,
FT                   10005484..10005624,10005987..10006163,10007501..10007656,
FT                   10011615..10011746,10014166..10014383,10015286..10015374,
FT                   10016078..10016197,10018210..10018300,10022376..10022477,
FT                   10023267..10023329,10024274..10024334,10028294..10028411,
FT                   10030546..10030645))
FT                   /codon_start=1
FT                   /gene="Sema6a"
FT                   /locus_tag="mCG_8025"
FT                   /product="sema domain, transmembrane domain (TM), and
FT                   cytoplasmic domain, (semaphorin) 6A, isoform CRA_c"
FT                   /note="gene_id=mCG8025.2 transcript_id=mCT7168.2
FT                   protein_id=mCP12546.2 isoform=CRA_c"
FT                   /protein_id="EDL09956.1"
FT                   /translation="MRPAALLLCLTLLHCAGAGFPEDSEPISISHGNYTKQYPVFVGHK
FT                   PGRNTTQRHRLDIQMIMIMNRTLYVAARDHIYTVDIDTSHTEEIYCSKKLTWKSRQADV
FT                   DTCRMKGKHKDECHNFIKVLLKKNDDTLFVCGTNAFNPSCRNYRVDTLETFGDEFSGMA
FT                   RCPYDAKHANIALFADGKLYSATVTDFLAIDAVIYRSLGDSPTLRTVKHDSKWLKEPYF
FT                   VQAVDYGDYIYFFFREIAVEYNTMGKVVFPRVAQVCKNDMGGSQRVLEKQWTSFLKARL
FT                   NCSVPGDSHFYFNILQAVTDVIRINGRDVVLATFSTPYNSIPGSAVCAYDMLDIANVFT
FT                   GRFKEQKSPDSTWTPVPDERVPKPRPGCCAGSSSLEKYATSNEFPDDTLNFIKTHPLMD
FT                   EAVPSIINRPWFLRTMVRYRLTKIAVDNAAGPYQNHTVVFLGSEKGIILKFLARIGSSG
FT                   FLNGSLFLEEMNVYNPEKCSYDGVEDKRIMGMQLDRASGSLYVAFSTCVIKVPLGRCER
FT                   HGKCKKTCIASRDPYCGWVRESGSCAHLSPLSRLTFEQDIERGNTDGLGDCHNSFVALN
FT                   GHASSLYPSTTTSDSASRDGYESRGGMLDWNDLLEAPGSTDPLGAVSSHNHQDKKGVIR
FT                   ESYLKSNDQLVPVTLLAIAVILAFVMGAVFSGIIVYCVCDHRRKDVAVVQRKEKELTHS
FT                   RRGSMSSVTKLSGLFGDTQSKDPKPEAILTPLMHNGKLATPSNTAKMLIKADQHHLDLT
FT                   ALPTPESTPTLQQKRKPNRGSREWERNQNIINACTKDMPPMGSPVIPTDLPLRASPSHI
FT                   PSVVVLPITQQGYQHEYVDQPKMSEVVAQMALEDQAATLEYKTIKEHLSSKSPNHGVNL
FT                   VENLDSLPPKVPQREASLGPPGTSLSQTGLSKRLEMQHSSSYGLEYKRSYPTNSLTRSH
FT                   QTTTLKRNNTNSSNSSHLSRNQSFGRGDNPPPAPQRVDSIQVHSSQPSGQAVTVSRQPS
FT                   LNAYNSLTRSGLKRTPSLKPDVPPKPSFAPLSTSMKPNDACT"
FT   mRNA            complement(join(10027864..10028411,10030546..10030683,
FT                   10092513..10092543))
FT                   /gene="Sema6a"
FT                   /locus_tag="mCG_8025"
FT                   /product="sema domain, transmembrane domain (TM), and
FT                   cytoplasmic domain, (semaphorin) 6A, transcript variant
FT                   mCT175453"
FT                   /note="gene_id=mCG8025.2 transcript_id=mCT175453.0 created
FT                   on 08-NOV-2002"
FT   CDS             complement(join(10028290..10028411,10030546..10030645))
FT                   /codon_start=1
FT                   /gene="Sema6a"
FT                   /locus_tag="mCG_8025"
FT                   /product="sema domain, transmembrane domain (TM), and
FT                   cytoplasmic domain, (semaphorin) 6A, isoform CRA_b"
FT                   /note="gene_id=mCG8025.2 transcript_id=mCT175453.0
FT                   protein_id=mCP98372.0 isoform=CRA_b"
FT                   /protein_id="EDL09955.1"
FT                   /translation="MRPAALLLCLTLLHCAGAGFPEDSEPISISHGNYTKQYPVFVGHK
FT                   PGRNTTQRHRLDIQMIMIMNRTLYVAAR"
FT   gene            complement(10139153..10140031)
FT                   /pseudo
FT                   /locus_tag="mCG_8028"
FT                   /note="gene_id=mCG8028.2"
FT   mRNA            complement(10139153..10140031)
FT                   /pseudo
FT                   /locus_tag="mCG_8028"
FT                   /note="gene_id=mCG8028.2 transcript_id=mCT7163.2 created on
FT                   11-OCT-2002"
FT   gene            10177664..10201246
FT                   /locus_tag="mCG_8027"
FT                   /note="gene_id=mCG8027.2"
FT   mRNA            join(10177664..10177782,10179078..10179178,
FT                   10181398..10181535,10195562..10195881)
FT                   /locus_tag="mCG_8027"
FT                   /product="mCG8027, transcript variant mCT7162"
FT                   /note="gene_id=mCG8027.2 transcript_id=mCT7162.1 created on
FT                   11-OCT-2002"
FT   mRNA            join(10177692..10177782,10179078..10179178,
FT                   10181398..10181535,10199300..10199416,10200878..10201246)
FT                   /locus_tag="mCG_8027"
FT                   /product="mCG8027, transcript variant mCT174168"
FT                   /note="gene_id=mCG8027.2 transcript_id=mCT174168.0 created
FT                   on 11-OCT-2002"
FT   CDS             join(10179131..10179178,10181398..10181535,
FT                   10199300..10199416)
FT                   /codon_start=1
FT                   /locus_tag="mCG_8027"
FT                   /product="mCG8027, isoform CRA_a"
FT                   /note="gene_id=mCG8027.2 transcript_id=mCT174168.0
FT                   protein_id=mCP97087.0 isoform=CRA_a"
FT                   /protein_id="EDL09952.1"
FT                   /translation="MPELLQLCVEAVQLAKQDSKQLFEAAGFKKPGSHVIARGGLTGYG
FT                   ELNNVITFMECHLLILKFCIFRLPWQGFLIHPGGRFGQKSDLLLCRTPDWTWKEE"
FT   CDS             join(10179131..10179178,10181398..10181535,
FT                   10195562..10195573)
FT                   /codon_start=1
FT                   /locus_tag="mCG_8027"
FT                   /product="mCG8027, isoform CRA_b"
FT                   /note="gene_id=mCG8027.2 transcript_id=mCT7162.1
FT                   protein_id=mCP12534.2 isoform=CRA_b"
FT                   /protein_id="EDL09953.1"
FT                   /translation="MPELLQLCVEAVQLAKQDSKQLFEAAGFKKPGSHVIARGGLTGYG
FT                   ELNNVITFMECHLLILKLCV"
FT   gene            10202519..10223983
FT                   /locus_tag="mCG_147331"
FT                   /note="gene_id=mCG147331.0"
FT   mRNA            join(10202519..10202604,10222228..10223983)
FT                   /locus_tag="mCG_147331"
FT                   /product="mCG147331"
FT                   /note="gene_id=mCG147331.0 transcript_id=mCT187594.0
FT                   created on 13-JAN-2004"
FT   CDS             10223267..10223449
FT                   /codon_start=1
FT                   /locus_tag="mCG_147331"
FT                   /product="mCG147331"
FT                   /note="gene_id=mCG147331.0 transcript_id=mCT187594.0
FT                   protein_id=mCP109719.0"
FT                   /protein_id="EDL09951.1"
FT                   /translation="MVILKPLSSSHCAALCAVDLTTAAKGEPGKASGVGSPPNLTGFWG
FT                   SNSGSQYHIPGRRFF"
FT   gene            <10267410..10446278
FT                   /locus_tag="mCG_145928"
FT                   /note="gene_id=mCG145928.0"
FT   mRNA            join(<10267410..10268487,10430571..10430671,
FT                   10443344..10443474,10443732..10443801,10446046..10446144,
FT                   10446234..10446278)
FT                   /locus_tag="mCG_145928"
FT                   /product="mCG145928"
FT                   /note="gene_id=mCG145928.0 transcript_id=mCT186036.0
FT                   created on 04-JUL-2003"
FT   CDS             join(<10268347..10268487,10430571..10430671,
FT                   10443344..10443474,10443732..10443751)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145928"
FT                   /product="mCG145928"
FT                   /note="gene_id=mCG145928.0 transcript_id=mCT186036.0
FT                   protein_id=mCP107760.0"
FT                   /protein_id="EDL09950.1"
FT                   /translation="NGEKQINVPGLGSEMEHCIMITSAVNQHRKEGCWCRRTAYPAGEL
FT                   DKIGSSLTHKTSQHVTSEAVWTNILLDASWAQQLQRMICSSGIWQSRTEKPFCLLFSDS
FT                   LIQQSVQKLTISEDGDLKASGGGFGL"
FT   gene            10413602..10414269
FT                   /pseudo
FT                   /locus_tag="mCG_1033311"
FT                   /note="gene_id=mCG1033311.1"
FT   mRNA            10413602..10414269
FT                   /pseudo
FT                   /locus_tag="mCG_1033311"
FT                   /note="gene_id=mCG1033311.1 transcript_id=mCT151015.1
FT                   created on 17-OCT-2002"
FT   gene            complement(10483097..10504506)
FT                   /locus_tag="mCG_1050964"
FT                   /note="gene_id=mCG1050964.0"
FT   mRNA            complement(join(10483097..10483514,10483615..10483687,
FT                   10504304..10504506))
FT                   /locus_tag="mCG_1050964"
FT                   /product="mCG1050964"
FT                   /note="gene_id=mCG1050964.0 transcript_id=mCT194753.0
FT                   created on 27-JAN-2005"
FT   CDS             complement(join(10483499..10483514,10483615..10483687,
FT                   10504304..10504325))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1050964"
FT                   /product="mCG1050964"
FT                   /note="gene_id=mCG1050964.0 transcript_id=mCT194753.0
FT                   protein_id=mCP115784.0"
FT                   /protein_id="EDL09949.1"
FT                   /translation="MFQNIINDLSQAKMNLLDFYRSDKKLSSNGSWKEIP"
FT   gene            complement(10515596..10516848)
FT                   /pseudo
FT                   /locus_tag="mCG_48619"
FT                   /note="gene_id=mCG48619.1"
FT   mRNA            complement(10515596..10516848)
FT                   /pseudo
FT                   /locus_tag="mCG_48619"
FT                   /note="gene_id=mCG48619.1 transcript_id=mCT48802.1 created
FT                   on 11-OCT-2002"
FT   gene            <10638547..10818117
FT                   /locus_tag="mCG_145143"
FT                   /note="gene_id=mCG145143.0"
FT   mRNA            join(<10638547..10638807,10651481..10651640,
FT                   10773978..10774069,10817284..10818117)
FT                   /locus_tag="mCG_145143"
FT                   /product="mCG145143"
FT                   /note="gene_id=mCG145143.0 transcript_id=mCT184567.0
FT                   created on 05-JUN-2003"
FT   gene            complement(10782929..10784166)
FT                   /locus_tag="mCG_8026"
FT                   /note="gene_id=mCG8026.2"
FT   mRNA            complement(10782929..10784166)
FT                   /locus_tag="mCG_8026"
FT                   /product="mCG8026"
FT                   /note="gene_id=mCG8026.2 transcript_id=mCT7172.2 created on
FT                   11-OCT-2002"
FT   CDS             complement(10783214..10783618)
FT                   /codon_start=1
FT                   /locus_tag="mCG_8026"
FT                   /product="mCG8026"
FT                   /note="gene_id=mCG8026.2 transcript_id=mCT7172.2
FT                   protein_id=mCP12532.2"
FT                   /protein_id="EDL09948.1"
FT                   /translation="MRIGAEVYHNLKNVIKEKYRKDATNVGDEGGFASNILENKEALLL
FT                   LKTAISKAGITDQVVIGMDVAASEFYRSGKYDLDFKSLDDTSRYITHDQLADLYKSFIQ
FT                   TTQWYPSKPPLTRTTGMLGRSSLLVRASRW"
FT   CDS             <10817638..10817928
FT                   /codon_start=1
FT                   /locus_tag="mCG_145143"
FT                   /product="mCG145143"
FT                   /note="gene_id=mCG145143.0 transcript_id=mCT184567.0
FT                   protein_id=mCP106254.0"
FT                   /protein_id="EDL09947.1"
FT                   /translation="YTLLPFKIKDDDFLVRRRSAFDFKTFAFGKIPLFVNLWFLISFFC
FT                   LFYKALEKFRNIVQNSKYYFIKKQEILLYLELGQSRNLTISTHNFLHCPGV"
FT   gene            11324477..11325477
FT                   /pseudo
FT                   /locus_tag="mCG_50946"
FT                   /note="gene_id=mCG50946.2"
FT   mRNA            11324477..11325477
FT                   /pseudo
FT                   /locus_tag="mCG_50946"
FT                   /note="gene_id=mCG50946.2 transcript_id=mCT51129.2 created
FT                   on 10-MAR-2003"
FT   gene            12217503..12218650
FT                   /locus_tag="mCG_147315"
FT                   /note="gene_id=mCG147315.0"
FT   mRNA            join(12217503..12217572,12218348..12218650)
FT                   /locus_tag="mCG_147315"
FT                   /product="mCG147315"
FT                   /note="gene_id=mCG147315.0 transcript_id=mCT187578.0
FT                   created on 13-JAN-2004"
FT   CDS             12218366..12218584
FT                   /codon_start=1
FT                   /locus_tag="mCG_147315"
FT                   /product="mCG147315"
FT                   /note="gene_id=mCG147315.0 transcript_id=mCT187578.0
FT                   protein_id=mCP109702.0"
FT                   /protein_id="EDL09946.1"
FT                   /translation="MRSLKRIECRLPHQIRRSEKPVFSSQWTKRKGGKKQGRKAVLPFS
FT                   LIPYFSVNTTLLTSLVNSKTCFLDSSM"
FT   gene            complement(12390637..12448679)
FT                   /locus_tag="mCG_15519"
FT                   /note="gene_id=mCG15519.2"
FT   mRNA            complement(join(12390637..12391663,12393422..12393550,
FT                   12416704..12416896,12417195..12417289,12421451..12421541,
FT                   12448403..12448660))
FT                   /locus_tag="mCG_15519"
FT                   /product="mCG15519, transcript variant mCT17721"
FT                   /note="gene_id=mCG15519.2 transcript_id=mCT17721.2 created
FT                   on 11-OCT-2002"
FT   mRNA            complement(join(12390638..12391663,12393422..12393550,
FT                   12421451..12421541,12448403..12448679))
FT                   /locus_tag="mCG_15519"
FT                   /product="mCG15519, transcript variant mCT174106"
FT                   /note="gene_id=mCG15519.2 transcript_id=mCT174106.0 created
FT                   on 11-OCT-2002"
FT   CDS             complement(join(12391493..12391663,12393422..12393550,
FT                   12421451..12421541,12448403..12448620))
FT                   /codon_start=1
FT                   /locus_tag="mCG_15519"
FT                   /product="mCG15519, isoform CRA_b"
FT                   /note="gene_id=mCG15519.2 transcript_id=mCT174106.0
FT                   protein_id=mCP97025.0 isoform=CRA_b"
FT                   /db_xref="GOA:B7ZP35"
FT                   /db_xref="InterPro:IPR005636"
FT                   /db_xref="MGI:MGI:1916107"
FT                   /db_xref="UniProtKB/TrEMBL:B7ZP35"
FT                   /protein_id="EDL09945.1"
FT                   /translation="MEPQAEERTLGEPAPPPSGALASPTPDEEERTEGGAPPTATPAGA
FT                   SGDSTSADGLWGLPVEHAERRPECGRCSRPQKVCLCPYLPVRPLQISTHLYIIQHPAEV
FT                   QLKTSVCSQYVIRMQPTNRCLSTLECAAVALSILEKNNCIQETLLRPLQALCSFQLQHG
FT                   AQIRLSKEYLLRNGLYPKPMPKNKRKLRKMELLMNSVKI"
FT   CDS             complement(join(12391493..12391663,12393422..12393550,
FT                   12416704..12416896,12417195..12417289,12421451..12421541,
FT                   12448403..12448620))
FT                   /codon_start=1
FT                   /locus_tag="mCG_15519"
FT                   /product="mCG15519, isoform CRA_a"
FT                   /note="gene_id=mCG15519.2 transcript_id=mCT17721.2
FT                   protein_id=mCP20947.2 isoform=CRA_a"
FT                   /db_xref="GOA:B2RTH8"
FT                   /db_xref="InterPro:IPR005636"
FT                   /db_xref="MGI:MGI:1916107"
FT                   /db_xref="UniProtKB/TrEMBL:B2RTH8"
FT                   /protein_id="EDL09944.1"
FT                   /translation="MEPQAEERTLGEPAPPPSGALASPTPDEEERTEGGAPPTATPAGA
FT                   SGDSTSADGLWGLPVEHAERRPECGRCSRPQKVCLCPYLPVRPLQISTHLYIIQHPAEE
FT                   SRVLRTVPLLAACLPPDRCTVKIGRRFSEERDVELATVCRDSGTLILYPGAEATNLEEF
FT                   ILDSPVYPSTIILIDGTWSQAKDIFYKNSLFRLPKQVQLKTSVCSQYVIRMQPTNRCLS
FT                   TLECAAVALSILEKNNCIQETLLRPLQALCSFQLQHGAQIRLSKEYLLRNGLYPKPMPK
FT                   NKRKLRKMELLMNSVKI"
FT   gene            complement(12496545..>12511191)
FT                   /locus_tag="mCG_145149"
FT                   /note="gene_id=mCG145149.0"
FT   mRNA            complement(join(12496545..12496740,12498990..12499087,
FT                   12500386..12500565,12501541..12501628,12511048..>12511191))
FT                   /locus_tag="mCG_145149"
FT                   /product="mCG145149"
FT                   /note="gene_id=mCG145149.0 transcript_id=mCT184573.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(12499067..12499087,12500386..12500565,
FT                   12501541..>12501546))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145149"
FT                   /product="mCG145149"
FT                   /note="gene_id=mCG145149.0 transcript_id=mCT184573.0
FT                   protein_id=mCP106259.0"
FT                   /protein_id="EDL09943.1"
FT                   /translation="AQRGPRGPRTAQAIATAVGCPLELYGKNLLMRITCALGKGHRKMK
FT                   LQLNFCLQERHHRKRQKGEIFLT"
FT   gene            12526238..12657916
FT                   /locus_tag="mCG_140807"
FT                   /note="gene_id=mCG140807.0"
FT   mRNA            join(12526238..12526402,12533613..12533738,
FT                   12537012..12537083,12539811..12539889,12541894..12542020,
FT                   12544656..12544722,12545472..12545650,12550460..12550649,
FT                   12552343..12552511,12556132..12556344,12557175..12557428,
FT                   12557537..12558221,12558310..12558431,12561032..12561121,
FT                   12561202..12561304,12564036..12564155,12564733..12564954,
FT                   12570849..12572531,12573901..12574008,12581887..12582056,
FT                   12582634..12582731,12583788..12583953,12584563..12584824,
FT                   12586391..12587469,12588154..12588345,12591872..12591948,
FT                   12595429..12595556,12595948..12596196,12605812..12605966,
FT                   12610748..12610890,12613057..12613142,12613999..12614200,
FT                   12615767..12615884,12625081..12625167,12627756..12627877,
FT                   12628364..12628505,12632723..12632783,12644376..12644503,
FT                   12649283..12649375,12650768..12650859,12651889..12651941,
FT                   12654550..12654767,12655664..12657916)
FT                   /locus_tag="mCG_140807"
FT                   /product="mCG140807"
FT                   /note="gene_id=mCG140807.0 transcript_id=mCT171609.0
FT                   created on 06-AUG-2002"
FT   CDS             join(12526316..12526402,12533613..12533738,
FT                   12537012..12537083,12539811..12539889,12541894..12542020,
FT                   12544656..12544722,12545472..12545650,12550460..12550649,
FT                   12552343..12552511,12556132..12556344,12557175..12557428,
FT                   12557537..12558221,12558310..12558431,12561032..12561121,
FT                   12561202..12561304,12564036..12564155,12564733..12564954,
FT                   12570849..12572531,12573901..12574008,12581887..12582056,
FT                   12582634..12582731,12583788..12583953,12584563..12584824,
FT                   12586391..12587469,12588154..12588345,12591872..12591948,
FT                   12595429..12595556,12595948..12596196,12605812..12605966,
FT                   12610748..12610890,12613057..12613142,12613999..12614200,
FT                   12615767..12615884,12625081..12625167,12627756..12627877,
FT                   12628364..12628505,12632723..12632783,12644376..12644503,
FT                   12649283..12649375,12650768..12650859,12651889..12651941,
FT                   12654550..12654767,12655664..12655888)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140807"
FT                   /product="mCG140807"
FT                   /note="gene_id=mCG140807.0 transcript_id=mCT171609.0
FT                   protein_id=mCP94528.0"
FT                   /protein_id="EDL09942.1"
FT                   /translation="MNLHQVLTGAVNPGDHCFAVGSVGEQRFTAYASGCDIVILGSNFE
FT                   RLQIIPGAKHGNIQVGCVDCSMQQGKIAASYGNVISVFEPVSLPKKRKNLEFYSQWQKS
FT                   GQFFLDSIAHNITWDPAGNRLLTGSSCLQLWCNSRKQTEDENPDKTDLNFGNWMCIWHC
FT                   KTASQVHLMKFSPDGEFFATAGKDDCLLKVWYNVENWRPAVTSPDKNSEKQSQGEIDFS
FT                   FVYLAHPRAVNGFSWRKTSKYMPRASVCNVLLTCCKDNVCRLWVETFLPNDCFLYGSDC
FT                   NHWCEPVSLTNNLKRNASSKDRVQSALEVNLRPFRRGRSRSLALVAHTGYLPHQQDPHH
FT                   AHRNTPLHANALCHFHIAASINPATDIPLLPSITSLSLNENEEKCGPFVVHWLNNKELH
FT                   FTLSMEVFLQQLRKSFEQPSSEASVEDSIQADLKSDEELDDGVDDLKINHEKKELDEDK
FT                   MLPSSSFTPLSSAAVDHQIEVLLSEWSKNADMLFSIHPMDGSLLVWHVDWLDEYQPGMF
FT                   RQVQVSFVSRIPVAFPTGDANSLCKSIVMYACTKNVDLAIQQGKQRPTGLTRSTSMLIS
FT                   SAHSKSSNNLKLSIFTPNVMMISKHADGSLNQWLVSFAEESAFSTVLSISHKSRYCGHR
FT                   FHLNDLACHSVLPLLLTTSHHNALRTPNVGNQKQAHDAVNTEECSLAQQNKSNVDMAFQ
FT                   DPNAIYSELILWRVDPVGPLSFSGGVSELARINSLHVSAFSNVAWLPTLIPSYCLGAYC
FT                   NSPSACFVASDGQYLRLYEAVIDAKKLLYELSNPEISKYVGEVFNIVSQQSTARPGCII
FT                   ALDSITKLHGRKTQLLHVFQEDFILNNLEKKRLGVDNILLDSDSSCNGFSEKFYLVVIE
FT                   CTEDNRSLLRMWDLHLRSTPVSLDERIDTKISEASWLPEEHYSSSPEKILSPFSQKFQA
FT                   CRANLQSTSKLSLFSEMVYSKELDLPEGVEIISVKPSAGHLSSSSIYPVCSAPYLLATS
FT                   CSDDKVRFWRCRVTNGESATSKNGKLDVVYVWEEWPLLIEDGLENNSSVTVPGRPVEVS
FT                   CAHTSRLAVAYKQPTGNSRSQEFVMHVSIFECESTGGSCWILEQTIHLDELSTVLDSGI
FT                   SIDSNLVAYNKQETYLVSKESITSNTKHLVHLDWMSREDGSHILTVGIGSKLFMYGPMA
FT                   GKVQDQTGKENQAFPLWDSTKIVPLSKFVLLRSVDLVSSVEGAPPFPVSLSWVRDGILV
FT                   VGMDCEMHVYSQWQPSNKQEPVISESYNGSTPSILSLIKQSNSSSSGLHPPKKTLTRSM
FT                   TSLAQKICGKKSIFDPSVDMEDSGLFEAAHVLSPTLPQYHPLQLLELMDLGKVRRAKAI
FT                   LSHLVKCIAGEVVALNEAESNHERRLRSLTISASGSTTRDPQAFNKADSRDYTEIDSVP
FT                   PLPLYALLAADDDSYCSSLEKTGSESSLKKSKQLSKESYDELFQTSVLMSDNHMLETDE
FT                   ENTQPRVIDLSQYSPTYFGPEHAQVLSGHLLHSSLPGLTRMEQMSLMALADTIATTSTD
FT                   IGESRDRNQGGETLDECGLKFLLAVRLHTFLTTSLPAYRAQLLHQGLSTGHFAWAFHSV
FT                   AEEELLNMLPAMQKDDPTWSELRAMGVGWWVRNARILRRCIEKVAKAAFHRNNDPLDAA
FT                   IFYLAMKKKAVIWGLYRSQKDTKMTQFFGHNFEEERWRKAALKNAFSLLGKQRFEHSAA
FT                   FFLLGGCLKDAIEVCLEKLNDIQLALVIARLFESEFDKSATYKSILRKKVLGIGSPASE
FT                   LSSSSINAHHDPFLRSMAHWILEDYSAALETLIKQPVTEDEDQVMMSACNPIVFNFYNY
FT                   LRTHPLLLRRHFGSSSETFSTHMTLAGKSGLAGTINLSERRLFFTTASAHLKAGCPMLA
FT                   LEVLSKMPKVSKKAKPCCRGSSFLTSKDSSLKLDVREDKCCAADWSPSLTNGLESSSEG
FT                   SSERHSHSTLSFDWSQPSVVFQDDSLELKWDSDNDEENEDPPISMKEIRPLQRKTVKEI
FT                   DELSSYTDSLSTLDENDILNPSEDIIAVQLKFRACLKILTVELRTLSTGYEIDGGKLRY
FT                   QLYHWLEKEVVALQRTCDFCSDADQLQTTFSQSADESGSTEDADDLHHQTKVKQLRESF
FT                   QEKRQWLLKYQSLLRMFLSYCVLHGSHGGGLASVRMELILLLQESQQETAEPIFSNPLS
FT                   EQTSVPLLFACTASAKTVVANPLLHLSNLTHDILHAIINFDSPPHPDSQTNKVYVMHTL
FT                   AASLSACIYQCLCGSHNYSSFQTNQFTGMVYQTVLLAHRHSLRTGSLDESVTPNTSPAQ
FT                   WPGINFLIQLLNSSGEEAQSGLTVLLCEILTAVYLSLFIHGLATHSSNELFRIVAHPLN
FT                   EKMWSAVFGGGAHVPSKGQANSKALSVEGEKQNRHISPSKVSARESPVSSSSGNQEPPA
FT                   VKEKFVPPELSIWDYFIAKPFLPPSQSRAEYDSEESLESDDEEEEDDDDALPSGLQLHE
FT                   HSNSNSFSWSLMRLAMVQLVLNNLKTFYPFAGHDLAELPVSSPLCHAVLKTLQCWEQVL
FT                   LRRLEIHGGPPQNYISSHTSEENVSAGPAILRHKALLEPTNTPFKSKNHLALSVKRLWQ
FT                   YLVKQEEIQETFIRNIFTKKRCLNEIEADLGYPGGKARIIHKESDIITAFAVNRANRNC
FT                   IAIASSHDVQELDVSAILATQIYTWVDDDTETETKGSEDFLVIHARDDLSAVQGSTPYT
FT                   HSNPGTPINMPWLGSTQTGRGASVMLKKAINNVRRMTSHPTLPYYLTGAQDGSVRMFEW
FT                   GHSQQITCFRSGGNSRITRMRFNYQGNKFGIVDADGYLSLYQTNWKCCPVTGSMPKPYL
FT                   AWQCHNKTANDFVFVSSSSLIATAGLSSDNRNICLWDTLVAPANSLVHAFTCHDSGATV
FT                   LAYAPKHQLLISGGRKGFTCIFDLRQRQQRQLFQSHDSPVKAIAIDPTEEYFVTGSAEG
FT                   NIKIWSLSSFSLLHTFINEHARQSIFRNIGTGVMQIETGPANHIFSCGADGTMKMRILP
FT                   DQFSPLNEVLKNDVKFML"
FT   gene            complement(12707489..12710698)
FT                   /locus_tag="mCG_147282"
FT                   /note="gene_id=mCG147282.0"
FT   mRNA            complement(join(12707489..12708080,12710075..12710698))
FT                   /locus_tag="mCG_147282"
FT                   /product="mCG147282"
FT                   /note="gene_id=mCG147282.0 transcript_id=mCT187545.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(12707671..12707931)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147282"
FT                   /product="mCG147282"
FT                   /note="gene_id=mCG147282.0 transcript_id=mCT187545.0
FT                   protein_id=mCP109670.0"
FT                   /protein_id="EDL09941.1"
FT                   /translation="MSPCNLWFTAGTSCEDCATRSDDGSAPGQSARKRLRIPRGSPRNV
FT                   RPPASCSCRSSLPRPLSWRWDKTLRILLPVAGETEPAGVES"
FT   gene            complement(<12740081..>12747681)
FT                   /locus_tag="mCG_145924"
FT                   /note="gene_id=mCG145924.0"
FT   mRNA            complement(join(<12740081..12740553,12740797..12741012,
FT                   12741207..12741325,12745531..12746356,12746533..12746652,
FT                   12747354..>12747681))
FT                   /locus_tag="mCG_145924"
FT                   /product="mCG145924"
FT                   /note="gene_id=mCG145924.0 transcript_id=mCT186032.0
FT                   created on 04-JUL-2003"
FT   CDS             complement(<12740081..>12740402)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145924"
FT                   /product="mCG145924"
FT                   /note="gene_id=mCG145924.0 transcript_id=mCT186032.0
FT                   protein_id=mCP107757.0"
FT                   /protein_id="EDL09940.1"
FT                   /translation="CRTYPNRVQVKRTGSFSAVAQEVFHLNRSGSETGLFGQSLERGYR
FT                   DMCQLPLRGWGARSDNPPHLSRVQSTECDIKPMNFVGKKKGKKIINFLNLNSISTDFFF
FT                   FNY"
FT   gene            12745567..12788334
FT                   /gene="Tnfaip8"
FT                   /locus_tag="mCG_15520"
FT                   /note="gene_id=mCG15520.1"
FT   mRNA            join(12745567..12745686,12746542..12746603,
FT                   12747133..12747455,12786750..12788334)
FT                   /gene="Tnfaip8"
FT                   /locus_tag="mCG_15520"
FT                   /product="tumor necrosis factor, alpha-induced protein 8,
FT                   transcript variant mCT17722"
FT                   /note="gene_id=mCG15520.1 transcript_id=mCT17722.1 created
FT                   on 05-FEB-2003"
FT   mRNA            join(12745571..12745686,12786750..12788327)
FT                   /gene="Tnfaip8"
FT                   /locus_tag="mCG_15520"
FT                   /product="tumor necrosis factor, alpha-induced protein 8,
FT                   transcript variant mCT179561"
FT                   /note="gene_id=mCG15520.1 transcript_id=mCT179561.0 created
FT                   on 05-FEB-2003"
FT   CDS             join(12745677..12745686,12786750..12787315)
FT                   /codon_start=1
FT                   /gene="Tnfaip8"
FT                   /locus_tag="mCG_15520"
FT                   /product="tumor necrosis factor, alpha-induced protein 8,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG15520.1 transcript_id=mCT179561.0
FT                   protein_id=mCP102483.0 isoform=CRA_a"
FT                   /protein_id="EDL09937.1"
FT                   /translation="MLSVATDVFNSKNLAVQAQKKILGKMVSKSIATTLIDDTSSEVLD
FT                   ELYRVTKEYTQNKKEAERVIKNLIKTVIKLAVLHRNNQFNQDELALMEKFKKKVHQLAM
FT                   TVVSFHQVEYTFDRNVLSRLLNECRELLHEIIQRHLTAKSHGRVNNVFDHFSDCDFLAA
FT                   LYNPFGKFKPHLQKLCDGINKMLDEENI"
FT   CDS             join(12747425..12747455,12786750..12787315)
FT                   /codon_start=1
FT                   /gene="Tnfaip8"
FT                   /locus_tag="mCG_15520"
FT                   /product="tumor necrosis factor, alpha-induced protein 8,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG15520.1 transcript_id=mCT17722.1
FT                   protein_id=mCP20948.1 isoform=CRA_b"
FT                   /protein_id="EDL09938.1"
FT                   /translation="MLSEAEEPREVATDVFNSKNLAVQAQKKILGKMVSKSIATTLIDD
FT                   TSSEVLDELYRVTKEYTQNKKEAERVIKNLIKTVIKLAVLHRNNQFNQDELALMEKFKK
FT                   KVHQLAMTVVSFHQVEYTFDRNVLSRLLNECRELLHEIIQRHLTAKSHGRVNNVFDHFS
FT                   DCDFLAALYNPFGKFKPHLQKLCDGINKMLDEENI"
FT   gene            12759640..12765359
FT                   /locus_tag="mCG_146102"
FT                   /note="gene_id=mCG146102.0"
FT   mRNA            join(12759640..12760446,12763180..12765359)
FT                   /locus_tag="mCG_146102"
FT                   /product="mCG146102"
FT                   /note="gene_id=mCG146102.0 transcript_id=mCT186205.1
FT                   created on 19-MAR-2004"
FT   CDS             12763607..12763738
FT                   /codon_start=1
FT                   /locus_tag="mCG_146102"
FT                   /product="mCG146102"
FT                   /note="gene_id=mCG146102.0 transcript_id=mCT186205.1
FT                   protein_id=mCP107762.1"
FT                   /protein_id="EDL09939.1"
FT                   /translation="MDATSVRQDCLHFLLCIPDSVLCAGHLSYHLSAKYTAMQGKEI"
FT   gene            12793811..12895561
FT                   /gene="Hsd17b4"
FT                   /locus_tag="mCG_15516"
FT                   /note="gene_id=mCG15516.2"
FT   mRNA            join(12793811..12793831,12877205..12877311,
FT                   12878345..12878431,12881230..12881316,12882457..12882595,
FT                   12891010..12891137,12895153..12895482)
FT                   /gene="Hsd17b4"
FT                   /locus_tag="mCG_15516"
FT                   /product="hydroxysteroid (17-beta) dehydrogenase 4,
FT                   transcript variant mCT174105"
FT                   /note="gene_id=mCG15516.2 transcript_id=mCT174105.0 created
FT                   on 11-OCT-2002"
FT   mRNA            join(12827390..12827509,12829226..12829279,
FT                   12838742..12838849,12839634..12839693,12841769..12841790,
FT                   12841892..12841938,12844040..12844124,12845689..12845876,
FT                   12854417..12854508,12857675..12857699,12859427..12859555,
FT                   12894916..12895030)
FT                   /gene="Hsd17b4"
FT                   /locus_tag="mCG_15516"
FT                   /product="hydroxysteroid (17-beta) dehydrogenase 4,
FT                   transcript variant mCT174103"
FT                   /note="gene_id=mCG15516.2 transcript_id=mCT174103.0 created
FT                   on 11-OCT-2002"
FT   mRNA            join(12827440..12827509,12829226..12829279,
FT                   12838742..12838849,12839634..12839693,12841769..12841790,
FT                   12841892..12841938,12844040..12844124,12845689..12845876,
FT                   12854417..12854508,12857675..12857699,12859427..12859555,
FT                   12861391..12861491,12863915..12864151,12866184..12866235,
FT                   12870020..12870091,12871328..12871431,12872960..12873025,
FT                   12876468..12876537,12877205..12877311,12878345..12878431,
FT                   12881230..12881316,12882457..12882595,12891010..12891137,
FT                   12895153..12895487)
FT                   /gene="Hsd17b4"
FT                   /locus_tag="mCG_15516"
FT                   /product="hydroxysteroid (17-beta) dehydrogenase 4,
FT                   transcript variant mCT17716"
FT                   /note="gene_id=mCG15516.2 transcript_id=mCT17716.1 created
FT                   on 11-OCT-2002"
FT   mRNA            join(12827450..12827509,12829226..12829279,
FT                   12838742..12838849,12839634..12839698,12841881..12841938,
FT                   12844040..12844124,12845689..12845876,12854417..12854508,
FT                   12857675..12857699,12859427..12859555,12861391..12861491,
FT                   12863915..12864151,12866184..12866235,12870020..12870091,
FT                   12871328..12871431,12872960..12873025,12876468..12876537,
FT                   12877205..12877311,12878345..12878431,12881230..12881316,
FT                   12882457..12882595,12891010..12891137,12895153..12895561)
FT                   /gene="Hsd17b4"
FT                   /locus_tag="mCG_15516"
FT                   /product="hydroxysteroid (17-beta) dehydrogenase 4,
FT                   transcript variant mCT174104"
FT                   /note="gene_id=mCG15516.2 transcript_id=mCT174104.0 created
FT                   on 11-OCT-2002"
FT   CDS             join(12827452..12827509,12829226..12829279,
FT                   12838742..12838849,12839634..12839698,12841881..12841938,
FT                   12844040..12844124,12845689..12845876,12854417..12854508,
FT                   12857675..12857699,12859427..12859555,12861391..12861491,
FT                   12863915..12864151,12866184..12866235,12870020..12870091,
FT                   12871328..12871431,12872960..12873025,12876468..12876537,
FT                   12877205..12877311,12878345..12878431,12881230..12881316,
FT                   12882457..12882595,12891010..12891137,12895153..12895242)
FT                   /codon_start=1
FT                   /gene="Hsd17b4"
FT                   /locus_tag="mCG_15516"
FT                   /product="hydroxysteroid (17-beta) dehydrogenase 4, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG15516.2 transcript_id=mCT174104.0
FT                   protein_id=mCP97022.0 isoform=CRA_b"
FT                   /protein_id="EDL09934.1"
FT                   /translation="MASPLRFDGRVVLVTGAGGGLGRAYALAFAERGALVIVNDLGGDF
FT                   KGIGKGSSAADKVVAEIRRKGGKAVANYDSVEAGEKLVKTALDTFGRIGDQYFRILRDR
FT                   SFSRISDEDWDIIHRVHLRGSFQVTRAAWDHMKKQNYGRILMTSSASGIYGNFGQANYS
FT                   AAKLGILGLCNTLAIEGRKNNIHCNTIAPNAGSRMTETVLPEDLVEALKPEYVAPLVLW
FT                   LCHESCEENGGLFEVGAGWIGKLRWERTLGAIVRKRNQPMTPEAVRDNWEKICDFSNAS
FT                   KPQTIQESTGGIVEVLHKVDSEGISPNRTSHAAPAATSGFVGAVGHKLPSFSSSYTELQ
FT                   SIMYALGVGASVKNPKDLKFVYEGSADFSCLPTFGVIVAQKSMMNGGLAEVPGLSFNFA
FT                   KALHGEQYLELYKPLPRSGELKCEAVIADILDKGSGVVIVMDVYSYSGKELICYNQFSV
FT                   FVVGSGGFGGKRTSEKLKAAVAVPNRPPDAVLRDATSLNQAALYRLSGDWNPLHIDPDF
FT                   ASVAGFEKPILHGLCTFGFSARHVLQQFADNDVSRFKAIKVRFAKPVYPGQTLQTEMWK
FT                   EGNRIHFQTKVHETGDVVISNAYVDLVPASGVSTQTPSEGGELQSALVFGEIGRRLKSV
FT                   GREVVKKANAVFEWHITKGGTVAAKWTIDLKSGSGEVYQGPAKGSADVTIIISDEDFME
FT                   VVFGKLDPQKAFFSGRLKARGNIMLSQKLQMILKDYAKL"
FT   CDS             join(12827452..12827509,12829226..12829279,
FT                   12838742..12838849,12839634..12839693,12841769..12841790,
FT                   12841892..12841938,12844040..12844124,12845689..12845876,
FT                   12854417..12854508,12857675..12857699,12859427..12859555,
FT                   12861391..12861491,12863915..12864151,12866184..12866235,
FT                   12870020..12870091,12871328..12871431,12872960..12873025,
FT                   12876468..12876537,12877205..12877311,12878345..12878431,
FT                   12881230..12881316,12882457..12882595,12891010..12891137,
FT                   12895153..12895242)
FT                   /codon_start=1
FT                   /gene="Hsd17b4"
FT                   /locus_tag="mCG_15516"
FT                   /product="hydroxysteroid (17-beta) dehydrogenase 4, isoform
FT                   CRA_d"
FT                   /note="gene_id=mCG15516.2 transcript_id=mCT17716.1
FT                   protein_id=mCP20951.2 isoform=CRA_d"
FT                   /protein_id="EDL09936.1"
FT                   /translation="MASPLRFDGRVVLVTGAGGGLGRAYALAFAERGALVIVNDLGGDF
FT                   KGIGKGSSAADKVVAEIRRKGGKAVANYDSVEAGEKLVKTALDTFGRIDVVVNNAGILR
FT                   DRSFSRISDEDWDIIHRVHLRGSFQVTRAAWDHMKKQNYGRILMTSSASGIYGNFGQAN
FT                   YSAAKLGILGLCNTLAIEGRKNNIHCNTIAPNAGSRMTETVLPEDLVEALKPEYVAPLV
FT                   LWLCHESCEENGGLFEVGAGWIGKLRWERTLGAIVRKRNQPMTPEAVRDNWEKICDFSN
FT                   ASKPQTIQESTGGIVEVLHKVDSEGISPNRTSHAAPAATSGFVGAVGHKLPSFSSSYTE
FT                   LQSIMYALGVGASVKNPKDLKFVYEGSADFSCLPTFGVIVAQKSMMNGGLAEVPGLSFN
FT                   FAKALHGEQYLELYKPLPRSGELKCEAVIADILDKGSGVVIVMDVYSYSGKELICYNQF
FT                   SVFVVGSGGFGGKRTSEKLKAAVAVPNRPPDAVLRDATSLNQAALYRLSGDWNPLHIDP
FT                   DFASVAGFEKPILHGLCTFGFSARHVLQQFADNDVSRFKAIKVRFAKPVYPGQTLQTEM
FT                   WKEGNRIHFQTKVHETGDVVISNAYVDLVPASGVSTQTPSEGGELQSALVFGEIGRRLK
FT                   SVGREVVKKANAVFEWHITKGGTVAAKWTIDLKSGSGEVYQGPAKGSADVTIIISDEDF
FT                   MEVVFGKLDPQKAFFSGRLKARGNIMLSQKLQMILKDYAKL"
FT   CDS             join(12827452..12827509,12829226..12829279,
FT                   12838742..12838849,12839634..12839693,12841769..12841790,
FT                   12841892..12841938,12844040..12844124,12845689..12845876,
FT                   12854417..12854508,12857675..12857699,12859427..12859555,
FT                   12894916..12894950)
FT                   /codon_start=1
FT                   /gene="Hsd17b4"
FT                   /locus_tag="mCG_15516"
FT                   /product="hydroxysteroid (17-beta) dehydrogenase 4, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG15516.2 transcript_id=mCT174103.0
FT                   protein_id=mCP97023.0 isoform=CRA_a"
FT                   /protein_id="EDL09933.1"
FT                   /translation="MASPLRFDGRVVLVTGAGGGLGRAYALAFAERGALVIVNDLGGDF
FT                   KGIGKGSSAADKVVAEIRRKGGKAVANYDSVEAGEKLVKTALDTFGRIDVVVNNAGILR
FT                   DRSFSRISDEDWDIIHRVHLRGSFQVTRAAWDHMKKQNYGRILMTSSASGIYGNFGQAN
FT                   YSAAKLGILGLCNTLAIEGRKNNIHCNTIAPNAGSRMTETVLPEDLVEALKPEYVAPLV
FT                   LWLCHESCEENGGLFEVGAGWIGKLRWERTLGAIVRKRNQPMTPEAVRDNWEKICDFSN
FT                   ASKPQTIQESPSLSSQITL"
FT   gene            12833828..12834892
FT                   /pseudo
FT                   /locus_tag="mCG_125639"
FT                   /note="gene_id=mCG125639.2"
FT   mRNA            join(12833828..12834139,12834356..12834892)
FT                   /pseudo
FT                   /locus_tag="mCG_125639"
FT                   /note="gene_id=mCG125639.2 transcript_id=mCT126902.2
FT                   created on 16-MAY-2003"
FT   CDS             join(12878393..12878431,12881230..12881316,
FT                   12882457..12882595,12891010..12891137,12895153..12895242)
FT                   /codon_start=1
FT                   /gene="Hsd17b4"
FT                   /locus_tag="mCG_15516"
FT                   /product="hydroxysteroid (17-beta) dehydrogenase 4, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG15516.2 transcript_id=mCT174105.0
FT                   protein_id=mCP97024.0 isoform=CRA_c"
FT                   /protein_id="EDL09935.1"
FT                   /translation="MWKEGNRIHFQTKVHETGDVVISNAYVDLVPASGVSTQTPSEGGE
FT                   LQSALVFGEIGRRLKSVGREVVKKANAVFEWHITKGGTVAAKWTIDLKSGSGEVYQGPA
FT                   KGSADVTIIISDEDFMEVVFGKLDPQKAFFSGRLKARGNIMLSQKLQMILKDYAKL"
FT   gene            complement(12919616..12920434)
FT                   /pseudo
FT                   /locus_tag="mCG_15523"
FT                   /note="gene_id=mCG15523.2"
FT   mRNA            complement(12919616..12920434)
FT                   /pseudo
FT                   /locus_tag="mCG_15523"
FT                   /note="gene_id=mCG15523.2 transcript_id=mCT17723.2 created
FT                   on 10-OCT-2002"
FT   gene            <12974653..12976022
FT                   /gene="Gm93"
FT                   /locus_tag="mCG_15517"
FT                   /note="gene_id=mCG15517.1"
FT   mRNA            join(<12974653..12975253,12975526..12975584,
FT                   12975898..12976022)
FT                   /gene="Gm93"
FT                   /locus_tag="mCG_15517"
FT                   /product="gene model 93, (NCBI), transcript variant
FT                   mCT17717"
FT                   /note="gene_id=mCG15517.1 transcript_id=mCT17717.1 created
FT                   on 17-APR-2003"
FT   mRNA            join(<12974653..12975253,12975898..12976015)
FT                   /gene="Gm93"
FT                   /locus_tag="mCG_15517"
FT                   /product="gene model 93, (NCBI), transcript variant
FT                   mCT181918"
FT                   /note="gene_id=mCG15517.1 transcript_id=mCT181918.0 created
FT                   on 17-APR-2003"
FT   CDS             join(12974653..12975253,12975526..12975584,
FT                   12975898..12975987)
FT                   /codon_start=1
FT                   /gene="Gm93"
FT                   /locus_tag="mCG_15517"
FT                   /product="gene model 93, (NCBI), isoform CRA_b"
FT                   /note="gene_id=mCG15517.1 transcript_id=mCT17717.1
FT                   protein_id=mCP20946.1 isoform=CRA_b"
FT                   /protein_id="EDL09932.1"
FT                   /translation="MKIYYMQVQMKKGVAISWDTKETSESLEKQPRMEEATLPEGVWVG
FT                   TPPSDVSTRNLLSDSEPIGEEKEHEEKPESDSPPGSPAVEERPRAKTPDWLVTMENGFR
FT                   CMACCRVFATMESLQEHVQYGIREGFSCHVFHLTMAQLIGSMESESTQEEEEDHTEETE
FT                   KPKEEKAEEQQPTEEDVGMKKPWSQCPGCVFDSPKDRTTEIPGSEEHARWGGPFLGEEE
FT                   ERTIATTAAADNASSTKEDENNTPSDT"
FT   CDS             join(12974653..12975253,12975898..12975935)
FT                   /codon_start=1
FT                   /gene="Gm93"
FT                   /locus_tag="mCG_15517"
FT                   /product="gene model 93, (NCBI), isoform CRA_a"
FT                   /note="gene_id=mCG15517.1 transcript_id=mCT181918.0
FT                   protein_id=mCP104840.0 isoform=CRA_a"
FT                   /protein_id="EDL09931.1"
FT                   /translation="MKIYYMQVQMKKGVAISWDTKETSESLEKQPRMEEATLPEGVWVG
FT                   TPPSDVSTRNLLSDSEPIGEEKEHEEKPESDSPPGSPAVEERPRAKTPDWLVTMENGFR
FT                   CMACCRVFATMESLQEHVQYGIREGFSCHVFHLTMAQLIGSMESESTQEEEEDHTEETE
FT                   KPKEEKAEEQQPTEEDVGMKKPWSQCPGCVFDSPKDRRRRKDHCDNSGS"
FT   gene            complement(13265689..13266710)
FT                   /gene="Hdhd1a"
FT                   /locus_tag="mCG_15424"
FT                   /note="gene_id=mCG15424.0"
FT   mRNA            complement(13265689..13266710)
FT                   /gene="Hdhd1a"
FT                   /locus_tag="mCG_15424"
FT                   /product="haloacid dehalogenase-like hydrolase domain"
FT                   /note="gene_id=mCG15424.0 transcript_id=mCT16142.0 created
FT                   on 10-OCT-2002"
FT   CDS             complement(13265989..13266693)
FT                   /codon_start=1
FT                   /gene="Hdhd1a"
FT                   /locus_tag="mCG_15424"
FT                   /product="haloacid dehalogenase-like hydrolase domain"
FT                   /note="gene_id=mCG15424.0 transcript_id=mCT16142.0
FT                   protein_id=mCP18090.1"
FT                   /protein_id="EDL09930.1"
FT                   /translation="MAAAVPVPQFRPVTHLIFDLDGLILNTEDLYTDVFEEICNRYGKK
FT                   YNWDVKSLVMGKKALETAQTIVEFLNLPISKEELLKESQEKLQMVLHTAGFMPGAEELI
FT                   HHLKKHRLPFALATSSETVTFQTKTSRHTGFFGLFHHIVLGDDPEVKNGKPGMDIFLTC
FT                   AKRFSPPPDPKDCLVFEDSPNGVEAAIHCGMQVVMVPHENLSADLTRKATLVLSSLHDF
FT                   KPELFGLPAFTE"
FT   gene            13688351..13689107
FT                   /pseudo
FT                   /locus_tag="mCG_18969"
FT                   /note="gene_id=mCG18969.0"
FT   mRNA            13688351..13689107
FT                   /pseudo
FT                   /locus_tag="mCG_18969"
FT                   /note="gene_id=mCG18969.0 transcript_id=mCT16656.0 created
FT                   on 10-OCT-2002"
FT   gene            13802919..13990008
FT                   /locus_tag="mCG_49157"
FT                   /note="gene_id=mCG49157.2"
FT   mRNA            join(13802919..13803276,13987223..13990008)
FT                   /locus_tag="mCG_49157"
FT                   /product="mCG49157"
FT                   /note="gene_id=mCG49157.2 transcript_id=mCT49340.2 created
FT                   on 17-OCT-2002"
FT   CDS             join(13803118..13803276,13987223..13987978)
FT                   /codon_start=1
FT                   /locus_tag="mCG_49157"
FT                   /product="mCG49157"
FT                   /note="gene_id=mCG49157.2 transcript_id=mCT49340.2
FT                   protein_id=mCP26432.2"
FT                   /protein_id="EDL09929.1"
FT                   /translation="MSAKSKGNPSSSSAAEGPPAASKTKVKEQIKIIVEDLELVLGDLK
FT                   DVAKELKEVVDQIDTLTSDLQLEDEMTDSSKTDTLNSSSSGTTASSIEKIKEQANAPLI
FT                   KPPAHPSAILTVLRKPNPPPPPPRLTPVRCEEPQRVVPTANPVKTNGTLLRNGGLAGRP
FT                   NKIPNGDICCIPNSNLDKAPLQSLMHRPEKDRSPQAGPRERVRFNEKVQYHGYCPDCES
FT                   RYNIKNREVHLHSEPVHPPGKIPHQGPLLHPPPHLPNFPLENGGLGISHSNSFPPPTPA
FT                   TVPPPAAPKPQKTILRKSTTTTV"
FT   gene            complement(14560387..14561031)
FT                   /locus_tag="mCG_1283"
FT                   /note="gene_id=mCG1283.1"
FT   mRNA            complement(14560387..14561031)
FT                   /locus_tag="mCG_1283"
FT                   /product="mCG1283"
FT                   /note="gene_id=mCG1283.1 transcript_id=mCT8552.1 created on
FT                   10-OCT-2002"
FT   CDS             complement(14560398..14561015)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1283"
FT                   /product="mCG1283"
FT                   /note="gene_id=mCG1283.1 transcript_id=mCT8552.1
FT                   protein_id=mCP3478.2"
FT                   /protein_id="EDL09928.1"
FT                   /translation="MSIMPYNGGAVMAMKGKNCVAIAADRCFGIQAQMVTTDFQKIFAL
FT                   GDRLYIGLAGLATDIQTVAQRLKFRLNLYMLKEGRHIKPFTLMSMVANLLYEKRFGPYY
FT                   TEPVIAGLDPKTFKLFICSLDLIGCPMVTDDFVVSGTCSEQMHGMCESLWEPHMDPEHL
FT                   FETISQAMLNAVDRDAMSGMGVIVHVIEKDKITTRTLKARMD"
FT   gene            15026416..15027666
FT                   /gene="Ftmt"
FT                   /locus_tag="mCG_1282"
FT                   /note="gene_id=mCG1282.0"
FT   mRNA            15026416..15027666
FT                   /gene="Ftmt"
FT                   /locus_tag="mCG_1282"
FT                   /product="ferritin mitochondrial"
FT                   /note="gene_id=mCG1282.0 transcript_id=mCT8551.0 created on
FT                   10-OCT-2002"
FT   CDS             15026495..15027208
FT                   /codon_start=1
FT                   /gene="Ftmt"
FT                   /locus_tag="mCG_1282"
FT                   /product="ferritin mitochondrial"
FT                   /note="gene_id=mCG1282.0 transcript_id=mCT8551.0
FT                   protein_id=mCP3477.1"
FT                   /protein_id="EDL09927.1"
FT                   /translation="MLSCFWLFSKHIGSALMSLPRVLHRFTAPQCLASRYPLGPLLASP
FT                   RRLLASVASSQDSTRPSRVRQNFHPDSEAAINRQINLELYASYVYLSMAYYFSRDDVAL
FT                   YNFSKYFLRQSLEEREHAEKLMKLQNQRGGRICLQDIKKPDKDDWECGLRAMECALLLE
FT                   KNVNQSLLDLHTLASEKGDPHLCDFLETHYLHEQVKSIKELGDHVHNLVTMGAPAAGLA
FT                   EYLFDKHTLGSESKH"
FT   gene            15150179..>15175623
FT                   /gene="Srfbp1"
FT                   /locus_tag="mCG_3251"
FT                   /note="gene_id=mCG3251.2"
FT   mRNA            join(15150179..15150273,15160078..15160166,
FT                   15160784..15160856,15175552..>15175623)
FT                   /gene="Srfbp1"
FT                   /locus_tag="mCG_3251"
FT                   /product="serum response factor binding protein 1,
FT                   transcript variant mCT2073"
FT                   /note="gene_id=mCG3251.2 transcript_id=mCT2073.2 created on
FT                   10-OCT-2002"
FT   CDS             join(15150208..15150273,15160078..15160166,
FT                   15160784..15160856,15175552..>15175623)
FT                   /codon_start=1
FT                   /gene="Srfbp1"
FT                   /locus_tag="mCG_3251"
FT                   /product="serum response factor binding protein 1, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG3251.2 transcript_id=mCT2073.2
FT                   protein_id=mCP3485.2 isoform=CRA_b"
FT                   /protein_id="EDL09926.1"
FT                   /translation="MAADPLPPSAMVQPGTLNLNNEVVKMRKEVKRIRVLVIRKLVRSV
FT                   GRLKSKKGTEDALLKNQRRAQRLLEEIHAMKELKPDVVTKSALSDDINFEKTCKK"
FT   mRNA            join(15150223..15150273,15160078..15160166,
FT                   15160784..15160856,15163928..15164422)
FT                   /gene="Srfbp1"
FT                   /locus_tag="mCG_3251"
FT                   /product="serum response factor binding protein 1,
FT                   transcript variant mCT174126"
FT                   /note="gene_id=mCG3251.2 transcript_id=mCT174126.0 created
FT                   on 10-OCT-2002"
FT   CDS             join(15150238..15150273,15160078..15160166,
FT                   15160784..15160856,15163928..15163936)
FT                   /codon_start=1
FT                   /gene="Srfbp1"
FT                   /locus_tag="mCG_3251"
FT                   /product="serum response factor binding protein 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG3251.2 transcript_id=mCT174126.0
FT                   protein_id=mCP97045.0 isoform=CRA_a"
FT                   /protein_id="EDL09925.1"
FT                   /translation="MVQPGTLNLNNEVVKMRKEVKRIRVLVIRKLVRSVGRLKSKKGTE
FT                   DALLKNQRRAQRLLEEIHAMKVL"
FT   gene            complement(15195643..15209220)
FT                   /gene="Lox"
FT                   /locus_tag="mCG_3257"
FT                   /note="gene_id=mCG3257.1"
FT   mRNA            complement(join(15195643..15198809,15200349..15200464,
FT                   15200798..15200893,15204636..15204792,15206418..15206555,
FT                   15207796..15207904,15208234..15209220))
FT                   /gene="Lox"
FT                   /locus_tag="mCG_3257"
FT                   /product="lysyl oxidase"
FT                   /note="gene_id=mCG3257.1 transcript_id=mCT2067.1 created on
FT                   10-OCT-2002"
FT   CDS             complement(join(15198803..15198809,15200349..15200464,
FT                   15200798..15200893,15204636..15204792,15206418..15206555,
FT                   15207796..15207904,15208234..15208846))
FT                   /codon_start=1
FT                   /gene="Lox"
FT                   /locus_tag="mCG_3257"
FT                   /product="lysyl oxidase"
FT                   /note="gene_id=mCG3257.1 transcript_id=mCT2067.1
FT                   protein_id=mCP3484.2"
FT                   /db_xref="GOA:Q3TXH3"
FT                   /db_xref="InterPro:IPR001695"
FT                   /db_xref="InterPro:IPR019828"
FT                   /db_xref="MGI:MGI:96817"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TXH3"
FT                   /protein_id="EDL09924.1"
FT                   /translation="MRFAWAVLLLGPLQLCPLLRCAPQTPREPPAAPGAWRQTIQWENN
FT                   GQVFSLLSLGAQYQPQRRRDPSATARRPDGDAASQPRTPILLLRDNRTASTRARTPSPS
FT                   GVAAGRPRPAARHWFQAGFSPSGARDGASRRAANRTASPQPPQLSNLRPPSHIDRMVGD
FT                   DPYNPYKYSDDNPYYNYYDTYERPRPGSRNRPGYGTGYFQYGLPDLVPDPYYIQASTYV
FT                   QKMSMYNLRCAAEENCLASSAYRADVRDYDHRVLLRFPQRVKNQGTSDFLPSRPRYSWE
FT                   WHSCHQHYHSMDEFSHYDLLDANTQRRVAEGHKASFCLEDTSCDYGYHRRFACTAHTQG
FT                   LSPGCYDTYAADIDCQWIDITDVQPGNYILKVSVNPSYLVPESDYTNNVVRCDIRYTGH
FT                   HAYASGCTISPY"
FT   gene            <15208177..15257470
FT                   /locus_tag="mCG_146105"
FT                   /note="gene_id=mCG146105.0"
FT   mRNA            join(<15208177..15208263,15243791..15244009,
FT                   15257227..15257470)
FT                   /locus_tag="mCG_146105"
FT                   /product="mCG146105"
FT                   /note="gene_id=mCG146105.0 transcript_id=mCT186208.0
FT                   created on 14-JUL-2003"
FT   CDS             join(<15208186..15208263,15243791..15243982)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146105"
FT                   /product="mCG146105"
FT                   /note="gene_id=mCG146105.0 transcript_id=mCT186208.0
FT                   protein_id=mCP107765.0"
FT                   /protein_id="EDL09923.1"
FT                   /translation="PAARVAGTYGGSRGAYRTGSNRCRIQIFRVDVATVRMFLNHRQEG
FT                   TAAIYSSWTWADTRIQELGTVIMSRTHDSQMKQGRSCPSGSADC"
FT   gene            15213256..15213753
FT                   /pseudo
FT                   /locus_tag="mCG_1033366"
FT                   /note="gene_id=mCG1033366.1"
FT   mRNA            15213256..15213753
FT                   /pseudo
FT                   /locus_tag="mCG_1033366"
FT                   /note="gene_id=mCG1033366.1 transcript_id=mCT151070.1
FT                   created on 10-MAR-2003"
FT   gene            <15296063..15323668
FT                   /gene="Zfp474"
FT                   /locus_tag="mCG_3256"
FT                   /note="gene_id=mCG3256.1"
FT   mRNA            join(<15296063..15296234,15321910..15323668)
FT                   /gene="Zfp474"
FT                   /locus_tag="mCG_3256"
FT                   /product="zinc finger protein 474, transcript variant
FT                   mCT2069"
FT                   /note="gene_id=mCG3256.1 transcript_id=mCT2069.0 created on
FT                   10-OCT-2002"
FT   mRNA            join(15296131..15296234,15304738..15304860,
FT                   15305596..15305722,15321910..15323668)
FT                   /gene="Zfp474"
FT                   /locus_tag="mCG_3256"
FT                   /product="zinc finger protein 474, transcript variant
FT                   mCT174129"
FT                   /note="gene_id=mCG3256.1 transcript_id=mCT174129.0 created
FT                   on 10-OCT-2002"
FT   CDS             <15322097..15323158
FT                   /codon_start=1
FT                   /gene="Zfp474"
FT                   /locus_tag="mCG_3256"
FT                   /product="zinc finger protein 474, isoform CRA_a"
FT                   /note="gene_id=mCG3256.1 transcript_id=mCT2069.0
FT                   protein_id=mCP3483.0 isoform=CRA_a"
FT                   /protein_id="EDL09921.1"
FT                   /translation="TKPPLFMESGNERISSQSQGTIHLSKEPTFLIQQATLPSDLHSTL
FT                   LQETQCGGLTKNIKANTQKRRPGTVILSKRSSRIMSETQPRPPVIPSRRPGFRICYICG
FT                   REFGSQSLAIHEPQCLEKWRTENSKLPKHLRRPEPSKPQPIGGTDSHSLQAANEEAFQS
FT                   AQAQLLPCENCGRTFLPDRLLVHQRSCKPKGENPGPPSMGSSNVPTGLKKASSGIPARP
FT                   RTLICYICGREFGTLSLPIHEPKCLEKWKIENDQLPRELRRPQPQKPQPLPAGQSSQEG
FT                   ASQAALVPCPNCGRTFAVDRLPVHQRSCKSQPSGPKTSNSNIERKGGPNPPTNSKQQRN
FT                   MEAPNGDKVTGVI"
FT   CDS             15322115..15323158
FT                   /codon_start=1
FT                   /gene="Zfp474"
FT                   /locus_tag="mCG_3256"
FT                   /product="zinc finger protein 474, isoform CRA_b"
FT                   /note="gene_id=mCG3256.1 transcript_id=mCT174129.0
FT                   protein_id=mCP97048.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q6V5K9"
FT                   /db_xref="InterPro:IPR026319"
FT                   /db_xref="MGI:MGI:1914008"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6V5K9"
FT                   /protein_id="EDL09922.1"
FT                   /translation="MESGNERISSQSQGTIHLSKEPTFLIQQATLPSDLHSTLLQETQC
FT                   GGLTKNIKANTQKRRPGTVILSKRSSRIMSETQPRPPVIPSRRPGFRICYICGREFGSQ
FT                   SLAIHEPQCLEKWRTENSKLPKHLRRPEPSKPQPIGGTDSHSLQAANEEAFQSAQAQLL
FT                   PCENCGRTFLPDRLLVHQRSCKPKGENPGPPSMGSSNVPTGLKKASSGIPARPRTLICY
FT                   ICGREFGTLSLPIHEPKCLEKWKIENDQLPRELRRPQPQKPQPLPAGQSSQEGASQAAL
FT                   VPCPNCGRTFAVDRLPVHQRSCKSQPSGPKTSNSNIERKGGPNPPTNSKQQRNMEAPNG
FT                   DKVTGVI"
FT   gene            <15330075..15347541
FT                   /gene="1700034E13Rik"
FT                   /locus_tag="mCG_146104"
FT                   /note="gene_id=mCG146104.1"
FT   mRNA            join(<15330075..15330165,15344182..15344362,
FT                   15347375..15347541)
FT                   /gene="1700034E13Rik"
FT                   /locus_tag="mCG_146104"
FT                   /product="RIKEN cDNA 1700034E13, transcript variant
FT                   mCT190304"
FT                   /note="gene_id=mCG146104.1 transcript_id=mCT190304.0
FT                   created on 08-MAR-2004"
FT   mRNA            join(<15330079..15330165,15340194..15340237,
FT                   15344182..15344362,15347375..15347538)
FT                   /gene="1700034E13Rik"
FT                   /locus_tag="mCG_146104"
FT                   /product="RIKEN cDNA 1700034E13, transcript variant
FT                   mCT186207"
FT                   /note="gene_id=mCG146104.1 transcript_id=mCT186207.0
FT                   created on 14-JUL-2003"
FT   CDS             join(<15330127..15330165,15344182..15344362,
FT                   15347375..15347526)
FT                   /codon_start=1
FT                   /gene="1700034E13Rik"
FT                   /locus_tag="mCG_146104"
FT                   /product="RIKEN cDNA 1700034E13, isoform CRA_b"
FT                   /note="gene_id=mCG146104.1 transcript_id=mCT190304.0
FT                   protein_id=mCP111274.0 isoform=CRA_b"
FT                   /protein_id="EDL09920.1"
FT                   /translation="DPVALRCKKNNNKPTMIRRPPTIVCYICGREYGTKSISIHEPQCL
FT                   KKWHNENNLLPKELRRPEPKKPEVRTITAKGFYDLDALNEAAWTSAQSQLVPCNVCGRT
FT                   FLPDRLIVHQRSCKPKASK"
FT   CDS             join(<15340205..15340237,15344182..15344362,
FT                   15347375..15347526)
FT                   /codon_start=1
FT                   /gene="1700034E13Rik"
FT                   /locus_tag="mCG_146104"
FT                   /product="RIKEN cDNA 1700034E13, isoform CRA_a"
FT                   /note="gene_id=mCG146104.1 transcript_id=mCT186207.0
FT                   protein_id=mCP107764.0 isoform=CRA_a"
FT                   /protein_id="EDL09919.1"
FT                   /translation="KETYEKEERFIPTMIRRPPTIVCYICGREYGTKSISIHEPQCLKK
FT                   WHNENNLLPKELRRPEPKKPEVRTITAKGFYDLDALNEAAWTSAQSQLVPCNVCGRTFL
FT                   PDRLIVHQRSCKPKASK"
FT   gene            15379300..15381289
FT                   /gene="Gykl1"
FT                   /locus_tag="mCG_3255"
FT                   /note="gene_id=mCG3255.0"
FT   mRNA            15379300..15381289
FT                   /gene="Gykl1"
FT                   /locus_tag="mCG_3255"
FT                   /product="glycerol kinase-like 1"
FT                   /note="gene_id=mCG3255.0 transcript_id=mCT2068.0 created on
FT                   10-OCT-2002"
FT   CDS             15379343..15380992
FT                   /codon_start=1
FT                   /gene="Gykl1"
FT                   /locus_tag="mCG_3255"
FT                   /product="glycerol kinase-like 1"
FT                   /note="gene_id=mCG3255.0 transcript_id=mCT2068.0
FT                   protein_id=mCP3482.1"
FT                   /db_xref="GOA:Q8C635"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="MGI:MGI:891990"
FT                   /db_xref="UniProtKB/TrEMBL:Q8C635"
FT                   /protein_id="EDL09918.1"
FT                   /translation="MAEAPKAVLGPLVGAVDQGTSSTRFLVFNPQTAELLCHHQVEIAQ
FT                   EFPKEGWVEQDPKAILQSVYECIEKACEKLGQQSIDISNIKAIGVTNQRETTIVWDKFT
FT                   GEPLYNAVVWLDLRTQSTVENLSKSISVSNNFVKNKTGLPISTYFSAVKLHWLIENVRK
FT                   VQKAIEDGRAIFGTVDSWLIWCMTGGINGGVHCTDVSNASRTMLFNIHSLQWDEELCDF
FT                   FGIPMTILPRIRSSSEIYGLVKSGVLEGVPISGCLGDQSAALVGQLCLQDGQAKSTYGT
FT                   GCFLLCNTGQKCVNSEHGLLTTVAYQLGRQEPVYYALEGSVAIAGAVVSWIKNNLQIIQ
FT                   SSSEIEKLAEVAGTSYGCYFVPAFSGLYAPYWDPSARGIICGLTQFTNKFHIAFAALEA
FT                   VCFQTREILDAMNSDCGIPLTHLQVDGGMTANRVLMQLQADILCIPVMKPFMPETTALG
FT                   VAMAAGAAEGVSVWSLDPKDLSSVQMEKFEPQINVEESEGRYATWKKAVLKSMGWVLTQ
FT                   SPDGRDPSIFSSLTLGFYVVSSMVILIGARYM"
FT   gene            15521839..15599510
FT                   /gene="Sncaip"
FT                   /locus_tag="mCG_3252"
FT                   /note="gene_id=mCG3252.1"
FT   mRNA            join(15521839..15521941,15535218..15535290,
FT                   15552278..15553146,15555042..15555221,15568370..15568483,
FT                   15578249..15578374,15581535..15581704,15589382..15589474,
FT                   15589995..15591054,15592187..15592257,15598885..15599510)
FT                   /gene="Sncaip"
FT                   /locus_tag="mCG_3252"
FT                   /product="synuclein, alpha interacting protein (synphilin),
FT                   transcript variant mCT2071"
FT                   /note="gene_id=mCG3252.1 transcript_id=mCT2071.0 created on
FT                   10-OCT-2002"
FT   mRNA            join(15521839..15521941,15535218..15535290,
FT                   15552278..15553146,15555042..15555221,15568370..15568483,
FT                   15578249..15578374,15581535..15581704,15589382..15589474,
FT                   15589995..15591054,15598885..15599510)
FT                   /gene="Sncaip"
FT                   /locus_tag="mCG_3252"
FT                   /product="synuclein, alpha interacting protein (synphilin),
FT                   transcript variant mCT174127"
FT                   /note="gene_id=mCG3252.1 transcript_id=mCT174127.0 created
FT                   on 10-OCT-2002"
FT   CDS             join(15521885..15521941,15535218..15535290,
FT                   15552278..15553146,15555042..15555221,15568370..15568483,
FT                   15578249..15578374,15581535..15581704,15589382..15589474,
FT                   15589995..15591054,15592187..15592257,15598885..15598969)
FT                   /codon_start=1
FT                   /gene="Sncaip"
FT                   /locus_tag="mCG_3252"
FT                   /product="synuclein, alpha interacting protein (synphilin),
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG3252.1 transcript_id=mCT2071.0
FT                   protein_id=mCP3486.1 isoform=CRA_b"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="MGI:MGI:1915097"
FT                   /db_xref="UniProtKB/TrEMBL:G5E848"
FT                   /protein_id="EDL09917.1"
FT                   /translation="MEAPEYLDLDEIDFSDDISYSVTSLKTIPALCRRCDSQNEDRSVS
FT                   SSGWNCGVSTLITNPQKPTGIADVYSKFRPVKRVSPLKHQPETLENNENEDQKNNTVEY
FT                   QKGGETDQGPQPEELSPEDGVGGLPGKGSEPSQALGELEHYDLDMDEILDVPYIKSSQQ
FT                   LAPLTKVTSEKRILGLCTTINGLSAKTCPIASTENSTPNMTPFCVLSPVKSPHLRKAPT
FT                   ALRDQHKLSTEDSESSPALGKCGPAYESENHSKDFLNKVFSDPHSRKIEKSGPDCKLRS
FT                   FHLQSSAAGAKTEEPINGMNWTNTQGTEERTEYLKKVRSILNIVNEGQISLLPHLAADN
FT                   LDKIHDENGNNLLHIAASKGHAECLQHLTSLMGEDCLNERNTEQLTPAGLAIKNGQLEC
FT                   VRWMVSETEAIAELSCSKDFPSLIHYAGCYGQEKILLWLLQFMQEQGISLDEVDREGNS
FT                   AVHVASQHGYLGCIQTLVEYGANVTMQNHAGEKPSQSAERHGHTLCSRYLVVVETCMSL
FT                   ASQVVKLTKQLKEQTVERVTLQSQLQQLLEAQKSEGKSLPSSPSSPSSPASTKSQWKAL
FT                   DTDEESTGKSKVGAQEGIQVLGSLSVSSRARTKGKDEDSDKILRQLLGKEISENVCTQE
FT                   KLSLEFQDAQASSRNSKKIPLEKRELKLARLRQLMQRSLSESDTDSNNSEDPKNTPVKR
FT                   ADRPRPQPIVESVENVDSAESLHLMIKKHSLASGRRFPFGMKASKSLDGHSPSPTSESS
FT                   EPDLDSHGPGLGMTPPTQPSTEATQSSPDSTAAQKVATSPKSALKSPSSKRRTSQNSKL
FT                   RVTFEEPVVQMEQTGLELNGEKDKDKGRAPQRTSESGEQMKRPFGTFRSIMESLSGNQN
FT                   NNNNYQPASQLKTCTLPLTSLGRKTADAKGNPVSPASKGKNKAAMYSSCIHLPSNALVE
FT                   EHLRDYARHNDIKRNATKTYHMKHTAEPEPRELFL"
FT   CDS             join(15521885..15521941,15535218..15535290,
FT                   15552278..15553146,15555042..15555221,15568370..15568483,
FT                   15578249..15578374,15581535..15581704,15589382..15589474,
FT                   15589995..15591054,15598885..15598890)
FT                   /codon_start=1
FT                   /gene="Sncaip"
FT                   /locus_tag="mCG_3252"
FT                   /product="synuclein, alpha interacting protein (synphilin),
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG3252.1 transcript_id=mCT174127.0
FT                   protein_id=mCP97046.0 isoform=CRA_a"
FT                   /db_xref="GOA:E9Q4E2"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="MGI:MGI:1915097"
FT                   /db_xref="UniProtKB/TrEMBL:E9Q4E2"
FT                   /protein_id="EDL09916.1"
FT                   /translation="MEAPEYLDLDEIDFSDDISYSVTSLKTIPALCRRCDSQNEDRSVS
FT                   SSGWNCGVSTLITNPQKPTGIADVYSKFRPVKRVSPLKHQPETLENNENEDQKNNTVEY
FT                   QKGGETDQGPQPEELSPEDGVGGLPGKGSEPSQALGELEHYDLDMDEILDVPYIKSSQQ
FT                   LAPLTKVTSEKRILGLCTTINGLSAKTCPIASTENSTPNMTPFCVLSPVKSPHLRKAPT
FT                   ALRDQHKLSTEDSESSPALGKCGPAYESENHSKDFLNKVFSDPHSRKIEKSGPDCKLRS
FT                   FHLQSSAAGAKTEEPINGMNWTNTQGTEERTEYLKKVRSILNIVNEGQISLLPHLAADN
FT                   LDKIHDENGNNLLHIAASKGHAECLQHLTSLMGEDCLNERNTEQLTPAGLAIKNGQLEC
FT                   VRWMVSETEAIAELSCSKDFPSLIHYAGCYGQEKILLWLLQFMQEQGISLDEVDREGNS
FT                   AVHVASQHGYLGCIQTLVEYGANVTMQNHAGEKPSQSAERHGHTLCSRYLVVVETCMSL
FT                   ASQVVKLTKQLKEQTVERVTLQSQLQQLLEAQKSEGKSLPSSPSSPSSPASTKSQWKAL
FT                   DTDEESTGKSKVGAQEGIQVLGSLSVSSRARTKGKDEDSDKILRQLLGKEISENVCTQE
FT                   KLSLEFQDAQASSRNSKKIPLEKRELKLARLRQLMQRSLSESDTDSNNSEDPKNTPVKR
FT                   ADRPRPQPIVESVENVDSAESLHLMIKKHSLASGRRFPFGMKASKSLDGHSPSPTSESS
FT                   EPDLDSHGPGLGMTPPTQPSTEATQSSPDSTAAQKVATSPKSALKSPSSKRRTSQNSKL
FT                   RVTFEEPVVQMEQTGLELNGEKDKDKGRAPQRTSESGEQMKRPFGTFRSIMESLSGNQN
FT                   NNNNYQPASQLKTCTLPLTSLGRKTADAKGNPVSPASKGKNKAA"
FT   gene            15635217..15636002
FT                   /pseudo
FT                   /locus_tag="mCG_3254"
FT                   /note="gene_id=mCG3254.1"
FT   mRNA            15635217..15636002
FT                   /pseudo
FT                   /locus_tag="mCG_3254"
FT                   /note="gene_id=mCG3254.1 transcript_id=mCT2070.2 created on
FT                   10-OCT-2002"
FT   gene            15852449..15897287
FT                   /locus_tag="mCG_3253"
FT                   /note="gene_id=mCG3253.2"
FT   mRNA            join(15852449..15852523,15852710..15852765,
FT                   15865843..15866023,15874111..15874177,15874442..15874485,
FT                   15876013..15876154,15879297..15879375,15885845..15885920,
FT                   15886587..15886700,15886956..15887049,15889010..15889215,
FT                   15892808..15892951,15894529..15894613,15894716..15894787,
FT                   15896799..15897287)
FT                   /locus_tag="mCG_3253"
FT                   /product="mCG3253, transcript variant mCT174128"
FT                   /note="gene_id=mCG3253.2 transcript_id=mCT174128.0 created
FT                   on 09-OCT-2002"
FT   mRNA            join(15852460..15852523,15852710..15852765,
FT                   15865906..15866023,15870685..15870848,15874111..15874177,
FT                   15874442..15874485,15876013..15876154,15879297..15879375,
FT                   15885845..15885920,15886587..15886700,15886956..15887049,
FT                   15889010..15889215,15892808..15892951,15894529..15894609,
FT                   15894716..15894787,15896799..15897287)
FT                   /locus_tag="mCG_3253"
FT                   /product="mCG3253, transcript variant mCT2072"
FT                   /note="gene_id=mCG3253.2 transcript_id=mCT2072.2 created on
FT                   09-OCT-2002"
FT   CDS             join(15852475..15852523,15852710..15852765,
FT                   15865906..15866023,15870685..15870848,15874111..15874177,
FT                   15874442..15874485,15876013..15876154,15879297..15879375,
FT                   15885845..15885920,15886587..15886700,15886956..15887049,
FT                   15889010..15889215,15892808..15892951,15894529..15894609,
FT                   15894716..15894787,15896799..15896849)
FT                   /codon_start=1
FT                   /locus_tag="mCG_3253"
FT                   /product="mCG3253, isoform CRA_b"
FT                   /note="gene_id=mCG3253.2 transcript_id=mCT2072.2
FT                   protein_id=mCP3480.2 isoform=CRA_b"
FT                   /protein_id="EDL09915.1"
FT                   /translation="MAAEREPPPLGDVKPTVEELEDGEDLFTSTVSTLESSPSSPEPAS
FT                   LPAEDISANSNGSKPVEVVLDDDREDLFAEATEEVSLDSPERELILSSEPSPAVTPVTP
FT                   TTLIAPRIESKSISAPVIFDRSRDEIEEEANGDIFDIEIGVSDPEKVGDGMNAYMAYRV
FT                   TTKTSLSMFSKSEFSVKRRFSDFLGLHSKLASKYLHVGYIVPPAPEKSIVGMTKVKVGK
FT                   EDSSSTEFVEKRRAALERYLQRTVKHPTLLQDPDLRQFLESSELPRAVNTQALSGAGIL
FT                   RMVNKAADAVNKMTIKMNESDAWFEEKQQQFENLDQQLRKLHASVEALVCHRKELSANT
FT                   AAFAKSAAMLGNSEDHTALSRALSQLAEVEEKIDQLHQEQAFADFYMFSELLSDYIRLI
FT                   AAVKGVFDHRMKCWQKWEDAQITLLKKRETEAKMMVANKPDKIQQAKNEIREWEAKVQQ
FT                   GERDFEQISKTIRKEVGRFEKERVKDFKAVIIKYLESLVQTQQQLIKYWEAFLPEAKAI
FT                   A"
FT   CDS             join(15866000..15866023,15874111..15874177,
FT                   15874442..15874485,15876013..15876154,15879297..15879375,
FT                   15885845..15885920,15886587..15886700,15886956..15887049,
FT                   15889010..15889215,15892808..15892951,15894529..15894613,
FT                   15894716..15894717)
FT                   /codon_start=1
FT                   /locus_tag="mCG_3253"
FT                   /product="mCG3253, isoform CRA_a"
FT                   /note="gene_id=mCG3253.2 transcript_id=mCT174128.0
FT                   protein_id=mCP97047.0 isoform=CRA_a"
FT                   /protein_id="EDL09914.1"
FT                   /translation="MTEKIFSQIEEEANGDIFDIEIGVSDPEKVGDGMNAYMAYRVTTK
FT                   TSLSMFSKSEFSVKRRFSDFLGLHSKLASKYLHVGYIVPPAPEKSIVGMTKVKVGKEDS
FT                   SSTEFVEKRRAALERYLQRTVKHPTLLQDPDLRQFLESSELPRAVNTQALSGAGILRMV
FT                   NKAADAVNKMTIKMNESDAWFEEKQQQFENLDQQLRKLHASVEALVCHRKELSANTAAF
FT                   AKSAAMLGNSEDHTALSRALSQLAEVEEKIDQLHQEQAFADFYMFSELLSDYIRLIAAV
FT                   KGVFDHRMKCWQKWEDAQITLLKKRETEAKMMVANKPDKIQQAKNEIREWEAKVQQGER
FT                   DFEQISKTIRKEVGRFEA"
FT   gene            complement(15897410..15898326)
FT                   /pseudo
FT                   /locus_tag="mCG_48828"
FT                   /note="gene_id=mCG48828.2"
FT   mRNA            complement(15897410..15898326)
FT                   /pseudo
FT                   /locus_tag="mCG_48828"
FT                   /note="gene_id=mCG48828.2 transcript_id=mCT49011.2 created
FT                   on 17-OCT-2002"
FT   gene            <15921422..16064513
FT                   /gene="Snx24"
FT                   /locus_tag="mCG_8358"
FT                   /note="gene_id=mCG8358.2"
FT   mRNA            join(15921422..15921507,16000955..16001038,
FT                   16013677..16013781,16056669..16056763,16058215..16058247,
FT                   16058775..16058839,16063113..16063212,16063988..16064419)
FT                   /gene="Snx24"
FT                   /locus_tag="mCG_8358"
FT                   /product="sorting nexing 24, transcript variant mCT173334"
FT                   /note="gene_id=mCG8358.2 transcript_id=mCT173334.0 created
FT                   on 19-SEP-2002"
FT   mRNA            join(<15921422..15921507,16000955..16001038,
FT                   16013677..16013781,16056669..16056763,16058215..16058247,
FT                   16058775..16058839,16063113..16063208,16063988..16064419)
FT                   /gene="Snx24"
FT                   /locus_tag="mCG_8358"
FT                   /product="sorting nexing 24, transcript variant mCT190282"
FT                   /note="gene_id=mCG8358.2 transcript_id=mCT190282.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(15921423..15921507,16000955..16001038,
FT                   16013677..16013781,16056669..16056763,16058215..16058247,
FT                   16058775..16058839,16063113..16064513)
FT                   /gene="Snx24"
FT                   /locus_tag="mCG_8358"
FT                   /product="sorting nexing 24, transcript variant mCT7423"
FT                   /note="gene_id=mCG8358.2 transcript_id=mCT7423.2 created on
FT                   19-SEP-2002"
FT   CDS             join(<15921424..15921507,16000955..16001038,
FT                   16013677..16013781,16056669..16056763,16058215..16058247,
FT                   16058775..16058839,16063113..16063180)
FT                   /codon_start=1
FT                   /gene="Snx24"
FT                   /locus_tag="mCG_8358"
FT                   /product="sorting nexing 24, isoform CRA_b"
FT                   /note="gene_id=mCG8358.2 transcript_id=mCT190282.0
FT                   protein_id=mCP111293.0 isoform=CRA_b"
FT                   /protein_id="EDL09912.1"
FT                   /translation="EWRGPAAAMEVYIPSFRHEDSDLERGYTVFKIEVLMNGRKHFVEK
FT                   RYSEFHALHKKLKKCIKTPEIPSKHVRNWVPKVLEQRRQGLETYLQAVILENEELPKLF
FT                   LDFLNVRHLPSLPKAESCGSFDETESEESSKLSHQPVLLFLGDPYVLPAASDFPNVVIE
FT                   GVLHGIFFSHLQPR"
FT   CDS             join(15921448..15921507,16000955..16001038,
FT                   16013677..16013781,16056669..16056763,16058215..16058247,
FT                   16058775..16058839,16063113..16063180)
FT                   /codon_start=1
FT                   /gene="Snx24"
FT                   /locus_tag="mCG_8358"
FT                   /product="sorting nexing 24, isoform CRA_a"
FT                   /note="gene_id=mCG8358.2 transcript_id=mCT173334.0
FT                   protein_id=mCP96253.0 isoform=CRA_a"
FT                   /protein_id="EDL09911.1"
FT                   /translation="MEVYIPSFRHEDSDLERGYTVFKIEVLMNGRKHFVEKRYSEFHAL
FT                   HKKLKKCIKTPEIPSKHVRNWVPKVLEQRRQGLETYLQAVILENEELPKLFLDFLNVRH
FT                   LPSLPKAESCGSFDETESEESSKLSHQPVLLFLGDPYVLPAASDFPNVVIEGVLHGIFF
FT                   SHLQPR"
FT   CDS             join(15921448..15921507,16000955..16001038,
FT                   16013677..16013781,16056669..16056763,16058215..16058247,
FT                   16058775..16058839,16063113..16063180)
FT                   /codon_start=1
FT                   /gene="Snx24"
FT                   /locus_tag="mCG_8358"
FT                   /product="sorting nexing 24, isoform CRA_a"
FT                   /note="gene_id=mCG8358.2 transcript_id=mCT7423.2
FT                   protein_id=mCP21495.2 isoform=CRA_a"
FT                   /protein_id="EDL09913.1"
FT                   /translation="MEVYIPSFRHEDSDLERGYTVFKIEVLMNGRKHFVEKRYSEFHAL
FT                   HKKLKKCIKTPEIPSKHVRNWVPKVLEQRRQGLETYLQAVILENEELPKLFLDFLNVRH
FT                   LPSLPKAESCGSFDETESEESSKLSHQPVLLFLGDPYVLPAASDFPNVVIEGVLHGIFF
FT                   SHLQPR"
FT   gene            complement(16081113..16092862)
FT                   /gene="Ppic"
FT                   /locus_tag="mCG_8356"
FT                   /note="gene_id=mCG8356.2"
FT   mRNA            complement(join(16081113..16081840,16083898..16084082,
FT                   16085826..16085919,16086345..16086458,16092680..16092847))
FT                   /gene="Ppic"
FT                   /locus_tag="mCG_8356"
FT                   /product="peptidylprolyl isomerase C, transcript variant
FT                   mCT7426"
FT                   /note="gene_id=mCG8356.2 transcript_id=mCT7426.1 created on
FT                   09-OCT-2002"
FT   CDS             complement(join(16081712..16081840,16083898..16084082,
FT                   16085826..16085919,16086345..16086458,16092680..16092796))
FT                   /codon_start=1
FT                   /gene="Ppic"
FT                   /locus_tag="mCG_8356"
FT                   /product="peptidylprolyl isomerase C, isoform CRA_b"
FT                   /note="gene_id=mCG8356.2 transcript_id=mCT7426.1
FT                   protein_id=mCP21482.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q3UC73"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="MGI:MGI:97751"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UC73"
FT                   /protein_id="EDL09910.1"
FT                   /translation="MSPGPRLLLPAVLCLGLGALVSSSGSSGVRKRGPSVTDKVFFDVR
FT                   IGDKDVGRIVIGLFGNVVPKTVENFVALATGEKGYGYKGSIFHRVIKDFMIQGGDFTAR
FT                   DGTGGMSIYGETFPDENFKLKHYGIGWVSMANAGPDTNGSQFFITLTKPTWLDGKHVVF
FT                   GKVLDGMTVVHSIELQATDGHDRPLTDCTIVNSGKIDVKTPFVVEVPDW"
FT   mRNA            complement(join(16086254..16086458,16092680..16092862))
FT                   /gene="Ppic"
FT                   /locus_tag="mCG_8356"
FT                   /product="peptidylprolyl isomerase C, transcript variant
FT                   mCT174169"
FT                   /note="gene_id=mCG8356.2 transcript_id=mCT174169.0 created
FT                   on 09-OCT-2002"
FT   CDS             complement(join(16086303..16086458,16092680..16092796))
FT                   /codon_start=1
FT                   /gene="Ppic"
FT                   /locus_tag="mCG_8356"
FT                   /product="peptidylprolyl isomerase C, isoform CRA_a"
FT                   /note="gene_id=mCG8356.2 transcript_id=mCT174169.0
FT                   protein_id=mCP97088.0 isoform=CRA_a"
FT                   /protein_id="EDL09909.1"
FT                   /translation="MSPGPRLLLPAVLCLGLGALVSSSGSSGVRKRGPSVTDKVFFDVR
FT                   IGDKDVGRIVIGLFGNVVPKTVENFVALATGEVCPSLTAFNREQV"
FT   gene            16121474..16240851
FT                   /locus_tag="mCG_125860"
FT                   /note="gene_id=mCG125860.1"
FT   mRNA            join(16121474..16121524,16136994..16137280,
FT                   16145664..16145964,16208301..16208428,16211885..16212009,
FT                   16223746..16224088,16233597..16233773,16240405..16240851)
FT                   /locus_tag="mCG_125860"
FT                   /product="mCG125860"
FT                   /note="gene_id=mCG125860.1 transcript_id=mCT127123.1
FT                   created on 09-OCT-2002"
FT   CDS             join(16121522..16121524,16136994..16137280,
FT                   16145664..16145964,16208301..16208428,16211885..16212009,
FT                   16223746..16224088,16233597..16233773,16240405..16240519)
FT                   /codon_start=1
FT                   /locus_tag="mCG_125860"
FT                   /product="mCG125860"
FT                   /note="gene_id=mCG125860.1 transcript_id=mCT127123.1
FT                   protein_id=mCP77960.1"
FT                   /protein_id="EDL09908.1"
FT                   /translation="MALAGLSALPVAQMPVFAPLAAAAVAAEPLPPKDLCLGASAGPGP
FT                   AKCGGGGGSVGDGRGVPRFRCSAEELDYYLYGQQRMEIIPLNQHTSDPNNRTMCADNRN
FT                   GECPMHGPLHSLRRLVGTSSAAAAAPPPELPEWLRDLPREVCLCTSTVPGLAYGICAAQ
FT                   RIQQGTWIGPFQGVLLSPEKVQTGVVRNTQHLWEIYDQDGTLQHFIDGGEPSKSSWMRY
FT                   IRCARHCGEQNLTVVQYRSNIFYRACIDIPRGTELLVWYNDSYTSFFGIPLQCIAQDEN
FT                   LNVPSTVMEAMCRQDALQPFNKSSKLSPSGQQRSVVFPQTPCSRNFSLLDKSGPMEAGF
FT                   NQINVKNQRVLASPTSTSQLHSEFSDWHLWKCGQCFKTFTQRILLQMHVCTQNPDRPYQ
FT                   CGHCSQSFSQPSELRNHVVTHSSDRPFKCGYCGRAFAGATTLNNHIRTHTGEKPFKCER
FT                   CERSFTQATQLSRHQRMPNECKPITESPESIEVD"
FT   gene            <16313900..16376592
FT                   /locus_tag="mCG_144599"
FT                   /note="gene_id=mCG144599.0"
FT   mRNA            join(<16313900..16314119,16364006..16364072,
FT                   16374572..16376592)
FT                   /locus_tag="mCG_144599"
FT                   /product="mCG144599"
FT                   /note="gene_id=mCG144599.0 transcript_id=mCT184023.0
FT                   created on 05-JUN-2003"
FT   gene            complement(16352897..>16415718)
FT                   /gene="AU016693"
FT                   /locus_tag="mCG_141305"
FT                   /note="gene_id=mCG141305.1"
FT   mRNA            complement(join(16352897..16354637,16357056..16357201,
FT                   16368709..16368849,16374294..16374416,16377992..16378153,
FT                   16380229..16380321,16384555..16384644,16385945..16386097,
FT                   16386181..16386277,16389627..16389809,16390396..16390545,
FT                   16392803..16392980,16394263..16394485,16395543..16395725,
FT                   16398673..16398870,16402217..16402365,16406753..16406894,
FT                   16409588..16409702,16411161..16411317,16415391..>16415439))
FT                   /gene="AU016693"
FT                   /locus_tag="mCG_141305"
FT                   /product="expressed sequence AU016693, transcript variant
FT                   mCT174468"
FT                   /note="gene_id=mCG141305.1 transcript_id=mCT174468.0
FT                   created on 08-OCT-2002"
FT   mRNA            complement(join(16352897..16354637,16357056..16357201,
FT                   16368751..16368849,16374294..16374416,16377992..16378676))
FT                   /gene="AU016693"
FT                   /locus_tag="mCG_141305"
FT                   /product="expressed sequence AU016693, transcript variant
FT                   mCT174469"
FT                   /note="gene_id=mCG141305.1 transcript_id=mCT174469.0
FT                   created on 08-OCT-2002"
FT   mRNA            complement(join(16352899..16354637,16357056..16357201,
FT                   16368751..16368849,16374294..16374416,16377992..16378153,
FT                   16380229..16380321,16384555..16384644,16385945..16386097,
FT                   16386181..16386277,16389627..16389809,16390396..16390545,
FT                   16392803..16392980,16394263..16394485,16395498..16395725,
FT                   16398673..16398870,16402217..16402365,16406753..16406894,
FT                   16409588..16409702,16411161..16411317,16415391..16415456,
FT                   16415597..>16415664))
FT                   /gene="AU016693"
FT                   /locus_tag="mCG_141305"
FT                   /product="expressed sequence AU016693, transcript variant
FT                   mCT190296"
FT                   /note="gene_id=mCG141305.1 transcript_id=mCT190296.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(16354406..16354637,16357056..16357201,
FT                   16368751..16368849,16374294..16374416,16377992..16378153,
FT                   16380229..16380321,16384555..16384644,16385945..16386097,
FT                   16386181..16386277,16389627..16389809,16390396..16390545,
FT                   16392803..16392980,16394263..16394485,16395498..16395725,
FT                   16398673..16398870,16402217..16402365,16406753..16406894,
FT                   16409588..16409702,16411161..16411317,16415391..16415456,
FT                   16415597..>16415618))
FT                   /codon_start=1
FT                   /gene="AU016693"
FT                   /locus_tag="mCG_141305"
FT                   /product="expressed sequence AU016693, isoform CRA_c"
FT                   /note="gene_id=mCG141305.1 transcript_id=mCT190296.0
FT                   protein_id=mCP111271.0 isoform=CRA_c"
FT                   /protein_id="EDL09904.1"
FT                   /translation="RLSRRQKDPAAATMVPKSDQLLIVVSILEGRHFPKRPKHLLVVEA
FT                   KFDGEQLATDPVDHTDQPEFATELAWEIDRKVLHQHRLQRTPIKLQCFALDPQTSAKET
FT                   VGYIVLDLRTAQETKQAPKWYQLLSNKYTKFKAEVQISLTLETDTKAQVDSYKAKAAPP
FT                   RDGKVLASLAGVDPKDIVAVLNEEGGYHQIGPAEHCTDPFILSVTIAFATQLEQLIPCT
FT                   MKLPERQPEFFFYYSLLGNDVTNEPFSDLINPNFEPERASVRIRSSVEILRVYLALHSK
FT                   LQIHLCCGDQSLGSTEIPLNGLLKKGSTEINQHPVTVEGAFTLDPPNRAKQKLAPVPLD
FT                   LAPTVGVSVALQREGIDSQSLIELKTQNGHEAEHSQKRVLTPIKEKTLTGPKSPRESPA
FT                   PPPPPNQTPPTKDDATESEVESLQYDKDPKPTVKGIGSVPASLAQPEATCGASEVVTSG
FT                   QKIAVPAASHHFCFSVDLRSVHDLELSFPVNCILRYSYPFFGSAAPIMTNPPVEVRKNM
FT                   EVFLPQSYCAFDFATMPHQLQDTFLRIPLLVELWHKDKMSKDLLLGVARIQLSNILSSE
FT                   KTRFLGANGEQCWRQTYSESVPVIAAQGSNNRILDLSYTMTLEDYGLVKMREIFVSESS
FT                   QGVPAVDQKPSSPPPAPCPSEIQMEPRETLEYKAALELEMWKEMQEDIFESQLKQKELA
FT                   HMQALAEEWKKRDRERESLVKKKVAEYSILEGKLQKALTELETREQQLASAEAELQRER
FT                   KELQLERERNLQELQDSVRRARDDCVYQVELERLKLKQLEEDKQRLQQQLNDAGNKYKT
FT                   LEKEFQQFKDQQNNKPEIRLQSEINLLTLEKVELERKLESATKSKLHYKQQWGRALKEL
FT                   ARLKQREQESQMARLKKQQEELEQMRLRYLAAEEKETVRTEQQELLDIRNELNRLRQQE
FT                   QNQYQDCKEIASGKLGSPRGSGLEEGLDDYLTRLIEERDTLMRTGVYNHEDRIISELDR
FT                   QIREVLTKNSAS"
FT   CDS             complement(join(16354406..16354637,16357056..16357201,
FT                   16368709..16368849,16374294..16374416,16377992..16378153,
FT                   16380229..16380321,16384555..16384644,16385945..16386097,
FT                   16386181..16386277,16389627..16389809,16390396..16390545,
FT                   16392803..16392980,16394263..16394485,16395543..16395725,
FT                   16398673..16398870,16402217..16402365,16406753..16406894,
FT                   16409588..16409702,16411161..16411317,16415391..16415439))
FT                   /codon_start=1
FT                   /gene="AU016693"
FT                   /locus_tag="mCG_141305"
FT                   /product="expressed sequence AU016693, isoform CRA_d"
FT                   /note="gene_id=mCG141305.1 transcript_id=mCT174468.0
FT                   protein_id=mCP97389.0 isoform=CRA_d"
FT                   /protein_id="EDL09905.1"
FT                   /translation="MVPKSDQLLIVVSILEGRHFPKRPKHLLVVEAKFDGEQLATDPVD
FT                   HTDQPEFATELAWEIDRKVLHQHRLQRTPIKLQCFALDPQTSAKETVGYIVLDLRTAQE
FT                   TKQAPKWYQLLSNKYTKFKAEVQISLTLETDTKAQVDSYKAKAAPPRDGKVLASLAGVD
FT                   PKDIVAVLNEEGGYHQIGPAEHCTDPFILSVTIAFATQLEQLIPCTMKLPERQPEFFFY
FT                   YSLLGNDVTNEPFSDLINPNFEPERASVRIRSSVEILRVYLALHSKLQIHLCCGDQSLG
FT                   STEIPLNGLLKKGSTEINQHPVTVEGAFTLDPPNRAKQKLAPVPLDLAPTSLIELKTQN
FT                   GHEAEHSQKRVLTPIKEKTLTGPKSPRESPAPPPPPNQTPPTKDDATESEVESLQYDKD
FT                   PKPTVKGIGSVPASLAQPEATCGASEVVTSGQKIAVPAASHHFCFSVDLRSVHDLELSF
FT                   PVNCILRYSYPFFGSAAPIMTNPPVEVRKNMEVFLPQSYCAFDFATMPHQLQDTFLRIP
FT                   LLVELWHKDKMSKDLLLGVARIQLSNILSSEKTRFLGANGEQCWRQTYSESVPVIAAQG
FT                   SNNRILDLSYTMTLEDYGLVKMREIFVSESSQGVPAVDQKPSSPPPAPCPSEIQMEPRE
FT                   TLEYKAALELEMWKEMQEDIFESQLKQKELAHMQALAEEWKKRDRERESLVKKKVAEYS
FT                   ILEGKLQKALTELETREQQLASAEAELQRERKELQLERERNLQELQDSVRRARDDCVYQ
FT                   VELERLKLKQLEEDKQRLQQQLNDAGNKYKTLEKEFQQFKDQQNNKPEIRLQSEINLLT
FT                   LEKVELERKLESATKSKLHYKQQWGRALKELARLKQVRGREQTLSSLRSFREQESQMAR
FT                   LKKQQEELEQMRLRYLAAEEKETVRTEQQELLDIRNELNRLRQQEQNQYQDCKEIASGK
FT                   LGSPRGSGLEEGLDDYLTRLIEERDTLMRTGVYNHEDRIISELDRQIREVLTKNSAS"
FT   CDS             complement(join(16354406..16354637,16357056..16357183))
FT                   /codon_start=1
FT                   /gene="AU016693"
FT                   /locus_tag="mCG_141305"
FT                   /product="expressed sequence AU016693, isoform CRA_a"
FT                   /note="gene_id=mCG141305.1 transcript_id=mCT174469.0
FT                   protein_id=mCP97387.0 isoform=CRA_a"
FT                   /protein_id="EDL09902.1"
FT                   /translation="MARLKKQQEELEQMRLRYLAAEEKETVRTEQQELLDIRNELNRLR
FT                   QQEQNQYQDCKEIASGKLGSPRGSGLEEGLDDYLTRLIEERDTLMRTGVYNHEDRIISE
FT                   LDRQIREVLTKNSAS"
FT   mRNA            complement(join(16356668..16357201,16368751..16368849,
FT                   16374294..16374416,16377992..16378153,16380229..16380321,
FT                   16384555..16384644,16385945..16386097,16386181..16386277,
FT                   16389627..16389809,16390396..16390545,16392803..16392980,
FT                   16394263..16394485,16395498..16395725,16398673..16398870,
FT                   16402217..16402365,16406753..16406894,16409588..16409702,
FT                   16411161..16411317,16415391..16415456,16415597..>16415718))
FT                   /gene="AU016693"
FT                   /locus_tag="mCG_141305"
FT                   /product="expressed sequence AU016693, transcript variant
FT                   mCT190295"
FT                   /note="gene_id=mCG141305.1 transcript_id=mCT190295.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(16357001..16357201,16368751..16368849,
FT                   16374294..16374416,16377992..16378153,16380229..16380321,
FT                   16384555..16384644,16385945..16386097,16386181..16386277,
FT                   16389627..16389809,16390396..16390545,16392803..16392980,
FT                   16394263..16394485,16395498..16395725,16398673..16398870,
FT                   16402217..16402365,16406753..16406894,16409588..16409702,
FT                   16411161..16411317,16415391..16415456,16415597..>16415618))
FT                   /codon_start=1
FT                   /gene="AU016693"
FT                   /locus_tag="mCG_141305"
FT                   /product="expressed sequence AU016693, isoform CRA_b"
FT                   /note="gene_id=mCG141305.1 transcript_id=mCT190295.0
FT                   protein_id=mCP111270.0 isoform=CRA_b"
FT                   /protein_id="EDL09903.1"
FT                   /translation="RLSRRQKDPAAATMVPKSDQLLIVVSILEGRHFPKRPKHLLVVEA
FT                   KFDGEQLATDPVDHTDQPEFATELAWEIDRKVLHQHRLQRTPIKLQCFALDPQTSAKET
FT                   VGYIVLDLRTAQETKQAPKWYQLLSNKYTKFKAEVQISLTLETDTKAQVDSYKAKAAPP
FT                   RDGKVLASLAGVDPKDIVAVLNEEGGYHQIGPAEHCTDPFILSVTIAFATQLEQLIPCT
FT                   MKLPERQPEFFFYYSLLGNDVTNEPFSDLINPNFEPERASVRIRSSVEILRVYLALHSK
FT                   LQIHLCCGDQSLGSTEIPLNGLLKKGSTEINQHPVTVEGAFTLDPPNRAKQKLAPVPLD
FT                   LAPTVGVSVALQREGIDSQSLIELKTQNGHEAEHSQKRVLTPIKEKTLTGPKSPRESPA
FT                   PPPPPNQTPPTKDDATESEVESLQYDKDPKPTVKGIGSVPASLAQPEATCGASEVVTSG
FT                   QKIAVPAASHHFCFSVDLRSVHDLELSFPVNCILRYSYPFFGSAAPIMTNPPVEVRKNM
FT                   EVFLPQSYCAFDFATMPHQLQDTFLRIPLLVELWHKDKMSKDLLLGVARIQLSNILSSE
FT                   KTRFLGANGEQCWRQTYSESVPVIAAQGSNNRILDLSYTMTLEDYGLVKMREIFVSESS
FT                   QGVPAVDQKPSSPPPAPCPSEIQMEPRETLEYKAALELEMWKEMQEDIFESQLKQKELA
FT                   HMQALAEEWKKRDRERESLVKKKVAEYSILEGKLQKALTELETREQQLASAEAELQRER
FT                   KELQLERERNLQELQDSVRRARDDCVYQVELERLKLKQLEEDKQRLQQQLNDAGNKYKT
FT                   LEKEFQQFKDQQNNKPEIRLQSEINLLTLEKVELERKLESATKSKLHYKQQWGRALKEL
FT                   ARLKQREQESQMARLKKQQEELEQMRLRYLAAEEKETVRTEQQELLDIRNELNRYCPYN
FT                   HSFSHQHRSDSQ"
FT   CDS             <16375444..16375737
FT                   /codon_start=1
FT                   /locus_tag="mCG_144599"
FT                   /product="mCG144599"
FT                   /note="gene_id=mCG144599.0 transcript_id=mCT184023.0
FT                   protein_id=mCP106242.0"
FT                   /protein_id="EDL09907.1"
FT                   /translation="LRSSHRLTGWADSEHEASPCLYLPAQGRQSISTRPSTLLRHLDPH
FT                   PGRNVCLAHTVSDRDMFLAPLLYLNKKYTNSKCIGFFTTHGHYHKRLPLLQL"
FT   mRNA            complement(join(16395338..16395725,16398673..16398870,
FT                   16402217..16402365,16406753..16406894,16409588..16409702,
FT                   16411161..16411317,16415391..16415456,16415597..16415673))
FT                   /gene="AU016693"
FT                   /locus_tag="mCG_141305"
FT                   /product="expressed sequence AU016693, transcript variant
FT                   mCT174470"
FT                   /note="gene_id=mCG141305.1 transcript_id=mCT174470.0
FT                   created on 08-OCT-2002"
FT   CDS             complement(join(16395438..16395725,16398673..16398870,
FT                   16402217..16402365,16406753..16406894,16409588..16409702,
FT                   16411161..16411317,16415391..16415439))
FT                   /codon_start=1
FT                   /gene="AU016693"
FT                   /locus_tag="mCG_141305"
FT                   /product="expressed sequence AU016693, isoform CRA_e"
FT                   /note="gene_id=mCG141305.1 transcript_id=mCT174470.0
FT                   protein_id=mCP97388.0 isoform=CRA_e"
FT                   /protein_id="EDL09906.1"
FT                   /translation="MVPKSDQLLIVVSILEGRHFPKRPKHLLVVEAKFDGEQLATDPVD
FT                   HTDQPEFATELAWEIDRKVLHQHRLQRTPIKLQCFALDPQTSAKETVGYIVLDLRTAQE
FT                   TKQAPKWYQLLSNKYTKFKAEVQISLTLETDTKAQVDSYKAKAAPPRDGKVLASLAGVD
FT                   PKDIVAVLNEEGGYHQIGPAEHCTDPFILSVTIAFATQLEQLIPCTMKLPERQPEFFFY
FT                   YSLLGNDVTNEPFSDLINPNFEPERASVRIRSSVEILRVYLALHSKLQIHLCCGDQSLG
FT                   STEIPLNGLLKKGSTEINQHPVTVEGAFTLDPPNRAKQKLAPVPLDLAPTVGVSVALQR
FT                   EGIDSQAGGDSAFTCQFSHARDDKR"
FT   gene            16555409..16615394
FT                   /gene="Csnk1g3"
FT                   /locus_tag="mCG_8359"
FT                   /note="gene_id=mCG8359.1"
FT   mRNA            join(16555409..16555813,16562712..16562752,
FT                   16566455..16566524,16576870..16577018,16578775..16579009,
FT                   16589927..16590012,16590136..16590220,16592049..16592197,
FT                   16593309..16593404,16596712..16596807,16607908..16608014,
FT                   16608505..16608528,16613106..16615394)
FT                   /gene="Csnk1g3"
FT                   /locus_tag="mCG_8359"
FT                   /product="casein kinase 1, gamma 3, transcript variant
FT                   mCT174170"
FT                   /note="gene_id=mCG8359.1 transcript_id=mCT174170.0 created
FT                   on 08-OCT-2002"
FT   mRNA            join(16555546..16555813,16562712..16562752,
FT                   16566455..16566524,16576870..16577018,16578775..16579009,
FT                   16589927..16590012,16590136..16590220,16592049..16592197,
FT                   16593309..16593404,16607908..16608014,16608505..16608528,
FT                   16613106..16615394)
FT                   /gene="Csnk1g3"
FT                   /locus_tag="mCG_8359"
FT                   /product="casein kinase 1, gamma 3, transcript variant
FT                   mCT7429"
FT                   /note="gene_id=mCG8359.1 transcript_id=mCT7429.2 created on
FT                   08-OCT-2002"
FT   mRNA            join(16555546..16555813,16562712..16562752,
FT                   16566455..16566524,16576870..16577018,16578775..16579009,
FT                   16589927..16590012,16590136..16590220,16592049..16592197,
FT                   16593309..16593404,16607908..16608014,16613106..16615394)
FT                   /gene="Csnk1g3"
FT                   /locus_tag="mCG_8359"
FT                   /product="casein kinase 1, gamma 3, transcript variant
FT                   mCT174171"
FT                   /note="gene_id=mCG8359.1 transcript_id=mCT174171.0 created
FT                   on 08-OCT-2002"
FT   CDS             join(16555636..16555813,16562712..16562752,
FT                   16566455..16566524,16576870..16577018,16578775..16579009,
FT                   16589927..16590012,16590136..16590220,16592049..16592197,
FT                   16593309..16593404,16596712..16596807,16607908..16608014,
FT                   16608505..16608528,16613106..16613160)
FT                   /codon_start=1
FT                   /gene="Csnk1g3"
FT                   /locus_tag="mCG_8359"
FT                   /product="casein kinase 1, gamma 3, isoform CRA_a"
FT                   /note="gene_id=mCG8359.1 transcript_id=mCT174170.0
FT                   protein_id=mCP97090.0 isoform=CRA_a"
FT                   /protein_id="EDL09899.1"
FT                   /translation="MDNKKKDKDKSDDRMARPSGRSGHSTRGTGSSSSGVLMVGPNFRV
FT                   GKKIGCGNFGELRLGKNLYTNEYVAIKLEPMKSRAPQLHLEYRFYKQLGSGDGIPQVYY
FT                   FGPCGKYNAMVLELLGPSLEDLFDLCDRTFSLKTVLMIAIQLISRMEYVHSKNLIYRDV
FT                   KPENFLIGRPGNKAQQVIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHL
FT                   GKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCENFP
FT                   EEMATYLRYVRRLDFFEKPDYDYLRKLFTDLFDRKGYMFDYEYDWIGKQLPTPVGAVQQ
FT                   DPALSSNREAHQHRDKIQQSKNQSADHRAAWDSQQANPHHLRAHLAADRHGGSVQVVSS
FT                   TNGELNTDDPTAGRSNAPITAPTEVEVMDETNCQKVLNMWCCCFFKRRKRKTIQRHK"
FT   CDS             join(16555636..16555813,16562712..16562752,
FT                   16566455..16566524,16576870..16577018,16578775..16579009,
FT                   16589927..16590012,16590136..16590220,16592049..16592197,
FT                   16593309..16593404,16607908..16608014,16608505..16608528,
FT                   16613106..16613160)
FT                   /codon_start=1
FT                   /gene="Csnk1g3"
FT                   /locus_tag="mCG_8359"
FT                   /product="casein kinase 1, gamma 3, isoform CRA_b"
FT                   /note="gene_id=mCG8359.1 transcript_id=mCT7429.2
FT                   protein_id=mCP21503.2 isoform=CRA_b"
FT                   /protein_id="EDL09900.1"
FT                   /translation="MDNKKKDKDKSDDRMARPSGRSGHSTRGTGSSSSGVLMVGPNFRV
FT                   GKKIGCGNFGELRLGKNLYTNEYVAIKLEPMKSRAPQLHLEYRFYKQLGSGDGIPQVYY
FT                   FGPCGKYNAMVLELLGPSLEDLFDLCDRTFSLKTVLMIAIQLISRMEYVHSKNLIYRDV
FT                   KPENFLIGRPGNKAQQVIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHL
FT                   GKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCENFP
FT                   EEMATYLRYVRRLDFFEKPDYDYLRKLFTDLFDRKGYMFDYEYDWIGKQLPTPVGAVQQ
FT                   DPALSSNREAHQHRDKIQQSKNQVVSSTNGELNTDDPTAGRSNAPITAPTEVEVMDETN
FT                   CQKVLNMWCCCFFKRRKRKTIQRHK"
FT   CDS             join(16555636..16555813,16562712..16562752,
FT                   16566455..16566524,16576870..16577018,16578775..16579009,
FT                   16589927..16590012,16590136..16590220,16592049..16592197,
FT                   16593309..16593404,16607908..16608014,16613106..16613160)
FT                   /codon_start=1
FT                   /gene="Csnk1g3"
FT                   /locus_tag="mCG_8359"
FT                   /product="casein kinase 1, gamma 3, isoform CRA_c"
FT                   /note="gene_id=mCG8359.1 transcript_id=mCT174171.0
FT                   protein_id=mCP97089.0 isoform=CRA_c"
FT                   /protein_id="EDL09901.1"
FT                   /translation="MDNKKKDKDKSDDRMARPSGRSGHSTRGTGSSSSGVLMVGPNFRV
FT                   GKKIGCGNFGELRLGKNLYTNEYVAIKLEPMKSRAPQLHLEYRFYKQLGSGDGIPQVYY
FT                   FGPCGKYNAMVLELLGPSLEDLFDLCDRTFSLKTVLMIAIQLISRMEYVHSKNLIYRDV
FT                   KPENFLIGRPGNKAQQVIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHL
FT                   GKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCENFP
FT                   EEMATYLRYVRRLDFFEKPDYDYLRKLFTDLFDRKGYMFDYEYDWIGKQLPTPVGAVQQ
FT                   DPALSSNREAHQHRDKIQQSKNQVVSSTNGELNTDDPTAGRSNAPITAPTEVEVMDETK
FT                   CCCFFKRRKRKTIQRHK"
FT   gene            16644123..16645241
FT                   /pseudo
FT                   /locus_tag="mCG_8357"
FT                   /note="gene_id=mCG8357.1"
FT   mRNA            16644123..16645241
FT                   /pseudo
FT                   /locus_tag="mCG_8357"
FT                   /note="gene_id=mCG8357.1 transcript_id=mCT7427.1 created on
FT                   08-OCT-2002"
FT   gene            complement(16690357..16691541)
FT                   /pseudo
FT                   /locus_tag="mCG_8353"
FT                   /note="gene_id=mCG8353.2"
FT   mRNA            complement(join(16690357..16690469,16690539..16690841,
FT                   16690876..16691541))
FT                   /pseudo
FT                   /locus_tag="mCG_8353"
FT                   /note="gene_id=mCG8353.2 transcript_id=mCT7428.2 created on
FT                   22-OCT-2002"
FT   gene            17071549..>17072082
FT                   /locus_tag="mCG_1033306"
FT                   /note="gene_id=mCG1033306.1"
FT   mRNA            17071549..>17072082
FT                   /locus_tag="mCG_1033306"
FT                   /product="mCG1033306"
FT                   /note="gene_id=mCG1033306.1 transcript_id=mCT151010.1
FT                   created on 17-OCT-2002"
FT   CDS             17071591..>17072082
FT                   /codon_start=1
FT                   /locus_tag="mCG_1033306"
FT                   /product="mCG1033306"
FT                   /note="gene_id=mCG1033306.1 transcript_id=mCT151010.1
FT                   protein_id=mCP77502.1"
FT                   /protein_id="EDL09898.1"
FT                   /translation="MLRLPTVLRQMRPVSRALAPHLTRAYAKDVKFGADARALMLQGVD
FT                   LLADAVAVTMGPKGRTVIIEQSWGSPKVTKDGVTVAKSIDLKDKYKNIGAKLVQDVANN
FT                   TNEEAGDGTTTATVLARSIAKEGFEKISKGANPVEIRRGVMLAVDAVIAELKKQSKPVT
FT                   T"
FT   gene            <17077910..17108462
FT                   /locus_tag="mCG_145140"
FT                   /note="gene_id=mCG145140.0"
FT   mRNA            join(<17077910..17078177,17105310..17105416,
FT                   17107062..17108462)
FT                   /locus_tag="mCG_145140"
FT                   /product="mCG145140"
FT                   /note="gene_id=mCG145140.0 transcript_id=mCT184564.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<17105348..17105416,17107062..17107259)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145140"
FT                   /product="mCG145140"
FT                   /note="gene_id=mCG145140.0 transcript_id=mCT184564.0
FT                   protein_id=mCP106252.0"
FT                   /protein_id="EDL09897.1"
FT                   /translation="AFGLSWEDPERMTWPEDCPILHEEGRMSLTLHPECQLHFHPVLKK
FT                   YHAHPDSPGQTNTVETHWMHSEGSLIMKNEMPSSICRKMLRVP"
FT   gene            complement(17150383..17152280)
FT                   /locus_tag="mCG_147294"
FT                   /note="gene_id=mCG147294.0"
FT   mRNA            complement(join(17150383..17151342,17151918..17152280))
FT                   /locus_tag="mCG_147294"
FT                   /product="mCG147294"
FT                   /note="gene_id=mCG147294.0 transcript_id=mCT187557.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(17151090..17151212)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147294"
FT                   /product="mCG147294"
FT                   /note="gene_id=mCG147294.0 transcript_id=mCT187557.0
FT                   protein_id=mCP109681.0"
FT                   /protein_id="EDL09896.1"
FT                   /translation="MGDAKMETLSLEKIRWDLISYIWNIFMIRVDFRWDILGSH"
FT   gene            <17267774..17295884
FT                   /locus_tag="mCG_145139"
FT                   /note="gene_id=mCG145139.0"
FT   mRNA            join(<17267774..17267945,17292196..17292587,
FT                   17294608..17295884)
FT                   /locus_tag="mCG_145139"
FT                   /product="mCG145139"
FT                   /note="gene_id=mCG145139.0 transcript_id=mCT184563.0
FT                   created on 05-JUN-2003"
FT   CDS             <17295275..17295622
FT                   /codon_start=1
FT                   /locus_tag="mCG_145139"
FT                   /product="mCG145139"
FT                   /note="gene_id=mCG145139.0 transcript_id=mCT184563.0
FT                   protein_id=mCP106251.0"
FT                   /protein_id="EDL09895.1"
FT                   /translation="IDRAGCICLVICACVKVCVFITFLMFKKRSTIWKKTDNIGTLDEG
FT                   LTSGSFYQCPCSLIYSGNCPAANLKHIPKCTEKLDQVDFKSCQGQKQQQSQTRIPEETE
FT                   SDLHLSHLCLG"
FT   gene            complement(17547176..17652321)
FT                   /locus_tag="mCG_8951"
FT                   /note="gene_id=mCG8951.2"
FT   mRNA            complement(join(17547176..17548208,17548941..17549022,
FT                   17550877..17551030,17553554..17553726,17554323..17554740,
FT                   17556268..17558722,17559292..17559379,17606417..17606672,
FT                   17647414..17648509,17652009..17652321))
FT                   /locus_tag="mCG_8951"
FT                   /product="mCG8951, transcript variant mCT171633"
FT                   /note="gene_id=mCG8951.2 transcript_id=mCT171633.0 created
FT                   on 08-OCT-2002"
FT   mRNA            complement(join(17547176..17548208,17548941..17549022,
FT                   17550877..17551030,17553554..17553726,17554323..17554740,
FT                   17556268..17558722,17559292..17559379,17606417..17606672,
FT                   17647414..17648509,17649629..17649981))
FT                   /locus_tag="mCG_8951"
FT                   /product="mCG8951, transcript variant mCT8853"
FT                   /note="gene_id=mCG8951.2 transcript_id=mCT8853.2 created on
FT                   08-OCT-2002"
FT   mRNA            complement(join(17547208..17548208,17548941..17549022,
FT                   17550877..17551030,17553554..17553726,17554323..17554740,
FT                   17556268..17558722,17559292..17559379,17606417..17606672,
FT                   17616357..17616526))
FT                   /locus_tag="mCG_8951"
FT                   /product="mCG8951, transcript variant mCT174172"
FT                   /note="gene_id=mCG8951.2 transcript_id=mCT174172.0 created
FT                   on 08-OCT-2002"
FT   mRNA            complement(join(17547866..17548208,17548941..17549022,
FT                   17550877..17551030,17553554..17553726,17554323..17554740,
FT                   17556268..17558722,17559292..17559379,17647414..17648509,
FT                   17652009..>17652284))
FT                   /locus_tag="mCG_8951"
FT                   /product="mCG8951, transcript variant mCT190292"
FT                   /note="gene_id=mCG8951.2 transcript_id=mCT190292.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(17548202..17548208,17548941..17549022,
FT                   17550877..17551030,17553554..17553726,17554323..17554740,
FT                   17556268..17558722,17559292..17559379,17606417..17606672,
FT                   17647414..17648316))
FT                   /codon_start=1
FT                   /locus_tag="mCG_8951"
FT                   /product="mCG8951, isoform CRA_a"
FT                   /note="gene_id=mCG8951.2 transcript_id=mCT171633.0
FT                   protein_id=mCP94552.0 isoform=CRA_a"
FT                   /db_xref="GOA:B9EKR3"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="MGI:MGI:2442338"
FT                   /db_xref="UniProtKB/TrEMBL:B9EKR3"
FT                   /protein_id="EDL09891.1"
FT                   /translation="MSVNVSTAGKGVDPNTVDTYDSGDDWEIGVGNLIIDLDADLEKDR
FT                   QKFEMNNSTNTTTNTTKDCGGPASNGTCSTSALADGLKFASVQPSAPQGNSHKETSKSK
FT                   VKRAKTSKDANKSLPSAALYGIPEISSTGKRQEVQGRPGEATGMNSALGQSVSGGGSSN
FT                   PNSNGTSTGTSAATAGAGSCGKSKEEKPGKSHSSRGAKRDKDAARSRKEKHDLLQGHQN
FT                   GGGGQAPSGGHLYGFGTKSNGSGASPFHCGGAGSGSVGAAGEVSKTAPDSTLMGNSMLV
FT                   KKEEEEEESHRRIKKLKTEKVDPLFTVPAPPPPIASSLAPQIPPSYFPPSSSNIAAPVE
FT                   QLLVRTRSVGVNTCEVGVVTEPECLGPCEPGTSVNLEGIVWHETEEGVLVVNVTWRNKT
FT                   YVGTLLDCTKHDWAPPRFCESPTSDLEMRGGRGRGKRARSAAAAPGSEVSFTESRGLQS
FT                   KNRGGANGKGRRGSLNASGRRTPPNCAAEDIKASPSSTNKRKNKPPMELDLNSSSEDSK
FT                   PGKRVRTNSRSTPTTPQGKPETTFLDQGCSSPVLIDCPHPNCNKKYKHINGLRYHQAHA
FT                   HLDPENKLEFEPDSEDKISDCEEALSNVALECNESSTSVSSYDQTKAPGSPGAGNPPGT
FT                   PKGKREHVSNGPGPIIGSKTGKNSGKKRGLNNELNNLPVISNMTAALDICSATDSNLTA
FT                   EMPKLEAEGLIDKKSLGDKEKGKKANNCKMDKNLSKLKSARPIAPAPAPTPPQLIAIPT
FT                   AAFTSTTTGTIPGLPSLTTTVVQATPKSPPLKPIQPKPTIMGEPITVNPALVSLKDRKK
FT                   KEKRKLKDKEGKETGGPKMDAKLGKLEEAKAASKDLSGHFLKDHLGKSEGLANGLSESQ
FT                   ESRMASIKAEADKVYTFTDNAPSPSIGSASRMECSTLVNGQAPMAPLHVLTQNGAESAA
FT                   AKTSSPAYSDISDAADDGGSDSRSEGMRSKASSPSDTFSNKDGVVKGHPSTSAQPSQLK
FT                   ESHSPYYHGYEPYYSPSYMHPGQVGAPAAGNGGSTQGMKIKKESEEDAEKKDKAEQLES
FT                   KKVDHTSAPLQPQHQSVITQRHPALAQSLYYGQYAYGLYMDQKSLMATSPAYRQQYEKY
FT                   YEDQRLAEQKMAQSGRGDCERKAELPLKELGKEDNKQKNMPSATISKAPSTPEPNKNHS
FT                   KLGPSVPNKTEETGKSQLLSSHQQQLQADSFKAKQMENHQLIKEAVEMKSVMDSMKQTG
FT                   VDPTSRFKQDPESRTWHHYVYQPKYLDQQKPEELDREKKLKEDSPRKTPNKESGVSSLP
FT                   VSLTNIKEEPKEGKRPDSQSVEENKLKNDDRKTPVNWKDSRGTRVAVSSPMSQHQSYIQ
FT                   YLHAYPYPQMYDPSHPAYRAVSPVLMHSYPGAYLSPGFHYPVYGKMSGREEAEKVNTSP
FT                   SINTKTASEAKALDLLQHHANQYRSKSPAPVEKASTEREREAERERDRHSPFSQRHLHT
FT                   HHHTHVGMGYPLIPGQYDPFQGLTSAALVASQQVAAQASASGMFPAQRRE"
FT   CDS             complement(join(17548202..17548208,17548941..17549022,
FT                   17550877..17551030,17553554..17553726,17554323..17554740,
FT                   17556268..17558722,17559292..17559379,17606417..17606672,
FT                   17647414..17648316))
FT                   /codon_start=1
FT                   /locus_tag="mCG_8951"
FT                   /product="mCG8951, isoform CRA_a"
FT                   /note="gene_id=mCG8951.2 transcript_id=mCT8853.2
FT                   protein_id=mCP21540.2 isoform=CRA_a"
FT                   /db_xref="GOA:B9EKR3"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="MGI:MGI:2442338"
FT                   /db_xref="UniProtKB/TrEMBL:B9EKR3"
FT                   /protein_id="EDL09894.1"
FT                   /translation="MSVNVSTAGKGVDPNTVDTYDSGDDWEIGVGNLIIDLDADLEKDR
FT                   QKFEMNNSTNTTTNTTKDCGGPASNGTCSTSALADGLKFASVQPSAPQGNSHKETSKSK
FT                   VKRAKTSKDANKSLPSAALYGIPEISSTGKRQEVQGRPGEATGMNSALGQSVSGGGSSN
FT                   PNSNGTSTGTSAATAGAGSCGKSKEEKPGKSHSSRGAKRDKDAARSRKEKHDLLQGHQN
FT                   GGGGQAPSGGHLYGFGTKSNGSGASPFHCGGAGSGSVGAAGEVSKTAPDSTLMGNSMLV
FT                   KKEEEEEESHRRIKKLKTEKVDPLFTVPAPPPPIASSLAPQIPPSYFPPSSSNIAAPVE
FT                   QLLVRTRSVGVNTCEVGVVTEPECLGPCEPGTSVNLEGIVWHETEEGVLVVNVTWRNKT
FT                   YVGTLLDCTKHDWAPPRFCESPTSDLEMRGGRGRGKRARSAAAAPGSEVSFTESRGLQS
FT                   KNRGGANGKGRRGSLNASGRRTPPNCAAEDIKASPSSTNKRKNKPPMELDLNSSSEDSK
FT                   PGKRVRTNSRSTPTTPQGKPETTFLDQGCSSPVLIDCPHPNCNKKYKHINGLRYHQAHA
FT                   HLDPENKLEFEPDSEDKISDCEEALSNVALECNESSTSVSSYDQTKAPGSPGAGNPPGT
FT                   PKGKREHVSNGPGPIIGSKTGKNSGKKRGLNNELNNLPVISNMTAALDICSATDSNLTA
FT                   EMPKLEAEGLIDKKSLGDKEKGKKANNCKMDKNLSKLKSARPIAPAPAPTPPQLIAIPT
FT                   AAFTSTTTGTIPGLPSLTTTVVQATPKSPPLKPIQPKPTIMGEPITVNPALVSLKDRKK
FT                   KEKRKLKDKEGKETGGPKMDAKLGKLEEAKAASKDLSGHFLKDHLGKSEGLANGLSESQ
FT                   ESRMASIKAEADKVYTFTDNAPSPSIGSASRMECSTLVNGQAPMAPLHVLTQNGAESAA
FT                   AKTSSPAYSDISDAADDGGSDSRSEGMRSKASSPSDTFSNKDGVVKGHPSTSAQPSQLK
FT                   ESHSPYYHGYEPYYSPSYMHPGQVGAPAAGNGGSTQGMKIKKESEEDAEKKDKAEQLES
FT                   KKVDHTSAPLQPQHQSVITQRHPALAQSLYYGQYAYGLYMDQKSLMATSPAYRQQYEKY
FT                   YEDQRLAEQKMAQSGRGDCERKAELPLKELGKEDNKQKNMPSATISKAPSTPEPNKNHS
FT                   KLGPSVPNKTEETGKSQLLSSHQQQLQADSFKAKQMENHQLIKEAVEMKSVMDSMKQTG
FT                   VDPTSRFKQDPESRTWHHYVYQPKYLDQQKPEELDREKKLKEDSPRKTPNKESGVSSLP
FT                   VSLTNIKEEPKEGKRPDSQSVEENKLKNDDRKTPVNWKDSRGTRVAVSSPMSQHQSYIQ
FT                   YLHAYPYPQMYDPSHPAYRAVSPVLMHSYPGAYLSPGFHYPVYGKMSGREEAEKVNTSP
FT                   SINTKTASEAKALDLLQHHANQYRSKSPAPVEKASTEREREAERERDRHSPFSQRHLHT
FT                   HHHTHVGMGYPLIPGQYDPFQGLTSAALVASQQVAAQASASGMFPAQRRE"
FT   CDS             complement(join(17548202..17548208,17548941..17549022,
FT                   17550877..17551030,17553554..17553726,17554323..17554740,
FT                   17556268..17558722,17559292..17559379,17647414..>17647417))
FT                   /codon_start=1
FT                   /locus_tag="mCG_8951"
FT                   /product="mCG8951, isoform CRA_c"
FT                   /note="gene_id=mCG8951.2 transcript_id=mCT190292.0
FT                   protein_id=mCP111294.0 isoform=CRA_c"
FT                   /protein_id="EDL09893.1"
FT                   /translation="EGVLVVNVTWRNKTYVGTLLDCTKHDWAPPRFCESPTSDLEMRGG
FT                   RGRGKRARSAAAAPGSEVSFTESRGLQSKNRGGANGKGRRGSLNASGRRTPPNCAAEDI
FT                   KASPSSTNKRKNKPPMELDLNSSSEDSKPGKRVRTNSRSTPTTPQGKPETTFLDQGCSS
FT                   PVLIDCPHPNCNKKYKHINGLRYHQAHAHLDPENKLEFEPDSEDKISDCEEALSNVALE
FT                   CNESSTSVSSYDQTKAPGSPGAGNPPGTPKGKREHVSNGPGPIIGSKTGKNSGKKRGLN
FT                   NELNNLPVISNMTAALDICSATDSNLTAEMPKLEAEGLIDKKSLGDKEKGKKANNCKMD
FT                   KNLSKLKSARPIAPAPAPTPPQLIAIPTAAFTSTTTGTIPGLPSLTTTVVQATPKSPPL
FT                   KPIQPKPTIMGEPITVNPALVSLKDRKKKEKRKLKDKEGKETGGPKMDAKLGKLEEAKA
FT                   ASKDLSGHFLKDHLGKSEGLANGLSESQESRMASIKAEADKVYTFTDNAPSPSIGSASR
FT                   MECSTLVNGQAPMAPLHVLTQNGAESAAAKTSSPAYSDISDAADDGGSDSRSEGMRSKA
FT                   SSPSDTFSNKDGVVKGHPSTSAQPSQLKESHSPYYHGYEPYYSPSYMHPGQVGAPAAGN
FT                   GGSTQGMKIKKESEEDAEKKDKAEQLESKKVDHTSAPLQPQHQSVITQRHPALAQSLYY
FT                   GQYAYGLYMDQKSLMATSPAYRQQYEKYYEDQRLAEQKMAQSGRGDCERKAELPLKELG
FT                   KEDNKQKNMPSATISKAPSTPEPNKNHSKLGPSVPNKTEETGKSQLLSSHQQQLQADSF
FT                   KAKQMENHQLIKEAVEMKSVMDSMKQTGVDPTSRFKQDPESRTWHHYVYQPKYLDQQKP
FT                   EELDREKKLKEDSPRKTPNKESGVSSLPVSLTNIKEEPKEGKRPDSQSVEENKLKNDDR
FT                   KTPVNWKDSRGTRVAVSSPMSQHQSYIQYLHAYPYPQMYDPSHPAYRAVSPVLMHSYPG
FT                   AYLSPGFHYPVYGKMSGREEAEKVNTSPSINTKTASEAKALDLLQHHANQYRSKSPAPV
FT                   EKASTEREREAERERDRHSPFSQRHLHTHHHTHVGMGYPLIPGQYDPFQGLTSAALVAS
FT                   QQVAAQASASGMFPAQRRE"
FT   CDS             complement(join(17548202..17548208,17548941..17549022,
FT                   17550877..17551030,17553554..17553726,17554323..17554740,
FT                   17556268..17558691))
FT                   /codon_start=1
FT                   /locus_tag="mCG_8951"
FT                   /product="mCG8951, isoform CRA_b"
FT                   /note="gene_id=mCG8951.2 transcript_id=mCT174172.0
FT                   protein_id=mCP97091.0 isoform=CRA_b"
FT                   /protein_id="EDL09892.1"
FT                   /translation="MRGGRGRGKRARSAAAAPGSEVSFTESRGLQSKNRGGANGKGRRG
FT                   SLNASGRRTPPNCAAEDIKASPSSTNKRKNKPPMELDLNSSSEDSKPGKRVRTNSRSTP
FT                   TTPQGKPETTFLDQGCSSPVLIDCPHPNCNKKYKHINGLRYHQAHAHLDPENKLEFEPD
FT                   SEDKISDCEEALSNVALECNESSTSVSSYDQTKAPGSPGAGNPPGTPKGKREHVSNGPG
FT                   PIIGSKTGKNSGKKRGLNNELNNLPVISNMTAALDICSATDSNLTAEMPKLEAEGLIDK
FT                   KSLGDKEKGKKANNCKMDKNLSKLKSARPIAPAPAPTPPQLIAIPTAAFTSTTTGTIPG
FT                   LPSLTTTVVQATPKSPPLKPIQPKPTIMGEPITVNPALVSLKDRKKKEKRKLKDKEGKE
FT                   TGGPKMDAKLGKLEEAKAASKDLSGHFLKDHLGKSEGLANGLSESQESRMASIKAEADK
FT                   VYTFTDNAPSPSIGSASRMECSTLVNGQAPMAPLHVLTQNGAESAAAKTSSPAYSDISD
FT                   AADDGGSDSRSEGMRSKASSPSDTFSNKDGVVKGHPSTSAQPSQLKESHSPYYHGYEPY
FT                   YSPSYMHPGQVGAPAAGNGGSTQGMKIKKESEEDAEKKDKAEQLESKKVDHTSAPLQPQ
FT                   HQSVITQRHPALAQSLYYGQYAYGLYMDQKSLMATSPAYRQQYEKYYEDQRLAEQKMAQ
FT                   SGRGDCERKAELPLKELGKEDNKQKNMPSATISKAPSTPEPNKNHSKLGPSVPNKTEET
FT                   GKSQLLSSHQQQLQADSFKAKQMENHQLIKEAVEMKSVMDSMKQTGVDPTSRFKQDPES
FT                   RTWHHYVYQPKYLDQQKPEELDREKKLKEDSPRKTPNKESGVSSLPVSLTNIKEEPKEG
FT                   KRPDSQSVEENKLKNDDRKTPVNWKDSRGTRVAVSSPMSQHQSYIQYLHAYPYPQMYDP
FT                   SHPAYRAVSPVLMHSYPGAYLSPGFHYPVYGKMSGREEAEKVNTSPSINTKTASEAKAL
FT                   DLLQHHANQYRSKSPAPVEKASTEREREAERERDRHSPFSQRHLHTHHHTHVGMGYPLI
FT                   PGQYDPFQGLTSAALVASQQVAAQASASGMFPAQRRE"
FT   gene            17720074..17742438
FT                   /locus_tag="mCG_147327"
FT                   /note="gene_id=mCG147327.0"
FT   mRNA            join(17720074..17720125,17739489..17742438)
FT                   /locus_tag="mCG_147327"
FT                   /product="mCG147327"
FT                   /note="gene_id=mCG147327.0 transcript_id=mCT187590.0
FT                   created on 13-JAN-2004"
FT   CDS             17739616..17739831
FT                   /codon_start=1
FT                   /locus_tag="mCG_147327"
FT                   /product="mCG147327"
FT                   /note="gene_id=mCG147327.0 transcript_id=mCT187590.0
FT                   protein_id=mCP109716.0"
FT                   /protein_id="EDL09890.1"
FT                   /translation="MVNYMLCLFYHCAILSWFCTWENPVFLKGLKTVSCFILFVCEYTV
FT                   TVFRHTERGHQISLQMVVSYPVVAGN"
FT   gene            complement(18492635..18493588)
FT                   /pseudo
FT                   /locus_tag="mCG_124916"
FT                   /note="gene_id=mCG124916.1"
FT   mRNA            complement(18492635..18493588)
FT                   /pseudo
FT                   /locus_tag="mCG_124916"
FT                   /note="gene_id=mCG124916.1 transcript_id=mCT126168.1
FT                   created on 08-OCT-2002"
FT   gene            18496238..18497649
FT                   /pseudo
FT                   /locus_tag="mCG_124917"
FT                   /note="gene_id=mCG124917.1"
FT   mRNA            18496238..18497649
FT                   /pseudo
FT                   /locus_tag="mCG_124917"
FT                   /note="gene_id=mCG124917.1 transcript_id=mCT126169.1
FT                   created on 08-OCT-2002"
FT   gene            18640080..18641100
FT                   /pseudo
FT                   /locus_tag="mCG_5422"
FT                   /note="gene_id=mCG5422.2"
FT   mRNA            18640080..18641100
FT                   /pseudo
FT                   /locus_tag="mCG_5422"
FT                   /note="gene_id=mCG5422.2 transcript_id=mCT4719.2 created on
FT                   08-OCT-2002"
FT   gene            19062512..19063051
FT                   /pseudo
FT                   /locus_tag="mCG_1033362"
FT                   /note="gene_id=mCG1033362.1"
FT   mRNA            19062512..19063051
FT                   /pseudo
FT                   /locus_tag="mCG_1033362"
FT                   /note="gene_id=mCG1033362.1 transcript_id=mCT151066.1
FT                   created on 10-MAR-2003"
FT   gene            19074654..19181365
FT                   /gene="Gramd3"
FT                   /locus_tag="mCG_16293"
FT                   /note="gene_id=mCG16293.1"
FT   mRNA            join(19074654..19074896,19106444..19106682,
FT                   19143849..19143968,19148335..19148446,19150919..19150985,
FT                   19153165..19153268,19156939..19157034,19162735..19162806,
FT                   19162899..19162979,19166274..19166385,19167138..19167260,
FT                   19168194..19168281,19169451..19169555,19174892..19174985,
FT                   19180157..19181365)
FT                   /gene="Gramd3"
FT                   /locus_tag="mCG_16293"
FT                   /product="GRAM domain containing 3, transcript variant
FT                   mCT17034"
FT                   /note="gene_id=mCG16293.1 transcript_id=mCT17034.2 created
FT                   on 08-OCT-2002"
FT   mRNA            join(19074654..19074896,19143849..19143968,
FT                   19148335..19148446,19150919..19150985,19153165..19153268,
FT                   19156939..19157034,19162735..19162806,19162899..19162979,
FT                   19166274..19166385,19167138..19167260,19168194..19168281,
FT                   19169451..19169555,19174892..19174985,19180157..19181365)
FT                   /gene="Gramd3"
FT                   /locus_tag="mCG_16293"
FT                   /product="GRAM domain containing 3, transcript variant
FT                   mCT174115"
FT                   /note="gene_id=mCG16293.1 transcript_id=mCT174115.0 created
FT                   on 08-OCT-2002"
FT   CDS             join(19074775..19074896,19143849..19143968,
FT                   19148335..19148446,19150919..19150985,19153165..19153268,
FT                   19156939..19157034,19162735..19162806,19162899..19162979,
FT                   19166274..19166385,19167138..19167260,19168194..19168281,
FT                   19169451..19169555,19174892..19174985,19180157..19180198)
FT                   /codon_start=1
FT                   /gene="Gramd3"
FT                   /locus_tag="mCG_16293"
FT                   /product="GRAM domain containing 3, isoform CRA_d"
FT                   /note="gene_id=mCG16293.1 transcript_id=mCT174115.0
FT                   protein_id=mCP97035.0 isoform=CRA_d"
FT                   /protein_id="EDL09888.1"
FT                   /translation="MVKKRLSSSDNVFKFEIPSNSKTSAEAPHSSTDSPSSVFLSSEAE
FT                   NGAEDRRRVSKSPTAQSPTSSVEAESPDQKRSLGLWSKSSFDGSSLLSDKNDCKTESKT
FT                   DSKTERKKSSSSSQYKANMHFHKLFLDVPTEEPLRQSFTCALQKEILYQGKLFVSENWI
FT                   CFHSKVFGKDTKISIPAFSVTLIKKTKTALLVPNALIIATVTDRYIFVSLLSRDSTYKL
FT                   IKSVCGHLEKTSVGNSPNPSSAENSFRADRPSSLPLDFNDEFSDLDGVVRQRRQDLEGY
FT                   SSSGSQTPESENSRDFHVTESQTVLNVTKGETKPPRTDAHGSRAPDGKAKILPAHGQSE
FT                   TIGILHKMESRKCPTLHHILIVYAIIVCALIISTFYMRYRINTLEERLGTLTSIMDPHS
FT                   TEQTAPSGLGSQMQLNVEVLCQELTANIVKLEKIQNNLQKLLENGD"
FT   CDS             join(19074806..19074896,19106444..19106682,
FT                   19143849..19143860)
FT                   /codon_start=1
FT                   /gene="Gramd3"
FT                   /locus_tag="mCG_16293"
FT                   /product="GRAM domain containing 3, isoform CRA_a"
FT                   /note="gene_id=mCG16293.1 transcript_id=mCT17034.2
FT                   protein_id=mCP21476.1 isoform=CRA_a"
FT                   /protein_id="EDL09885.1"
FT                   /translation="MCSSSRSPATRRPVLRPHTAPLTAQAPCFSAQLGPIAPAPTCPCW
FT                   RPGSTAAWMRSARVPESWEPGAPNREPSAGVRPGRGPDDRAPARGGGRQASQSAHQERR
FT                   QSWPGPLRG"
FT   mRNA            join(<19093492..19093649,19143849..19143968,
FT                   19148335..19148446,19150919..19150985,19153165..19153268,
FT                   19156939..19157034,19162735..19162806,19162899..19162979,
FT                   19166274..19166385,19167138..19167260,19168194..19168281,
FT                   19169451..19169555,19174892..19174985,19180157..19181365)
FT                   /gene="Gramd3"
FT                   /locus_tag="mCG_16293"
FT                   /product="GRAM domain containing 3, transcript variant
FT                   mCT174114"
FT                   /note="gene_id=mCG16293.1 transcript_id=mCT174114.0 created
FT                   on 08-OCT-2002"
FT   CDS             join(<19093618..19093649,19143849..19143968,
FT                   19148335..19148446,19150919..19150985,19153165..19153268,
FT                   19156939..19157034,19162735..19162806,19162899..19162979,
FT                   19166274..19166385,19167138..19167260,19168194..19168281,
FT                   19169451..19169555,19174892..19174985,19180157..19180198)
FT                   /codon_start=1
FT                   /gene="Gramd3"
FT                   /locus_tag="mCG_16293"
FT                   /product="GRAM domain containing 3, isoform CRA_b"
FT                   /note="gene_id=mCG16293.1 transcript_id=mCT174114.0
FT                   protein_id=mCP97034.0 isoform=CRA_b"
FT                   /protein_id="EDL09886.1"
FT                   /translation="DIEILRIETESSEAENGAEDRRRVSKSPTAQSPTSSVEAESPDQK
FT                   RSLGLWSKSSFDGSSLLSDKNDCKTESKTDSKTERKKSSSSSQYKANMHFHKLFLDVPT
FT                   EEPLRQSFTCALQKEILYQGKLFVSENWICFHSKVFGKDTKISIPAFSVTLIKKTKTAL
FT                   LVPNALIIATVTDRYIFVSLLSRDSTYKLIKSVCGHLEKTSVGNSPNPSSAENSFRADR
FT                   PSSLPLDFNDEFSDLDGVVRQRRQDLEGYSSSGSQTPESENSRDFHVTESQTVLNVTKG
FT                   ETKPPRTDAHGSRAPDGKAKILPAHGQSETIGILHKMESRKCPTLHHILIVYAIIVCAL
FT                   IISTFYMRYRINTLEERLGTLTSIMDPHSTEQTAPSGLGSQMQLNVEVLCQELTANIVK
FT                   LEKIQNNLQKLLENGD"
FT   mRNA            join(19106518..19106587,19106609..19106682,
FT                   19143849..19143927,19148335..19148446,19150919..19150985,
FT                   19153165..19153268,19156939..19157034,19162735..19162806,
FT                   19162899..19162979,19166274..19166385,19167138..19167260,
FT                   19168194..19168281,19169451..19169555,19174892..19174985,
FT                   19180157..19181365)
FT                   /gene="Gramd3"
FT                   /locus_tag="mCG_16293"
FT                   /product="GRAM domain containing 3, transcript variant
FT                   mCT174117"
FT                   /note="gene_id=mCG16293.1 transcript_id=mCT174117.0 created
FT                   on 08-OCT-2002"
FT   mRNA            join(19143582..19143968,19148335..19148446,
FT                   19150919..19150985,19153165..19153268,19156939..19157034,
FT                   19162735..19162806,19162899..19162979,19166274..19166385,
FT                   19167138..19167260,19168194..19168281,19169451..19169555,
FT                   19174892..19174985,19180157..19181365)
FT                   /gene="Gramd3"
FT                   /locus_tag="mCG_16293"
FT                   /product="GRAM domain containing 3, transcript variant
FT                   mCT174116"
FT                   /note="gene_id=mCG16293.1 transcript_id=mCT174116.0 created
FT                   on 08-OCT-2002"
FT   CDS             join(19143748..19143968,19148335..19148446,
FT                   19150919..19150985,19153165..19153268,19156939..19157034,
FT                   19162735..19162806,19162899..19162979,19166274..19166385,
FT                   19167138..19167260,19168194..19168281,19169451..19169555,
FT                   19174892..19174985,19180157..19180198)
FT                   /codon_start=1
FT                   /gene="Gramd3"
FT                   /locus_tag="mCG_16293"
FT                   /product="GRAM domain containing 3, isoform CRA_c"
FT                   /note="gene_id=mCG16293.1 transcript_id=mCT174116.0
FT                   protein_id=mCP97036.0 isoform=CRA_c"
FT                   /protein_id="EDL09887.1"
FT                   /translation="MKIISLSRTQDHFLFSLSTSPWMSKVKRFSLFSSSEAENGAEDRR
FT                   RVSKSPTAQSPTSSVEAESPDQKRSLGLWSKSSFDGSSLLSDKNDCKTESKTDSKTERK
FT                   KSSSSSQYKANMHFHKLFLDVPTEEPLRQSFTCALQKEILYQGKLFVSENWICFHSKVF
FT                   GKDTKISIPAFSVTLIKKTKTALLVPNALIIATVTDRYIFVSLLSRDSTYKLIKSVCGH
FT                   LEKTSVGNSPNPSSAENSFRADRPSSLPLDFNDEFSDLDGVVRQRRQDLEGYSSSGSQT
FT                   PESENSRDFHVTESQTVLNVTKGETKPPRTDAHGSRAPDGKAKILPAHGQSETIGILHK
FT                   MESRKCPTLHHILIVYAIIVCALIISTFYMRYRINTLEERLGTLTSIMDPHSTEQTAPS
FT                   GLGSQMQLNVEVLCQELTANIVKLEKIQNNLQKLLENGD"
FT   CDS             join(19143863..19143927,19148335..19148446,
FT                   19150919..19150985,19153165..19153268,19156939..19157034,
FT                   19162735..19162806,19162899..19162979,19166274..19166385,
FT                   19167138..19167260,19168194..19168281,19169451..19169555,
FT                   19174892..19174985,19180157..19180198)
FT                   /codon_start=1
FT                   /gene="Gramd3"
FT                   /locus_tag="mCG_16293"
FT                   /product="GRAM domain containing 3, isoform CRA_e"
FT                   /note="gene_id=mCG16293.1 transcript_id=mCT174117.0
FT                   protein_id=mCP97033.0 isoform=CRA_e"
FT                   /protein_id="EDL09889.1"
FT                   /translation="MVRRTEGGSASRQQPNLLPHLWSKSSFDGSSLLSDKNDCKTESKT
FT                   DSKTERKKSSSSSQYKANMHFHKLFLDVPTEEPLRQSFTCALQKEILYQGKLFVSENWI
FT                   CFHSKVFGKDTKISIPAFSVTLIKKTKTALLVPNALIIATVTDRYIFVSLLSRDSTYKL
FT                   IKSVCGHLEKTSVGNSPNPSSAENSFRADRPSSLPLDFNDEFSDLDGVVRQRRQDLEGY
FT                   SSSGSQTPESENSRDFHVTESQTVLNVTKGETKPPRTDAHGSRAPDGKAKILPAHGQSE
FT                   TIGILHKMESRKCPTLHHILIVYAIIVCALIISTFYMRYRINTLEERLGTLTSIMDPHS
FT                   TEQTAPSGLGSQMQLNVEVLCQELTANIVKLEKIQNNLQKLLENGD"
FT   gene            complement(19181831..19244822)
FT                   /gene="Aldh7a1"
FT                   /locus_tag="mCG_16296"
FT                   /note="gene_id=mCG16296.2"
FT   mRNA            complement(join(19181831..19181852,19196809..19197077,
FT                   19198298..19198373,19201478..19201551,19201699..19201796,
FT                   19201969..19202085,19202476..19202582,19204178..19204262,
FT                   19207177..19207271,19208620..19208661,19212036..19212135,
FT                   19214782..19214859,19216721..19216765,19218269..19218401,
FT                   19220119..19220242,19220984..19221064,19229028..19229093,
FT                   19230584..19230637,19231842..19232013,19232294..19232486,
FT                   19244756..19244784))
FT                   /gene="Aldh7a1"
FT                   /locus_tag="mCG_16296"
FT                   /product="aldehyde dehydrogenase family 7, member A1,
FT                   transcript variant mCT174120"
FT                   /note="gene_id=mCG16296.2 transcript_id=mCT174120.0 created
FT                   on 08-OCT-2002"
FT   mRNA            complement(join(19195145..19197077,19198298..19198373,
FT                   19201478..19201551,19201699..19201754,19220198..19220242,
FT                   19220984..19221064,19229028..19229093,19230584..19230637,
FT                   19231842..19232013,19232294..19232486,19244756..19244822))
FT                   /gene="Aldh7a1"
FT                   /locus_tag="mCG_16296"
FT                   /product="aldehyde dehydrogenase family 7, member A1,
FT                   transcript variant mCT174119"
FT                   /note="gene_id=mCG16296.2 transcript_id=mCT174119.0 created
FT                   on 08-OCT-2002"
FT   mRNA            complement(join(19195145..19197077,19198298..19198373,
FT                   19201478..19201551,19201699..19201796,19201969..19202085,
FT                   19202476..19202582,19204178..19204262,19207177..19207271,
FT                   19208620..19208661,19212036..19212135,19214782..19214859,
FT                   19216721..19216765,19218269..19218401,19220119..19220242,
FT                   19220984..19221064,19229028..19229093,19230584..19230637,
FT                   19231842..19232013,19232294..19232486,19244756..19244822))
FT                   /gene="Aldh7a1"
FT                   /locus_tag="mCG_16296"
FT                   /product="aldehyde dehydrogenase family 7, member A1,
FT                   transcript variant mCT17037"
FT                   /note="gene_id=mCG16296.2 transcript_id=mCT17037.2 created
FT                   on 08-OCT-2002"
FT   mRNA            complement(join(19195145..19197077,19198298..19198373,
FT                   19201478..19201551,19201699..19201796,19201969..19202085,
FT                   19202476..19202582,19204178..19204262,19207177..19207271,
FT                   19208620..19208661,19212036..19212135,19214782..19214859,
FT                   19216721..19216765,19218269..19218401,19220119..19220242,
FT                   19220984..19221064,19229028..19229093,19230584..19230637,
FT                   19231842..19232119))
FT                   /gene="Aldh7a1"
FT                   /locus_tag="mCG_16296"
FT                   /product="aldehyde dehydrogenase family 7, member A1,
FT                   transcript variant mCT174118"
FT                   /note="gene_id=mCG16296.2 transcript_id=mCT174118.0 created
FT                   on 08-OCT-2002"
FT   mRNA            complement(join(19196815..19196872,19201755..19201796,
FT                   19201969..19202085,19202476..19202582,19204178..19204262,
FT                   19207177..19207271,19208620..19208661,19212036..19212135,
FT                   19214782..19214859,19216721..19216765,19218269..19218401,
FT                   19220119..19220242,19220984..19221064,19229028..19229093,
FT                   19230584..19230637,19231842..19232013,19232294..19232486,
FT                   19244756..19244784))
FT                   /gene="Aldh7a1"
FT                   /locus_tag="mCG_16296"
FT                   /product="aldehyde dehydrogenase family 7, member A1,
FT                   transcript variant mCT174121"
FT                   /note="gene_id=mCG16296.2 transcript_id=mCT174121.0 created
FT                   on 08-OCT-2002"
FT   mRNA            complement(join(19196845..19196973,19212032..19212135,
FT                   19214782..19214859,19216721..19216765,19218269..19218401,
FT                   19220119..19220242,19220984..19221064,19229028..19229093,
FT                   19230584..19230637,19231842..19232013,19232294..19232486,
FT                   19244756..19244784))
FT                   /gene="Aldh7a1"
FT                   /locus_tag="mCG_16296"
FT                   /product="aldehyde dehydrogenase family 7, member A1,
FT                   transcript variant mCT174123"
FT                   /note="gene_id=mCG16296.2 transcript_id=mCT174123.0 created
FT                   on 08-OCT-2002"
FT   CDS             complement(join(19196966..19196973,19212032..19212135,
FT                   19214782..19214859,19216721..19216765,19218269..19218401,
FT                   19220119..19220242,19220984..19221064,19229028..19229093,
FT                   19230584..19230637,19231842..19231949))
FT                   /codon_start=1
FT                   /gene="Aldh7a1"
FT                   /locus_tag="mCG_16296"
FT                   /product="aldehyde dehydrogenase family 7, member A1,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG16296.2 transcript_id=mCT174123.0
FT                   protein_id=mCP97037.0 isoform=CRA_c"
FT                   /protein_id="EDL09881.1"
FT                   /translation="MSTLLIHHPQYAWLQDLGLREDNEGVYNGSWGGRGEVITTYCPAN
FT                   NEPIARVRQASLKDYEETIGKAKKAWNIWADIPAPKRGEIVRKIGDAFREKIQLLGRLV
FT                   SLEMGKILVEGIGEVQEYVDVCDYAAGLSRMIGGPTLPSERPGHALIEMWNPLGLVGII
FT                   TAFNFPVAVFGWNNAIALITGNVCLWKGAPTTSLVSVAVTKIIAQVLEDNLLPGAICSL
FT                   VCGGADIGTTMARDERVNLLSFTGSTQVGKGGGPHGAGRGLVKA"
FT   mRNA            complement(join(19197002..19197077,19204197..19204262,
FT                   19207177..19207271,19208620..19208661,19212036..19212135,
FT                   19214782..19214859,19216721..19216765,19218269..19218401,
FT                   19220119..19220242,19220984..19221064,19229028..19229093,
FT                   19230584..19230637,19231842..19232013,19232294..19232486,
FT                   19244756..19244784))
FT                   /gene="Aldh7a1"
FT                   /locus_tag="mCG_16296"
FT                   /product="aldehyde dehydrogenase family 7, member A1,
FT                   transcript variant mCT174122"
FT                   /note="gene_id=mCG16296.2 transcript_id=mCT174122.0 created
FT                   on 08-OCT-2002"
FT   CDS             complement(join(19197023..19197077,19198298..19198373,
FT                   19201478..19201551,19201699..19201754,19220198..19220242,
FT                   19220984..19221064,19229028..19229093,19230584..19230637,
FT                   19231842..19231949))
FT                   /codon_start=1
FT                   /gene="Aldh7a1"
FT                   /locus_tag="mCG_16296"
FT                   /product="aldehyde dehydrogenase family 7, member A1,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG16296.2 transcript_id=mCT174119.0
FT                   protein_id=mCP97038.0 isoform=CRA_b"
FT                   /protein_id="EDL09879.1"
FT                   /translation="MSTLLIHHPQYAWLQDLGLREDNEGVYNGSWGGRGEVITTYCPAN
FT                   NEPIARVRQASLKDYEETIGKAKKAWNIWADIPAPKRGEIVRKIGDAFREKIQLLGRLV
FT                   SLEMGKILVEGIGEGLSSSIFTKDLGRIFRWLGPKGSDCGIVNVNIPTSGAEIGGAFGG
FT                   EKHTGGGRESGSDAWKQYMRRSTCTINYSTSLPLAQGIKFQ"
FT   CDS             complement(join(19207185..19207271,19208620..19208661,
FT                   19212036..19212135,19214782..19214859,19216721..19216765,
FT                   19218269..19218401,19220119..19220242,19220984..19221064,
FT                   19229028..19229093,19230584..19230637,19231842..19232033))
FT                   /codon_start=1
FT                   /gene="Aldh7a1"
FT                   /locus_tag="mCG_16296"
FT                   /product="aldehyde dehydrogenase family 7, member A1,
FT                   isoform CRA_d"
FT                   /note="gene_id=mCG16296.2 transcript_id=mCT174118.0
FT                   protein_id=mCP97040.0 isoform=CRA_d"
FT                   /protein_id="EDL09882.1"
FT                   /translation="MWRVPRRLCVQSVKTSKLSGPWSRPAAHMSTLLIHHPQYAWLQDL
FT                   GLREDNEGVYNGSWGGRGEVITTYCPANNEPIARVRQASLKDYEETIGKAKKAWNIWAD
FT                   IPAPKRGEIVRKIGDAFREKIQLLGRLVSLEMGKILVEGIGEVQEYVDVCDYAAGLSRM
FT                   IGGPTLPSERPGHALIEMWNPLGLVGIITAFNFPVAVFGWNNAIALITGNVCLWKGAPT
FT                   TSLVSVAVTKIIAQVLEDNLLPGAICSLVCGGADIGTTMARDERVNLLSFTGSTQVGKG
FT                   GGPHGAGRGLGKACWSLEETTPLLLSRTRTSAWLFHQFCLPPWEQLGKGVPL"
FT   CDS             complement(join(19207185..19207271,19208620..19208661,
FT                   19212036..19212135,19214782..19214859,19216721..19216765,
FT                   19218269..19218401,19220119..19220242,19220984..19221064,
FT                   19229028..19229093,19230584..19230637,19231842..19231949))
FT                   /codon_start=1
FT                   /gene="Aldh7a1"
FT                   /locus_tag="mCG_16296"
FT                   /product="aldehyde dehydrogenase family 7, member A1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG16296.2 transcript_id=mCT17037.2
FT                   protein_id=mCP21507.2 isoform=CRA_a"
FT                   /protein_id="EDL09878.1"
FT                   /translation="MSTLLIHHPQYAWLQDLGLREDNEGVYNGSWGGRGEVITTYCPAN
FT                   NEPIARVRQASLKDYEETIGKAKKAWNIWADIPAPKRGEIVRKIGDAFREKIQLLGRLV
FT                   SLEMGKILVEGIGEVQEYVDVCDYAAGLSRMIGGPTLPSERPGHALIEMWNPLGLVGII
FT                   TAFNFPVAVFGWNNAIALITGNVCLWKGAPTTSLVSVAVTKIIAQVLEDNLLPGAICSL
FT                   VCGGADIGTTMARDERVNLLSFTGSTQVGKGGGPHGAGRGLGKACWSLEETTPLLLSRT
FT                   RTSAWLFHQFCLPPWEQLGKGVPL"
FT   CDS             complement(join(19207185..19207271,19208620..19208661,
FT                   19212036..19212135,19214782..19214859,19216721..19216765,
FT                   19218269..19218401,19220119..19220242,19220984..19221064,
FT                   19229028..19229093,19230584..19230637,19231842..19231949))
FT                   /codon_start=1
FT                   /gene="Aldh7a1"
FT                   /locus_tag="mCG_16296"
FT                   /product="aldehyde dehydrogenase family 7, member A1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG16296.2 transcript_id=mCT174121.0
FT                   protein_id=mCP97039.0 isoform=CRA_a"
FT                   /protein_id="EDL09880.1"
FT                   /translation="MSTLLIHHPQYAWLQDLGLREDNEGVYNGSWGGRGEVITTYCPAN
FT                   NEPIARVRQASLKDYEETIGKAKKAWNIWADIPAPKRGEIVRKIGDAFREKIQLLGRLV
FT                   SLEMGKILVEGIGEVQEYVDVCDYAAGLSRMIGGPTLPSERPGHALIEMWNPLGLVGII
FT                   TAFNFPVAVFGWNNAIALITGNVCLWKGAPTTSLVSVAVTKIIAQVLEDNLLPGAICSL
FT                   VCGGADIGTTMARDERVNLLSFTGSTQVGKGGGPHGAGRGLGKACWSLEETTPLLLSRT
FT                   RTSAWLFHQFCLPPWEQLGKGVPL"
FT   CDS             complement(join(19207185..19207271,19208620..19208661,
FT                   19212036..19212135,19214782..19214859,19216721..19216765,
FT                   19218269..19218401,19220119..19220242,19220984..19221064,
FT                   19229028..19229093,19230584..19230637,19231842..19231949))
FT                   /codon_start=1
FT                   /gene="Aldh7a1"
FT                   /locus_tag="mCG_16296"
FT                   /product="aldehyde dehydrogenase family 7, member A1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG16296.2 transcript_id=mCT174120.0
FT                   protein_id=mCP97041.0 isoform=CRA_a"
FT                   /protein_id="EDL09883.1"
FT                   /translation="MSTLLIHHPQYAWLQDLGLREDNEGVYNGSWGGRGEVITTYCPAN
FT                   NEPIARVRQASLKDYEETIGKAKKAWNIWADIPAPKRGEIVRKIGDAFREKIQLLGRLV
FT                   SLEMGKILVEGIGEVQEYVDVCDYAAGLSRMIGGPTLPSERPGHALIEMWNPLGLVGII
FT                   TAFNFPVAVFGWNNAIALITGNVCLWKGAPTTSLVSVAVTKIIAQVLEDNLLPGAICSL
FT                   VCGGADIGTTMARDERVNLLSFTGSTQVGKGGGPHGAGRGLGKACWSLEETTPLLLSRT
FT                   RTSAWLFHQFCLPPWEQLGKGVPL"
FT   CDS             complement(join(19207185..19207271,19208620..19208661,
FT                   19212036..19212135,19214782..19214859,19216721..19216765,
FT                   19218269..19218401,19220119..19220242,19220984..19221064,
FT                   19229028..19229093,19230584..19230637,19231842..19231949))
FT                   /codon_start=1
FT                   /gene="Aldh7a1"
FT                   /locus_tag="mCG_16296"
FT                   /product="aldehyde dehydrogenase family 7, member A1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG16296.2 transcript_id=mCT174122.0
FT                   protein_id=mCP97042.0 isoform=CRA_a"
FT                   /protein_id="EDL09884.1"
FT                   /translation="MSTLLIHHPQYAWLQDLGLREDNEGVYNGSWGGRGEVITTYCPAN
FT                   NEPIARVRQASLKDYEETIGKAKKAWNIWADIPAPKRGEIVRKIGDAFREKIQLLGRLV
FT                   SLEMGKILVEGIGEVQEYVDVCDYAAGLSRMIGGPTLPSERPGHALIEMWNPLGLVGII
FT                   TAFNFPVAVFGWNNAIALITGNVCLWKGAPTTSLVSVAVTKIIAQVLEDNLLPGAICSL
FT                   VCGGADIGTTMARDERVNLLSFTGSTQVGKGGGPHGAGRGLGKACWSLEETTPLLLSRT
FT                   RTSAWLFHQFCLPPWEQLGKGVPL"
FT   gene            19232378..19259596
FT                   /gene="Rnuxa"
FT                   /locus_tag="mCG_16297"
FT                   /note="gene_id=mCG16297.2"
FT   mRNA            join(19232378..19232534,19247355..19247941,
FT                   19252068..19252188,19256175..19256258,19258761..19259394)
FT                   /gene="Rnuxa"
FT                   /locus_tag="mCG_16297"
FT                   /product="RNA U, small nuclear RNA export adaptor,
FT                   transcript variant mCT174124"
FT                   /note="gene_id=mCG16297.2 transcript_id=mCT174124.0 created
FT                   on 08-OCT-2002"
FT   CDS             join(19232505..19232534,19247355..19247941,
FT                   19252068..19252188,19256175..19256258,19258761..19259030)
FT                   /codon_start=1
FT                   /gene="Rnuxa"
FT                   /locus_tag="mCG_16297"
FT                   /product="RNA U, small nuclear RNA export adaptor, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG16297.2 transcript_id=mCT174124.0
FT                   protein_id=mCP97043.0 isoform=CRA_b"
FT                   /db_xref="GOA:G5E8V8"
FT                   /db_xref="InterPro:IPR019385"
FT                   /db_xref="MGI:MGI:1891839"
FT                   /db_xref="UniProtKB/TrEMBL:G5E8V8"
FT                   /protein_id="EDL09877.1"
FT                   /translation="MTSLTPVVAQKVLGGGSAACAPVSHYRTVKHVDSSEESLDSDDDC
FT                   SLWKRKRQKCHNTPPKPEPFPFGPSGQKTALNGGKKVNNIWGAVLQEQNQDAVATELGI
FT                   LGMEGSIDRSRQSETYNYLLAKKLAKKESQEYTKELDKDLDEYMHGDKKPGSKEDENGQ
FT                   GHLKRKRPVRDRLGNRVEMNYKGRYEITEEDAPEKVADEIAFRLQEPKKDLIARVVRIL
FT                   GNKKAIELLMETAEVEQNGGLFIMNGSRRRTPGGVFLNLLKNTPSISEEQIKDIFYVEN
FT                   QKEYENKKAARKRRTQLLGKKMKQAIKSLNFQEDDDTSRETFASDTNEALASLDEAQEG
FT                   PGETKLDAEEAIEVDHPQDLDIF"
FT   mRNA            join(<19244951..19245046,19247355..19247941,
FT                   19252068..19252188,19256175..19256258,19258761..19259596)
FT                   /gene="Rnuxa"
FT                   /locus_tag="mCG_16297"
FT                   /product="RNA U, small nuclear RNA export adaptor,
FT                   transcript variant mCT17038"
FT                   /note="gene_id=mCG16297.2 transcript_id=mCT17038.1 created
FT                   on 08-OCT-2002"
FT   CDS             join(19244951..19245046,19247355..19247941,
FT                   19252068..19252188,19256175..19256258,19258761..19259030)
FT                   /codon_start=1
FT                   /gene="Rnuxa"
FT                   /locus_tag="mCG_16297"
FT                   /product="RNA U, small nuclear RNA export adaptor, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG16297.2 transcript_id=mCT17038.1
FT                   protein_id=mCP21559.0 isoform=CRA_a"
FT                   /protein_id="EDL09876.1"
FT                   /translation="MALEAGDMEEGQLSDSDSDMTVVPSDRPLQMAKVLGGGSAACAPV
FT                   SHYRTVKHVDSSEESLDSDDDCSLWKRKRQKCHNTPPKPEPFPFGPSGQKTALNGGKKV
FT                   NNIWGAVLQEQNQDAVATELGILGMEGSIDRSRQSETYNYLLAKKLAKKESQEYTKELD
FT                   KDLDEYMHGDKKPGSKEDENGQGHLKRKRPVRDRLGNRVEMNYKGRYEITEEDAPEKVA
FT                   DEIAFRLQEPKKDLIARVVRILGNKKAIELLMETAEVEQNGGLFIMNGSRRRTPGGVFL
FT                   NLLKNTPSISEEQIKDIFYVENQKEYENKKAARKRRTQLLGKKMKQAIKSLNFQEDDDT
FT                   SRETFASDTNEALASLDEAQEGPGETKLDAEEAIEVDHPQDLDIF"
FT   gene            19260229..19266660
FT                   /gene="1700065I17Rik"
FT                   /locus_tag="mCG_16299"
FT                   /note="gene_id=mCG16299.1"
FT   mRNA            join(19260229..19260353,19264254..19264362,
FT                   19266326..19266660)
FT                   /gene="1700065I17Rik"
FT                   /locus_tag="mCG_16299"
FT                   /product="RIKEN cDNA 1700065I17"
FT                   /note="gene_id=mCG16299.1 transcript_id=mCT17040.0 created
FT                   on 08-OCT-2002"
FT   CDS             join(19260318..19260353,19264254..19264362,
FT                   19266326..19266585)
FT                   /codon_start=1
FT                   /gene="1700065I17Rik"
FT                   /locus_tag="mCG_16299"
FT                   /product="RIKEN cDNA 1700065I17"
FT                   /note="gene_id=mCG16299.1 transcript_id=mCT17040.0
FT                   protein_id=mCP21564.1"
FT                   /protein_id="EDL09875.1"
FT                   /translation="MQTCRRAASTAQVGRYSLAPVLTKARDDPDPLRHALERKHEIQER
FT                   ESTASRSLWDLCWPFGRFSVLGLQREALPWGRSESRPEERPAGDKDYRHAFAFASLQIP
FT                   EHSDFPRFPEATDLIGGSRKLLSFGNGALA"
FT   gene            19343470..19344105
FT                   /pseudo
FT                   /locus_tag="mCG_50521"
FT                   /note="gene_id=mCG50521.2"
FT   mRNA            19343470..19344105
FT                   /pseudo
FT                   /locus_tag="mCG_50521"
FT                   /note="gene_id=mCG50521.2 transcript_id=mCT50704.2 created
FT                   on 17-OCT-2002"
FT   gene            19383666..19430749
FT                   /gene="Lmnb1"
FT                   /locus_tag="mCG_16290"
FT                   /note="gene_id=mCG16290.2"
FT   mRNA            join(19383666..19384267,19405736..19405892,
FT                   19406624..19406749,19408307..19408477,19410539..19410664,
FT                   19417162..19417382,19418028..19418253,19420545..19420649,
FT                   19425295..19425414,19427017..19427127,19429925..19430740)
FT                   /gene="Lmnb1"
FT                   /locus_tag="mCG_16290"
FT                   /product="lamin B1, transcript variant mCT17031"
FT                   /note="gene_id=mCG16290.2 transcript_id=mCT17031.1 created
FT                   on 08-OCT-2002"
FT   CDS             join(19383906..19384267,19405736..19405892,
FT                   19406624..19406749,19408307..19408477,19410539..19410664,
FT                   19417162..19417382,19418028..19418253,19420545..19420649,
FT                   19425295..19425414,19427017..19427127,19429925..19429966)
FT                   /codon_start=1
FT                   /gene="Lmnb1"
FT                   /locus_tag="mCG_16290"
FT                   /product="lamin B1, isoform CRA_a"
FT                   /note="gene_id=mCG16290.2 transcript_id=mCT17031.1
FT                   protein_id=mCP21565.2 isoform=CRA_a"
FT                   /protein_id="EDL09872.1"
FT                   /translation="MATATPVQQQRAGSRASAPATPLSPTRLSRLQEKEELRELNDRLA
FT                   VYIDKVRSLETENSALQLQVTEREEVRGRELTGLKALYETELADARRALDDTARERAKL
FT                   QIELGKFKAEHDQLLLNYAKKESDLSGAQIKLREYEAALNSKDAALATALGDKKSLEGD
FT                   LEDLKDQIAQLEASLSAAKKQLADETLLKVDLENRCQSLTEDLEFRKNMYEEEINETRR
FT                   KHETRLVEVDSGRQIEYEYKLAQALHEMREQHDAQVRLYKEELEQTYHAKLENARLSSE
FT                   MNTSTVNSAREELMESRMRIESLSSQLSNLQKESRACLERIQELEDMLAKERDNSRRML
FT                   SDREREMAEIRDQMQQQLSDYEQLLDVKLALDMEISAYRKLLEGEEERLKLSPSPSSRV
FT                   TVSRASSSRSVRTTRGKRKRVDVEESEASSSVSISHSASATGNVCIEEIDVDGKFIRLK
FT                   NTSEQDQPMGGWEMIRKIGDTSVSYKYTSRYVLKAGQTVTVWAANAGVTASPPTDLIWK
FT                   NQNSWGTGEDVKVILKNSQGEEVAQRSTVFKTTIPEEEEEEEEEPIGVAVEEERFHQQG
FT                   APRASNKSCAIM"
FT   mRNA            join(19383968..19384267,19405736..19405892,
FT                   19406624..19406749,19408307..19408477,19410539..19410664,
FT                   19417162..19417382,19418028..19418253,19420545..19420591,
FT                   19427062..19427127,19429925..19430749)
FT                   /gene="Lmnb1"
FT                   /locus_tag="mCG_16290"
FT                   /product="lamin B1, transcript variant mCT174111"
FT                   /note="gene_id=mCG16290.2 transcript_id=mCT174111.0 created
FT                   on 08-OCT-2002"
FT   mRNA            join(19383968..19384267,19405736..19405892,
FT                   19406624..19406749,19408307..19408329,19430531..19430742)
FT                   /gene="Lmnb1"
FT                   /locus_tag="mCG_16290"
FT                   /product="lamin B1, transcript variant mCT174112"
FT                   /note="gene_id=mCG16290.2 transcript_id=mCT174112.0 created
FT                   on 08-OCT-2002"
FT   CDS             join(19406664..19406749,19408307..19408329,
FT                   19430531..19430574)
FT                   /codon_start=1
FT                   /gene="Lmnb1"
FT                   /locus_tag="mCG_16290"
FT                   /product="lamin B1, isoform CRA_c"
FT                   /note="gene_id=mCG16290.2 transcript_id=mCT174112.0
FT                   protein_id=mCP97031.0 isoform=CRA_c"
FT                   /protein_id="EDL09874.1"
FT                   /translation="MKLYLKWIWRIAVRALLRTWSFVKICMKRRSMRQGGITMYALWME
FT                   VLQSC"
FT   CDS             join(19406738..19406749,19408307..19408477,
FT                   19410539..19410664,19417162..19417382,19418028..19418253,
FT                   19420545..19420591,19427062..19427127,19429925..19430081)
FT                   /codon_start=1
FT                   /gene="Lmnb1"
FT                   /locus_tag="mCG_16290"
FT                   /product="lamin B1, isoform CRA_b"
FT                   /note="gene_id=mCG16290.2 transcript_id=mCT174111.0
FT                   protein_id=mCP97030.0 isoform=CRA_b"
FT                   /protein_id="EDL09873.1"
FT                   /translation="MYEEEINETRRKHETRLVEVDSGRQIEYEYKLAQALHEMREQHDA
FT                   QVRLYKEELEQTYHAKLENARLSSEMNTSTVNSAREELMESRMRIESLSSQLSNLQKES
FT                   RACLERIQELEDMLAKERDNSRRMLSDREREMAEIRDQMQQQLSDYEQLLDVKLALDME
FT                   ISAYRKLLEGEEERLKLSPSPSSRVTVSRASSSRSVRTTRGKRKRVDVEESEASSSVSI
FT                   SHSASATGNVCIEEIDVDGKFIRLKNTSEQDQPMGGWEMIRKIGDTRRRRRRRSPSEWL
FT                   WRRSVSTSREPQEHPIKAVPLCELVKTWSIFLKLEAWSPVYSAEPSQKHMIFLYFLYVN
FT                   F"
FT   gene            complement(19439130..19601847)
FT                   /gene="March3"
FT                   /locus_tag="mCG_16294"
FT                   /note="gene_id=mCG16294.3"
FT   mRNA            complement(join(19439130..19439982,19460412..19460621,
FT                   19485227..19485431,19489395..19489638,19601606..19601847))
FT                   /gene="March3"
FT                   /locus_tag="mCG_16294"
FT                   /product="membrane-associated ring finger (C3HC4) 3,
FT                   transcript variant mCT17035"
FT                   /note="gene_id=mCG16294.3 transcript_id=mCT17035.3 created
FT                   on 16-MAY-2003"
FT   CDS             complement(join(19439929..19439982,19460412..19460621,
FT                   19485227..19485431,19489395..19489582))
FT                   /codon_start=1
FT                   /gene="March3"
FT                   /locus_tag="mCG_16294"
FT                   /product="membrane-associated ring finger (C3HC4) 3,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG16294.3 transcript_id=mCT17035.3
FT                   protein_id=mCP21499.3 isoform=CRA_a"
FT                   /protein_id="EDL09870.1"
FT                   /translation="MTTSRCSHLPEVLPDCTSSAAPVVKTVEDCGSLVNGQPQYVMQVS
FT                   AKDGQLLSTVVRTLATQSPFNDRPMCRICHEGSSQEDLLSPCECTGTLGTIHRSCLEHW
FT                   LSSSNTSYCELCHFRFAVERKPRPLVEWLRNPGPQHEKRTLFGDMVCFLFITPLATISG
FT                   WLCLRGAVDHLHFSSRLEAVGLIALTVALFTIYLFWTLRRYGHQSKPFWNQSSRS"
FT   mRNA            complement(join(19481232..19485431,19489395..19489638,
FT                   19601606..19601847))
FT                   /gene="March3"
FT                   /locus_tag="mCG_16294"
FT                   /product="membrane-associated ring finger (C3HC4) 3,
FT                   transcript variant mCT182128"
FT                   /note="gene_id=mCG16294.3 transcript_id=mCT182128.0 created
FT                   on 16-MAY-2003"
FT   CDS             complement(join(19485203..19485431,19489395..19489582))
FT                   /codon_start=1
FT                   /gene="March3"
FT                   /locus_tag="mCG_16294"
FT                   /product="membrane-associated ring finger (C3HC4) 3,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG16294.3 transcript_id=mCT182128.0
FT                   protein_id=mCP105048.0 isoform=CRA_b"
FT                   /protein_id="EDL09871.1"
FT                   /translation="MTTSRCSHLPEVLPDCTSSAAPVVKTVEDCGSLVNGQPQYVMQVS
FT                   AKDGQLLSTVVRTLATQSPFNDRPMCRICHEGSSQEDLLSPCECTGTLGTIHRSCLEHW
FT                   LSSSNTSYCELCHFRFAVERKPRPLVEVSKWSAS"
FT   gene            complement(19591608..19592320)
FT                   /pseudo
FT                   /locus_tag="mCG_1033361"
FT                   /note="gene_id=mCG1033361.1"
FT   mRNA            complement(19591608..19592320)
FT                   /pseudo
FT                   /locus_tag="mCG_1033361"
FT                   /note="gene_id=mCG1033361.1 transcript_id=mCT151065.1
FT                   created on 10-MAR-2003"
FT   gene            complement(19632212..19649612)
FT                   /locus_tag="mCG_16291"
FT                   /note="gene_id=mCG16291.2"
FT   mRNA            complement(join(19632212..19634089,19634691..19634747,
FT                   19638534..19638651,19643231..19643327,19649511..19649612))
FT                   /locus_tag="mCG_16291"
FT                   /product="mCG16291, transcript variant mCT174113"
FT                   /note="gene_id=mCG16291.2 transcript_id=mCT174113.0 created
FT                   on 08-OCT-2002"
FT   mRNA            complement(join(19632212..19634089,19634691..19634747,
FT                   19638534..19638651,19649511..19649601))
FT                   /locus_tag="mCG_16291"
FT                   /product="mCG16291, transcript variant mCT17032"
FT                   /note="gene_id=mCG16291.2 transcript_id=mCT17032.2 created
FT                   on 08-OCT-2002"
FT   CDS             complement(join(19633910..19634089,19634691..19634747,
FT                   19638534..19638644))
FT                   /codon_start=1
FT                   /locus_tag="mCG_16291"
FT                   /product="mCG16291, isoform CRA_a"
FT                   /note="gene_id=mCG16291.2 transcript_id=mCT17032.2
FT                   protein_id=mCP21575.2 isoform=CRA_a"
FT                   /protein_id="EDL09868.1"
FT                   /translation="MLWFQGKSLQIAKSSFGLLRNLSASNRALPVLTLFTKAPCPLCDE
FT                   AKEVLQPYKDRFILQEVDITLPENSTWYERYKFDIPVFHLNGQFLMMHRVNTSKLEKQL
FT                   RKLEQQVLATN"
FT   CDS             complement(join(19633910..19634089,19634691..19634747,
FT                   19638534..19638644))
FT                   /codon_start=1
FT                   /locus_tag="mCG_16291"
FT                   /product="mCG16291, isoform CRA_a"
FT                   /note="gene_id=mCG16291.2 transcript_id=mCT174113.0
FT                   protein_id=mCP97032.0 isoform=CRA_a"
FT                   /protein_id="EDL09869.1"
FT                   /translation="MLWFQGKSLQIAKSSFGLLRNLSASNRALPVLTLFTKAPCPLCDE
FT                   AKEVLQPYKDRFILQEVDITLPENSTWYERYKFDIPVFHLNGQFLMMHRVNTSKLEKQL
FT                   RKLEQQVLATN"
FT   gene            19810617..19972163
FT                   /gene="Megf10"
FT                   /locus_tag="mCG_59698"
FT                   /note="gene_id=mCG59698.2"
FT   mRNA            join(19810617..19810970,19857519..19857651,
FT                   19866580..19866681,19868186..19868286,19889432..19889524,
FT                   19918185..19918431,19930283..19930495,19937406..19937580,
FT                   19938854..19938974,19939737..19939900,19942182..19942284,
FT                   19953499..19953645,19954735..19954941,19955414..19955542,
FT                   19959460..19959588,19961622..19961750,19963636..19963764,
FT                   19965611..19965847,19967115..19967242,19968229..19968352,
FT                   19969603..19969647,19970441..19970647,19971715..19972163)
FT                   /gene="Megf10"
FT                   /locus_tag="mCG_59698"
FT                   /product="multiple EGF-like-domains 10"
FT                   /note="gene_id=mCG59698.2 transcript_id=mCT126316.1 created
FT                   on 14-OCT-2002"
FT   CDS             join(19857536..19857651,19866580..19866681,
FT                   19868186..19868286,19889432..19889524,19918185..19918431,
FT                   19930283..19930495,19937406..19937580,19938854..19938974,
FT                   19939737..19939900,19942182..19942284,19953499..19953645,
FT                   19954735..19954941,19955414..19955542,19959460..19959588,
FT                   19961622..19961750,19963636..19963764,19965611..19965847,
FT                   19967115..19967242,19968229..19968352,19969603..19969647,
FT                   19970441..19970647,19971715..19971926)
FT                   /codon_start=1
FT                   /gene="Megf10"
FT                   /locus_tag="mCG_59698"
FT                   /product="multiple EGF-like-domains 10"
FT                   /note="gene_id=mCG59698.2 transcript_id=mCT126316.1
FT                   protein_id=mCP77964.1"
FT                   /protein_id="EDL09867.1"
FT                   /translation="MAISSSSCLGLICSLLCHWVGTASSLNLEDPNVCSHWESYSVTVQ
FT                   ESYPHPFDQIYYTSCTDILNWFKCTRHRISYRTAYRHGEKTMYRRKSQCCPGFYESRDM
FT                   CVPHCADKCVHGRCIAPNTCQCEPGWGGTNCSSACDGDHWGPHCSSRCQCKNRALCNPI
FT                   TGACHCAAGYRGWRCEDRCEQGTYGNDCHQRCQCQNGATCDHITGECRCSPGYTGALCQ
FT                   DECPVGSYGVRCAEACRCVNGGKCYHVSGTCLCEAGFSGELCEARLCPEGLYGIKCDKR
FT                   CPCHLDNTHSCHPMSGECGCKPGWSGLYCNETCSPGFYGEACQQICSCQNGADCDSVTG
FT                   RCACAPGFKGTDCSTPCPLGRYGINCSSRCGCKNDAVCSPVDGSCICKAGWHGVDCSIR
FT                   CPSGTWGFGCNLTCQCLNGGACNTLDGTCTCAPGWRGAKCEFPCQDGTYGLNCAERCDC
FT                   SHADGCHPTTGHCRCLPGWSGVHCDSVCAEGRWGPNCSLPCYCKNGASCSPDDGICECA
FT                   PGFRGTTCQRISVNLCVEQEINPTWGSNYEFLFAVCSPGFYGHRCSQTCPQCVHSSGPC
FT                   HHITGLCDCLPGFTGALCNEVCPSGRFGKNCAGVCTCTNNGTCNPIDRSCQCYPGWIGS
FT                   DCSQPCPPAHWGPNCIHTCNCHNGAFCSAYDGECKCTPGWTGLYCTQRCPLGFYGKDCA
FT                   LICQCQNGADCDHISGQCTCRTGFMGRHCEQKCPAGTYGYGCRQICDCLNNSTCDHITG
FT                   TCYCSPGWKGARCDQAGVIIVGNLNSLSRTSTALPADSYQIGAIAGIVVLVLVVLFLLA
FT                   LFIIYRHKQKRKESSMPAVTYTPAMRVINADYTIAETLPHSNGGNANSHYFTNPSYHTL
FT                   SQCATSPHVNNRDRMTIAKSKNNQLFVNLKNVNPGKRGTLVDCTGTLPADWKQGGYLNE
FT                   LGAFGLDRSYMGKSLKDLGKNSEYNSSTCSLSSSENPYATIKDPPALLPKSSECGYVEM
FT                   KSPARRDSPYAEINNSTPANRNVYEVEPTVSVVQGVFSNSGHVTQDPYDLPKNSHIPCH
FT                   YDLLPVRDSSSSPKREDGGGSNSTSSNSTSSSSSSSE"
FT   gene            complement(20031564..20032748)
FT                   /locus_tag="mCG_147318"
FT                   /note="gene_id=mCG147318.0"
FT   mRNA            complement(20031564..20032748)
FT                   /locus_tag="mCG_147318"
FT                   /product="mCG147318"
FT                   /note="gene_id=mCG147318.0 transcript_id=mCT187581.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(20031960..20032604)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147318"
FT                   /product="mCG147318"
FT                   /note="gene_id=mCG147318.0 transcript_id=mCT187581.0
FT                   protein_id=mCP109706.0"
FT                   /protein_id="EDL09866.1"
FT                   /translation="MDRVKGSLRGGDGHSRGSREEPLRPTGAGGLGSLCHVCRPGRAGR
FT                   RSAGLATRARAGGCGRESRDRGRSDAGRDPVVPTSVSAARSPRTPPLAGRPARPPGARP
FT                   RPVATARVTAQVHAHLGRSERLRRSCTRGSGSGAGSGVPRGDPAYGGRGRPEERVPRAK
FT                   MASAPPRCHVGDTPRHAPRPASTGLPHTHPQLARVHRRPRRSVPTPVTAGE"
FT   gene            20032095..20067576
FT                   /gene="1190002C06Rik"
FT                   /locus_tag="mCG_125065"
FT                   /note="gene_id=mCG125065.0"
FT   mRNA            join(20032095..20032247,20039748..20039864,
FT                   20040391..20040780,20042506..20042666,20048622..20048724,
FT                   20051782..20051945,20058865..20058968,20061409..20061511,
FT                   20066851..20067576)
FT                   /gene="1190002C06Rik"
FT                   /locus_tag="mCG_125065"
FT                   /product="RIKEN cDNA 1190002C06, transcript variant
FT                   mCT126318"
FT                   /note="gene_id=mCG125065.0 transcript_id=mCT126318.1
FT                   created on 08-OCT-2002"
FT   CDS             join(20039768..20039864,20040391..20040780,
FT                   20042506..20042666,20048622..20048724,20051782..20051945,
FT                   20058865..20058968,20061409..20061511,20066851..20067060)
FT                   /codon_start=1
FT                   /gene="1190002C06Rik"
FT                   /locus_tag="mCG_125065"
FT                   /product="RIKEN cDNA 1190002C06, isoform CRA_a"
FT                   /note="gene_id=mCG125065.0 transcript_id=mCT126318.1
FT                   protein_id=mCP77539.1 isoform=CRA_a"
FT                   /protein_id="EDL09864.1"
FT                   /translation="MMEESGIETTPPGTPPLHPAGLAAVPSTEAHSAATSSFSSPNVSG
FT                   MESLPPHVYSTPQPSLPPVQPSAPPPFVSMSPAPSVPLSGTSVPPSVSPSPATAFSGPP
FT                   MSHFPPATSASGALLSAPPSGPPISGFSVGTTYDITRGHAGRAPQTPLMPSFSAPPVTG
FT                   ILPAPITQQASMTSLAQGPGTTSAITFPEEQEDPRINRGQDDAPAGGIWGFIKGVAGNP
FT                   MVKSVLDKTKHSVESMITTLDPGMAPYIKSGGELDIVVTSNKEVKVAAVRDAFQEVFGL
FT                   AVVVGEAGQSNIAPQPVGYAAGLKGAQERIDSLRRSGAIHEKQTAVSVENFIAELLPDK
FT                   WFDIGCLVVEDPVHGIRLEAFTQATPVPLEFVQQAQSLTPQDYNLRWSGLLVTVGEVLE
FT                   KSLLNVSRTDWHLAFTGMSRRQMIYSAAKAVAGMYKQRLPPRPM"
FT   mRNA            join(20051154..20051338,20051782..20051945,
FT                   20058865..20058968,20061409..20061511,20066851..20067232)
FT                   /gene="1190002C06Rik"
FT                   /locus_tag="mCG_125065"
FT                   /product="RIKEN cDNA 1190002C06, transcript variant
FT                   mCT174094"
FT                   /note="gene_id=mCG125065.0 transcript_id=mCT174094.0
FT                   created on 08-OCT-2002"
FT   CDS             join(20051311..20051338,20051782..20051945,
FT                   20058865..20058968,20061409..20061511,20066851..20067060)
FT                   /codon_start=1
FT                   /gene="1190002C06Rik"
FT                   /locus_tag="mCG_125065"
FT                   /product="RIKEN cDNA 1190002C06, isoform CRA_b"
FT                   /note="gene_id=mCG125065.0 transcript_id=mCT174094.0
FT                   protein_id=mCP97013.0 isoform=CRA_b"
FT                   /protein_id="EDL09865.1"
FT                   /translation="MAHPGAREKESGGELDIVVTSNKEVKVAAVRDAFQEVFGLAVVVG
FT                   EAGQSNIAPQPVGYAAGLKGAQERIDSLRRSGAIHEKQTAVSVENFIAELLPDKWFDIG
FT                   CLVVEDPVHGIRLEAFTQATPVPLEFVQQAQSLTPQDYNLRWSGLLVTVGEVLEKSLLN
FT                   VSRTDWHLAFTGMSRRQMIYSAAKAVAGMYKQRLPPRPM"
FT   gene            <20083007..20093735
FT                   /locus_tag="mCG_145144"
FT                   /note="gene_id=mCG145144.0"
FT   mRNA            join(<20083007..20083359,20085180..20085366,
FT                   20090674..20090773,20091704..20092649,20092738..20093735)
FT                   /locus_tag="mCG_145144"
FT                   /product="mCG145144"
FT                   /note="gene_id=mCG145144.0 transcript_id=mCT184568.0
FT                   created on 05-JUN-2003"
FT   CDS             <20092207..20092614
FT                   /codon_start=1
FT                   /locus_tag="mCG_145144"
FT                   /product="mCG145144"
FT                   /note="gene_id=mCG145144.0 transcript_id=mCT184568.0
FT                   protein_id=mCP106255.0"
FT                   /protein_id="EDL09863.1"
FT                   /translation="LIFLAPMVGYYDLVSKVIVHFELMSQLLTSQLLTSQLSTWLGWFV
FT                   CVCVCVCVCVCVCVCFSQNSVWGRGIANLVMVISLRTANIFLAAVDLIILTAKTMFLCL
FT                   FSQPASLSGSALGLLVQFGKSFSKGEGTGLS"
FT   gene            20148870..20158444
FT                   /locus_tag="mCG_147297"
FT                   /note="gene_id=mCG147297.0"
FT   mRNA            join(20148870..20149181,20157349..20158444)
FT                   /locus_tag="mCG_147297"
FT                   /product="mCG147297"
FT                   /note="gene_id=mCG147297.0 transcript_id=mCT187560.0
FT                   created on 13-JAN-2004"
FT   CDS             20157448..20157690
FT                   /codon_start=1
FT                   /locus_tag="mCG_147297"
FT                   /product="mCG147297"
FT                   /note="gene_id=mCG147297.0 transcript_id=mCT187560.0
FT                   protein_id=mCP109685.0"
FT                   /protein_id="EDL09862.1"
FT                   /translation="MDGGQPVPSPLVPLGNGSDYSMSLEQKTTFVFVILLFIFLGILIV
FT                   RCFRILLDPYRSMPTSTWADGLEGLEKGQFDHALA"
FT   gene            complement(<20210614..>20213905)
FT                   /locus_tag="mCG_145152"
FT                   /note="gene_id=mCG145152.0"
FT   mRNA            complement(join(<20210614..20211221,20213607..20213676,
FT                   20213831..>20213905))
FT                   /locus_tag="mCG_145152"
FT                   /product="mCG145152"
FT                   /note="gene_id=mCG145152.0 transcript_id=mCT184576.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(<20210614..>20210796)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145152"
FT                   /product="mCG145152"
FT                   /note="gene_id=mCG145152.0 transcript_id=mCT184576.0
FT                   protein_id=mCP106262.0"
FT                   /protein_id="EDL09861.1"
FT                   /translation="TGWNMKDGSHETLAGKTVPAGPDVRGVHMQGSLDLTSPLCSSNKN
FT                   KRNSKSSLEEECPLNI"
FT   gene            <20213959..20411711
FT                   /locus_tag="mCG_21819"
FT                   /note="gene_id=mCG21819.1"
FT   mRNA            join(<20213959..20214149,20218211..20218262,
FT                   20242984..20243082,20271067..20271198,20273148..20273204,
FT                   20346991..20347123,20411360..20411711)
FT                   /locus_tag="mCG_21819"
FT                   /product="mCG21819, transcript variant mCT21377"
FT                   /note="gene_id=mCG21819.1 transcript_id=mCT21377.2 created
FT                   on 07-OCT-2002"
FT   mRNA            join(20213959..20214149,20218211..20218262,
FT                   20242984..20243082,20245882..20246098)
FT                   /locus_tag="mCG_21819"
FT                   /product="mCG21819, transcript variant mCT174125"
FT                   /note="gene_id=mCG21819.1 transcript_id=mCT174125.0 created
FT                   on 07-OCT-2002"
FT   mRNA            join(<20214010..20214149,20218211..20218262,
FT                   20242984..20243082,20271067..20271198,20273148..20273204,
FT                   20411360..20411710)
FT                   /locus_tag="mCG_21819"
FT                   /product="mCG21819, transcript variant mCT190279"
FT                   /note="gene_id=mCG21819.1 transcript_id=mCT190279.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<20214031..20214149,20218211..20218262,
FT                   20242984..20243082,20271067..20271198,20273148..20273204,
FT                   20346991..20347123,20411360..20411586)
FT                   /codon_start=1
FT                   /locus_tag="mCG_21819"
FT                   /product="mCG21819, isoform CRA_c"
FT                   /note="gene_id=mCG21819.1 transcript_id=mCT21377.2
FT                   protein_id=mCP21543.2 isoform=CRA_c"
FT                   /protein_id="EDL09858.1"
FT                   /translation="GMRLVGVCPWTEDLNGPAKMGGCHSKKVVIPDIETSARCRSMLGS
FT                   YQSYIQSQNRTSGNSPDSGQTVFSLEHLEICLKEAEEKARALLEQLTASEATKSQLLEK
FT                   VSMLEGRLEDVNRKNVGGELYENMVLEKDKCIEKLQAEVKASQEKLNIHKLKHKKAVKK
FT                   LQTDLAIAKQEAAITVLELNEKIMTLCEGRPFPRATNSVEVLSGGLPPVEESDRKFSLI
FT                   MELSTQLSLQTEKITQLEDTLAEKEKKIEELEAECTSQVPQGEDRLTEDL"
FT   CDS             join(<20214031..20214149,20218211..20218262,
FT                   20242984..20243082,20271067..20271198,20273148..20273204,
FT                   20411360..20411431)
FT                   /codon_start=1
FT                   /locus_tag="mCG_21819"
FT                   /product="mCG21819, isoform CRA_b"
FT                   /note="gene_id=mCG21819.1 transcript_id=mCT190279.0
FT                   protein_id=mCP111281.0 isoform=CRA_b"
FT                   /protein_id="EDL09857.1"
FT                   /translation="GMRLVGVCPWTEDLNGPAKMGGCHSKKVVIPDIETSARCRSMLGS
FT                   YQSYIQSQNRTSGNSPDSGQTVFSLEHLEICLKEAEEKARALLEQLTASEATKSQLLEK
FT                   VSMLEGRLEDVNRKNVGGELYENMVLEKDKCIEKLQAEVKASQEKLNIHQPTQWKYSPE
FT                   VSHLWKKATGSFP"
FT   CDS             join(20214034..20214149,20218211..20218262,
FT                   20242984..20243082,20245882..20245899)
FT                   /codon_start=1
FT                   /locus_tag="mCG_21819"
FT                   /product="mCG21819, isoform CRA_a"
FT                   /note="gene_id=mCG21819.1 transcript_id=mCT174125.0
FT                   protein_id=mCP97044.0 isoform=CRA_a"
FT                   /protein_id="EDL09856.1"
FT                   /translation="MRLVGVCPWTEDLNGPAKMGGCHSKKVVIPDIETSARCRSMLGSY
FT                   QSYIQSQNRTSGNSPDSGQTVFSLEHLEICLKEAEEKARALLEQTSFSL"
FT   gene            complement(20225532..20232052)
FT                   /locus_tag="mCG_21818"
FT                   /note="gene_id=mCG21818.1"
FT   mRNA            complement(join(20225532..20226035,20228450..20228546,
FT                   20229255..20229407,20231918..20232052))
FT                   /locus_tag="mCG_21818"
FT                   /product="mCG21818"
FT                   /note="gene_id=mCG21818.1 transcript_id=mCT21376.1 created
FT                   on 08-OCT-2002"
FT   CDS             complement(join(20225900..20226035,20228450..20228546,
FT                   20229255..20229267))
FT                   /codon_start=1
FT                   /locus_tag="mCG_21818"
FT                   /product="mCG21818"
FT                   /note="gene_id=mCG21818.1 transcript_id=mCT21376.1
FT                   protein_id=mCP21537.1"
FT                   /protein_id="EDL09860.1"
FT                   /translation="MNVEEIGLGMSEEQLEEKEERLIWRTERKGDGFAVPRSEKKVSSV
FT                   KAATKQPLHFLSSPRVQITQHINQNQQAYFKVTNFL"
FT   gene            complement(20311170..>20317686)
FT                   /locus_tag="mCG_56487"
FT                   /note="gene_id=mCG56487.1"
FT   mRNA            complement(join(20311170..20311392,20315105..20315232,
FT                   20317577..>20317686))
FT                   /locus_tag="mCG_56487"
FT                   /product="mCG56487"
FT                   /note="gene_id=mCG56487.1 transcript_id=mCT56670.1 created
FT                   on 08-OCT-2002"
FT   CDS             complement(join(20311256..20311392,20315105..20315232,
FT                   20317577..>20317686))
FT                   /codon_start=1
FT                   /locus_tag="mCG_56487"
FT                   /product="mCG56487"
FT                   /note="gene_id=mCG56487.1 transcript_id=mCT56670.1
FT                   protein_id=mCP41578.1"
FT                   /protein_id="EDL09859.1"
FT                   /translation="SPFFSSHASARGKSSLAADTICSVTQHDPDGTNTFRRSHEQETSP
FT                   SGRGGTDPRRQQLLEAEWELLCHVGLLHSLHQGHISIIAELNHTTESHGPKTSNSWRAR
FT                   EKTVHIPDSSSTNPQKDMCT"
FT   gene            complement(20461583..>20467507)
FT                   /locus_tag="mCG_145147"
FT                   /note="gene_id=mCG145147.0"
FT   mRNA            complement(join(20461583..20463234,20465817..20466511,
FT                   20466763..20466872,20467002..>20467507))
FT                   /locus_tag="mCG_145147"
FT                   /product="mCG145147"
FT                   /note="gene_id=mCG145147.0 transcript_id=mCT184571.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(20462506..>20462766)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145147"
FT                   /product="mCG145147"
FT                   /note="gene_id=mCG145147.0 transcript_id=mCT184571.0
FT                   protein_id=mCP106258.0"
FT                   /protein_id="EDL09855.1"
FT                   /translation="SKASWGGEGFFGLHFKSLFIIEGRQGRDLEAGADEEAMEGCCIVP
FT                   CLLLMACSYRTQDHQLRGGTTLSHQLLMKKMSYWLAYSLML"
FT   gene            20557754..20625170
FT                   /gene="Slc12a2"
FT                   /locus_tag="mCG_21827"
FT                   /note="gene_id=mCG21827.1"
FT   mRNA            join(20557754..20558100,20574732..20574851,
FT                   20575794..20575869,20576509..20576604,20577710..20577849,
FT                   20578472..20578582,20579806..20579914,20582574..20582701,
FT                   20582788..20582872,20584403..20584554,20588691..20588798,
FT                   20590340..20590463,20591311..20591412,20592580..20592735,
FT                   20593883..20593982,20597930..20598041,20600219..20600359,
FT                   20604883..20604989,20608632..20608711,20610957..20611082,
FT                   20613433..20613480,20614789..20614911,20616141..20616252,
FT                   20618617..20618703,20619492..20619627,20620119..20620186,
FT                   20622282..20625170)
FT                   /gene="Slc12a2"
FT                   /locus_tag="mCG_21827"
FT                   /product="solute carrier family 12, member 2"
FT                   /note="gene_id=mCG21827.1 transcript_id=mCT21401.1 created
FT                   on 07-OCT-2002"
FT   CDS             join(20557996..20558100,20574732..20574851,
FT                   20575794..20575869,20576509..20576604,20577710..20577849,
FT                   20578472..20578582,20579806..20579914,20582574..20582701,
FT                   20582788..20582872,20584403..20584554,20588691..20588798,
FT                   20590340..20590463,20591311..20591412,20592580..20592735,
FT                   20593883..20593982,20597930..20598041,20600219..20600359,
FT                   20604883..20604989,20608632..20608711,20610957..20611082,
FT                   20613433..20613480,20614789..20614911,20616141..20616252,
FT                   20618617..20618703,20619492..20619627,20620119..20620186,
FT                   20622282..20622417)
FT                   /codon_start=1
FT                   /gene="Slc12a2"
FT                   /locus_tag="mCG_21827"
FT                   /product="solute carrier family 12, member 2"
FT                   /note="gene_id=mCG21827.1 transcript_id=mCT21401.1
FT                   protein_id=mCP21561.2"
FT                   /protein_id="EDL09854.1"
FT                   /translation="MDAVPRIDHYRHTAAQLGEKLLRPSLAELHDELEKEPFEDGFANG
FT                   EESTPTRDAVVAYTAESKGVVKFGWIKGVLVRCMLNIWGVMLFIRLSWIVGQAGIGLSV
FT                   VVIAMATVVTTITGLSTSAIATNGFVRGGGAYYLISRSLGPEFGGAIGLIFAFANAVAV
FT                   AMYVVGFAETVVELLKEHSILMIDEINDIRIIGAITVVILLGISVAGMEWEAKAQIVLL
FT                   VILLLAIADFVIGTFISLESKKPKGFFGYKSEIFNENFGPDFREEETFFSVFAIFFPAA
FT                   TGILAGANISGDLADPQSAIPKGTLLAILITTVVYIGIAVSVGSCVVRDATGNVNDTIT
FT                   TELTNCTSAACKLNFDFSYCESNTCSYGLMNNFQVMSMVSGFAPLISAGIFSATLSSAL
FT                   ASLVSAPKIFQALCKDNIYPAFQMFAKGYGKNNEPLRGYILTFLIALGFILIAELNVIA
FT                   PIISNFFLASYALINFSVFHASLAKSPGWRPAFKYYNMWISLIGAILCCIVMFVINWWA
FT                   ALLTYVIVLGLYIYVTYKKPDVNWGSSTQALTYLSALQHSIRLSGVEDHVKNFRPQCLV
FT                   MTGSPNSRPALLHLVHDFTKNVGLMICGHVHMGPRRQAMKEMSIDQARYQRWLIKNKMK
FT                   AFYAPVHADDLREGAQYLMQAAGLGRMKPNTLVLGFKKDWLQADMRDVDMYINLFHDAF
FT                   DIQFGVVVIRLKEGLDISHLQGQEELLSSQEKSPGTKDVVVNVDYSKKSDQDTCKSSGE
FT                   KSITQKDEEEDGKTPTQPLLKKESKGPIVPLNVADQKLLEASTQFQKKQGKNTIDVWWL
FT                   FDDGGLTLLIPYLLTTKKKWKDCKIRVFIGGKINRIDHDRRAMATLLSKFRIDFSDIMV
FT                   LGDINTKPKKENIIAFDDMIEPYRLHEDDKEQDIADKMKEDEPWRITDNELELYKTKTY
FT                   RQIRLNELLKEHSSTANIIVMSLPVARKGAVSSALYMAWLEALSKDLPPVLLVRGNHQS
FT                   VLTFYS"
FT   gene            complement(20686942..>20894307)
FT                   /gene="Fbn2"
FT                   /locus_tag="mCG_124634"
FT                   /note="gene_id=mCG124634.1"
FT   mRNA            complement(join(20686942..20688948,20690532..20690709,
FT                   20691949..20692180,20697034..20697153,20698667..20698795,
FT                   20699371..20699487,20701528..20701650,20703381..20703506,
FT                   20704688..20704894,20706173..20706298,20713688..20713819,
FT                   20714262..20714384,20715380..20715499,20716120..20716245,
FT                   20716591..20716656,20717690..20717842,20718458..20718583,
FT                   20721972..20722091,20722670..20722798,20723748..20723864,
FT                   20726406..20726531,20727044..20727169,20727310..20727435,
FT                   20728720..20728788,20731474..20731626,20732180..20732305,
FT                   20733358..20733483,20733946..20734014,20734725..20734886,
FT                   20736884..20737006,20737857..20737979,20740163..20740288,
FT                   20742029..20742151,20744516..20744638,20746785..20746910,
FT                   20747647..20747772,20747926..20748048,20748467..20748592,
FT                   20750313..20750438,20751074..20751202,20754514..20754633,
FT                   20755140..20755367,20758674..20758799,20759252..20759302,
FT                   20759836..20759973,20763094..20763213,20769101..20769226,
FT                   20771822..20771947,20773784..20773837,20774512..20774664,
FT                   20781077..20781199,20782729..20782851,20787912..20788037,
FT                   20789110..20789229,20796111..20796248,20797259..20797471,
FT                   20798460..20798612,20807343..20807468,20832146..20832271,
FT                   20836960..20837157,20873182..20873277,20888222..20888310,
FT                   20893101..20893183,20894054..>20894307))
FT                   /gene="Fbn2"
FT                   /locus_tag="mCG_124634"
FT                   /product="fibrillin 2, transcript variant mCT125882"
FT                   /note="gene_id=mCG124634.1 transcript_id=mCT125882.1
FT                   created on 07-OCT-2002"
FT   CDS             complement(join(20688574..20688948,20690532..20690709,
FT                   20691949..20692180,20697034..20697153,20698667..20698795,
FT                   20699371..20699487,20701528..20701650,20703381..20703506,
FT                   20704688..20704894,20706173..20706298,20713688..20713819,
FT                   20714262..20714384,20715380..20715499,20716120..20716245,
FT                   20716591..20716656,20717690..20717842,20718458..20718583,
FT                   20721972..20722091,20722670..20722798,20723748..20723864,
FT                   20726406..20726531,20727044..20727169,20727310..20727435,
FT                   20728720..20728788,20731474..20731626,20732180..20732305,
FT                   20733358..20733483,20733946..20734014,20734725..20734886,
FT                   20736884..20737006,20737857..20737979,20740163..20740288,
FT                   20742029..20742151,20744516..20744638,20746785..20746910,
FT                   20747647..20747772,20747926..20748048,20748467..20748592,
FT                   20750313..20750438,20751074..20751202,20754514..20754633,
FT                   20755140..20755367,20758674..20758799,20759252..20759302,
FT                   20759836..20759973,20763094..20763213,20769101..20769226,
FT                   20771822..20771947,20773784..20773837,20774512..20774664,
FT                   20781077..20781199,20782729..20782851,20787912..20788037,
FT                   20789110..20789229,20796111..20796248,20797259..20797471,
FT                   20798460..20798612,20807343..20807468,20832146..20832271,
FT                   20836960..20837157,20873182..20873277,20888222..20888310,
FT                   20893101..>20893162))
FT                   /codon_start=1
FT                   /gene="Fbn2"
FT                   /locus_tag="mCG_124634"
FT                   /product="fibrillin 2, isoform CRA_a"
FT                   /note="gene_id=mCG124634.1 transcript_id=mCT125882.1
FT                   protein_id=mCP78048.1 isoform=CRA_a"
FT                   /protein_id="EDL09852.1"
FT                   /translation="IPLLLLPRMEDAPWRKSMHCPHLQEQLWRWILFPPQHVYLFQWTN
FT                   IPDMRTVCENGCQNGGRCIGPNRCACVYGFTGPQCERDYRTGPCFTQVNNQMCQGQLTG
FT                   IVCTKTLCCATIGRAWGHPCEMCPAQPQPCRRGFIPNIRTGACQDVDECQAIPGLCQGG
FT                   NCINTVGSFECRCPAGHKQSETTQKCEDIDECSVIPGVCETGDCSNTVGSYFCLCPRGF
FT                   VTSTDGSRCIDQRAGTCFSGLVNGRCAQELPGRMAKAQCCCEPGRCWSIGTIPEACPVR
FT                   GSEEYRRLCLDGLPMGGIPGSSVSRPGGTGSNGNGYGPGGTGFLPIPGDNGFSPGVGGA
FT                   GVGAGGQGPIITGLTILNQTIDICKHHANLCLNGRCIPTVSSYRCECNMGYKQDANGDC
FT                   IDVDECTSNPCSNGDCVNTPGSYYCKCHAGFQRTPTKQACIDIDECIQNGVLCKNGRCV
FT                   NTDGSFQCICNAGFELTTDGKNCVDHDECTTTNMCLNGMCINEDGSFKCVCKPGFVLAP
FT                   NGRYCTDVDECQTPGICMNGHCINNEGSFRCDCPPGLAVGVDGRVCVDTHMRSTCYGEI
FT                   KKGVCVRPFPGAVTKSECCCANPDYGFGEPCQPCPAKNSAEFHGLCSSGIGITVDGRDI
FT                   NECALDPDICANGICENLRGSYRCNCNSGYEPDASGRNCIDIDECLVNRLLCDNGLCRN
FT                   TPGSYSCTCPPGYVFRTETETCEDVNECESNPCVNGACRNNLGSFHCECSPGSKLSSTG
FT                   LICIDSLKGTCWLNIQDNRCEVNINGATLKSECCATLGAAWGSPCERCELDAACPRGFA
FT                   RIKGVTCEDVNECEVFPGVCPNGRCVNSKGSFHCECPEGLTLDGTGRVCLDIRMEHCFL
FT                   KWDEDECIHPVPGKFRMDACCCAVGAAWGTECEECPKPGTKEYETLCPRGPGFANRGDI
FT                   LTGRPFYKDINECKAFPGMCTYGKCRNTIGSFKCRCNNGFALDMEERNYIDECRISPDL
FT                   CGSGICVNTPGSFECECFEGYESGFMMMKNCMDIDECERNPLLCRGGTCVNTEGSFQCD
FT                   CPLGHELSPSREDCVDINECSLSDNLCRNGKCVNMIGTYQCSCNPGYQATPDRQGCTDI
FT                   DECMIMNGGCDTQCTNSEGSYECSCSEGYALMPDGRSCADIDECENNPDICDGGQCTNI
FT                   PGEYRCLCYDGFMASMDMKTCIDVNECDLNPNICMFGECENTKGSFICHCQLGYSVKKG
FT                   TTGCTDVDECEIGAHNCDMHASCLNVPGSFKCSCREGWVGNGIKCIDLDECANGTHQCS
FT                   INAQCVNTPGSYQCACSEGFTGDGFTCSDVDECAENTNLCENGQCLNVPGAYRCECEMG
FT                   FTPASDSRSCQDIDECSFQNICVFGTCNNLPGMFHCICDDGYELDRTGGNCTDIDECAD
FT                   PINCVNGLCVNTPGRYECNCPPDFQLNPTGVGCVDNRVGNCYLKFGPRGDGSLSCNTEV
FT                   GVGVSRSSCCCSLGKAWGNPCETCPPVNSTEYYTLCPGGEGFRPNPITIILEDIDECQE
FT                   LPGLCQGGNCINTFGSFQCECPQGYYLSEETRICEDIDECFAHPGVCGPGTCYNTLGNY
FT                   TCICPPEYMQVNGGHNCMDMRKSFCYRSYNGTTCENELPFNVTKRMCCCTYNVGKAWNK
FT                   PCEPCPTPGTADFKTICGNIPGFTFDIHTGKAVDIDECKEIPGICANGVCINQIGSFRC
FT                   ECPTGFSYNDLLLVCEDIDECSNGDNLCQRNADCINSPGSYRCECAAGFKLSPNGACVD
FT                   RNECLEIPNVCSHGLCVDLQGSYQCICNNGFKASQDQTMCMDVDECERHPCGNGTCKNT
FT                   VGSYNCLCYPGFELTHNNDCLDIDECSSFFGQVCRNGRCFNEIGSFKCLCNEGYELTPD
FT                   GKNCIDTNECVALPGSCSPGTCQNLEGSFRCICPPGYEVRSENCIDINECDEDPNICLF
FT                   GSCTNTPGGFQCICPPGFVLSDNGRRCFDTRQSFCFTNFENGKCSVPKAFNTTKAKCCC
FT                   SKMPGEGWGDPCELCPKDDEVAFQDLCPYGHGTVPSLHDTREDVNECLESPGICSNGQC
FT                   INTDGSFRCECPMGYNLDYTGVRCVDTDECSIGNPCGNGTCTNVIGSFECTCNEGFEPG
FT                   PMMNCEDINECAQNPLLCAFRCMNTFGSYECTCPVGYALREDQKMCKDLDECAEGLHDC
FT                   ESRGMMCKNLIGTFMCICPPGMARRPDGEGCVDENECRTKPGICENGRCVNIIGSYRCE
FT                   CNEGFQSSSSGTECLDNRQGLCFAEVLQTMCQMASSSRNLVTKSECCCDGGRGWGHQCE
FT                   LCPLPGTAQYKKICPHGPGYATDGRDIDECKVMPSLCTNGQCVNTMGSFRCFCKVGYTT
FT                   DISGTACVDLDECSQSPKPCNFICKNTKGSYQCSCPRGYVLQEDGKTCKDLDECQTKQH
FT                   NCQFLCVNTLGGFTCKCPPGFTQHHTACIDNNECGSQPSLCGAKGICQNTPGSFSCECQ
FT                   RGFSLDASGLNCEDVDECDGNHRCQHGCQNILGGYRCGCPQGYVQHYQWNQCVDENECS
FT                   NPGACGSASCYNTLGSYKCACPSGFSFDQFSSACHDVNECSSSKNPCSYGCSNTEGGYL
FT                   CGCPPGYFRVGQGHCVSGMGFNKGQYLSVDAEAEDDENALSPEACYECKINGYTKKDGR
FT                   RKRSAQEPEPASAEEQISLESVAMDSPVNMKFNLSGLGSKEHILELVPAIEPLNNHIRY
FT                   VISQGNEDGVFRIHQRNGLSYLHTAKKKLAPGTYTLEITSIPLYGKKELRKLEEHNEDD
FT                   YLLGVLGEALRMRLQIQLY"
FT   mRNA            complement(join(20744223..20744638,20746785..20746910,
FT                   20747647..20747772,20747926..20748048,20748467..20748592,
FT                   20750313..20750438,20751074..20751208,20754514..20754633,
FT                   20755140..20755367,20758674..20758799,20759252..20759302,
FT                   20759836..20759973,20763094..20763213,20769101..20769226,
FT                   20771822..20771947,20773784..20773837,20774512..20774664,
FT                   20781077..20781199,20782729..20782851,20787912..20788037,
FT                   20789110..20789229,20796111..20796248,20797259..20797471,
FT                   20798460..20798601,20807343..20807468,20832146..20832271,
FT                   20836960..20837157,20873182..20873275,20888213..20888310,
FT                   20893101..20893183,20894054..>20894307))
FT                   /gene="Fbn2"
FT                   /locus_tag="mCG_124634"
FT                   /product="fibrillin 2, transcript variant mCT174093"
FT                   /note="gene_id=mCG124634.1 transcript_id=mCT174093.0
FT                   created on 07-OCT-2002"
FT   CDS             complement(join(20798519..20798601,20807343..20807468,
FT                   20832146..20832271,20836960..20837157,20873182..20873275,
FT                   20888213..20888310,20893101..20893183,20894054..20894307))
FT                   /codon_start=1
FT                   /gene="Fbn2"
FT                   /locus_tag="mCG_124634"
FT                   /product="fibrillin 2, isoform CRA_b"
FT                   /note="gene_id=mCG124634.1 transcript_id=mCT174093.0
FT                   protein_id=mCP97012.0 isoform=CRA_b"
FT                   /protein_id="EDL09853.1"
FT                   /translation="MGRRRRLCLQPYFVWLGCVALWAQGTDGQPQPPPPKTLRPQPPPQ
FT                   QVRPAVAGSEGGFMGPEYRDEGAVAASRVRRRGQQEILRGPNVCGSRFHSYCCPGWKTL
FT                   PGGNQCIVPICRNSCGDGFCSRPNMCTCSSGQISPTCGAKSVCENGCQNGGRCIGPNRC
FT                   ACVYGFTGPQCERDYRTGPCFTQVNNQMCQGQLTGIVCTKTLCCATIGRAWGHPCEMCP
FT                   AQPQPCRRGFIPNIRTGACQDVDECQAIPGLCQGGNCINTVGSFECRCPAGHKQSETTQ
FT                   KCEDIDECSVIPGVCETGDCSNTVGSYFCLCPRGFVTSTDGSRCIGNMLLRPGEWPLCP
FT                   RTPGPNGKSSMLL"
FT   gene            <21226410..21282995
FT                   /locus_tag="mCG_12542"
FT                   /note="gene_id=mCG12542.1"
FT   mRNA            join(<21226410..21227114,21242200..21242403,
FT                   21249980..21250138,21252383..21252507,21268730..21268924,
FT                   21275209..21275299,21277749..21277947,21279295..21279392,
FT                   21279919..21280049,21282304..21282995)
FT                   /locus_tag="mCG_12542"
FT                   /product="mCG12542"
FT                   /note="gene_id=mCG12542.1 transcript_id=mCT13210.1 created
FT                   on 07-OCT-2002"
FT   CDS             join(<21226601..21227114,21242200..21242403,
FT                   21249980..21250138,21252383..21252507,21268730..21268924,
FT                   21275209..21275299,21277749..21277947,21279295..21279392,
FT                   21279919..21280049,21282304..21282480)
FT                   /codon_start=1
FT                   /locus_tag="mCG_12542"
FT                   /product="mCG12542"
FT                   /note="gene_id=mCG12542.1 transcript_id=mCT13210.1
FT                   protein_id=mCP21517.1"
FT                   /protein_id="EDL09851.1"
FT                   /translation="DPSGLLEVWAPMLLSWLTGLGAGLLSLHFLQKLLFPYFWDDFWYL
FT                   LKVVRYGIQMEMYKLRGELVTVLDKFLSHTRKQPRKAFIIYEGDVYTYEDVDKRSNRIA
FT                   HALLNHSSLKRGDVVALLMSNEPDFVHVWFGLAKLGCVVAFLNSNLRFDSLLHCINTCE
FT                   PTAVVVGGDLLGSIEEILPSLPKHVRVWGMKDSVPEGIDSLQEKLSLASDEPVPPSHHV
FT                   TSSLKSTCLYIFTSGTTGLPKAAVISQLQVLKGSVGLWAFGCTADDIIYITLPLYHSSG
FT                   SLLGIGGCVELGATCVLKKKFSASQFWNDCKKYNVTVFQYIGELCRYLCKQPQREGEKD
FT                   HRVRLAVGNGLSSDVWRQFLDRFGNIKMCELYGATEGNIVFMNHTGKIGSVGRANFFYS
FT                   LFFSFELIKYDFQKDEPWRNGQGWCSCVRKGEPGLLISRVNKKNPFFGYAGSDTHTKSK
FT                   LLFDVFRKGDVYFNTGDLMFQDQENFVYFWDRLGDTFRWKGENVATTEVADVLGRLDFI
FT                   QEANVYGVRVPGYEGKAGMTSVILKPNKSLDLEKMYNQVVTSLPAYACPLFLRIQDKME
FT                   TTGTFKLKKLQLVEEGFDPLKISDPLYFMDNLKKSYVPLTEEIYNQIMSEEVKL"
FT   gene            21329692..21350601
FT                   /gene="Isoc1"
FT                   /locus_tag="mCG_124636"
FT                   /note="gene_id=mCG124636.1"
FT   mRNA            join(21329692..21330007,21341447..21341566,
FT                   21341687..21341890,21343489..21343605,21348005..21350601)
FT                   /gene="Isoc1"
FT                   /locus_tag="mCG_124636"
FT                   /product="isochorismatase domain containing 1"
FT                   /note="gene_id=mCG124636.1 transcript_id=mCT125884.1
FT                   created on 07-OCT-2002"
FT   CDS             join(21329702..21330007,21341447..21341566,
FT                   21341687..21341890,21343489..21343605,21348005..21348151)
FT                   /codon_start=1
FT                   /gene="Isoc1"
FT                   /locus_tag="mCG_124636"
FT                   /product="isochorismatase domain containing 1"
FT                   /note="gene_id=mCG124636.1 transcript_id=mCT125884.1
FT                   protein_id=mCP77352.0"
FT                   /protein_id="EDL09850.1"
FT                   /translation="MAAAEPSVAALAGGGVGAGAPSGGVPVLFCFSVFARPASVPHGAG
FT                   YDVLIQKFLSLYGDQLDMHRKFVVQLFAEEWGQYVDLPKGFAVSERCKLRLVPLQIQLT
FT                   TLGNLTPPSTVFFCCDMQERFRPAIKYFGDIISVGQRLLQGARILGIPVIITEQYPKGL
FT                   GSTVQEIDLTGVKLVLPKTKFSMVLPEVEAALAEIPGVRSVVLFGVETHVCIQQTALEL
FT                   VGRGIEVHIVADATSSRSMMDRMFALERLARTGIIVTTSEAVLLQLVADKDHPKFKEIQ
FT                   NLIKASAPESGLLSKV"
FT   gene            21451828..21460175
FT                   /locus_tag="mCG_147306"
FT                   /note="gene_id=mCG147306.0"
FT   mRNA            join(21451828..21451879,21457720..21460175)
FT                   /locus_tag="mCG_147306"
FT                   /product="mCG147306"
FT                   /note="gene_id=mCG147306.0 transcript_id=mCT187569.0
FT                   created on 13-JAN-2004"
FT   CDS             21458461..21458640
FT                   /codon_start=1
FT                   /locus_tag="mCG_147306"
FT                   /product="mCG147306"
FT                   /note="gene_id=mCG147306.0 transcript_id=mCT187569.0
FT                   protein_id=mCP109695.0"
FT                   /protein_id="EDL09849.1"
FT                   /translation="MRGNNQDPLHTEPSKLYFRQIMKELSPESSLYIPQKTPTLYTDPR
FT                   SATFIAAQYTTARK"
FT   gene            21514661..21726117
FT                   /gene="Adamts19"
FT                   /locus_tag="mCG_141254"
FT                   /note="gene_id=mCG141254.0"
FT   mRNA            join(21514661..21515259,21515804..21516453,
FT                   21568513..21568678,21579099..21579271,21580342..21580425,
FT                   21581146..21581303,21606314..21606357,21621431..21621536,
FT                   21631383..21631523,21633549..21633699,21642505..21642606,
FT                   21647771..21647901,21648979..21649103,21651750..21651877,
FT                   21664193..21664313,21667900..21667980,21680399..21680580,
FT                   21684088..21684241,21697626..21697761,21704954..21705131,
FT                   21706069..21706236,21721973..21722150,21725716..21726117)
FT                   /gene="Adamts19"
FT                   /locus_tag="mCG_141254"
FT                   /product="a disintegrin-like and metallopeptidase
FT                   (reprolysin type) with thrombospondin type 1 motif, 19,
FT                   transcript variant mCT174091"
FT                   /note="gene_id=mCG141254.0 transcript_id=mCT174091.0
FT                   created on 07-OCT-2002"
FT   mRNA            join(<21515172..21515259,21515804..21516453,
FT                   21568513..21568678,21579099..21579271,21580342..21580425,
FT                   21581146..21581303,21606314..21606357,21621431..21621536,
FT                   21631383..21631523,21633549..21633699,21642505..21642606,
FT                   21647771..21647901,21648931..21649103,21651750..21651877,
FT                   21664193..21664313,21667900..21667980,21680423..21680580,
FT                   21684088..21684241,21697626..21697761,21704954..21705158,
FT                   21706069..21706221,21721973..21722150,21725716..>21725867)
FT                   /gene="Adamts19"
FT                   /locus_tag="mCG_141254"
FT                   /product="a disintegrin-like and metallopeptidase
FT                   (reprolysin type) with thrombospondin type 1 motif, 19,
FT                   transcript variant mCT190297"
FT                   /note="gene_id=mCG141254.0 transcript_id=mCT190297.0
FT                   created on 08-MAR-2004"
FT   CDS             join(21515172..21515259,21515804..21516453,
FT                   21568513..21568678,21579099..21579271,21580342..21580425,
FT                   21581146..21581303,21606314..21606357,21621431..21621536,
FT                   21631383..21631523,21633549..21633699,21642505..21642606,
FT                   21647771..21647901,21648931..21649103,21651750..21651877,
FT                   21664193..21664313,21667900..21667980,21680423..21680580,
FT                   21684088..21684241,21697626..21697761,21704954..21705158,
FT                   21706069..21706221,21721973..21722150,21725716..21725867)
FT                   /codon_start=1
FT                   /gene="Adamts19"
FT                   /locus_tag="mCG_141254"
FT                   /product="a disintegrin-like and metallopeptidase
FT                   (reprolysin type) with thrombospondin type 1 motif, 19,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG141254.0 transcript_id=mCT190297.0
FT                   protein_id=mCP111269.0 isoform=CRA_b"
FT                   /protein_id="EDL09848.1"
FT                   /translation="MGPEMRLTRICCCCCLLYQLGFLSHGTTSGLQLTPDLEEWEVVFP
FT                   ALWRRESLNATGLSGGSSDPGSGRSSGGGGRGQASGSSREVRSVARAPQEEATRGQSEP
FT                   WFGSPLEPGAEDEEELESQELPRGSSGDTALSSGTPASWQPPLPPQRPSSPPPAQQEEP
FT                   SAEEVLLRIPALSRDLYLLLRRDGRFLAQRFAVEQWPKPGPDPTRATADPGSSLLPDAS
FT                   CFYTGTVLRHPGSLASFSTCGGGLMGFIQLNEDFLFIEPFNDTMAIIGHPHRLYRQKRS
FT                   TEEKVTENSAVHRHHCGVISDKGRPRSKKIADNRREKRYSYKLSQEYNIETVVVADPAM
FT                   VSYHGADAARRFILTILNMVFNLFQHKSLGVQVNLRVLKLILLHETPADLYIGHHGEKM
FT                   LESFCKWQHEEFGRRNDVHLEMSTSWGEDIAAVDAAILITRKDFCVHKDEPCDTVGIAY
FT                   LNGMCSEKRKCIIAEDNGLNLAFTIAHEMGHNMGINHDNDHPSCADGLHIMSGEWIKGQ
FT                   NLGDVSWSRCSKEDLERFLRSKASSCLLHTDPQSLSSVLVPSKLPGMAYTADEQCQILF
FT                   GPLASFCQEMQHVICTGLWCKVEGEAECRTKLDPPMDGTDCDPGKWCKAGECTRRTPAP
FT                   EHLAGEWSPWSSCSRSCSSGVSSRERKCPGLGSEARDCNGPRKQYRICENPPCPAGLPG
FT                   FRDWQCQAYSVRTSYPKHALQWQAVFDEEKPCALFCSPVGKEQPVLLSEKVMDGTSCGY
FT                   QGLDICANGRCQKAGCDGLLGSLAREDHCGVCNGNGKSCKVIKGDFNHTRGAGYVEVLV
FT                   IPAGARRIKVVEEKPAHSFLALRDASKQSINSDWKIEHSGAFSLAGTTVHYLRRGLWEK
FT                   ISAKGPTTTPLHLLVLLFQDQNYGLHYEYTVPSDPLPDNQSSKEPGPLFMWTHAGWGDC
FT                   NATCGGGERKTMVSCTKIMSKNISLVDNKKCKDLTKPEPQIRKCNEQPCQTRWMMTEWT
FT                   TCSRTCGKGVQSRQVACTQQLENGTLIRAWERDCLGPKPATVQRCEGQDCMTVWEAGVW
FT                   SECSVKCGKGVRHRTVRCTNPRKKCVLSTRPREAEDCEDYSKCYVWRVGDWSKCSITCG
FT                   KGMQSRVIQCMHKITGRHGNECFSSEKPAAYRPCHLQPCNEKINVNTITSPRLAALTFK
FT                   CLGDQWPVYCRVIREKNLCQDMRWYQRCCETCRDFYAQKLQQKS"
FT   CDS             join(21515172..21515259,21515804..21516453,
FT                   21568513..21568678,21579099..21579271,21580342..21580425,
FT                   21581146..21581303,21606314..21606357,21621431..21621536,
FT                   21631383..21631523,21633549..21633699,21642505..21642606,
FT                   21647771..21647901,21648979..21649103,21651750..21651877,
FT                   21664193..21664313,21667900..21667980,21680399..21680580,
FT                   21684088..21684241,21697626..21697761,21704954..21705131,
FT                   21706069..21706236,21721973..21722150,21725716..21725867)
FT                   /codon_start=1
FT                   /gene="Adamts19"
FT                   /locus_tag="mCG_141254"
FT                   /product="a disintegrin-like and metallopeptidase
FT                   (reprolysin type) with thrombospondin type 1 motif, 19,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG141254.0 transcript_id=mCT174091.0
FT                   protein_id=mCP97010.0 isoform=CRA_a"
FT                   /protein_id="EDL09847.1"
FT                   /translation="MGPEMRLTRICCCCCLLYQLGFLSHGTTSGLQLTPDLEEWEVVFP
FT                   ALWRRESLNATGLSGGSSDPGSGRSSGGGGRGQASGSSREVRSVARAPQEEATRGQSEP
FT                   WFGSPLEPGAEDEEELESQELPRGSSGDTALSSGTPASWQPPLPPQRPSSPPPAQQEEP
FT                   SAEEVLLRIPALSRDLYLLLRRDGRFLAQRFAVEQWPKPGPDPTRATADPGSSLLPDAS
FT                   CFYTGTVLRHPGSLASFSTCGGGLMGFIQLNEDFLFIEPFNDTMAIIGHPHRLYRQKRS
FT                   TEEKVTENSAVHRHHCGVISDKGRPRSKKIADNRREKRYSYKLSQEYNIETVVVADPAM
FT                   VSYHGADAARRFILTILNMVFNLFQHKSLGVQVNLRVLKLILLHETPADLYIGHHGEKM
FT                   LESFCKWQHEEFGRRNDVHLEMSTSWGEDIAAVDAAILITRKDFCVHKDEPCDTVGIAY
FT                   LNGMCSEKRKCIIAEDNGLNLAFTIAHEMGHNMGINHDNDHPSCADGLHIMSGEWIKGQ
FT                   NLGDVSWSRCSKEDLERFLRSKASSCLLHTDPQSLSSVLVPSKLPGMAYTADEQCQILF
FT                   GPLASFCQEMQHVICTGLWCKVEGEAECRTKLDPPMDGTDCDPGKWCKAGECTRRTPAP
FT                   EHLAGEWSPWSSCSRSCSSGVSSRERKCPGICENPPCPAGLPGFRDWQCQAYSVRTSYP
FT                   KHALQWQAVFDEEKPCALFCSPVGKEQPVLLSEKVMDGTSCGYQGLDICANGRCQKAGC
FT                   DGLLGSLAREDHCGVCNGNGKSCKVIKGDFNHTRGAGYVEVLVIPAGARRIKVVEEKPA
FT                   HSFLDRVLHLFIALRDASKQSINSDWKIEHSGAFSLAGTTVHYLRRGLWEKISAKGPTT
FT                   TPLHLLVLLFQDQNYGLHYEYTVPSDPLPDNQSSKEPGPLFMWTHAGWGDCNATCGGGE
FT                   RKTMVSCTKIMSKNISLVDNKKCKDLTKPEPQIRKCNEQPCQTRWMMTEWTTCSRTCGK
FT                   GVQSRQVACTQQLENGTLIRAWERDCLGPKPATVQRCEGQDCMTCSVKCGKGVRHRTVR
FT                   CTNPRKKCVLSTRPREAEDCEDYSKCYVWRVGDWSKVRMICCSITCGKGMQSRVIQCMH
FT                   KITGRHGNECFSSEKPAAYRPCHLQPCNEKINVNTITSPRLAALTFKCLGDQWPVYCRV
FT                   IREKNLCQDMRWYQRCCETCRDFYAQKLQQKS"
FT   gene            21738954..21749024
FT                   /gene="A730017C20Rik"
FT                   /locus_tag="mCG_12547"
FT                   /note="gene_id=mCG12547.1"
FT   mRNA            join(21738954..21739008,21739940..21740112,
FT                   21745316..21745540,21748681..21749024)
FT                   /gene="A730017C20Rik"
FT                   /locus_tag="mCG_12547"
FT                   /product="RIKEN cDNA A730017C20, transcript variant
FT                   mCT13215"
FT                   /note="gene_id=mCG12547.1 transcript_id=mCT13215.2 created
FT                   on 10-FEB-2003"
FT   mRNA            join(21738955..21739008,21745316..21745540,
FT                   21748681..21749024)
FT                   /gene="A730017C20Rik"
FT                   /locus_tag="mCG_12547"
FT                   /product="RIKEN cDNA A730017C20, transcript variant
FT                   mCT174095"
FT                   /note="gene_id=mCG12547.1 transcript_id=mCT174095.0 created
FT                   on 10-FEB-2003"
FT   mRNA            join(21738955..21739008,21740014..21740112,
FT                   21745316..21745540,21748681..21748956)
FT                   /gene="A730017C20Rik"
FT                   /locus_tag="mCG_12547"
FT                   /product="RIKEN cDNA A730017C20, transcript variant
FT                   mCT174096"
FT                   /note="gene_id=mCG12547.1 transcript_id=mCT174096.1 created
FT                   on 10-FEB-2003"
FT   mRNA            join(21738955..21740112,21745316..21747787)
FT                   /gene="A730017C20Rik"
FT                   /locus_tag="mCG_12547"
FT                   /product="RIKEN cDNA A730017C20, transcript variant
FT                   mCT179942"
FT                   /note="gene_id=mCG12547.1 transcript_id=mCT179942.0 created
FT                   on 10-FEB-2003"
FT   CDS             join(21740062..21740112,21745316..21745540,
FT                   21748681..21748860)
FT                   /codon_start=1
FT                   /gene="A730017C20Rik"
FT                   /locus_tag="mCG_12547"
FT                   /product="RIKEN cDNA A730017C20, isoform CRA_a"
FT                   /note="gene_id=mCG12547.1 transcript_id=mCT13215.2
FT                   protein_id=mCP21478.2 isoform=CRA_a"
FT                   /protein_id="EDL09843.1"
FT                   /translation="MPAYQEDREEDTCTIGEREKTIATQRIKGFGVENPVLPESPPASM
FT                   SSVMKNNPLYGDITLEEAMEERKKSPSWTIEEYDKHSVHTNLSGHLKENPNDLRFWLGD
FT                   TYTPGFDTLLKKKKKRNKRSKLCHMGLILLLVASILVTIVTLSTIFS"
FT   CDS             join(21740062..21740112,21745316..21745540,
FT                   21748681..21748860)
FT                   /codon_start=1
FT                   /gene="A730017C20Rik"
FT                   /locus_tag="mCG_12547"
FT                   /product="RIKEN cDNA A730017C20, isoform CRA_a"
FT                   /note="gene_id=mCG12547.1 transcript_id=mCT174096.1
FT                   protein_id=mCP97014.0 isoform=CRA_a"
FT                   /protein_id="EDL09844.1"
FT                   /translation="MPAYQEDREEDTCTIGEREKTIATQRIKGFGVENPVLPESPPASM
FT                   SSVMKNNPLYGDITLEEAMEERKKSPSWTIEEYDKHSVHTNLSGHLKENPNDLRFWLGD
FT                   TYTPGFDTLLKKKKKRNKRSKLCHMGLILLLVASILVTIVTLSTIFS"
FT   CDS             join(21740062..21740112,21745316..21745573)
FT                   /codon_start=1
FT                   /gene="A730017C20Rik"
FT                   /locus_tag="mCG_12547"
FT                   /product="RIKEN cDNA A730017C20, isoform CRA_b"
FT                   /note="gene_id=mCG12547.1 transcript_id=mCT179942.0
FT                   protein_id=mCP102864.0 isoform=CRA_b"
FT                   /protein_id="EDL09845.1"
FT                   /translation="MPAYQEDREEDTCTIGEREKTIATQRIKGFGVENPVLPESPPASM
FT                   SSVMKNNPLYGDITLEEAMEERKKSPSWTIEEYDKHSVHTNLSGHLKVCVLRMVSNG"
FT   CDS             join(21745397..21745540,21748681..21748860)
FT                   /codon_start=1
FT                   /gene="A730017C20Rik"
FT                   /locus_tag="mCG_12547"
FT                   /product="RIKEN cDNA A730017C20, isoform CRA_c"
FT                   /note="gene_id=mCG12547.1 transcript_id=mCT174095.0
FT                   protein_id=mCP97015.0 isoform=CRA_c"
FT                   /protein_id="EDL09846.1"
FT                   /translation="MSSVMKNNPLYGDITLEEAMEERKKSPSWTIEEYDKHSVHTNLSG
FT                   HLKENPNDLRFWLGDTYTPGFDTLLKKKKKRNKRSKLCHMGLILLLVASILVTIVTLST
FT                   IFS"
FT   gene            21848222..22081259
FT                   /locus_tag="mCG_51595"
FT                   /note="gene_id=mCG51595.2"
FT   mRNA            join(21848222..21848265,21848314..21849349,
FT                   21852130..21852413,22078835..22081259)
FT                   /locus_tag="mCG_51595"
FT                   /product="mCG51595"
FT                   /note="gene_id=mCG51595.2 transcript_id=mCT174420.0 created
FT                   on 17-OCT-2002"
FT   CDS             join(21848542..21849349,21852130..21852413,
FT                   22078835..22080397)
FT                   /codon_start=1
FT                   /locus_tag="mCG_51595"
FT                   /product="mCG51595"
FT                   /note="gene_id=mCG51595.2 transcript_id=mCT174420.0
FT                   protein_id=mCP97339.0"
FT                   /db_xref="GOA:Q5DTK1"
FT                   /db_xref="InterPro:IPR008428"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="MGI:MGI:1926173"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5DTK1"
FT                   /protein_id="EDL09842.1"
FT                   /translation="MAVRSRRPWVSVALGLVLGFTAASWLIAPRVAELSEKRRRGSSLC
FT                   SYYGRSATGPRADAQQLLPQPQSRPRLEQSPPPASHELPGPQQPEAAPGGPSFRSSPWQ
FT                   QPALLPQRRRGHTPEGATALPGAPAAKGEPEEEDGGAADPRKGGRPGSSHNGSGDGGAA
FT                   VPTSGPGDFLYVGVMTAQKYLGSRALAAQRTWARFIPGRVEFFSSQQSPSAALGQPPPP
FT                   LPVIALPGVDDSYPPQKKSFMMIKYMHDHYLDKYEWFMRADDDVYIKGDKLEEFLRSLN
FT                   SSKPLYLGQTGLGNTEELGKLGLEPGENFCMGGPGMIFSREVLRRMVPHIGECLREMYT
FT                   THEDVEVGRCVRRFGGTQCVWSYEMQQLFHENYEHNRKGYIQDLHNSKIHAAITLHPNK
FT                   RPAYQYRLHNYMLSRKISELRYRTIQLHRESALMSKLSNSEVSKEDQQLGRTPSFNHFQ
FT                   PRERNEVMEWEFLTGKLLYSAAENQPPRQSINSILRSALDDTVLQVMEMINENAKSRGR
FT                   LIDFKEIQYGYRRVDPMHGVEYILDLLLLYKRHKGRKLTVPVRRHAYLQQPFSKPFFRE
FT                   VEELDVNRLVESINSGTQSFSVISNSLKILSSLQEAKDIGGHNEKKVHILVPLVGRYDI
FT                   FLRFMENFESTCLIPKQNVKLVIILFSRDAGQESIKHIELIQEYQSRYPSAEMMLIPMK
FT                   GEFSRGLGLEMASSQFDNDTLLLFCDVDLIFRGDFLQRCRDNTVQGQQVYYPIIFSQYD
FT                   PKVTHMRNPPTEGDFVFSKETGFWRDYGYGITCIYKSDLLGAGGFDTSIQGWGLEDVDL
FT                   YNKVILSGLRPFRSQEVGVVHIFHPVHCDPNLDPKQYKMCLGSKASTFASTMQLAELWL
FT                   EKHLGVRDNRTLS"
FT   gene            complement(21918146..21918924)
FT                   /pseudo
FT                   /locus_tag="mCG_1033358"
FT                   /note="gene_id=mCG1033358.1"
FT   mRNA            complement(21918146..21918924)
FT                   /pseudo
FT                   /locus_tag="mCG_1033358"
FT                   /note="gene_id=mCG1033358.1 transcript_id=mCT151062.1
FT                   created on 10-MAR-2003"
FT   gene            complement(22439579..22439964)
FT                   /pseudo
FT                   /locus_tag="mCG_15633"
FT                   /note="gene_id=mCG15633.0"
FT   mRNA            complement(22439579..22439964)
FT                   /pseudo
FT                   /locus_tag="mCG_15633"
FT                   /note="gene_id=mCG15633.0 transcript_id=mCT19134.0 created
FT                   on 07-OCT-2002"
FT   gene            complement(22490752..>22531492)
FT                   /locus_tag="mCG_145927"
FT                   /note="gene_id=mCG145927.0"
FT   mRNA            complement(join(22490752..22491046,22494854..22494936,
FT                   22499963..22500025,22521329..22521452,22522094..22522235,
FT                   22530626..22530720,22531467..>22531492))
FT                   /locus_tag="mCG_145927"
FT                   /product="mCG145927"
FT                   /note="gene_id=mCG145927.0 transcript_id=mCT186035.0
FT                   created on 04-JUL-2003"
FT   gene            22490755..22522195
FT                   /pseudo
FT                   /locus_tag="mCG_141255"
FT                   /note="gene_id=mCG141255.0"
FT   mRNA            join(22490755..22491048,22494861..22494936,
FT                   22499986..22500038,22521331..22521465,22522085..22522195)
FT                   /pseudo
FT                   /locus_tag="mCG_141255"
FT                   /note="gene_id=mCG141255.0 transcript_id=mCT174092.0
FT                   created on 07-OCT-2002"
FT   CDS             complement(join(22494918..22494936,22499963..22500025,
FT                   22521329..22521452,22522094..>22522094))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145927"
FT                   /product="mCG145927"
FT                   /note="gene_id=mCG145927.0 transcript_id=mCT186035.0
FT                   protein_id=mCP107759.0"
FT                   /protein_id="EDL09841.1"
FT                   /translation="GLWIEASILLCVVQVPADERRASLSLYQTEISSELHNCRNNLSCF
FT                   RGCYLEGFTILHANIIKKFYDIL"
FT   gene            22565545..22565911
FT                   /pseudo
FT                   /locus_tag="mCG_1033356"
FT                   /note="gene_id=mCG1033356.1"
FT   mRNA            22565545..22565911
FT                   /pseudo
FT                   /locus_tag="mCG_1033356"
FT                   /note="gene_id=mCG1033356.1 transcript_id=mCT151060.1
FT                   created on 10-MAR-2003"
FT   gene            22834515..23322106
FT                   /locus_tag="mCG_147283"
FT                   /note="gene_id=mCG147283.0"
FT   mRNA            join(22834515..22834544,23313971..23314401,
FT                   23317447..23317660,23319749..23322106)
FT                   /locus_tag="mCG_147283"
FT                   /product="mCG147283"
FT                   /note="gene_id=mCG147283.0 transcript_id=mCT187546.0
FT                   created on 13-JAN-2004"
FT   gene            <22845057..>22845777
FT                   /locus_tag="mCG_1033355"
FT                   /note="gene_id=mCG1033355.1"
FT   mRNA            <22845057..>22845777
FT                   /locus_tag="mCG_1033355"
FT                   /product="mCG1033355"
FT                   /note="gene_id=mCG1033355.1 transcript_id=mCT151059.1
FT                   created on 10-MAR-2003"
FT   CDS             <22845376..>22845777
FT                   /codon_start=1
FT                   /locus_tag="mCG_1033355"
FT                   /product="mCG1033355"
FT                   /note="gene_id=mCG1033355.1 transcript_id=mCT151059.1
FT                   protein_id=mCP77318.1"
FT                   /protein_id="EDL09840.1"
FT                   /translation="CAYCEKAFSRKTEPTAYPLTHTGGKPYDCTECKNTLFHKSQLTIH
FT                   HRTNTGEKPYKSNDCGKAFCQKSHPFGHQRILTKEKKNYVCAECKKAFFQKSHITGHQQ
FT                   IPTEEKHYICAECGRPLLEVVLCSKSENSH"
FT   gene            22881791..22883156
FT                   /pseudo
FT                   /locus_tag="mCG_142656"
FT                   /note="gene_id=mCG142656.0"
FT   mRNA            22881791..22883156
FT                   /pseudo
FT                   /locus_tag="mCG_142656"
FT                   /note="gene_id=mCG142656.0 transcript_id=mCT181475.0
FT                   created on 24-MAR-2003"
FT   gene            22899909..22907723
FT                   /locus_tag="mCG_142655"
FT                   /note="gene_id=mCG142655.0"
FT   mRNA            join(22899909..22900001,22906332..22907723)
FT                   /locus_tag="mCG_142655"
FT                   /product="mCG142655"
FT                   /note="gene_id=mCG142655.0 transcript_id=mCT181474.0
FT                   created on 24-MAR-2003"
FT   CDS             22906352..22907572
FT                   /codon_start=1
FT                   /locus_tag="mCG_142655"
FT                   /product="mCG142655"
FT                   /note="gene_id=mCG142655.0 transcript_id=mCT181474.0
FT                   protein_id=mCP104397.0"
FT                   /db_xref="GOA:Q3UED7"
FT                   /db_xref="InterPro:IPR007743"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:3644953"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UED7"
FT                   /protein_id="EDL09839.1"
FT                   /translation="MGQLFSSRRSEDQDLSSSFIEYLKECEKGINIIPHEIITSIEINM
FT                   KKGNIQEVNSTVRDMLREIDNTPLNVALTGETGSGKSSFINTLRGIGHEEGGAAHTGVT
FT                   DKTKERHPYEHPKMPNVVFWDLPGTGSEDFQPKTYLEKMKFYEYDFFIIISATRFKKND
FT                   IDLAKAIGIMKKEFYFVRTQVDSDLRNEEDFKPQTFDREKVLQDIRLNCVNTFRENGIA
FT                   EPPIFLISNKNVCHYDFPVLMDKLISDLPVFKRQNFMFSLPNITDSVIEKKRNFLRWKT
FT                   WLEGFADGLLSFFLESDLETLEKSMKFYRTVFGVDDASLQRLARAWEIDQVDQVRAMIK
FT                   SPAVFTPTDEETIQERLSRYNQEFCLANGYLLPKNHCREILYLKLYFLDMVTEDAKTLL
FT                   KEICLRN"
FT   gene            22954003..22962187
FT                   /locus_tag="mCG_59313"
FT                   /note="gene_id=mCG59313.2"
FT   mRNA            join(22954003..22954728,22960849..22962187)
FT                   /locus_tag="mCG_59313"
FT                   /product="mCG59313"
FT                   /note="gene_id=mCG59313.2 transcript_id=mCT59496.2 created
FT                   on 07-OCT-2002"
FT   CDS             22960869..22962119
FT                   /codon_start=1
FT                   /locus_tag="mCG_59313"
FT                   /product="mCG59313"
FT                   /note="gene_id=mCG59313.2 transcript_id=mCT59496.2
FT                   protein_id=mCP41571.2"
FT                   /db_xref="GOA:G3UWE2"
FT                   /db_xref="InterPro:IPR007743"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:3588218"
FT                   /db_xref="UniProtKB/TrEMBL:G3UWE2"
FT                   /protein_id="EDL09838.1"
FT                   /translation="MGQLLSDTSKTEDNEDLVSSFNEYFKNIKTEKIISQETIDLIKLY
FT                   LNKGNIHGANSLISDALRNIDNAPINIAVTGESGAGKSSLINALIGIGPEEEGAAEVGV
FT                   IETTMKRTSYKHPKIETLTLWDLPGIGTQKFPPKTYLEEVKFKEYDFFIIVSATRFTKL
FT                   ELDLAKAITNMKKNYYFVRTKVDIDVENERKSKPRTFEREKALKQIQSYSVKIFNDNNM
FT                   AVPPIFLISNYDLSDYDFPFLVDTLIKELHVQKRHNFMLSLPNFTDQAIDRKYKATQQF
FT                   IWLEAFKIGVVAIFPVLGNLRNKDMKKIKNTLNYYQKIFGVDDESLELVAKDFQVPVEQ
FT                   VKKTMKTPHLLKKYREETFRNDFKKLVSTFGRLLAVGLYFPAIYYLQLHILDTVTEDAK
FT                   VLLRWKYSKPRSNSTYP"
FT   gene            23037592..23054198
FT                   /gene="LOC435565"
FT                   /locus_tag="mCG_15634"
FT                   /note="gene_id=mCG15634.1"
FT   mRNA            join(23037592..23037702,23051361..23054198)
FT                   /gene="LOC435565"
FT                   /locus_tag="mCG_15634"
FT                   /product="interferon-inducible GTPase-like, transcript
FT                   variant mCT19135"
FT                   /note="gene_id=mCG15634.1 transcript_id=mCT19135.1 created
FT                   on 07-OCT-2002"
FT   mRNA            join(23037619..23037702,23049828..23049939,
FT                   23051361..23054198)
FT                   /gene="LOC435565"
FT                   /locus_tag="mCG_15634"
FT                   /product="interferon-inducible GTPase-like, transcript
FT                   variant mCT174108"
FT                   /note="gene_id=mCG15634.1 transcript_id=mCT174108.0 created
FT                   on 07-OCT-2002"
FT   mRNA            join(23037647..23037702,23044176..23044358,
FT                   23051361..23054198)
FT                   /gene="LOC435565"
FT                   /locus_tag="mCG_15634"
FT                   /product="interferon-inducible GTPase-like, transcript
FT                   variant mCT174107"
FT                   /note="gene_id=mCG15634.1 transcript_id=mCT174107.0 created
FT                   on 07-OCT-2002"
FT   mRNA            join(23038965..23039166,23040134..23040179,
FT                   23051361..23054198)
FT                   /gene="LOC435565"
FT                   /locus_tag="mCG_15634"
FT                   /product="interferon-inducible GTPase-like, transcript
FT                   variant mCT174109"
FT                   /note="gene_id=mCG15634.1 transcript_id=mCT174109.0 created
FT                   on 07-OCT-2002"
FT   mRNA            join(23044281..23044358,23049049..23049165,
FT                   23049828..23049939,23051361..23054198)
FT                   /gene="LOC435565"
FT                   /locus_tag="mCG_15634"
FT                   /product="interferon-inducible GTPase-like, transcript
FT                   variant mCT174110"
FT                   /note="gene_id=mCG15634.1 transcript_id=mCT174110.0 created
FT                   on 07-OCT-2002"
FT   CDS             23051381..23052622
FT                   /codon_start=1
FT                   /gene="LOC435565"
FT                   /locus_tag="mCG_15634"
FT                   /product="interferon-inducible GTPase-like, isoform CRA_a"
FT                   /note="gene_id=mCG15634.1 transcript_id=mCT174107.0
FT                   protein_id=mCP97027.0 isoform=CRA_a"
FT                   /db_xref="GOA:J7NNX8"
FT                   /db_xref="InterPro:IPR007743"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1926259"
FT                   /db_xref="UniProtKB/TrEMBL:J7NNX8"
FT                   /protein_id="EDL09833.1"
FT                   /translation="MGQLFSSPKSDENNDLPSSFTGYFKKFNTGRKIISQEILNLIELR
FT                   MRKGNIQLTNSAISDALKEIDSSVLNVAVTGETGSGKSSFINTLRGIGNEEEGAAKTGV
FT                   VEVTMERHPYKHPNIPNVVFWDLPGIGSTNFPPNTYLEKMKFYEYDFFIIISATRFKKN
FT                   DIDIAKAISMMKKEFYFVRTKVDSDITNEADGKPQTFDKEKVLQDIRLNCVNTFRENGI
FT                   AEPPIFLLSNKNVCHYDFPVLMDKLISDLPIYKRHNFMVSLPNITDSVIEKKRQFLKQR
FT                   IWLEGFAADLVNIIPSLTFLLDSDLETLKKSMKFYRTVFGVDETSLQRLARDWEIEVDQ
FT                   VEAMIKSPAVFKPTDEETIQERLSRYIQEFCLANGYLLPKNSFLKEIFYLKYYFLDMVT
FT                   EDAKTLLKEICLRN"
FT   CDS             23051381..23052622
FT                   /codon_start=1
FT                   /gene="LOC435565"
FT                   /locus_tag="mCG_15634"
FT                   /product="interferon-inducible GTPase-like, isoform CRA_a"
FT                   /note="gene_id=mCG15634.1 transcript_id=mCT174108.0
FT                   protein_id=mCP97028.0 isoform=CRA_a"
FT                   /db_xref="GOA:J7NNX8"
FT                   /db_xref="InterPro:IPR007743"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1926259"
FT                   /db_xref="UniProtKB/TrEMBL:J7NNX8"
FT                   /protein_id="EDL09834.1"
FT                   /translation="MGQLFSSPKSDENNDLPSSFTGYFKKFNTGRKIISQEILNLIELR
FT                   MRKGNIQLTNSAISDALKEIDSSVLNVAVTGETGSGKSSFINTLRGIGNEEEGAAKTGV
FT                   VEVTMERHPYKHPNIPNVVFWDLPGIGSTNFPPNTYLEKMKFYEYDFFIIISATRFKKN
FT                   DIDIAKAISMMKKEFYFVRTKVDSDITNEADGKPQTFDKEKVLQDIRLNCVNTFRENGI
FT                   AEPPIFLLSNKNVCHYDFPVLMDKLISDLPIYKRHNFMVSLPNITDSVIEKKRQFLKQR
FT                   IWLEGFAADLVNIIPSLTFLLDSDLETLKKSMKFYRTVFGVDETSLQRLARDWEIEVDQ
FT                   VEAMIKSPAVFKPTDEETIQERLSRYIQEFCLANGYLLPKNSFLKEIFYLKYYFLDMVT
FT                   EDAKTLLKEICLRN"
FT   CDS             23051381..23052622
FT                   /codon_start=1
FT                   /gene="LOC435565"
FT                   /locus_tag="mCG_15634"
FT                   /product="interferon-inducible GTPase-like, isoform CRA_a"
FT                   /note="gene_id=mCG15634.1 transcript_id=mCT174110.0
FT                   protein_id=mCP97026.0 isoform=CRA_a"
FT                   /db_xref="GOA:J7NNX8"
FT                   /db_xref="InterPro:IPR007743"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1926259"
FT                   /db_xref="UniProtKB/TrEMBL:J7NNX8"
FT                   /protein_id="EDL09835.1"
FT                   /translation="MGQLFSSPKSDENNDLPSSFTGYFKKFNTGRKIISQEILNLIELR
FT                   MRKGNIQLTNSAISDALKEIDSSVLNVAVTGETGSGKSSFINTLRGIGNEEEGAAKTGV
FT                   VEVTMERHPYKHPNIPNVVFWDLPGIGSTNFPPNTYLEKMKFYEYDFFIIISATRFKKN
FT                   DIDIAKAISMMKKEFYFVRTKVDSDITNEADGKPQTFDKEKVLQDIRLNCVNTFRENGI
FT                   AEPPIFLLSNKNVCHYDFPVLMDKLISDLPIYKRHNFMVSLPNITDSVIEKKRQFLKQR
FT                   IWLEGFAADLVNIIPSLTFLLDSDLETLKKSMKFYRTVFGVDETSLQRLARDWEIEVDQ
FT                   VEAMIKSPAVFKPTDEETIQERLSRYIQEFCLANGYLLPKNSFLKEIFYLKYYFLDMVT
FT                   EDAKTLLKEICLRN"
FT   CDS             23051381..23052622
FT                   /codon_start=1
FT                   /gene="LOC435565"
FT                   /locus_tag="mCG_15634"
FT                   /product="interferon-inducible GTPase-like, isoform CRA_a"
FT                   /note="gene_id=mCG15634.1 transcript_id=mCT19135.1
FT                   protein_id=mCP21490.2 isoform=CRA_a"
FT                   /db_xref="GOA:J7NNX8"
FT                   /db_xref="InterPro:IPR007743"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1926259"
FT                   /db_xref="UniProtKB/TrEMBL:J7NNX8"
FT                   /protein_id="EDL09836.1"
FT                   /translation="MGQLFSSPKSDENNDLPSSFTGYFKKFNTGRKIISQEILNLIELR
FT                   MRKGNIQLTNSAISDALKEIDSSVLNVAVTGETGSGKSSFINTLRGIGNEEEGAAKTGV
FT                   VEVTMERHPYKHPNIPNVVFWDLPGIGSTNFPPNTYLEKMKFYEYDFFIIISATRFKKN
FT                   DIDIAKAISMMKKEFYFVRTKVDSDITNEADGKPQTFDKEKVLQDIRLNCVNTFRENGI
FT                   AEPPIFLLSNKNVCHYDFPVLMDKLISDLPIYKRHNFMVSLPNITDSVIEKKRQFLKQR
FT                   IWLEGFAADLVNIIPSLTFLLDSDLETLKKSMKFYRTVFGVDETSLQRLARDWEIEVDQ
FT                   VEAMIKSPAVFKPTDEETIQERLSRYIQEFCLANGYLLPKNSFLKEIFYLKYYFLDMVT
FT                   EDAKTLLKEICLRN"
FT   CDS             23051381..23052622
FT                   /codon_start=1
FT                   /gene="LOC435565"
FT                   /locus_tag="mCG_15634"
FT                   /product="interferon-inducible GTPase-like, isoform CRA_a"
FT                   /note="gene_id=mCG15634.1 transcript_id=mCT174109.0
FT                   protein_id=mCP97029.0 isoform=CRA_a"
FT                   /db_xref="GOA:J7NNX8"
FT                   /db_xref="InterPro:IPR007743"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1926259"
FT                   /db_xref="UniProtKB/TrEMBL:J7NNX8"
FT                   /protein_id="EDL09837.1"
FT                   /translation="MGQLFSSPKSDENNDLPSSFTGYFKKFNTGRKIISQEILNLIELR
FT                   MRKGNIQLTNSAISDALKEIDSSVLNVAVTGETGSGKSSFINTLRGIGNEEEGAAKTGV
FT                   VEVTMERHPYKHPNIPNVVFWDLPGIGSTNFPPNTYLEKMKFYEYDFFIIISATRFKKN
FT                   DIDIAKAISMMKKEFYFVRTKVDSDITNEADGKPQTFDKEKVLQDIRLNCVNTFRENGI
FT                   AEPPIFLLSNKNVCHYDFPVLMDKLISDLPIYKRHNFMVSLPNITDSVIEKKRQFLKQR
FT                   IWLEGFAADLVNIIPSLTFLLDSDLETLKKSMKFYRTVFGVDETSLQRLARDWEIEVDQ
FT                   VEAMIKSPAVFKPTDEETIQERLSRYIQEFCLANGYLLPKNSFLKEIFYLKYYFLDMVT
FT                   EDAKTLLKEICLRN"
FT   gene            23078910..23079987
FT                   /locus_tag="mCG_15632"
FT                   /note="gene_id=mCG15632.2"
FT   mRNA            23078910..23079987
FT                   /locus_tag="mCG_15632"
FT                   /product="mCG15632"
FT                   /note="gene_id=mCG15632.2 transcript_id=mCT19133.2 created
FT                   on 07-OCT-2002"
FT   CDS             23079019..23079936
FT                   /codon_start=1
FT                   /locus_tag="mCG_15632"
FT                   /product="mCG15632"
FT                   /note="gene_id=mCG15632.2 transcript_id=mCT19133.2
FT                   protein_id=mCP21492.1"
FT                   /protein_id="EDL09832.1"
FT                   /translation="MEVLDEFDNEFPLSVTFCQLISEDDFERQAATYTERALRRLFSTL
FT                   DRNPALAERVVRKGKQTEFEQRGLLCSLWAKFVCAVQGDLNQCNDMGAIEMLRRLEQLK
FT                   RRIHRVHLYSQDAKKRRRRPKPKKPDPIFRDQSTSACLPPALLPPPLLPPPPQPVTTVA
FT                   SVVAASPSVYTMPWVFGPFPPLSGKPMEKLDISSSEVKLNWSGLSSTSKSHMVDLNPLV
FT                   LNPGGFHFSYLAGSSAHKLHCPGFPWTPACSRPSNTDETPSPVVKTSIFTPPVLLKFQP
FT                   VPRPNDDSENDPGSAESTPAKESQ"
FT   gene            23092032..23096636
FT                   /locus_tag="mCG_6032"
FT                   /note="gene_id=mCG6032.2"
FT   mRNA            join(23092032..23092235,23094516..23096037,
FT                   23096318..23096636)
FT                   /locus_tag="mCG_6032"
FT                   /product="mCG6032"
FT                   /note="gene_id=mCG6032.2 transcript_id=mCT4704.2 created on
FT                   07-OCT-2002"
FT   CDS             23094535..23095191
FT                   /codon_start=1
FT                   /locus_tag="mCG_6032"
FT                   /product="mCG6032"
FT                   /note="gene_id=mCG6032.2 transcript_id=mCT4704.2
FT                   protein_id=mCP21566.2"
FT                   /protein_id="EDL09831.1"
FT                   /translation="MGQLFSNMPKDEDKGILESSFTEYFRNYKQETKIISEETTRSIEL
FT                   CLKKGDIQRANSIISDALKNIDNAPINIAVTGESGAGKSSLINALREIKAEEESAAEVG
FT                   VTETTMKVYSYKHPKVKNLTLWDLPGIGTKKFPPKTYLETVEFKKYDFFIIVSATRFTN
FT                   HEIELAKAIRIMKKNYYFVRSKVDFDLYNEEKSKPRNFNREKHSESDPKFLSGYI"
FT   gene            complement(23127083..23154036)
FT                   /gene="2010002N04Rik"
FT                   /locus_tag="mCG_147304"
FT                   /note="gene_id=mCG147304.0"
FT   mRNA            complement(join(23127083..23128475,23153904..23154036))
FT                   /gene="2010002N04Rik"
FT                   /locus_tag="mCG_147304"
FT                   /product="RIKEN cDNA 2010002N04"
FT                   /note="gene_id=mCG147304.0 transcript_id=mCT187567.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(23127723..23128148)
FT                   /codon_start=1
FT                   /gene="2010002N04Rik"
FT                   /locus_tag="mCG_147304"
FT                   /product="RIKEN cDNA 2010002N04"
FT                   /note="gene_id=mCG147304.0 transcript_id=mCT187567.0
FT                   protein_id=mCP109693.0"
FT                   /protein_id="EDL09830.1"
FT                   /translation="MSSRDLTLSPRLSLAFSRGSRPLPSYLTGLWEPRDSGGKSCLRAV
FT                   KPHRPCAVRSFEESKTPEAAAGTGGEGGWERGTLASAPHAEPSKMVHPSPSKSEFCFCF
FT                   CFQVTLFPFFLVWEKERVWQAREMSKSFRSVSANPCS"
FT   gene            23178543..23210062
FT                   /gene="Dctn4"
FT                   /locus_tag="mCG_6022"
FT                   /note="gene_id=mCG6022.2"
FT   mRNA            join(23178543..23178743,23188953..23189133,
FT                   23192895..23192938,23195362..23195469,23197071..23197144,
FT                   23197544..23197656,23198091..23198200,23201495..23201568,
FT                   23203197..23203251,23204154..23204261,23206415..23206512,
FT                   23207536..23210062)
FT                   /gene="Dctn4"
FT                   /locus_tag="mCG_6022"
FT                   /product="dynactin 4, transcript variant mCT174152"
FT                   /note="gene_id=mCG6022.2 transcript_id=mCT174152.0 created
FT                   on 07-OCT-2002"
FT   mRNA            join(23178543..23178743,23185772..23185954,
FT                   23188955..23189133,23192895..23192938,23195362..23195469,
FT                   23196680..23196700,23197071..23197144,23197544..23197656,
FT                   23198091..23198200,23201495..23201568,23203197..23203251,
FT                   23204154..23204261,23206415..23206512,23207536..23209470)
FT                   /gene="Dctn4"
FT                   /locus_tag="mCG_6022"
FT                   /product="dynactin 4, transcript variant mCT174151"
FT                   /note="gene_id=mCG6022.2 transcript_id=mCT174151.0 created
FT                   on 07-OCT-2002"
FT   mRNA            join(23178544..23178743,23185772..23185954,
FT                   23188955..23189133,23192895..23192938,23195362..23195469,
FT                   23197071..23197144,23197544..23197656,23198091..23198200,
FT                   23201495..23201568,23203197..23203251,23204154..23204261,
FT                   23206415..23206512,23207536..23209470)
FT                   /gene="Dctn4"
FT                   /locus_tag="mCG_6022"
FT                   /product="dynactin 4, transcript variant mCT4716"
FT                   /note="gene_id=mCG6022.2 transcript_id=mCT4716.2 created on
FT                   07-OCT-2002"
FT   CDS             join(23178607..23178743,23185772..23185954,
FT                   23188955..23189133,23192895..23192938,23195362..23195469,
FT                   23196680..23196700,23197071..23197144,23197544..23197656,
FT                   23198091..23198200,23201495..23201568,23203197..23203251,
FT                   23204154..23204261,23206415..23206512,23207536..23207749)
FT                   /codon_start=1
FT                   /gene="Dctn4"
FT                   /locus_tag="mCG_6022"
FT                   /product="dynactin 4, isoform CRA_b"
FT                   /note="gene_id=mCG6022.2 transcript_id=mCT174151.0
FT                   protein_id=mCP97070.0 isoform=CRA_b"
FT                   /protein_id="EDL09827.1"
FT                   /translation="MASLLQSERVLYLVQGEKKVRAPLSQLYFCRYCSELRSLECVSHE
FT                   VCANCFDCPGCMHTLSTRATSISTQLPDDPAKTTMKKAYYLACGFCRWTSRDVGMADKS
FT                   VGECANCFDCPGCMHTLSTRATSISTQLPDDPAKTTMKKAYYLACGFCRWTSRDVGMAD
FT                   KSVASGGWQEPENPHTQRMNKLIEYYQQLAQKEKVERDRKKLARRRNYMPLAFSQHTIH
FT                   VVDKYSLGTRLQRPRAGASISTLAGLSLREGEDQKEVKIEPAQAVAEVEPLPEDYYTRP
FT                   VNLTEVTTLQQRLLQPDLQPVSASQLYPRHKHLLIKRSLRCRKCEHNLSKPEFNPTSIK
FT                   FKIQLVAVNYIPEVRIMSIPNLRYMKESQVLLTLTNPVENLTHVTLLECDEGDPDNINS
FT                   TAKVVVPPKELILAGKDAAAEYDELAEPQDFQDDPDIVAFRKANKVGIFIKVTPQREEG
FT                   EVTVCFKMKHDFKNLAAPIRPVEEGDQGTEVIWLTQHVELSFGPLLP"
FT   CDS             join(23178607..23178743,23185772..23185954,
FT                   23188955..23189133,23192895..23192938,23195362..23195469,
FT                   23197071..23197144,23197544..23197656,23198091..23198200,
FT                   23201495..23201568,23203197..23203251,23204154..23204261,
FT                   23206415..23206512,23207536..23207749)
FT                   /codon_start=1
FT                   /gene="Dctn4"
FT                   /locus_tag="mCG_6022"
FT                   /product="dynactin 4, isoform CRA_d"
FT                   /note="gene_id=mCG6022.2 transcript_id=mCT4716.2
FT                   protein_id=mCP21536.2 isoform=CRA_d"
FT                   /protein_id="EDL09829.1"
FT                   /translation="MASLLQSERVLYLVQGEKKVRAPLSQLYFCRYCSELRSLECVSHE
FT                   VCANCFDCPGCMHTLSTRATSISTQLPDDPAKTTMKKAYYLACGFCRWTSRDVGMADKS
FT                   VGECANCFDCPGCMHTLSTRATSISTQLPDDPAKTTMKKAYYLACGFCRWTSRDVGMAD
FT                   KSVASGGWQEPENPHTQRMNKLIEYYQQLAQKEKVERDRKKLARRRNYMPLAFSDKYSL
FT                   GTRLQRPRAGASISTLAGLSLREGEDQKEVKIEPAQAVAEVEPLPEDYYTRPVNLTEVT
FT                   TLQQRLLQPDLQPVSASQLYPRHKHLLIKRSLRCRKCEHNLSKPEFNPTSIKFKIQLVA
FT                   VNYIPEVRIMSIPNLRYMKESQVLLTLTNPVENLTHVTLLECDEGDPDNINSTAKVVVP
FT                   PKELILAGKDAAAEYDELAEPQDFQDDPDIVAFRKANKVGIFIKVTPQREEGEVTVCFK
FT                   MKHDFKNLAAPIRPVEEGDQGTEVIWLTQHVELSFGPLLP"
FT   CDS             join(23178726..23178743,23188953..23189133,
FT                   23192895..23192938,23195362..23195469,23197071..23197144,
FT                   23197544..23197656,23198091..23198200,23201495..23201568,
FT                   23203197..23203251,23204154..23204261,23206415..23206512,
FT                   23207536..23207749)
FT                   /codon_start=1
FT                   /gene="Dctn4"
FT                   /locus_tag="mCG_6022"
FT                   /product="dynactin 4, isoform CRA_c"
FT                   /note="gene_id=mCG6022.2 transcript_id=mCT174152.0
FT                   protein_id=mCP97069.0 isoform=CRA_c"
FT                   /protein_id="EDL09828.1"
FT                   /translation="MCVARGRCANCFDCPGCMHTLSTRATSISTQLPDDPAKTTMKKAY
FT                   YLACGFCRWTSRDVGMADKSVASGGWQEPENPHTQRMNKLIEYYQQLAQKEKVERDRKK
FT                   LARRRNYMPLAFSDKYSLGTRLQRPRAGASISTLAGLSLREGEDQKEVKIEPAQAVAEV
FT                   EPLPEDYYTRPVNLTEVTTLQQRLLQPDLQPVSASQLYPRHKHLLIKRSLRCRKCEHNL
FT                   SKPEFNPTSIKFKIQLVAVNYIPEVRIMSIPNLRYMKESQVLLTLTNPVENLTHVTLLE
FT                   CDEGDPDNINSTAKVVVPPKELILAGKDAAAEYDELAEPQDFQDDPDIVAFRKANKVGI
FT                   FIKVTPQREEGEVTVCFKMKHDFKNLAAPIRPVEEGDQGTEVIWLTQHVELSFGPLLP"
FT   mRNA            join(23196557..23197144,23197544..23197656,
FT                   23198091..23198200,23201495..23201568,23203197..23203251,
FT                   23204154..23204261,23206415..23206512,23207536..23209470)
FT                   /gene="Dctn4"
FT                   /locus_tag="mCG_6022"
FT                   /product="dynactin 4, transcript variant mCT174150"
FT                   /note="gene_id=mCG6022.2 transcript_id=mCT174150.0 created
FT                   on 07-OCT-2002"
FT   CDS             join(23203222..23203251,23204154..23204261,
FT                   23206415..23206512,23207536..23207749)
FT                   /codon_start=1
FT                   /gene="Dctn4"
FT                   /locus_tag="mCG_6022"
FT                   /product="dynactin 4, isoform CRA_a"
FT                   /note="gene_id=mCG6022.2 transcript_id=mCT174150.0
FT                   protein_id=mCP97071.0 isoform=CRA_a"
FT                   /protein_id="EDL09826.1"
FT                   /translation="MSIPNLRYMKESQVLLTLTNPVENLTHVTLLECDEGDPDNINSTA
FT                   KVVVPPKELILAGKDAAAEYDELAEPQDFQDDPDIVAFRKANKVGIFIKVTPQREEGEV
FT                   TVCFKMKHDFKNLAAPIRPVEEGDQGTEVIWLTQHVELSFGPLLP"
FT   gene            23211628..23224114
FT                   /locus_tag="mCG_6024"
FT                   /note="gene_id=mCG6024.1"
FT   mRNA            join(23211628..23212186,23212558..23212611,
FT                   23215078..23215107,23215683..23215815,23216939..23217039,
FT                   23217674..23217846,23218677..23218877,23220663..23220827,
FT                   23222087..23222177,23222308..23222440,23223126..23224114)
FT                   /locus_tag="mCG_6024"
FT                   /product="mCG6024, transcript variant mCT4713"
FT                   /note="gene_id=mCG6024.1 transcript_id=mCT4713.1 created on
FT                   07-OCT-2002"
FT   mRNA            join(<23212086..23212186,23212558..23212611,
FT                   23215078..23215107,23215683..23215815,23216939..23217039,
FT                   23217674..23217846,23218677..23218877,23220663..23220827,
FT                   23222087..23222177,23222308..23222440,23223126..23223840,
FT                   23223921..23224025)
FT                   /locus_tag="mCG_6024"
FT                   /product="mCG6024, transcript variant mCT190312"
FT                   /note="gene_id=mCG6024.1 transcript_id=mCT190312.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<23212088..23212186,23212558..23212611,
FT                   23215078..23215107,23215683..23215815,23216939..23217039,
FT                   23217674..23217846,23218677..23218877,23220663..23220827,
FT                   23222087..23222177,23222308..23222440,23223126..23223256)
FT                   /codon_start=1
FT                   /locus_tag="mCG_6024"
FT                   /product="mCG6024, isoform CRA_b"
FT                   /note="gene_id=mCG6024.1 transcript_id=mCT190312.0
FT                   protein_id=mCP111302.0 isoform=CRA_b"
FT                   /protein_id="EDL09824.1"
FT                   /translation="SVSRVGSRSCPGTPDMATSLGSNTYNRQNWEDADFPILCQTCLGE
FT                   NPYIRMTKEKYGKECKICARPFTVFRWCPGVRMRFKKTEVCQTCSKLKNVCQTCLLDLE
FT                   YGLPIQVRDAGLSFKDDMPKSDVNKEYYTQNMEREISNSDGTRPVGMLGKATSTSDMLL
FT                   KLARTTPYYKRNRPHICSFWVKGECKRGEECPYRHEKPTDPDDPLADQNIKDRYYGIND
FT                   PVADKLLKRASTMPRLDPPEDKTITTLYVGGLGDTITETDLRNHFYQFGEIRTITVVQR
FT                   QQCAFIQFATRQAAEVAAEKSFNKLIVNGRRLNVKWGRSQAARGKEKEKDGTTDSGDQA
FT                   RTCARTALEVFSPPPAAEEEASANYFNLPPSGPPAVVNIALPPPPGIAPPPPPGFGPHM
FT                   FHPMGPPPPFMRAPGPIHYPSQDPQRMGAHAGKHSSP"
FT   CDS             join(23212133..23212186,23212558..23212611,
FT                   23215078..23215107,23215683..23215815,23216939..23217039,
FT                   23217674..23217846,23218677..23218877,23220663..23220827,
FT                   23222087..23222177,23222308..23222440,23223126..23223256)
FT                   /codon_start=1
FT                   /locus_tag="mCG_6024"
FT                   /product="mCG6024, isoform CRA_c"
FT                   /note="gene_id=mCG6024.1 transcript_id=mCT4713.1
FT                   protein_id=mCP21577.2 isoform=CRA_c"
FT                   /protein_id="EDL09825.1"
FT                   /translation="MATSLGSNTYNRQNWEDADFPILCQTCLGENPYIRMTKEKYGKEC
FT                   KICARPFTVFRWCPGVRMRFKKTEVCQTCSKLKNVCQTCLLDLEYGLPIQVRDAGLSFK
FT                   DDMPKSDVNKEYYTQNMEREISNSDGTRPVGMLGKATSTSDMLLKLARTTPYYKRNRPH
FT                   ICSFWVKGECKRGEECPYRHEKPTDPDDPLADQNIKDRYYGINDPVADKLLKRASTMPR
FT                   LDPPEDKTITTLYVGGLGDTITETDLRNHFYQFGEIRTITVVQRQQCAFIQFATRQAAE
FT                   VAAEKSFNKLIVNGRRLNVKWGRSQAARGKEKEKDGTTDSGDQARTCARTALEVFSPPP
FT                   AAEEEASANYFNLPPSGPPAVVNIALPPPPGIAPPPPPGFGPHMFHPMGPPPPFMRAPG
FT                   PIHYPSQDPQRMGAHAGKHSSP"
FT   mRNA            join(23221983..23222177,23222308..23222440,
FT                   23223126..23224114)
FT                   /locus_tag="mCG_6024"
FT                   /product="mCG6024, transcript variant mCT174153"
FT                   /note="gene_id=mCG6024.1 transcript_id=mCT174153.0 created
FT                   on 07-OCT-2002"
FT   CDS             23223140..23223256
FT                   /codon_start=1
FT                   /locus_tag="mCG_6024"
FT                   /product="mCG6024, isoform CRA_a"
FT                   /note="gene_id=mCG6024.1 transcript_id=mCT174153.0
FT                   protein_id=mCP97072.0 isoform=CRA_a"
FT                   /protein_id="EDL09823.1"
FT                   /translation="MFHPMGPPPPFMRAPGPIHYPSQDPQRMGAHAGKHSSP"
FT   gene            complement(23227718..23241779)
FT                   /locus_tag="mCG_142210"
FT                   /note="gene_id=mCG142210.0"
FT   mRNA            complement(join(23227718..23227936,23240177..23240238,
FT                   23241679..23241779))
FT                   /locus_tag="mCG_142210"
FT                   /product="mCG142210"
FT                   /note="gene_id=mCG142210.0 transcript_id=mCT179415.0
FT                   created on 06-FEB-2003"
FT   CDS             complement(join(23227905..23227936,23240177..23240237))
FT                   /codon_start=1
FT                   /locus_tag="mCG_142210"
FT                   /product="mCG142210"
FT                   /note="gene_id=mCG142210.0 transcript_id=mCT179415.0
FT                   protein_id=mCP102337.0"
FT                   /protein_id="EDL09822.1"
FT                   /translation="MIPKEQKEPVMAVPGDLAEPGPPCHLEDPT"
FT   gene            complement(23243969..>23254160)
FT                   /locus_tag="mCG_6023"
FT                   /note="gene_id=mCG6023.2"
FT   mRNA            complement(join(23243969..23246474,23250400..>23254160))
FT                   /locus_tag="mCG_6023"
FT                   /product="mCG6023"
FT                   /note="gene_id=mCG6023.2 transcript_id=mCT4714.2 created on
FT                   07-OCT-2002"
FT   CDS             complement(23252088..23254160)
FT                   /codon_start=1
FT                   /locus_tag="mCG_6023"
FT                   /product="mCG6023"
FT                   /note="gene_id=mCG6023.2 transcript_id=mCT4714.2
FT                   protein_id=mCP21477.2"
FT                   /db_xref="GOA:Q3URF1"
FT                   /db_xref="InterPro:IPR028753"
FT                   /db_xref="MGI:MGI:1099446"
FT                   /db_xref="UniProtKB/TrEMBL:Q3URF1"
FT                   /protein_id="EDL09821.1"
FT                   /translation="MEGYSEEASLLRHLEKVASEEEEVPLVVYLKENAALLTANGLHLS
FT                   QSRETQQSSPNPPDTEVPSPAADINQNPSSPNATLTTLASSSHHSQPTADINQNPPAAI
FT                   TPVPQNSSQAQCSPNGTLDSKPGTLCADDGQSPVPAEEVRSSILLIDKVSAPPSAASTF
FT                   SREATPLSSSGPPAADLMSSSLLIDMQPSTLVAPAEQEVPGHVAVTTPTKVYSEVHLTL
FT                   AKPASVVNRTARPFGIQSPGTSQIEQSPMMGRRQFGEKAWAPPASSMADRSPQPQRHIM
FT                   SRSPMVERRLLGQRSPVLERRPLGNFTPPPTYAETLSTAPVASRVRSPPSYSTLYPSSD
FT                   PKPSHLKGQVAPANKTGILEESMARRGSRKSMFTFVEKPKVTPNPDLLDLVQTADEKRR
FT                   QRDHGEVGMEEEPFALGAEASNFQQEPIARDRASPAAAEEAVPEWASCLKSPRIQAKPK
FT                   PKPNQNLSEASGKGAELYARRQSRMEKYVIESSGHAELARCPSPTMSLPSSWKYTTNAP
FT                   GGFRVASLSPARTPPASLYHGYLPENGVLRPEPTKQQPYQMRPSLYALSPVKEPAKASS
FT                   RATSSRTPSRTVSPRAASPAKPSSLDLVPNLPRAGLPPSPALPRPSRSSPGLYTAPVQD
FT                   SLQPTAVSPTYSSDISPVSPSRAWSPRAKQAPRPSFSTRNAGIEAQVWKPSFCFK"
FT   gene            complement(23255888..>23310001)
FT                   /locus_tag="mCG_145148"
FT                   /note="gene_id=mCG145148.0"
FT   mRNA            complement(join(23255888..23257029,23279368..23280000,
FT                   23302784..23302892,23309959..>23310001))
FT                   /locus_tag="mCG_145148"
FT                   /product="mCG145148"
FT                   /note="gene_id=mCG145148.0 transcript_id=mCT184572.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(23256974..23257029,23279368..>23279986))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145148"
FT                   /product="mCG145148"
FT                   /note="gene_id=mCG145148.0 transcript_id=mCT184572.0
FT                   protein_id=mCP106257.0"
FT                   /protein_id="EDL09820.1"
FT                   /translation="RGHPNRTQEDKEKVLDFVFTQPRKNLPYPSARSHSSPVCQQKKVN
FT                   LQRTQGDLERTQEQDSLTPARQWWLLGTAKEGAIMLGAHFPPPPLGASEGRAAPCTFQI
FT                   PDGSYRCLALEAEESSSEDGLQGEVRLVDLEEEGTSQSRANHGTPPLSRAPAIIQPSSC
FT                   HREARGGFQRSDRPSHDWDVVQARKVMTASGSSSPVPRVAQKPAKKPMTLGEDESLPKP
FT                   QG"
FT   CDS             23320057..23320392
FT                   /codon_start=1
FT                   /locus_tag="mCG_147283"
FT                   /product="mCG147283"
FT                   /note="gene_id=mCG147283.0 transcript_id=mCT187546.0
FT                   protein_id=mCP109671.0"
FT                   /protein_id="EDL09819.1"
FT                   /translation="MPGKPEQLLRRSTQLEGSQGSQACGQGRLWSGVATHPFRWGPQRL
FT                   GKWLCEQCLTLFLANSATPYTSPPLTPTDHIFCPPPPKNNPDATHPVPLGSLTQHTGQG
FT                   RRGGGGF"
FT   gene            complement(23335074..23398909)
FT                   /gene="Ndst1"
FT                   /locus_tag="mCG_6025"
FT                   /note="gene_id=mCG6025.2"
FT   mRNA            complement(join(23335074..23339944,23340544..23340646,
FT                   23341759..23341868,23342510..23342680,23345909..23346083,
FT                   23347640..23347763,23349012..23349108,23350081..23350263,
FT                   23350945..23351073,23353346..23353531,23354310..23354464,
FT                   23355649..23355736,23358174..23358668,23363296..23364205,
FT                   23398887..23398909))
FT                   /gene="Ndst1"
FT                   /locus_tag="mCG_6025"
FT                   /product="N-deacetylase/N-sulfotransferase (heparan
FT                   glucosaminyl) 1, transcript variant mCT4712"
FT                   /note="gene_id=mCG6025.2 transcript_id=mCT4712.2 created on
FT                   07-OCT-2002"
FT   mRNA            complement(join(23335074..23339944,23340544..23340646,
FT                   23341759..23341868,23342510..23342680,23345909..23346083,
FT                   23347640..23347763,23349012..23349108,23350081..23350263,
FT                   23350945..23351073,23353346..23353531,23354310..23354464,
FT                   23355649..23355736,23358174..23358668,23363296..23364205,
FT                   23378045..23378136))
FT                   /gene="Ndst1"
FT                   /locus_tag="mCG_6025"
FT                   /product="N-deacetylase/N-sulfotransferase (heparan
FT                   glucosaminyl) 1, transcript variant mCT174155"
FT                   /note="gene_id=mCG6025.2 transcript_id=mCT174155.0 created
FT                   on 07-OCT-2002"
FT   mRNA            complement(join(23335614..23339944,23340544..23340646,
FT                   23341759..23341868,23342510..23342680,23345909..23346083,
FT                   23347640..23347763,23349012..23349108,23350081..23350263,
FT                   23350945..23351073,23353346..23353531,23354310..23354464,
FT                   23355649..23355736,23358174..23358668,23363296..23364205,
FT                   23383579..23383651))
FT                   /gene="Ndst1"
FT                   /locus_tag="mCG_6025"
FT                   /product="N-deacetylase/N-sulfotransferase (heparan
FT                   glucosaminyl) 1, transcript variant mCT174154"
FT                   /note="gene_id=mCG6025.2 transcript_id=mCT174154.0 created
FT                   on 07-OCT-2002"
FT   CDS             complement(join(23339825..23339944,23340544..23340646,
FT                   23341759..23341868,23342510..23342680,23345909..23346083,
FT                   23347640..23347763,23349012..23349108,23350081..23350263,
FT                   23350945..23351073,23353346..23353531,23354310..23354464,
FT                   23355649..23355736,23358174..23358668,23363296..23363808))
FT                   /codon_start=1
FT                   /gene="Ndst1"
FT                   /locus_tag="mCG_6025"
FT                   /product="N-deacetylase/N-sulfotransferase (heparan
FT                   glucosaminyl) 1, isoform CRA_a"
FT                   /note="gene_id=mCG6025.2 transcript_id=mCT174154.0
FT                   protein_id=mCP97073.0 isoform=CRA_a"
FT                   /protein_id="EDL09816.1"
FT                   /translation="MPALACLRRLCRHLSPQAVLFLLFVFCLFSVFVSAYYLYGWNRGL
FT                   EPSADASESDCGDPPPVAPSRLLPIKPVQAVAPSRTDPLVLVFVESLYSQLGQEVVAIL
FT                   ESSRFKYRTEIAPGKGDMPTLTDKGRGRFALIIYENILKYVNLDAWNRELLDKYCVAYG
FT                   VGIIGFFKANENSLLSAQLKGFPLFLHSNLGLKDCSINPKSPLLYVTRPSEVEKGVLPG
FT                   EDWTVFQSNHSTYEPVLLAKTRSSESIPHLGADAGLHAALHATVVQDLGLHDGIQRVLF
FT                   GNNLNFWLHKLVFVDAVAFLTGKRLSLPLDRYILVDIDDIFVGKEGTRMKVEDVKALFD
FT                   TQNELRTHIPNFTFNLGYSGKFFHTGTDAEDAGDDLLLSYVKEFWWFPHMWSHMQPHLF
FT                   HNQSVLAEQMALNKKFAVEHGIPTDMGYAVAPHHSGVYPVHVQLYEAWKQVWGIRVTST
FT                   EEYPHLKPARYRRGFIHNGIMVLPRQTCGLFTHTIFYNEYPGGSSELDKIINGGELFLT
FT                   VLLNPISIFMTHLSNYGNDRLGLYTFKHLVRFLHSWTNLRLQTLPPVQLAQKYFQIFSE
FT                   EKDPLWQDPCEDKRHKDIWSKEKTCDRFPKLLIIGPQKTGTTALYLFLGMHPDLSSNYP
FT                   SSETFEEIQFFNGHNYHKGIDWYMEFFPIPSNTTSDFYFEKSANYFDSEVAPRRAAALL
FT                   PKAKILSILINPADRAYSWYQHQRAHDDPVALKYTFHEVITAGPDASSKLRALQNRCLV
FT                   PGWYATHIERWLSAFHANQILVLDGKLLRTEPAKVMDTVQKFLGVTSTVDYHKTLAFDP
FT                   KKGFWCQLLEGGKTKCLGKSKGRKYPEMDLDSRAFLKDYFRDHNIELSKLLYKMGQTLP
FT                   TWLREDLQNTR"
FT   CDS             complement(join(23339825..23339944,23340544..23340646,
FT                   23341759..23341868,23342510..23342680,23345909..23346083,
FT                   23347640..23347763,23349012..23349108,23350081..23350263,
FT                   23350945..23351073,23353346..23353531,23354310..23354464,
FT                   23355649..23355736,23358174..23358668,23363296..23363808))
FT                   /codon_start=1
FT                   /gene="Ndst1"
FT                   /locus_tag="mCG_6025"
FT                   /product="N-deacetylase/N-sulfotransferase (heparan
FT                   glucosaminyl) 1, isoform CRA_a"
FT                   /note="gene_id=mCG6025.2 transcript_id=mCT174155.0
FT                   protein_id=mCP97074.0 isoform=CRA_a"
FT                   /protein_id="EDL09817.1"
FT                   /translation="MPALACLRRLCRHLSPQAVLFLLFVFCLFSVFVSAYYLYGWNRGL
FT                   EPSADASESDCGDPPPVAPSRLLPIKPVQAVAPSRTDPLVLVFVESLYSQLGQEVVAIL
FT                   ESSRFKYRTEIAPGKGDMPTLTDKGRGRFALIIYENILKYVNLDAWNRELLDKYCVAYG
FT                   VGIIGFFKANENSLLSAQLKGFPLFLHSNLGLKDCSINPKSPLLYVTRPSEVEKGVLPG
FT                   EDWTVFQSNHSTYEPVLLAKTRSSESIPHLGADAGLHAALHATVVQDLGLHDGIQRVLF
FT                   GNNLNFWLHKLVFVDAVAFLTGKRLSLPLDRYILVDIDDIFVGKEGTRMKVEDVKALFD
FT                   TQNELRTHIPNFTFNLGYSGKFFHTGTDAEDAGDDLLLSYVKEFWWFPHMWSHMQPHLF
FT                   HNQSVLAEQMALNKKFAVEHGIPTDMGYAVAPHHSGVYPVHVQLYEAWKQVWGIRVTST
FT                   EEYPHLKPARYRRGFIHNGIMVLPRQTCGLFTHTIFYNEYPGGSSELDKIINGGELFLT
FT                   VLLNPISIFMTHLSNYGNDRLGLYTFKHLVRFLHSWTNLRLQTLPPVQLAQKYFQIFSE
FT                   EKDPLWQDPCEDKRHKDIWSKEKTCDRFPKLLIIGPQKTGTTALYLFLGMHPDLSSNYP
FT                   SSETFEEIQFFNGHNYHKGIDWYMEFFPIPSNTTSDFYFEKSANYFDSEVAPRRAAALL
FT                   PKAKILSILINPADRAYSWYQHQRAHDDPVALKYTFHEVITAGPDASSKLRALQNRCLV
FT                   PGWYATHIERWLSAFHANQILVLDGKLLRTEPAKVMDTVQKFLGVTSTVDYHKTLAFDP
FT                   KKGFWCQLLEGGKTKCLGKSKGRKYPEMDLDSRAFLKDYFRDHNIELSKLLYKMGQTLP
FT                   TWLREDLQNTR"
FT   CDS             complement(join(23339825..23339944,23340544..23340646,
FT                   23341759..23341868,23342510..23342680,23345909..23346083,
FT                   23347640..23347763,23349012..23349108,23350081..23350263,
FT                   23350945..23351073,23353346..23353531,23354310..23354464,
FT                   23355649..23355736,23358174..23358668,23363296..23363808))
FT                   /codon_start=1
FT                   /gene="Ndst1"
FT                   /locus_tag="mCG_6025"
FT                   /product="N-deacetylase/N-sulfotransferase (heparan
FT                   glucosaminyl) 1, isoform CRA_a"
FT                   /note="gene_id=mCG6025.2 transcript_id=mCT4712.2
FT                   protein_id=mCP21544.2 isoform=CRA_a"
FT                   /protein_id="EDL09818.1"
FT                   /translation="MPALACLRRLCRHLSPQAVLFLLFVFCLFSVFVSAYYLYGWNRGL
FT                   EPSADASESDCGDPPPVAPSRLLPIKPVQAVAPSRTDPLVLVFVESLYSQLGQEVVAIL
FT                   ESSRFKYRTEIAPGKGDMPTLTDKGRGRFALIIYENILKYVNLDAWNRELLDKYCVAYG
FT                   VGIIGFFKANENSLLSAQLKGFPLFLHSNLGLKDCSINPKSPLLYVTRPSEVEKGVLPG
FT                   EDWTVFQSNHSTYEPVLLAKTRSSESIPHLGADAGLHAALHATVVQDLGLHDGIQRVLF
FT                   GNNLNFWLHKLVFVDAVAFLTGKRLSLPLDRYILVDIDDIFVGKEGTRMKVEDVKALFD
FT                   TQNELRTHIPNFTFNLGYSGKFFHTGTDAEDAGDDLLLSYVKEFWWFPHMWSHMQPHLF
FT                   HNQSVLAEQMALNKKFAVEHGIPTDMGYAVAPHHSGVYPVHVQLYEAWKQVWGIRVTST
FT                   EEYPHLKPARYRRGFIHNGIMVLPRQTCGLFTHTIFYNEYPGGSSELDKIINGGELFLT
FT                   VLLNPISIFMTHLSNYGNDRLGLYTFKHLVRFLHSWTNLRLQTLPPVQLAQKYFQIFSE
FT                   EKDPLWQDPCEDKRHKDIWSKEKTCDRFPKLLIIGPQKTGTTALYLFLGMHPDLSSNYP
FT                   SSETFEEIQFFNGHNYHKGIDWYMEFFPIPSNTTSDFYFEKSANYFDSEVAPRRAAALL
FT                   PKAKILSILINPADRAYSWYQHQRAHDDPVALKYTFHEVITAGPDASSKLRALQNRCLV
FT                   PGWYATHIERWLSAFHANQILVLDGKLLRTEPAKVMDTVQKFLGVTSTVDYHKTLAFDP
FT                   KKGFWCQLLEGGKTKCLGKSKGRKYPEMDLDSRAFLKDYFRDHNIELSKLLYKMGQTLP
FT                   TWLREDLQNTR"
FT   gene            23397674..23429199
FT                   /locus_tag="mCG_6028"
FT                   /note="gene_id=mCG6028.2"
FT   mRNA            join(23397674..23397797,23427053..23427203,
FT                   23427582..23427743,23428467..23428543,23429085..23429199)
FT                   /locus_tag="mCG_6028"
FT                   /product="mCG6028, transcript variant mCT182090"
FT                   /note="gene_id=mCG6028.2 transcript_id=mCT182090.0 created
FT                   on 02-MAY-2003"
FT   mRNA            join(23425300..23425338,23427053..23427203,
FT                   23427582..23427743,23428467..23428543,23429085..23429199)
FT                   /locus_tag="mCG_6028"
FT                   /product="mCG6028, transcript variant mCT4726"
FT                   /note="gene_id=mCG6028.2 transcript_id=mCT4726.3 created on
FT                   02-MAY-2003"
FT   mRNA            join(23425349..23425433,23427053..23427203,
FT                   23427582..23427743,23428467..23428543,23429085..23429199)
FT                   /locus_tag="mCG_6028"
FT                   /product="mCG6028, transcript variant mCT174162"
FT                   /note="gene_id=mCG6028.2 transcript_id=mCT174162.1 created
FT                   on 02-MAY-2003"
FT   mRNA            join(23425879..23425969,23427053..23427203,
FT                   23427582..23427743,23428467..23428543,23429085..23429199)
FT                   /locus_tag="mCG_6028"
FT                   /product="mCG6028, transcript variant mCT174161"
FT                   /note="gene_id=mCG6028.2 transcript_id=mCT174161.1 created
FT                   on 02-MAY-2003"
FT   mRNA            join(23426889..23427203,23427582..23427743,
FT                   23428467..23428543,23429085..23429199)
FT                   /locus_tag="mCG_6028"
FT                   /product="mCG6028, transcript variant mCT174163"
FT                   /note="gene_id=mCG6028.2 transcript_id=mCT174163.1 created
FT                   on 02-MAY-2003"
FT   CDS             join(23427055..23427203,23427582..23427743,
FT                   23428467..23428543,23429085..23429152)
FT                   /codon_start=1
FT                   /locus_tag="mCG_6028"
FT                   /product="mCG6028, isoform CRA_a"
FT                   /note="gene_id=mCG6028.2 transcript_id=mCT174161.1
FT                   protein_id=mCP97082.0 isoform=CRA_a"
FT                   /protein_id="EDL09811.1"
FT                   /translation="MAPRKGKEKKEEQVISLGPQVAEGENVFGVCHIFASFNDTFVHVT
FT                   DLSGKETICRVTGGMKVKADRDESSPYAAMLAAQDVAQRCKELGITALHIKLRATGGNR
FT                   TKTPGPGAQSALRALARSGMKIGRIEDVTPIPSDSTRRKGGRRGRRL"
FT   CDS             join(23427055..23427203,23427582..23427743,
FT                   23428467..23428543,23429085..23429152)
FT                   /codon_start=1
FT                   /locus_tag="mCG_6028"
FT                   /product="mCG6028, isoform CRA_a"
FT                   /note="gene_id=mCG6028.2 transcript_id=mCT174162.1
FT                   protein_id=mCP97081.1 isoform=CRA_a"
FT                   /protein_id="EDL09812.1"
FT                   /translation="MAPRKGKEKKEEQVISLGPQVAEGENVFGVCHIFASFNDTFVHVT
FT                   DLSGKETICRVTGGMKVKADRDESSPYAAMLAAQDVAQRCKELGITALHIKLRATGGNR
FT                   TKTPGPGAQSALRALARSGMKIGRIEDVTPIPSDSTRRKGGRRGRRL"
FT   CDS             join(23427055..23427203,23427582..23427743,
FT                   23428467..23428543,23429085..23429152)
FT                   /codon_start=1
FT                   /locus_tag="mCG_6028"
FT                   /product="mCG6028, isoform CRA_a"
FT                   /note="gene_id=mCG6028.2 transcript_id=mCT174163.1
FT                   protein_id=mCP97080.0 isoform=CRA_a"
FT                   /protein_id="EDL09813.1"
FT                   /translation="MAPRKGKEKKEEQVISLGPQVAEGENVFGVCHIFASFNDTFVHVT
FT                   DLSGKETICRVTGGMKVKADRDESSPYAAMLAAQDVAQRCKELGITALHIKLRATGGNR
FT                   TKTPGPGAQSALRALARSGMKIGRIEDVTPIPSDSTRRKGGRRGRRL"
FT   CDS             join(23427055..23427203,23427582..23427743,
FT                   23428467..23428543,23429085..23429152)
FT                   /codon_start=1
FT                   /locus_tag="mCG_6028"
FT                   /product="mCG6028, isoform CRA_a"
FT                   /note="gene_id=mCG6028.2 transcript_id=mCT182090.0
FT                   protein_id=mCP105012.0 isoform=CRA_a"
FT                   /protein_id="EDL09814.1"
FT                   /translation="MAPRKGKEKKEEQVISLGPQVAEGENVFGVCHIFASFNDTFVHVT
FT                   DLSGKETICRVTGGMKVKADRDESSPYAAMLAAQDVAQRCKELGITALHIKLRATGGNR
FT                   TKTPGPGAQSALRALARSGMKIGRIEDVTPIPSDSTRRKGGRRGRRL"
FT   CDS             join(23427055..23427203,23427582..23427743,
FT                   23428467..23428543,23429085..23429152)
FT                   /codon_start=1
FT                   /locus_tag="mCG_6028"
FT                   /product="mCG6028, isoform CRA_a"
FT                   /note="gene_id=mCG6028.2 transcript_id=mCT4726.3
FT                   protein_id=mCP21549.2 isoform=CRA_a"
FT                   /protein_id="EDL09815.1"
FT                   /translation="MAPRKGKEKKEEQVISLGPQVAEGENVFGVCHIFASFNDTFVHVT
FT                   DLSGKETICRVTGGMKVKADRDESSPYAAMLAAQDVAQRCKELGITALHIKLRATGGNR
FT                   TKTPGPGAQSALRALARSGMKIGRIEDVTPIPSDSTRRKGGRRGRRL"
FT   gene            complement(23430236..23430763)
FT                   /pseudo
FT                   /locus_tag="mCG_6031"
FT                   /note="gene_id=mCG6031.2"
FT   mRNA            complement(23430236..23430763)
FT                   /pseudo
FT                   /locus_tag="mCG_6031"
FT                   /note="gene_id=mCG6031.2 transcript_id=mCT4708.2 created on
FT                   17-OCT-2002"
FT   gene            23455747..23465305
FT                   /gene="Cd74"
FT                   /locus_tag="mCG_6027"
FT                   /note="gene_id=mCG6027.2"
FT   mRNA            join(23455747..23455908,23460564..23460733,
FT                   23460889..23460968,23461685..23461747,23462639..23462731,
FT                   23462985..23463075,23464516..23464578,23464809..23465305)
FT                   /gene="Cd74"
FT                   /locus_tag="mCG_6027"
FT                   /product="CD74 antigen (invariant polypeptide of major
FT                   histocompatibility complex, class II antigen-associated),
FT                   transcript variant mCT174157"
FT                   /note="gene_id=mCG6027.2 transcript_id=mCT174157.0 created
FT                   on 07-OCT-2002"
FT   mRNA            join(23455748..23455908,23460564..23460733,
FT                   23460889..23460968,23461685..23461747,23462639..23462731,
FT                   23462985..23463075,23463951..23464142,23464516..23464578,
FT                   23464809..23465020,23465078..23465305)
FT                   /gene="Cd74"
FT                   /locus_tag="mCG_6027"
FT                   /product="CD74 antigen (invariant polypeptide of major
FT                   histocompatibility complex, class II antigen-associated),
FT                   transcript variant mCT4725"
FT                   /note="gene_id=mCG6027.2 transcript_id=mCT4725.2 created on
FT                   07-OCT-2002"
FT   mRNA            join(23455758..23455908,23459809..23459863,
FT                   23460619..23460733,23460889..23460968,23461685..23461747,
FT                   23462639..23462731,23462985..23463075,23464516..23464578,
FT                   23464809..23465013)
FT                   /gene="Cd74"
FT                   /locus_tag="mCG_6027"
FT                   /product="CD74 antigen (invariant polypeptide of major
FT                   histocompatibility complex, class II antigen-associated),
FT                   transcript variant mCT174158"
FT                   /note="gene_id=mCG6027.2 transcript_id=mCT174158.0 created
FT                   on 07-OCT-2002"
FT   mRNA            join(23455760..23455908,23459809..23459851,
FT                   23460607..23460733,23460889..23460968,23461685..23461747,
FT                   23462639..23462731,23462985..23463075,23464516..23464578,
FT                   23464809..23465016)
FT                   /gene="Cd74"
FT                   /locus_tag="mCG_6027"
FT                   /product="CD74 antigen (invariant polypeptide of major
FT                   histocompatibility complex, class II antigen-associated),
FT                   transcript variant mCT174160"
FT                   /note="gene_id=mCG6027.2 transcript_id=mCT174160.0 created
FT                   on 07-OCT-2002"
FT   mRNA            join(23455774..23455908,23460564..23460733,
FT                   23460889..23460968,23461685..23461747,23462639..23462731,
FT                   23462985..23463075,23464516..23464578,23464961..23465097)
FT                   /gene="Cd74"
FT                   /locus_tag="mCG_6027"
FT                   /product="CD74 antigen (invariant polypeptide of major
FT                   histocompatibility complex, class II antigen-associated),
FT                   transcript variant mCT174156"
FT                   /note="gene_id=mCG6027.2 transcript_id=mCT174156.0 created
FT                   on 07-OCT-2002"
FT   mRNA            join(23455774..23455908,23460564..23460733,
FT                   23460889..23460968,23461685..23461751,23462641..23462731,
FT                   23462985..23463049)
FT                   /gene="Cd74"
FT                   /locus_tag="mCG_6027"
FT                   /product="CD74 antigen (invariant polypeptide of major
FT                   histocompatibility complex, class II antigen-associated),
FT                   transcript variant mCT174159"
FT                   /note="gene_id=mCG6027.2 transcript_id=mCT174159.0 created
FT                   on 07-OCT-2002"
FT   CDS             join(23455832..23455908,23460564..23460733,
FT                   23460889..23460968,23461685..23461747,23462639..23462731,
FT                   23462985..23463075,23464516..23464578,23464961..23464974)
FT                   /codon_start=1
FT                   /gene="Cd74"
FT                   /locus_tag="mCG_6027"
FT                   /product="CD74 antigen (invariant polypeptide of major
FT                   histocompatibility complex, class II antigen-associated),
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG6027.2 transcript_id=mCT174156.0
FT                   protein_id=mCP97075.0 isoform=CRA_a"
FT                   /protein_id="EDL09805.1"
FT                   /translation="MDDQRDLISNHEQLPILGNRPREPERCSRGALYTGVSVLVALLLA
FT                   GQATTAYFLYQQQGRLDKLTITSQNLQLESLRMKLPKSAKPVSQMRMATPLLMRPMSMD
FT                   NMLLGPVKNVTKYGNMTQDHVMHLLTRSGPLEYPQLKGTFPENLKHLKNSMDGVNWKIF
FT                   ESWMKQWLLFEMSKNSLEEKKPTEAPPKEPLDMEDLSSGLGVTRQELGQGHGK"
FT   CDS             join(23455832..23455908,23459809..23459863,
FT                   23460619..23460733,23460889..23460968,23461685..23461747,
FT                   23462639..23462731,23462985..23463075,23464516..23464578,
FT                   23464809..23464819)
FT                   /codon_start=1
FT                   /gene="Cd74"
FT                   /locus_tag="mCG_6027"
FT                   /product="CD74 antigen (invariant polypeptide of major
FT                   histocompatibility complex, class II antigen-associated),
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG6027.2 transcript_id=mCT174158.0
FT                   protein_id=mCP97078.0 isoform=CRA_c"
FT                   /db_xref="GOA:Q545Y5"
FT                   /db_xref="InterPro:IPR011988"
FT                   /db_xref="InterPro:IPR015386"
FT                   /db_xref="InterPro:IPR022339"
FT                   /db_xref="MGI:MGI:96534"
FT                   /db_xref="UniProtKB/TrEMBL:Q545Y5"
FT                   /protein_id="EDL09807.1"
FT                   /translation="MDDQRDLISNHEQLPILGNRPREPERCSRGALYTGVSVLVALLLA
FT                   GQATTAYFLYQQQGRLDKLTITSQNLQLESLRMKLPKSAKPVSQMRMATPLLMRPMSMD
FT                   NMLLGPVKNVTKYGNMTQDHVMHLLTRSGPLEYPQLKGTFPENLKHLKNSMDGVNWKIF
FT                   ESWMKQWLLFEMSKNSLEEKKPTEAPPKEPLDMEDLSSGLGVTRQELGQVTL"
FT   CDS             join(23455832..23455908,23459809..23459851,
FT                   23460607..23460733,23460889..23460968,23461685..23461747,
FT                   23462639..23462731,23462985..23463075,23464516..23464578,
FT                   23464809..23464819)
FT                   /codon_start=1
FT                   /gene="Cd74"
FT                   /locus_tag="mCG_6027"
FT                   /product="CD74 antigen (invariant polypeptide of major
FT                   histocompatibility complex, class II antigen-associated),
FT                   isoform CRA_e"
FT                   /note="gene_id=mCG6027.2 transcript_id=mCT174160.0
FT                   protein_id=mCP97077.0 isoform=CRA_e"
FT                   /db_xref="GOA:Q545Y5"
FT                   /db_xref="InterPro:IPR011988"
FT                   /db_xref="InterPro:IPR015386"
FT                   /db_xref="InterPro:IPR022339"
FT                   /db_xref="MGI:MGI:96534"
FT                   /db_xref="UniProtKB/TrEMBL:Q545Y5"
FT                   /protein_id="EDL09809.1"
FT                   /translation="MDDQRDLISNHEQLPILGNRPREPERCSRGALYTGVSVLVALLLA
FT                   GQATTAYFLYQQQGRLDKLTITSQNLQLESLRMKLPKSAKPVSQMRMATPLLMRPMSMD
FT                   NMLLGPVKNVTKYGNMTQDHVMHLLTRSGPLEYPQLKGTFPENLKHLKNSMDGVNWKIF
FT                   ESWMKQWLLFEMSKNSLEEKKPTEAPPKEPLDMEDLSSGLGVTRQELGQVTL"
FT   CDS             join(23455832..23455908,23460564..23460733,
FT                   23460889..23460968,23461685..23461747,23462639..23462731,
FT                   23462985..23463075,23463951..23464142,23464516..23464578,
FT                   23464809..23464819)
FT                   /codon_start=1
FT                   /gene="Cd74"
FT                   /locus_tag="mCG_6027"
FT                   /product="CD74 antigen (invariant polypeptide of major
FT                   histocompatibility complex, class II antigen-associated),
FT                   isoform CRA_f"
FT                   /note="gene_id=mCG6027.2 transcript_id=mCT4725.2
FT                   protein_id=mCP21553.2 isoform=CRA_f"
FT                   /db_xref="GOA:Q3U4Q8"
FT                   /db_xref="InterPro:IPR000716"
FT                   /db_xref="InterPro:IPR011988"
FT                   /db_xref="InterPro:IPR015386"
FT                   /db_xref="InterPro:IPR022339"
FT                   /db_xref="MGI:MGI:96534"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U4Q8"
FT                   /protein_id="EDL09810.1"
FT                   /translation="MDDQRDLISNHEQLPILGNRPREPERCSRGALYTGVSVLVALLLA
FT                   GQATTAYFLYQQQGRLDKLTITSQNLQLESLRMKLPKSAKPVSQMRMATPLLMRPMSMD
FT                   NMLLGPVKNVTKYGNMTQDHVMHLLTRSGPLEYPQLKGTFPENLKHLKNSMDGVNWKIF
FT                   ESWMKQWLLFEMSKNSLEEKKPTEAPPKVLTKCQEEVSHIPAVYPGAFRPKCDENGNYL
FT                   PLQCHGSTGYCWCVFPNGTEVPHTKSRGRHNCSEPLDMEDLSSGLGVTRQELGQVTL"
FT   CDS             join(23455832..23455908,23460564..23460733,
FT                   23460889..23460968,23461685..23461747,23462639..23462731,
FT                   23462985..23463075,23464516..23464578,23464809..23464819)
FT                   /codon_start=1
FT                   /gene="Cd74"
FT                   /locus_tag="mCG_6027"
FT                   /product="CD74 antigen (invariant polypeptide of major
FT                   histocompatibility complex, class II antigen-associated),
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG6027.2 transcript_id=mCT174157.0
FT                   protein_id=mCP97079.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q545Y5"
FT                   /db_xref="InterPro:IPR011988"
FT                   /db_xref="InterPro:IPR015386"
FT                   /db_xref="InterPro:IPR022339"
FT                   /db_xref="MGI:MGI:96534"
FT                   /db_xref="UniProtKB/TrEMBL:Q545Y5"
FT                   /protein_id="EDL09806.1"
FT                   /translation="MDDQRDLISNHEQLPILGNRPREPERCSRGALYTGVSVLVALLLA
FT                   GQATTAYFLYQQQGRLDKLTITSQNLQLESLRMKLPKSAKPVSQMRMATPLLMRPMSMD
FT                   NMLLGPVKNVTKYGNMTQDHVMHLLTRSGPLEYPQLKGTFPENLKHLKNSMDGVNWKIF
FT                   ESWMKQWLLFEMSKNSLEEKKPTEAPPKEPLDMEDLSSGLGVTRQELGQVTL"
FT   CDS             join(23455832..23455908,23460564..23460733,
FT                   23460889..23460968,23461685..23461751,23462641..23462669)
FT                   /codon_start=1
FT                   /gene="Cd74"
FT                   /locus_tag="mCG_6027"
FT                   /product="CD74 antigen (invariant polypeptide of major
FT                   histocompatibility complex, class II antigen-associated),
FT                   isoform CRA_d"
FT                   /note="gene_id=mCG6027.2 transcript_id=mCT174159.0
FT                   protein_id=mCP97076.0 isoform=CRA_d"
FT                   /protein_id="EDL09808.1"
FT                   /translation="MDDQRDLISNHEQLPILGNRPREPERCSRGALYTGVSVLVALLLA
FT                   GQATTAYFLYQQQGRLDKLTITSQNLQLESLRMKLPKSAKPVSQMRMATPLLMRPMSMD
FT                   NMLLGPVKNVTKYGNMTQDHVMHLLTVSLDPWSTRS"
FT   gene            complement(23466412..23501608)
FT                   /gene="Tcof1"
FT                   /locus_tag="mCG_6035"
FT                   /note="gene_id=mCG6035.1"
FT   mRNA            complement(join(23466412..23466845,23467181..23467226,
FT                   23467616..23467710,23468659..23469186,23470688..23470868,
FT                   23471520..23471602,23472046..23472268,23474300..23474421,
FT                   23475461..23475647,23481021..23481215,23481312..23481491,
FT                   23481670..23481771,23484164..23484331,23484425..23484646,
FT                   23484817..23484960,23485078..23485275,23485372..23485581,
FT                   23486071..23486283,23488300..23488551,23490542..23490615,
FT                   23491320..23491506,23492217..23492278,23495852..23495997,
FT                   23498437..23498492,23501375..23501608))
FT                   /gene="Tcof1"
FT                   /locus_tag="mCG_6035"
FT                   /product="Treacher Collins Franceschetti syndrome 1,
FT                   homolog, transcript variant mCT4706"
FT                   /note="gene_id=mCG6035.1 transcript_id=mCT4706.2 created on
FT                   04-OCT-2002"
FT   mRNA            complement(join(23466421..23466845,23467181..23467226,
FT                   23467616..23467710,23468659..23469186,23470688..23470868,
FT                   23471520..23471602,23472046..23472268,23474300..23474421,
FT                   23475461..23475647,23481021..23481215,23481312..23481491,
FT                   23481670..23481771,23484164..23484331,23484425..23484646,
FT                   23485078..23485275,23485372..23485581,23486071..23486283,
FT                   23488300..23488551,23490542..23490615,23491320..23491506,
FT                   23492217..23492278,23495852..23495997,23498437..23498492,
FT                   23501375..23501532))
FT                   /gene="Tcof1"
FT                   /locus_tag="mCG_6035"
FT                   /product="Treacher Collins Franceschetti syndrome 1,
FT                   homolog, transcript variant mCT174423"
FT                   /note="gene_id=mCG6035.1 transcript_id=mCT174423.0 created
FT                   on 04-OCT-2002"
FT   mRNA            complement(join(23466421..23466845,23467181..23467226,
FT                   23467616..23467710,23468659..23469186,23470688..23470868,
FT                   23471520..23471602,23472046..23472268,23474300..23474421,
FT                   23475461..23475647,23481021..23481215,23481312..23481491,
FT                   23481670..23481771,23484164..23484331,23484425..23484646,
FT                   23484817..23484960,23485078..23485275,23485372..23485581,
FT                   23486071..23486283,23488300..23488551,23490542..23490615,
FT                   23491320..23491446,23492213..23492278,23495852..23495997,
FT                   23498437..23498492,23501375..>23501530))
FT                   /gene="Tcof1"
FT                   /locus_tag="mCG_6035"
FT                   /product="Treacher Collins Franceschetti syndrome 1,
FT                   homolog, transcript variant mCT190289"
FT                   /note="gene_id=mCG6035.1 transcript_id=mCT190289.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(23466421..23466845,23467181..23467226,
FT                   23467616..23467710,23468659..23469186,23470688..23470868,
FT                   23471520..23471602,23472046..23472070,23472140..23472268,
FT                   23474300..23474421,23475461..23475647,23481021..23481215,
FT                   23481312..23481491,23481670..23481771,23484164..23484331,
FT                   23484425..23484646,23484817..23484960,23485078..23485275,
FT                   23485372..23485581,23486071..23486283,23488300..23488551,
FT                   23490542..23490615,23491320..23491448,23492213..23492278,
FT                   23495852..23495997,23498437..23498492,23501375..23501530))
FT                   /gene="Tcof1"
FT                   /locus_tag="mCG_6035"
FT                   /product="Treacher Collins Franceschetti syndrome 1,
FT                   homolog, transcript variant mCT174424"
FT                   /note="gene_id=mCG6035.1 transcript_id=mCT174424.0 created
FT                   on 04-OCT-2002"
FT   mRNA            complement(join(23466421..23466845,23467181..23467226,
FT                   23467616..23467710,23468659..23469186,23470688..23470868,
FT                   23471520..23471602,23472046..23472268,23474300..23474421,
FT                   23475461..23475647,23481021..23481215,23481312..23481491,
FT                   23481670..23481771,23484164..23484331,23484425..23484646,
FT                   23484817..23484960,23485078..23485275,23485372..23485581,
FT                   23486071..23486283,23488300..23488551,23490542..23490615,
FT                   23491320..23491448,23492213..23492278,23495852..23495997,
FT                   23498437..23498492,23501375..23501530))
FT                   /gene="Tcof1"
FT                   /locus_tag="mCG_6035"
FT                   /product="Treacher Collins Franceschetti syndrome 1,
FT                   homolog, transcript variant mCT174425"
FT                   /note="gene_id=mCG6035.1 transcript_id=mCT174425.0 created
FT                   on 04-OCT-2002"
FT   mRNA            complement(join(23466755..23466845,23467181..23467226,
FT                   23467616..23467710,23468659..23469186,23470688..23470868,
FT                   23471520..23471602,23472046..23472268,23474300..23474421,
FT                   23475461..23475647,23479996..23480103,23481021..23481215,
FT                   23481312..23481491,23481670..23481771,23484164..23484331,
FT                   23484425..23484646,23484817..23484960,23485078..23485275,
FT                   23485372..23485581,23486071..23486283,23488300..23488551,
FT                   23490542..23490615,23491320..23491506,23492217..23492278,
FT                   23495852..23495997,23498437..23498492,23501375..23501532))
FT                   /gene="Tcof1"
FT                   /locus_tag="mCG_6035"
FT                   /product="Treacher Collins Franceschetti syndrome 1,
FT                   homolog, transcript variant mCT174426"
FT                   /note="gene_id=mCG6035.1 transcript_id=mCT174426.0 created
FT                   on 04-OCT-2002"
FT   CDS             complement(join(23467200..23467226,23467616..23467710,
FT                   23468659..23469186,23470688..23470868,23471520..23471602,
FT                   23472046..23472268,23474300..23474421,23475461..23475647,
FT                   23481021..23481215,23481312..23481491,23481670..23481771,
FT                   23484164..23484331,23484425..23484646,23485078..23485275,
FT                   23485372..23485581,23486071..23486283,23488300..23488551,
FT                   23490542..23490615,23491320..23491506,23492217..23492278,
FT                   23495852..23495997,23498437..23498492,23501375..23501482))
FT                   /codon_start=1
FT                   /gene="Tcof1"
FT                   /locus_tag="mCG_6035"
FT                   /product="Treacher Collins Franceschetti syndrome 1,
FT                   homolog, isoform CRA_a"
FT                   /note="gene_id=mCG6035.1 transcript_id=mCT174423.0
FT                   protein_id=mCP97342.0 isoform=CRA_a"
FT                   /protein_id="EDL09798.1"
FT                   /translation="MAEARKRRELLPLIYHHLLQAGYVRAAREVKEQSGQKSFLTQPVT
FT                   LLDIYTHWQQTSELGQKQKAEDDETLQAKKSRVSDPVSSSESSDQEKEEEAATERAKAT
FT                   PRPTPVNSATAALPSKVKEKGKTKTANKTVNSVSHPGSGKTVVHLLSGKSPKKSAEPLA
FT                   NTVLASETEEEGNAQALGPTAKSGTVSAGQGSSSSEDSSISSDETDVEVKSPAKPAQAK
FT                   ASAAPAKDPPARTAPGPTKLGNVAPTPAKPARAAAAAAAAAVAAAAAAAAEESESSEED
FT                   SDSEDEAPAGLPSQVKASGKGPHVRADSVSAKGISGKGPILATPGKTGPAATQAKAERP
FT                   EKDSETSSEDDSDSEDEMPVTVNTPQARTSGKSPRARGTSAPAKESSQKGAPAVTPGKA
FT                   RPVAAQAGKPEAKSSEESESDSGETPAAATLTTSPAKVKPLGKSSQVRPVSTVTPGSSG
FT                   KGANLPCPGKVGSAALRVQMVKKEDVSESSSAELDSDGPGSPAKAKPALEKQMKASSRK
FT                   GTPASATGASTSSHCKAGAVTSSASLSSPALAKGTQRSDVDSSSESESEGAAPSTPRVQ
FT                   GKSGGKGLQGKAALGQGVAPVHTQKTGPSVKAMAQEDSESLEEDSSSEEEDETPAQATP
FT                   LGRLPQAKANPPPTKTPPASASGKAVAAPTKGKPPVPNSTVSARGQRSVPAAGKAGAPA
FT                   TQAQKGPVAGTGEDSESSSKEESDSEEETPAQIKPVGKTSQVRAASAPAKESPKKGAHP
FT                   GTPGKTGSSATQAQPGKTEDSDSSSEESDSDTEMPSAQAIKSPPVSVNRNSSPAVPAPT
FT                   PEGVQAVNTTKKASGTTAQSSSSESEDGDEDLIPATQPSTYALRTSVTTPAALSRAASQ
FT                   PSKSEQSSRMPKGKKAKAAASAQTSSAVETLPMMPPQSAPIQPKATNKLGKSKLPEKQQ
FT                   LAPGYPKAPRSSEDSSDTSSEDEEDAKRPQMPKSAHRLDPDPSQKETVVEETPTESSED
FT                   EMVAPSQSLLSGYMTPGLTVANSQASKATPRPDSNSLASSAPATKDNPDGKQKSKSQHA
FT                   ADTALPKTGRKEASSGSTPQKPKKPKKSTSSSPAPTQTLPNSITQRLLEQAWPLSEAQV
FT                   QASVVKVLTELLEQERLKATEAIKESGKKSQKRKLSGDLEAGAPKNKKKKEQPVPRASA
FT                   VSPEKAPMTSKAKSKLDKGSAGGKGKGSPGPQGAKEKPDGELLGIKLESGEQSDPKSKS
FT                   KKKKSLKKKKDKEKKEKKKGKKSLAKDSASPIQKKKKKKKKSAEPAV"
FT   CDS             complement(join(23467200..23467226,23467616..23467710,
FT                   23468659..23469186,23470688..23470868,23471520..23471602,
FT                   23472046..23472268,23474300..23474421,23475461..23475647,
FT                   23481021..23481215,23481312..23481491,23481670..23481771,
FT                   23484164..23484331,23484425..23484646,23484817..23484960,
FT                   23485078..23485275,23485372..23485581,23486071..23486283,
FT                   23488300..23488551,23490542..23490615,23491320..23491506,
FT                   23492217..23492278,23495852..23495997,23498437..23498492,
FT                   23501375..23501482))
FT                   /codon_start=1
FT                   /gene="Tcof1"
FT                   /locus_tag="mCG_6035"
FT                   /product="Treacher Collins Franceschetti syndrome 1,
FT                   homolog, isoform CRA_f"
FT                   /note="gene_id=mCG6035.1 transcript_id=mCT4706.2
FT                   protein_id=mCP21555.2 isoform=CRA_f"
FT                   /protein_id="EDL09803.1"
FT                   /translation="MAEARKRRELLPLIYHHLLQAGYVRAAREVKEQSGQKSFLTQPVT
FT                   LLDIYTHWQQTSELGQKQKAEDDETLQAKKSRVSDPVSSSESSDQEKEEEAATERAKAT
FT                   PRPTPVNSATAALPSKVKEKGKTKTANKTVNSVSHPGSGKTVVHLLSGKSPKKSAEPLA
FT                   NTVLASETEEEGNAQALGPTAKSGTVSAGQGSSSSEDSSISSDETDVEVKSPAKPAQAK
FT                   ASAAPAKDPPARTAPGPTKLGNVAPTPAKPARAAAAAAAAAVAAAAAAAAEESESSEED
FT                   SDSEDEAPAGLPSQVKASGKGPHVRADSVSAKGISGKGPILATPGKTGPAATQAKAERP
FT                   EKDSETSSEDDSDSEDEMPVTVNTPQARTSGKSPRARGTSAPAKESSQKGAPAVTPGKA
FT                   RPVAAQAGKPEAKSSEESESDSGETPAAATLTTSPAKVKPLGKSSQVRPVSTVTPGSSG
FT                   KGANLPCPGKVGSAALRVQMVKKEDVSESSSAELDSDGPGSPAKAKASLALPQKVRPVA
FT                   TQVKTDRGKGHSGSSEESSDSEEEAAPAASAAQAKPALEKQMKASSRKGTPASATGAST
FT                   SSHCKAGAVTSSASLSSPALAKGTQRSDVDSSSESESEGAAPSTPRVQGKSGGKGLQGK
FT                   AALGQGVAPVHTQKTGPSVKAMAQEDSESLEEDSSSEEEDETPAQATPLGRLPQAKANP
FT                   PPTKTPPASASGKAVAAPTKGKPPVPNSTVSARGQRSVPAAGKAGAPATQAQKGPVAGT
FT                   GEDSESSSKEESDSEEETPAQIKPVGKTSQVRAASAPAKESPKKGAHPGTPGKTGSSAT
FT                   QAQPGKTEDSDSSSEESDSDTEMPSAQAIKSPPVSVNRNSSPAVPAPTPEGVQAVNTTK
FT                   KASGTTAQSSSSESEDGDEDLIPATQPSTYALRTSVTTPAALSRAASQPSKSEQSSRMP
FT                   KGKKAKAAASAQTSSAVETLPMMPPQSAPIQPKATNKLGKSKLPEKQQLAPGYPKAPRS
FT                   SEDSSDTSSEDEEDAKRPQMPKSAHRLDPDPSQKETVVEETPTESSEDEMVAPSQSLLS
FT                   GYMTPGLTVANSQASKATPRPDSNSLASSAPATKDNPDGKQKSKSQHAADTALPKTGRK
FT                   EASSGSTPQKPKKPKKSTSSSPAPTQTLPNSITQRLLEQAWPLSEAQVQASVVKVLTEL
FT                   LEQERLKATEAIKESGKKSQKRKLSGDLEAGAPKNKKKKEQPVPRASAVSPEKAPMTSK
FT                   AKSKLDKGSAGGKGKGSPGPQGAKEKPDGELLGIKLESGEQSDPKSKSKKKKSLKKKKD
FT                   KEKKEKKKGKKSLAKDSASPIQKKKKKKKKSAEPAV"
FT   CDS             complement(join(23467200..23467226,23467616..23467710,
FT                   23468659..23469186,23470688..23470868,23471520..23471602,
FT                   23472046..23472268,23474300..23474421,23475461..23475647,
FT                   23479996..23480103,23481021..23481215,23481312..23481491,
FT                   23481670..23481771,23484164..23484331,23484425..23484646,
FT                   23484817..23484960,23485078..23485275,23485372..23485581,
FT                   23486071..23486283,23488300..23488551,23490542..23490615,
FT                   23491320..23491506,23492217..23492278,23495852..23495997,
FT                   23498437..23498492,23501375..23501482))
FT                   /codon_start=1
FT                   /gene="Tcof1"
FT                   /locus_tag="mCG_6035"
FT                   /product="Treacher Collins Franceschetti syndrome 1,
FT                   homolog, isoform CRA_c"
FT                   /note="gene_id=mCG6035.1 transcript_id=mCT174426.0
FT                   protein_id=mCP97343.0 isoform=CRA_c"
FT                   /protein_id="EDL09800.1"
FT                   /translation="MAEARKRRELLPLIYHHLLQAGYVRAAREVKEQSGQKSFLTQPVT
FT                   LLDIYTHWQQTSELGQKQKAEDDETLQAKKSRVSDPVSSSESSDQEKEEEAATERAKAT
FT                   PRPTPVNSATAALPSKVKEKGKTKTANKTVNSVSHPGSGKTVVHLLSGKSPKKSAEPLA
FT                   NTVLASETEEEGNAQALGPTAKSGTVSAGQGSSSSEDSSISSDETDVEVKSPAKPAQAK
FT                   ASAAPAKDPPARTAPGPTKLGNVAPTPAKPARAAAAAAAAAVAAAAAAAAEESESSEED
FT                   SDSEDEAPAGLPSQVKASGKGPHVRADSVSAKGISGKGPILATPGKTGPAATQAKAERP
FT                   EKDSETSSEDDSDSEDEMPVTVNTPQARTSGKSPRARGTSAPAKESSQKGAPAVTPGKA
FT                   RPVAAQAGKPEAKSSEESESDSGETPAAATLTTSPAKVKPLGKSSQVRPVSTVTPGSSG
FT                   KGANLPCPGKVGSAALRVQMVKKEDVSESSSAELDSDGPGSPAKAKASLALPQKVRPVA
FT                   TQVKTDRGKGHSGSSEESSDSEEEAAPAASAAQAKPALEKQMKASSRKGTPASATGAST
FT                   SSHCKAGAVTSSASLSSPALAKGTQRSDVDSSSESESEGAAPSTPRVQGKSGGKGLQGK
FT                   AALGQGVAPVHTQKTGPSVKAMAQEDSESLEEDSSSEEEDETPAQATPLGRLPQAKANP
FT                   PPTKTPPASASGKAVAAPTKGKPPVPNSTVSARGQRSVPAAGKAGAPATQAQKGPVAGT
FT                   GEDSESSSKEESDSEEETPAQIKPVGKTSQVRAASAPAKESPKKGAHPGTPGKTGSSAT
FT                   QAQPGKTEDSDSSSEESDSDTEMPSAQDAISQPARGKASGPASPEKSIEGSSESSDEDL
FT                   PSGQAIKSPPVSVNRNSSPAVPAPTPEGVQAVNTTKKASGTTAQSSSSESEDGDEDLIP
FT                   ATQPSTYALRTSVTTPAALSRAASQPSKSEQSSRMPKGKKAKAAASAQTSSAVETLPMM
FT                   PPQSAPIQPKATNKLGKSKLPEKQQLAPGYPKAPRSSEDSSDTSSEDEEDAKRPQMPKS
FT                   AHRLDPDPSQKETVVEETPTESSEDEMVAPSQSLLSGYMTPGLTVANSQASKATPRPDS
FT                   NSLASSAPATKDNPDGKQKSKSQHAADTALPKTGRKEASSGSTPQKPKKPKKSTSSSPA
FT                   PTQTLPNSITQRLLEQAWPLSEAQVQASVVKVLTELLEQERLKATEAIKESGKKSQKRK
FT                   LSGDLEAGAPKNKKKKEQPVPRASAVSPEKAPMTSKAKSKLDKGSAGGKGKGSPGPQGA
FT                   KEKPDGELLGIKLESGEQSDPKSKSKKKKSLKKKKDKEKKEKKKGKKSLAKDSASPIQK
FT                   KKKKKKKSAEPAV"
FT   CDS             complement(join(23467200..23467226,23467616..23467710,
FT                   23468659..23469186,23470688..23470868,23471520..23471602,
FT                   23472046..23472070,23472140..23472268,23474300..23474421,
FT                   23475461..23475647,23481021..23481215,23481312..23481491,
FT                   23481670..23481771,23484164..23484331,23484425..23484646,
FT                   23484817..23484960,23485078..23485275,23485372..23485581,
FT                   23486071..23486283,23488300..23488551,23490542..23490615,
FT                   23491320..23491448,23492213..23492278,23495852..23495997,
FT                   23498437..23498492,23501375..23501482))
FT                   /codon_start=1
FT                   /gene="Tcof1"
FT                   /locus_tag="mCG_6035"
FT                   /product="Treacher Collins Franceschetti syndrome 1,
FT                   homolog, isoform CRA_g"
FT                   /note="gene_id=mCG6035.1 transcript_id=mCT174424.0
FT                   protein_id=mCP97344.0 isoform=CRA_g"
FT                   /protein_id="EDL09804.1"
FT                   /translation="MAEARKRRELLPLIYHHLLQAGYVRAAREVKEQSGQKSFLTQPVT
FT                   LLDIYTHWQQTSELGQKQKAEDDETLQAKKSRVSDPVSSSESSDQEKEEEAATERAKAT
FT                   PRPTPVNSATAALPSKVKEKVKTVVHLLSGKSPKKSAEPLANTVLASETEEEGNAQALG
FT                   PTAKSGTVSAGQGSSSSEDSSISSDETDVEVKSPAKPAQAKASAAPAKDPPARTAPGPT
FT                   KLGNVAPTPAKPARAAAAAAAAAVAAAAAAAAEESESSEEDSDSEDEAPAGLPSQVKAS
FT                   GKGPHVRADSVSAKGISGKGPILATPGKTGPAATQAKAERPEKDSETSSEDDSDSEDEM
FT                   PVTVNTPQARTSGKSPRARGTSAPAKESSQKGAPAVTPGKARPVAAQAGKPEAKSSEES
FT                   ESDSGETPAAATLTTSPAKVKPLGKSSQVRPVSTVTPGSSGKGANLPCPGKVGSAALRV
FT                   QMVKKEDVSESSSAELDSDGPGSPAKAKASLALPQKVRPVATQVKTDRGKGHSGSSEES
FT                   SDSEEEAAPAASAAQAKPALEKQMKASSRKGTPASATGASTSSHCKAGAVTSSASLSSP
FT                   ALAKGTQRSDVDSSSESESEGAAPSTPRVQGKSGGKGLQGKAALGQGVAPVHTQKTGPS
FT                   VKAMAQEDSESLEEDSSSEEEDETPAQATPLGRLPQAKANPPPTKTPPASASGKAVAAP
FT                   TKGKPPVPNSTVSARGQRSVPAAGKAGAPATQAQKGPVAGTGEDSESSSKEESDSEEET
FT                   PAQIKPVGKTSQVRAASAPAKESPKKGAHPGTPGKTGSSATQAQPGKTEDSDSSSEESD
FT                   SDTEMPSAQAIKSPPVSVNRNSSPAVPAPTPEGVQAVNTTKKASGTTAQSSSSESEDGD
FT                   EDLIPATQPSTYALRTSVTTPAALSRAASQPSKSEQSSRMPKGKKAKAAASAQTSSAVE
FT                   TLPMMPPQSAPIQPKATNKLGKSKLPEKQQLAPGYPKMPKSAHRLDPDPSQKETVVEET
FT                   PTESSEDEMVAPSQSLLSGYMTPGLTVANSQASKATPRPDSNSLASSAPATKDNPDGKQ
FT                   KSKSQHAADTALPKTGRKEASSGSTPQKPKKPKKSTSSSPAPTQTLPNSITQRLLEQAW
FT                   PLSEAQVQASVVKVLTELLEQERLKATEAIKESGKKSQKRKLSGDLEAGAPKNKKKKEQ
FT                   PVPRASAVSPEKAPMTSKAKSKLDKGSAGGKGKGSPGPQGAKEKPDGELLGIKLESGEQ
FT                   SDPKSKSKKKKSLKKKKDKEKKEKKKGKKSLAKDSASPIQKKKKKKKKSAEPAV"
FT   CDS             complement(join(23467200..23467226,23467616..23467710,
FT                   23468659..23469186,23470688..23470868,23471520..23471602,
FT                   23472046..23472268,23474300..23474421,23475461..23475647,
FT                   23481021..23481215,23481312..23481491,23481670..23481771,
FT                   23484164..23484331,23484425..23484646,23484817..23484960,
FT                   23485078..23485275,23485372..23485581,23486071..23486283,
FT                   23488300..23488551,23490542..23490615,23491320..23491448,
FT                   23492213..23492278,23495852..23495997,23498437..23498492,
FT                   23501375..23501482))
FT                   /codon_start=1
FT                   /gene="Tcof1"
FT                   /locus_tag="mCG_6035"
FT                   /product="Treacher Collins Franceschetti syndrome 1,
FT                   homolog, isoform CRA_b"
FT                   /note="gene_id=mCG6035.1 transcript_id=mCT174425.0
FT                   protein_id=mCP97345.0 isoform=CRA_b"
FT                   /protein_id="EDL09799.1"
FT                   /translation="MAEARKRRELLPLIYHHLLQAGYVRAAREVKEQSGQKSFLTQPVT
FT                   LLDIYTHWQQTSELGQKQKAEDDETLQAKKSRVSDPVSSSESSDQEKEEEAATERAKAT
FT                   PRPTPVNSATAALPSKVKEKVKTVVHLLSGKSPKKSAEPLANTVLASETEEEGNAQALG
FT                   PTAKSGTVSAGQGSSSSEDSSISSDETDVEVKSPAKPAQAKASAAPAKDPPARTAPGPT
FT                   KLGNVAPTPAKPARAAAAAAAAAVAAAAAAAAEESESSEEDSDSEDEAPAGLPSQVKAS
FT                   GKGPHVRADSVSAKGISGKGPILATPGKTGPAATQAKAERPEKDSETSSEDDSDSEDEM
FT                   PVTVNTPQARTSGKSPRARGTSAPAKESSQKGAPAVTPGKARPVAAQAGKPEAKSSEES
FT                   ESDSGETPAAATLTTSPAKVKPLGKSSQVRPVSTVTPGSSGKGANLPCPGKVGSAALRV
FT                   QMVKKEDVSESSSAELDSDGPGSPAKAKASLALPQKVRPVATQVKTDRGKGHSGSSEES
FT                   SDSEEEAAPAASAAQAKPALEKQMKASSRKGTPASATGASTSSHCKAGAVTSSASLSSP
FT                   ALAKGTQRSDVDSSSESESEGAAPSTPRVQGKSGGKGLQGKAALGQGVAPVHTQKTGPS
FT                   VKAMAQEDSESLEEDSSSEEEDETPAQATPLGRLPQAKANPPPTKTPPASASGKAVAAP
FT                   TKGKPPVPNSTVSARGQRSVPAAGKAGAPATQAQKGPVAGTGEDSESSSKEESDSEEET
FT                   PAQIKPVGKTSQVRAASAPAKESPKKGAHPGTPGKTGSSATQAQPGKTEDSDSSSEESD
FT                   SDTEMPSAQAIKSPPVSVNRNSSPAVPAPTPEGVQAVNTTKKASGTTAQSSSSESEDGD
FT                   EDLIPATQPSTYALRTSVTTPAALSRAASQPSKSEQSSRMPKGKKAKAAASAQTSSAVE
FT                   TLPMMPPQSAPIQPKATNKLGKSKLPEKQQLAPGYPKAPRSSEDSSDTSSEDEEDAKRP
FT                   QMPKSAHRLDPDPSQKETVVEETPTESSEDEMVAPSQSLLSGYMTPGLTVANSQASKAT
FT                   PRPDSNSLASSAPATKDNPDGKQKSKSQHAADTALPKTGRKEASSGSTPQKPKKPKKST
FT                   SSSPAPTQTLPNSITQRLLEQAWPLSEAQVQASVVKVLTELLEQERLKATEAIKESGKK
FT                   SQKRKLSGDLEAGAPKNKKKKEQPVPRASAVSPEKAPMTSKAKSKLDKGSAGGKGKGSP
FT                   GPQGAKEKPDGELLGIKLESGEQSDPKSKSKKKKSLKKKKDKEKKEKKKGKKSLAKDSA
FT                   SPIQKKKKKKKKSAEPAV"
FT   CDS             complement(join(23467200..23467226,23467616..23467710,
FT                   23468659..23469186,23470688..23470868,23471520..23471602,
FT                   23472046..23472268,23474300..23474421,23475461..23475647,
FT                   23481021..23481215,23481312..23481491,23481670..23481771,
FT                   23484164..23484331,23484425..23484646,23484817..23484960,
FT                   23485078..23485275,23485372..23485581,23486071..23486283,
FT                   23488300..23488551,23490542..23490615,23491320..>23491446))
FT                   /codon_start=1
FT                   /gene="Tcof1"
FT                   /locus_tag="mCG_6035"
FT                   /product="Treacher Collins Franceschetti syndrome 1,
FT                   homolog, isoform CRA_e"
FT                   /note="gene_id=mCG6035.1 transcript_id=mCT190289.0
FT                   protein_id=mCP111290.0 isoform=CRA_e"
FT                   /protein_id="EDL09802.1"
FT                   /translation="TVVHLLSGKSPKKSAEPLANTVLASETEEEGNAQALGPTAKSGTV
FT                   SAGQGSSSSEDSSISSDETDVEVKSPAKPAQAKASAAPAKDPPARTAPGPTKLGNVAPT
FT                   PAKPARAAAAAAAAAVAAAAAAAAEESESSEEDSDSEDEAPAGLPSQVKASGKGPHVRA
FT                   DSVSAKGISGKGPILATPGKTGPAATQAKAERPEKDSETSSEDDSDSEDEMPVTVNTPQ
FT                   ARTSGKSPRARGTSAPAKESSQKGAPAVTPGKARPVAAQAGKPEAKSSEESESDSGETP
FT                   AAATLTTSPAKVKPLGKSSQVRPVSTVTPGSSGKGANLPCPGKVGSAALRVQMVKKEDV
FT                   SESSSAELDSDGPGSPAKAKASLALPQKVRPVATQVKTDRGKGHSGSSEESSDSEEEAA
FT                   PAASAAQAKPALEKQMKASSRKGTPASATGASTSSHCKAGAVTSSASLSSPALAKGTQR
FT                   SDVDSSSESESEGAAPSTPRVQGKSGGKGLQGKAALGQGVAPVHTQKTGPSVKAMAQED
FT                   SESLEEDSSSEEEDETPAQATPLGRLPQAKANPPPTKTPPASASGKAVAAPTKGKPPVP
FT                   NSTVSARGQRSVPAAGKAGAPATQAQKGPVAGTGEDSESSSKEESDSEEETPAQIKPVG
FT                   KTSQVRAASAPAKESPKKGAHPGTPGKTGSSATQAQPGKTEDSDSSSEESDSDTEMPSA
FT                   QAIKSPPVSVNRNSSPAVPAPTPEGVQAVNTTKKASGTTAQSSSSESEDGDEDLIPATQ
FT                   PSTYALRTSVTTPAALSRAASQPSKSEQSSRMPKGKKAKAAASAQTSSAVETLPMMPPQ
FT                   SAPIQPKATNKLGKSKLPEKQQLAPGYPKAPRSSEDSSDTSSEDEEDAKRPQMPKSAHR
FT                   LDPDPSQKETVVEETPTESSEDEMVAPSQSLLSGYMTPGLTVANSQASKATPRPDSNSL
FT                   ASSAPATKDNPDGKQKSKSQHAADTALPKTGRKEASSGSTPQKPKKPKKSTSSSPAPTQ
FT                   TLPNSITQRLLEQAWPLSEAQVQASVVKVLTELLEQERLKATEAIKESGKKSQKRKLSG
FT                   DLEAGAPKNKKKKEQPVPRASAVSPEKAPMTSKAKSKLDKGSAGGKGKGSPGPQGAKEK
FT                   PDGELLGIKLESGEQSDPKSKSKKKKSLKKKKDKEKKEKKKGKKSLAKDSASPIQKKKK
FT                   KKKKSAEPAV"
FT   mRNA            complement(join(23468660..23469186,23470688..23470868,
FT                   23471520..23471602,23472046..23472268,23474290..23474421,
FT                   23475461..23475647,23479996..23480103,23481021..23481215,
FT                   23481312..23481491,23481670..23481771,23484164..23484331,
FT                   23484425..23484646,23484817..23484960,23485078..23485275,
FT                   23485372..23485581,23486071..23486283,23488300..23488551,
FT                   23490542..23490615,23491320..23491506,23492217..23492278,
FT                   23495852..23495997,23498437..23498492,23501375..>23501575))
FT                   /gene="Tcof1"
FT                   /locus_tag="mCG_6035"
FT                   /product="Treacher Collins Franceschetti syndrome 1,
FT                   homolog, transcript variant mCT190288"
FT                   /note="gene_id=mCG6035.1 transcript_id=mCT190288.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(23472171..23472268,23474290..23474421,
FT                   23475461..23475647,23479996..23480103,23481021..23481215,
FT                   23481312..23481491,23481670..23481771,23484164..23484331,
FT                   23484425..23484646,23484817..23484960,23485078..23485275,
FT                   23485372..23485581,23486071..23486283,23488300..23488551,
FT                   23490542..23490615,23491320..23491506,23492217..23492278,
FT                   23495852..23495997,23498437..23498492,23501375..>23501557))
FT                   /codon_start=1
FT                   /gene="Tcof1"
FT                   /locus_tag="mCG_6035"
FT                   /product="Treacher Collins Franceschetti syndrome 1,
FT                   homolog, isoform CRA_d"
FT                   /note="gene_id=mCG6035.1 transcript_id=mCT190288.0
FT                   protein_id=mCP111289.0 isoform=CRA_d"
FT                   /protein_id="EDL09801.1"
FT                   /translation="GSRARGKRLAGARGRARESPGQISGMAEARKRRELLPLIYHHLLQ
FT                   AGYVRAAREVKEQSGQKSFLTQPVTLLDIYTHWQQTSELGQKQKAEDDETLQAKKSRVS
FT                   DPVSSSESSDQEKEEEAATERAKATPRPTPVNSATAALPSKVKEKGKTKTANKTVNSVS
FT                   HPGSGKTVVHLLSGKSPKKSAEPLANTVLASETEEEGNAQALGPTAKSGTVSAGQGSSS
FT                   SEDSSISSDETDVEVKSPAKPAQAKASAAPAKDPPARTAPGPTKLGNVAPTPAKPARAA
FT                   AAAAAAAVAAAAAAAAEESESSEEDSDSEDEAPAGLPSQVKASGKGPHVRADSVSAKGI
FT                   SGKGPILATPGKTGPAATQAKAERPEKDSETSSEDDSDSEDEMPVTVNTPQARTSGKSP
FT                   RARGTSAPAKESSQKGAPAVTPGKARPVAAQAGKPEAKSSEESESDSGETPAAATLTTS
FT                   PAKVKPLGKSSQVRPVSTVTPGSSGKGANLPCPGKVGSAALRVQMVKKEDVSESSSAEL
FT                   DSDGPGSPAKAKASLALPQKVRPVATQVKTDRGKGHSGSSEESSDSEEEAAPAASAAQA
FT                   KPALEKQMKASSRKGTPASATGASTSSHCKAGAVTSSASLSSPALAKGTQRSDVDSSSE
FT                   SESEGAAPSTPRVQGKSGGKGLQGKAALGQGVAPVHTQKTGPSVKAMAQEDSESLEEDS
FT                   SSEEEDETPAQATPLGRLPQAKANPPPTKTPPASASGKAVAAPTKGKPPVPNSTVSARG
FT                   QRSVPAAGKAGAPATQAQKGPVAGTGEDSESSSKEESDSEEETPAQIKPVGKTSQVRAA
FT                   SAPAKESPKKGAHPGTPGKTGSSATQAQPGKTEDSDSSSEESDSDTEMPSAQDAISQPA
FT                   RGKASGPASPEKSIEGSSESSDEDLPSGQAIKSPPVSVNRNSSPAVPAPTPEGVQAVNT
FT                   TKKASGTTAQSSSSESEDGDEDLIPATQPSTYALRTSVTTPAALSRAASQPSKSEQSSR
FT                   MPKGKKAKAAASAQVLSDQQCRGNTPHDASPERTHPAQSHQQAREIQAP"
FT   gene            23565780..23572288
FT                   /locus_tag="mCG_6034"
FT                   /note="gene_id=mCG6034.2"
FT   mRNA            join(23565780..23566334,23570141..23572288)
FT                   /locus_tag="mCG_6034"
FT                   /product="mCG6034"
FT                   /note="gene_id=mCG6034.2 transcript_id=mCT4702.2 created on
FT                   04-OCT-2002"
FT   CDS             join(23566024..23566334,23570141..23571551)
FT                   /codon_start=1
FT                   /locus_tag="mCG_6034"
FT                   /product="mCG6034"
FT                   /note="gene_id=mCG6034.2 transcript_id=mCT4702.2
FT                   protein_id=mCP21567.1"
FT                   /db_xref="GOA:Q32KI9"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024607"
FT                   /db_xref="MGI:MGI:2670959"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q32KI9"
FT                   /protein_id="EDL09797.1"
FT                   /translation="MHALSGFSLVSLLSLGYLSWDWAKPGLVADGPAEAGDQPSVAPPQ
FT                   PPHIIFILTDDQGYHDVGYHGSDIETPTLDRLAAEGVKLENYYIQPICTPSRSQLLTGR
FT                   YQIHTGLQHSIIRPRQPNCLPLDQVTLPQKLQEAGYSTHMVGKWHLGFYRKECLPTRRG
FT                   FDTFLGSLTGNVDYYTYDNCDGPGVCGFDLHEGESVAWGLSGQYSTMLYAQRASHILAS
FT                   HNPQNPLFLYVAFQAVHTPLQSPREYLYRYRTMGNVARRKYAAMVTCMDEAVRNITWAL
FT                   KRYGFYNNSVIIFSSDNGGQTFSGGSNWPLRGRKGTYWEGGVRGLGFVHSPLLKKKRRT
FT                   SRALVHITDWYPTLVGLAGGTTSAADGLDGYDVWPAISEGRASPRTEILHNIDPLYNHA
FT                   RHGSLEGGFGIWNTAVQAAIRVGEWKLLTGDPGYGDWIPPQTLASFPGSWWNLERMASI
FT                   RQAVWLFNISADPYEREDLAGQRPDVVRTLLARLADYNRTAIPVRYPAANPRAHPDFNG
FT                   GAWGPWASEEEEEEEEEEEEGRARSFSRGRRKKKCKICKLRSFFRKLNTRLMSHRI"
FT   gene            23579404..23640203
FT                   /gene="Camk2a"
FT                   /locus_tag="mCG_127781"
FT                   /note="gene_id=mCG127781.1"
FT   mRNA            join(23579404..23579611,23595076..23595170,
FT                   23600775..23600834,23605162..23605216,23606003..23606068,
FT                   23606154..23606226,23609407..23609509,23610974..23611057,
FT                   23611170..23611264,23612011..23612133,23612443..23612526,
FT                   23613873..23613915,23617793..23617833,23623733..23623781,
FT                   23631675..23631750,23633778..23633872,23638135..23638363,
FT                   23638586..23640203)
FT                   /gene="Camk2a"
FT                   /locus_tag="mCG_127781"
FT                   /product="calcium/calmodulin-dependent protein kinase II
FT                   alpha, transcript variant mCT129074"
FT                   /note="gene_id=mCG127781.1 transcript_id=mCT129074.1
FT                   created on 04-OCT-2002"
FT   mRNA            join(23579537..23579611,23595076..23595170,
FT                   23596898..23597183)
FT                   /gene="Camk2a"
FT                   /locus_tag="mCG_127781"
FT                   /product="calcium/calmodulin-dependent protein kinase II
FT                   alpha, transcript variant mCT173858"
FT                   /note="gene_id=mCG127781.1 transcript_id=mCT173858.0
FT                   created on 04-OCT-2002"
FT   CDS             join(23579550..23579611,23595076..23595170,
FT                   23600775..23600834,23605162..23605216,23606003..23606068,
FT                   23606154..23606226,23609407..23609509,23610974..23611057,
FT                   23611170..23611264,23612011..23612133,23612443..23612526,
FT                   23613873..23613915,23617793..23617833,23623733..23623781,
FT                   23631675..23631750,23633778..23633872,23638135..23638363,
FT                   23638586..23638589)
FT                   /codon_start=1
FT                   /gene="Camk2a"
FT                   /locus_tag="mCG_127781"
FT                   /product="calcium/calmodulin-dependent protein kinase II
FT                   alpha, isoform CRA_c"
FT                   /note="gene_id=mCG127781.1 transcript_id=mCT129074.1
FT                   protein_id=mCP77875.1 isoform=CRA_c"
FT                   /protein_id="EDL09795.1"
FT                   /translation="MATITCTRFTEEYQLFEELGKGAFSVVRRCVKVLAGQEYAAKIIN
FT                   TKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGHHYLIFDLVTGGELFEDIVAR
FT                   EYYSEADASHCIQQILEAVLHCHQMGVVHRDLKPENLLLASKLKGAAVKLADFGLAIEV
FT                   EGEQQAWFGFAGTPGYLSPEVLRKDPYGKPVDLWACGVILYILLVGYPPFWDEDQHRLY
FT                   QQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPSKRITAAEALKHPWISHRSTVASCM
FT                   HRQETVDCLKKFNARRKLKGAILTTMLATRNFSGGKSGGNKKNDGVKESSESTNTTIED
FT                   EDTKVRKQEIIKVTEQLIEAISNGDFESYTKMCDPGMTAFEPEALGNLVEGLDFHRFYF
FT                   ENLWSRNSKPVHTTILNPHIHLMGDESACIAYIRITQYLDAGGIPRTAQSEETRVWHRR
FT                   DGKWQIVHFHRSGAPSVLPH"
FT   CDS             join(23579550..23579611,23595076..23595170,
FT                   23596898..23597067)
FT                   /codon_start=1
FT                   /gene="Camk2a"
FT                   /locus_tag="mCG_127781"
FT                   /product="calcium/calmodulin-dependent protein kinase II
FT                   alpha, isoform CRA_b"
FT                   /note="gene_id=mCG127781.1 transcript_id=mCT173858.0
FT                   protein_id=mCP96776.0 isoform=CRA_b"
FT                   /db_xref="GOA:D3Z7K9"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="MGI:MGI:88256"
FT                   /db_xref="UniProtKB/TrEMBL:D3Z7K9"
FT                   /protein_id="EDL09794.1"
FT                   /translation="MATITCTRFTEEYQLFEELGKGAFSVVRRCVKVLAGQEYAAKIIN
FT                   TKKLSARGGFYSCHFWQYSLNFSCCLSGMTSCSSLQEQTYPGRLSTPFSKLWPPLAHTL
FT                   PGLF"
FT   mRNA            join(23580720..23580790,23595061..23595170,
FT                   23600775..23600834,23605162..23605216,23606003..23606068,
FT                   23606154..23606226,23609407..23609509,23610974..23611057,
FT                   23611170..23611264,23612011..23612133,23612443..23612526,
FT                   23613873..23613915,23617793..23617833,23623733..23623781,
FT                   23631675..23631750,23633778..23633872,23638135..>23638291)
FT                   /gene="Camk2a"
FT                   /locus_tag="mCG_127781"
FT                   /product="calcium/calmodulin-dependent protein kinase II
FT                   alpha, transcript variant mCT173857"
FT                   /note="gene_id=mCG127781.1 transcript_id=mCT173857.0
FT                   created on 04-OCT-2002"
FT   CDS             join(23580765..23580790,23595061..23595170,
FT                   23600775..23600834,23605162..23605216,23606003..23606068,
FT                   23606154..23606226,23609407..23609509,23610974..23611057,
FT                   23611170..23611264,23612011..23612133,23612443..23612526,
FT                   23613873..23613915,23617793..23617833,23623733..23623781,
FT                   23631675..23631750,23633778..23633872,23638135..>23638291)
FT                   /codon_start=1
FT                   /gene="Camk2a"
FT                   /locus_tag="mCG_127781"
FT                   /product="calcium/calmodulin-dependent protein kinase II
FT                   alpha, isoform CRA_a"
FT                   /note="gene_id=mCG127781.1 transcript_id=mCT173857.0
FT                   protein_id=mCP96777.0 isoform=CRA_a"
FT                   /protein_id="EDL09793.1"
FT                   /translation="MDMHLCAHVSLSPRGAFSVVRRCVKVLAGQEYAAKIINTKKLSAR
FT                   DHQKLEREARICRLLKHPNIVRLHDSISEEGHHYLIFDLVTGGELFEDIVAREYYSEAD
FT                   ASHCIQQILEAVLHCHQMGVVHRDLKPENLLLASKLKGAAVKLADFGLAIEVEGEQQAW
FT                   FGFAGTPGYLSPEVLRKDPYGKPVDLWACGVILYILLVGYPPFWDEDQHRLYQQIKAGA
FT                   YDFPSPEWDTVTPEAKDLINKMLTINPSKRITAAEALKHPWISHRSTVASCMHRQETVD
FT                   CLKKFNARRKLKGAILTTMLATRNFSGGKSGGNKKNDGVKESSESTNTTIEDEDTKVRK
FT                   QEIIKVTEQLIEAISNGDFESYTKMCDPGMTAFEPEALGNLVEGLDFHRFYFENLWSRN
FT                   SKPVHTTILNPHIHLMGDESACIAYIRITQYLDAGGIPRTAQSEETRV"
FT   mRNA            join(23617424..23617833,23622750..23622782,
FT                   23623733..23623781,23631675..23631750,23633778..23633872,
FT                   23638135..23638363,23638586..23638672)
FT                   /gene="Camk2a"
FT                   /locus_tag="mCG_127781"
FT                   /product="calcium/calmodulin-dependent protein kinase II
FT                   alpha, transcript variant mCT173856"
FT                   /note="gene_id=mCG127781.1 transcript_id=mCT173856.0
FT                   created on 04-OCT-2002"
FT   CDS             join(23617717..23617833,23622750..23622782,
FT                   23623733..23623781,23631675..23631750,23633778..23633872,
FT                   23638135..23638363,23638586..23638589)
FT                   /codon_start=1
FT                   /gene="Camk2a"
FT                   /locus_tag="mCG_127781"
FT                   /product="calcium/calmodulin-dependent protein kinase II
FT                   alpha, isoform CRA_d"
FT                   /note="gene_id=mCG127781.1 transcript_id=mCT173856.0
FT                   protein_id=mCP96775.0 isoform=CRA_d"
FT                   /protein_id="EDL09796.1"
FT                   /translation="MLLFLTLWALVPCLVLLTLYFLSSTGGKSGGNKKNDGVKKRKSSS
FT                   SVQLMESSESTNTTIEDEDTKVRKQEIIKVTEQLIEAISNGDFESYTKMCDPGMTAFEP
FT                   EALGNLVEGLDFHRFYFENLWSRNSKPVHTTILNPHIHLMGDESACIAYIRITQYLDAG
FT                   GIPRTAQSEETRVWHRRDGKWQIVHFHRSGAPSVLPH"
FT   gene            complement(23649239..>23668085)
FT                   /gene="Slc6a7"
FT                   /locus_tag="mCG_140805"
FT                   /note="gene_id=mCG140805.0"
FT   mRNA            complement(join(23649239..23650713,23654312..23654479,
FT                   23655182..23655282,23655460..23655559,23656013..23656131,
FT                   23657127..23657251,23657373..23657476,23658277..23658411,
FT                   23659600..23659738,23661261..23661495,23661602..23661733,
FT                   23663308..23663491,23667863..23668085))
FT                   /gene="Slc6a7"
FT                   /locus_tag="mCG_140805"
FT                   /product="solute carrier family 6 (neurotransmitter
FT                   transporter, L-proline), member 7, transcript variant
FT                   mCT171603"
FT                   /note="gene_id=mCG140805.0 transcript_id=mCT171603.0
FT                   created on 06-AUG-2002"
FT   mRNA            complement(join(23649244..23650713,23654312..23654479,
FT                   23655182..23655282,23655460..23655559,23656013..23656144,
FT                   23656216..23656328,23657127..23657251,23657373..23657476,
FT                   23658277..23658411,23659600..23659738,23661261..23661495,
FT                   23661602..23661733,23663308..23663491,23667863..>23668085))
FT                   /gene="Slc6a7"
FT                   /locus_tag="mCG_140805"
FT                   /product="solute carrier family 6 (neurotransmitter
FT                   transporter, L-proline), member 7, transcript variant
FT                   mCT190277"
FT                   /note="gene_id=mCG140805.0 transcript_id=mCT190277.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(23650501..23650713,23654312..23654479,
FT                   23655182..23655282,23655460..23655559,23656013..23656144,
FT                   23656216..23656328,23657127..23657251,23657373..23657476,
FT                   23658277..23658411,23659600..23659738,23661261..23661495,
FT                   23661602..23661733,23663308..23663491,23667863..>23667964))
FT                   /codon_start=1
FT                   /gene="Slc6a7"
FT                   /locus_tag="mCG_140805"
FT                   /product="solute carrier family 6 (neurotransmitter
FT                   transporter, L-proline), member 7, isoform CRA_b"
FT                   /note="gene_id=mCG140805.0 transcript_id=mCT190277.0
FT                   protein_id=mCP111267.0 isoform=CRA_b"
FT                   /protein_id="EDL09792.1"
FT                   /translation="DQCSAPAWLALCALASCPRRLSKMKKLQEAHLRKPITPDLLMTPS
FT                   DQGDVDLDVDFAADRGNWTGKLDFLLSCIGYCVGLGNVWRFPYRAYTNGGGAFLVPYFL
FT                   MLAICGIPLFFLELSLGQFSSLGPLAVWKISPLFKGAGAAMLLIVGLVAIYYNMIIAYV
FT                   LFYLFASLTSNLPWEHCGNWWNTELCLEHRGPKSGNGVLPLNLSSTVSPSEEYWSRYVL
FT                   HIQGSQGIGRPGEIRWNLCLCLLLAWVIVFLCILKGVKSSGKVVYFTATFPYLILLMLL
FT                   VRGVTLPGAWKGIQFYLTPQFHHLLSSKVWIEAALQIFYSLGVGFGGLLTFASYNTFHQ
FT                   NIYRDTFIVTLGNAITSILAGFAIFSVLGYMSQELGVPVDQVAKAGPGLAFVVYPQAMT
FT                   MLPLSPFWSFLFFFMLLTLGLDSQFAFLETIVTAVTDEFPYYLRPKKAVFSGLICVAMY
FT                   LMGLILTTDGGMYWLVLLDDYSASFGLMVVVITTCLAVTRVYGIQRFCRDIHMMLGFKP
FT                   GLYFRACWLFLSPATLLALLVYSIVKYQPSEYGSYRFPAWAELLGILMGLLSCLMIPAG
FT                   MLVAVLREEGSLWERLQQASRPAMDWGPSLEENRTGMYVATLAGSQSPKPLMVHMRKYG
FT                   GITSFENTAIEVDREIAEEEEESMM"
FT   CDS             complement(join(23650501..23650713,23654312..23654479,
FT                   23655182..23655282,23655460..23655559,23656013..23656131,
FT                   23657127..23657251,23657373..23657476,23658277..23658411,
FT                   23659600..23659738,23661261..23661495,23661602..23661733,
FT                   23663308..23663491,23667863..23667895))
FT                   /codon_start=1
FT                   /gene="Slc6a7"
FT                   /locus_tag="mCG_140805"
FT                   /product="solute carrier family 6 (neurotransmitter
FT                   transporter, L-proline), member 7, isoform CRA_a"
FT                   /note="gene_id=mCG140805.0 transcript_id=mCT171603.0
FT                   protein_id=mCP94522.0 isoform=CRA_a"
FT                   /protein_id="EDL09791.1"
FT                   /translation="MKKLQEAHLRKPITPDLLMTPSDQGDVDLDVDFAADRGNWTGKLD
FT                   FLLSCIGYCVGLGNVWRFPYRAYTNGGGAFLVPYFLMLAICGIPLFFLELSLGQFSSLG
FT                   PLAVWKISPLFKGAGAAMLLIVGLVAIYYNMIIAYVLFYLFASLTSNLPWEHCGNWWNT
FT                   ELCLEHRGPKSGNGVLPLNLSSTVSPSEEYWSRYVLHIQGSQGIGRPGEIRWNLCLCLL
FT                   LAWVIVFLCILKGVKSSGKVVYFTATFPYLILLMLLVRGVTLPGAWKGIQFYLTPQFHH
FT                   LLSSKVWIEAALQIFYSLGVGFGGLLTFASYNTFHQNIYRDTFIVTLGNAITSILAGFA
FT                   IFSVLGYMSQELGVPVDQVAKAETIVTAVTDEFPYYLRPKKAVFSGLICVAMYLMGLIL
FT                   TTDGGMYWLVLLDDYSASFGLMVVVITTCLAVTRVYGIQRFCRDIHMMLGFKPGLYFRA
FT                   CWLFLSPATLLALLVYSIVKYQPSEYGSYRFPAWAELLGILMGLLSCLMIPAGMLVAVL
FT                   REEGSLWERLQQASRPAMDWGPSLEENRTGMYVATLAGSQSPKPLMVHMRKYGGITSFE
FT                   NTAIEVDREIAEEEEESMM"
FT   gene            complement(23672750..23689940)
FT                   /gene="Cdx1"
FT                   /locus_tag="mCG_6367"
FT                   /note="gene_id=mCG6367.2"
FT   mRNA            complement(join(23672750..23673827,23674260..23674405,
FT                   23689560..23689940))
FT                   /gene="Cdx1"
FT                   /locus_tag="mCG_6367"
FT                   /product="caudal type homeobox 1"
FT                   /note="gene_id=mCG6367.2 transcript_id=mCT4721.1 created on
FT                   04-OCT-2002"
FT   CDS             complement(join(23674349..23674405,23689560..23689778))
FT                   /codon_start=1
FT                   /gene="Cdx1"
FT                   /locus_tag="mCG_6367"
FT                   /product="caudal type homeobox 1"
FT                   /note="gene_id=mCG6367.2 transcript_id=mCT4721.1
FT                   protein_id=mCP21545.1"
FT                   /protein_id="EDL09790.1"
FT                   /translation="MARAPRPQPPARPRWPSGPLRTLARCPRLPGLVPASWRSPSGLRA
FT                   HRPRQERQGGRPTNGCGAAWRLQAAVAAVRPEPRTSTVWSTQTTNA"
FT   gene            <23699028..23738931
FT                   /gene="Pdgfrb"
FT                   /locus_tag="mCG_6019"
FT                   /note="gene_id=mCG6019.2"
FT   mRNA            join(<23699028..23699456,23713841..23713886,
FT                   23714902..23715222,23717564..23717830,23718494..23718621,
FT                   23718702..23718876,23719420..23719612,23720203..23720318,
FT                   23721821..23721944,23722467..23722681,23725386..23725480,
FT                   23726355..23726487,23726966..23727070,23727353..23727463,
FT                   23730244..23730403,23731414..23731574,23732325..23732443,
FT                   23732674..23732796,23733420..23733531,23734092..23734191,
FT                   23734751..23734856,23735613..23735845,23737093..23738931)
FT                   /gene="Pdgfrb"
FT                   /locus_tag="mCG_6019"
FT                   /product="platelet derived growth factor receptor, beta
FT                   polypeptide, transcript variant mCT190287"
FT                   /note="gene_id=mCG6019.2 transcript_id=mCT190287.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(23699325..23699456,23713841..23713886,
FT                   23714902..23715222,23717564..23717830,23718494..23718621,
FT                   23718702..23718876,23719420..23719612,23720203..23720318,
FT                   23721821..23721944,23722470..23722681,23725386..23725480,
FT                   23726355..23726487,23726966..23727070,23727353..23727463,
FT                   23730244..23730403,23731414..23731574,23732325..23732443,
FT                   23732674..23732796,23733420..23733531,23734092..23734191,
FT                   23734751..23734856,23735613..23735845,23737093..23738931)
FT                   /gene="Pdgfrb"
FT                   /locus_tag="mCG_6019"
FT                   /product="platelet derived growth factor receptor, beta
FT                   polypeptide, transcript variant mCT4724"
FT                   /note="gene_id=mCG6019.2 transcript_id=mCT4724.0 created on
FT                   04-OCT-2002"
FT   mRNA            join(23699325..23699456,23713841..23713886,
FT                   23714902..23715222,23717564..23717830,23718494..23718621,
FT                   23718702..23718876,23719420..23719612,23720203..23720318,
FT                   23721821..23721944,23722470..23722681,23725386..23725480,
FT                   23726355..23726487,23726966..23727070,23727353..23727463,
FT                   23730244..23730403,23731414..23731574,23732325..23732443,
FT                   23732674..23732796,23733420..23733531,23734092..23734191,
FT                   23734751..23734856,23735613..23735845,23737093..23737146,
FT                   23737319..23737731)
FT                   /gene="Pdgfrb"
FT                   /locus_tag="mCG_6019"
FT                   /product="platelet derived growth factor receptor, beta
FT                   polypeptide, transcript variant mCT173920"
FT                   /note="gene_id=mCG6019.2 transcript_id=mCT173920.0 created
FT                   on 04-OCT-2002"
FT   CDS             join(<23699430..23699456,23713841..23713886,
FT                   23714902..23715222,23717564..23717830,23718494..23718621,
FT                   23718702..23718876,23719420..23719612,23720203..23720318,
FT                   23721821..23721944,23722467..23722681,23725386..23725480,
FT                   23726355..23726487,23726966..23727070,23727353..23727463,
FT                   23730244..23730403,23731414..23731574,23732325..23732443,
FT                   23732674..23732796,23733420..23733531,23734092..23734191,
FT                   23734751..23734856,23735613..23735845,23737093..23737255)
FT                   /codon_start=1
FT                   /gene="Pdgfrb"
FT                   /locus_tag="mCG_6019"
FT                   /product="platelet derived growth factor receptor, beta
FT                   polypeptide, isoform CRA_b"
FT                   /note="gene_id=mCG6019.2 transcript_id=mCT190287.0
FT                   protein_id=mCP111286.0 isoform=CRA_b"
FT                   /protein_id="EDL09788.1"
FT                   /translation="LTSEAICSPDTMGLPGVIPALVLRGQLLLSVLWLLGPQTSRGLVI
FT                   TPPGPEFVLNISSTFVLTCSGSAPVMWEQMSQVPWQEAAMNQDGTFSSVLTLTNVTGGD
FT                   TGEYFCVYNNSLGPELSERKRIYIFVPDPTMGFLPMDSEDLFIFVTDVTETTIPCRVTD
FT                   PQLEVTLHEKKVDIPLHVPYDHQRGFTGTFEDKTYICKTTIGDREVDSDTYYVYSLQVS
FT                   SINVSVNAVQTVVRQGESITIRCIVMGNDVVNFQWTYPRMKSGRLVEPVTDYLFGVPSR
FT                   IGSILHIPTAELSDSGTYTCNVSVSVNDHGDEKAINISVIENGYVRLLETLGDVEIAEL
FT                   HRSRTLRVVFEAYPMPSVLWLKDNRTLGDSGAGELVLSTRNMSETRYVSELILVRVKVS
FT                   EAGYYTMRAFHEDDEVQLSFKLQVNVPVRVLELSESHPANGEQTIRCRGRGMPQPNVTW
FT                   STCRDLKSRCPRKLSPTPLGNSSKEESQLETNVTFWEEDQEYEVVSTLRLRHVDQPLSV
FT                   RCMLQNSMGGDSQEVTVVPHSLPFKVVVISAILALVVLTVISLIILIMLWQKKPRYEIR
FT                   WKVIESVSSDGHEYIYVDPVQLPYDSTWELPRDQLVLGRTLGSGAFGQVVEATAHGLSH
FT                   SQATMKVAVKMLKSTARSSEKQALMSELKIMSHLGPHLNVVNLLGACTKGGPIYIITEY
FT                   CRYGDLVDYLHRNKHTFLQRHSNKHCPPSAELYSNALPVGFSLPSHLNLTGESDGGYMD
FT                   MSKDESIDYVPMLDMKGDIKYADIESPSYMAPYDNYVPSAPERTYRATLINDSPVLSYT
FT                   DLVGFSYQVANGMDFLASKNCVHRDLAARNVLICEGKLVKICDFGLARDIMRDSNYISK
FT                   GSTFLPLKWMAPESIFNSLYTTLSDVWSFGILLWEIFTLGGTPYPELPMNDQFYNAIKR
FT                   GYRMAQPAHASDEIYEIMQKCWEEKFETRPPFSQLVLLLERLLGEGYKKKYQQVDEEFL
FT                   RSDHPAILRSQARFPGIHSLRSPLDTSSVLYTAVQPNESDNDYIIPLPDPKPDVADEGL
FT                   PEGSPSLASSTLNEVNTSSTISCDSPLELQEEPQQAEPEAQLEQPQDSGCPGPLAEAED
FT                   SFL"
FT   CDS             join(23713847..23713886,23714902..23715222,
FT                   23717564..23717830,23718494..23718621,23718702..23718876,
FT                   23719420..23719612,23720203..23720318,23721821..23721944,
FT                   23722470..23722681,23725386..23725480,23726355..23726487,
FT                   23726966..23727070,23727353..23727463,23730244..23730403,
FT                   23731414..23731574,23732325..23732443,23732674..23732796,
FT                   23733420..23733531,23734092..23734191,23734751..23734856,
FT                   23735613..23735845,23737093..23737146,23737319..23737607)
FT                   /codon_start=1
FT                   /gene="Pdgfrb"
FT                   /locus_tag="mCG_6019"
FT                   /product="platelet derived growth factor receptor, beta
FT                   polypeptide, isoform CRA_a"
FT                   /note="gene_id=mCG6019.2 transcript_id=mCT173920.0
FT                   protein_id=mCP96839.0 isoform=CRA_a"
FT                   /protein_id="EDL09787.1"
FT                   /translation="MGLPGVIPALVLRGQLLLSVLWLLGPQTSRGLVITPPGPEFVLNI
FT                   SSTFVLTCSGSAPVMWEQMSQVPWQEAAMNQDGTFSSVLTLTNVTGGDTGEYFCVYNNS
FT                   LGPELSERKRIYIFVPDPTMGFLPMDSEDLFIFVTDVTETTIPCRVTDPQLEVTLHEKK
FT                   VDIPLHVPYDHQRGFTGTFEDKTYICKTTIGDREVDSDTYYVYSLQVSSINVSVNAVQT
FT                   VVRQGESITIRCIVMGNDVVNFQWTYPRMKSGRLVEPVTDYLFGVPSRIGSILHIPTAE
FT                   LSDSGTYTCNVSVSVNDHGDEKAINISVIENGYVRLLETLGDVEIAELHRSRTLRVVFE
FT                   AYPMPSVLWLKDNRTLGDSGAGELVLSTRNMSETRYVSELILVRVKVSEAGYYTMRAFH
FT                   EDDEVQLSFKLQVNVPVRVLELSESHPANGEQTIRCRGRGMPQPNVTWSTCRDLKRCPR
FT                   KLSPTPLGNSSKEESQLETNVTFWEEDQEYEVVSTLRLRHVDQPLSVRCMLQNSMGGDS
FT                   QEVTVVPHSLPFKVVVISAILALVVLTVISLIILIMLWQKKPRYEIRWKVIESVSSDGH
FT                   EYIYVDPVQLPYDSTWELPRDQLVLGRTLGSGAFGQVVEATAHGLSHSQATMKVAVKML
FT                   KSTARSSEKQALMSELKIMSHLGPHLNVVNLLGACTKGGPIYIITEYCRYGDLVDYLHR
FT                   NKHTFLQRHSNKHCPPSAELYSNALPVGFSLPSHLNLTGESDGGYMDMSKDESIDYVPM
FT                   LDMKGDIKYADIESPSYMAPYDNYVPSAPERTYRATLINDSPVLSYTDLVGFSYQVANG
FT                   MDFLASKNCVHRDLAARNVLICEGKLVKICDFGLARDIMRDSNYISKGSTFLPLKWMAP
FT                   ESIFNSLYTTLSDVWSFGILLWEIFTLGGTPYPELPMNDQFYNAIKRGYRMAQPAHASD
FT                   EIYEIMQKCWEEKFETRPPFSQLVLLLERLLGEGYKKKYQQVDEEFLRSDHPAILRSQA
FT                   RFPGIHSLRSPLDTSSVLYTAVQPNESDNDYIIPLPDPKPDVADEGLPEGSPSLASSTL
FT                   NEVNTSSTISCDSPLLAWPGLASQQLHCHKLSPRGKPLVCSTQGPGTQLSLGGKRTLPR
FT                   EGHGTLNQGSSRGLSFPKCKRKSCTWLQDRSGARIPAEIHDCTVVCSYPPV"
FT   CDS             join(23713847..23713886,23714902..23715222,
FT                   23717564..23717830,23718494..23718621,23718702..23718876,
FT                   23719420..23719612,23720203..23720318,23721821..23721944,
FT                   23722470..23722681,23725386..23725480,23726355..23726487,
FT                   23726966..23727070,23727353..23727463,23730244..23730403,
FT                   23731414..23731574,23732325..23732443,23732674..23732796,
FT                   23733420..23733531,23734092..23734191,23734751..23734856,
FT                   23735613..23735845,23737093..23737255)
FT                   /codon_start=1
FT                   /gene="Pdgfrb"
FT                   /locus_tag="mCG_6019"
FT                   /product="platelet derived growth factor receptor, beta
FT                   polypeptide, isoform CRA_c"
FT                   /note="gene_id=mCG6019.2 transcript_id=mCT4724.0
FT                   protein_id=mCP21546.1 isoform=CRA_c"
FT                   /protein_id="EDL09789.1"
FT                   /translation="MGLPGVIPALVLRGQLLLSVLWLLGPQTSRGLVITPPGPEFVLNI
FT                   SSTFVLTCSGSAPVMWEQMSQVPWQEAAMNQDGTFSSVLTLTNVTGGDTGEYFCVYNNS
FT                   LGPELSERKRIYIFVPDPTMGFLPMDSEDLFIFVTDVTETTIPCRVTDPQLEVTLHEKK
FT                   VDIPLHVPYDHQRGFTGTFEDKTYICKTTIGDREVDSDTYYVYSLQVSSINVSVNAVQT
FT                   VVRQGESITIRCIVMGNDVVNFQWTYPRMKSGRLVEPVTDYLFGVPSRIGSILHIPTAE
FT                   LSDSGTYTCNVSVSVNDHGDEKAINISVIENGYVRLLETLGDVEIAELHRSRTLRVVFE
FT                   AYPMPSVLWLKDNRTLGDSGAGELVLSTRNMSETRYVSELILVRVKVSEAGYYTMRAFH
FT                   EDDEVQLSFKLQVNVPVRVLELSESHPANGEQTIRCRGRGMPQPNVTWSTCRDLKRCPR
FT                   KLSPTPLGNSSKEESQLETNVTFWEEDQEYEVVSTLRLRHVDQPLSVRCMLQNSMGGDS
FT                   QEVTVVPHSLPFKVVVISAILALVVLTVISLIILIMLWQKKPRYEIRWKVIESVSSDGH
FT                   EYIYVDPVQLPYDSTWELPRDQLVLGRTLGSGAFGQVVEATAHGLSHSQATMKVAVKML
FT                   KSTARSSEKQALMSELKIMSHLGPHLNVVNLLGACTKGGPIYIITEYCRYGDLVDYLHR
FT                   NKHTFLQRHSNKHCPPSAELYSNALPVGFSLPSHLNLTGESDGGYMDMSKDESIDYVPM
FT                   LDMKGDIKYADIESPSYMAPYDNYVPSAPERTYRATLINDSPVLSYTDLVGFSYQVANG
FT                   MDFLASKNCVHRDLAARNVLICEGKLVKICDFGLARDIMRDSNYISKGSTFLPLKWMAP
FT                   ESIFNSLYTTLSDVWSFGILLWEIFTLGGTPYPELPMNDQFYNAIKRGYRMAQPAHASD
FT                   EIYEIMQKCWEEKFETRPPFSQLVLLLERLLGEGYKKKYQQVDEEFLRSDHPAILRSQA
FT                   RFPGIHSLRSPLDTSSVLYTAVQPNESDNDYIIPLPDPKPDVADEGLPEGSPSLASSTL
FT                   NEVNTSSTISCDSPLELQEEPQQAEPEAQLEQPQDSGCPGPLAEAEDSFL"
FT   gene            <23759790..23784799
FT                   /gene="Csf1r"
FT                   /locus_tag="mCG_6021"
FT                   /note="gene_id=mCG6021.2"
FT   mRNA            join(<23759790..23759977,23763575..23763832,
FT                   23764180..23764464,23765917..23766053,23766661..23766820,
FT                   23768710..23768896,23771000..23771115,23771251..23771371,
FT                   23771491..23771722,23772911..23773026,23778160..23778286,
FT                   23778436..23778540,23778772..23778882,23779337..23779499,
FT                   23781528..23781616,23781732..23781829,23782650..23782772,
FT                   23782933..23783044,23783366..23783465,23783767..23783875,
FT                   23783967..23784799)
FT                   /gene="Csf1r"
FT                   /locus_tag="mCG_6021"
FT                   /product="colony stimulating factor 1 receptor, transcript
FT                   variant mCT190306"
FT                   /note="gene_id=mCG6021.2 transcript_id=mCT190306.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(23759854..23759977,23763575..23763832,
FT                   23764180..23764464,23765917..23766053,23766661..23766820,
FT                   23768710..23768896,23771000..23771115,23771251..23771371,
FT                   23771491..23771681,23772911..23773026,23778160..23778286,
FT                   23778436..23778540,23778772..23778882,23779337..23779499,
FT                   23781528..23781616,23781732..23781829,23782650..23782772,
FT                   23782933..23783044,23783366..23783465,23783767..23783875,
FT                   23783967..23784796)
FT                   /gene="Csf1r"
FT                   /locus_tag="mCG_6021"
FT                   /product="colony stimulating factor 1 receptor, transcript
FT                   variant mCT4715"
FT                   /note="gene_id=mCG6021.2 transcript_id=mCT4715.1 created on
FT                   04-OCT-2002"
FT   mRNA            join(<23759860..23759977,23763575..23763832,
FT                   23764180..23764464,23765917..23766053,23766661..23766820,
FT                   23768710..23768896,23771000..23771115,23771251..23771371,
FT                   23771491..23771681,23772911..23773026,23778160..23778286,
FT                   23778436..23778540,23778772..23778882,23779337..23780750)
FT                   /gene="Csf1r"
FT                   /locus_tag="mCG_6021"
FT                   /product="colony stimulating factor 1 receptor, transcript
FT                   variant mCT190307"
FT                   /note="gene_id=mCG6021.2 transcript_id=mCT190307.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<23759863..23759977,23763575..23763832,
FT                   23764180..23764464,23765917..23766053,23766661..23766820,
FT                   23768710..23768896,23771000..23771115,23771251..23771371,
FT                   23771491..23771681,23772911..23773026,23778160..23778286,
FT                   23778436..23778540,23778772..23778882,23779337..23779503)
FT                   /codon_start=1
FT                   /gene="Csf1r"
FT                   /locus_tag="mCG_6021"
FT                   /product="colony stimulating factor 1 receptor, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG6021.2 transcript_id=mCT190307.0
FT                   protein_id=mCP111288.0 isoform=CRA_b"
FT                   /protein_id="EDL09785.1"
FT                   /translation="QLGAPCPADSPTCIGSRYPLEAMELGPPLVLLLATVWHGQGAPVI
FT                   EPSGPELVVEPGETVTLRCVSNGSVEWDGPISPYWTLDPESPGSTLTTRNATFKNTGTY
FT                   RCTELEDPMAGSTTIHLYVKDPAHSWNLLAQEVTVVEGQEAVLPCLITDPALKDSVSLM
FT                   REGGRQVLRKTVYFFSPWRGFIIRKAKVLDSNTYVCKTMVNGRESTSTGIWLKVNRVHP
FT                   EPPQIKLEPSKLVRIRGEAAQIVCSATNAEVGFNVILKRGDTKLEIPLNSDFQDNYYKK
FT                   VRALSLNAVDFQDAGIYSCVASNDVGTRTATMNFQVVESAYLNLTSEQSLLQEVSVGDS
FT                   LILTVHADAYPSIQHYNWTYLGPFFEDQRKLEFITQRAIYRYTFKLFLNRVKASEAGQY
FT                   FLMAQNKAGWNNLTFELTLRYPPEVSVTWMPVNGSDVLFCDVSGYPQPSVTWMECRGHT
FT                   DRCDEAQALQVWNDTHPEVLSQKPFDKVIIQSQLPIGTLKHNMTYFCKTHNSVGNSSQY
FT                   FRAVSLGQSKQLPDESLFTPVVVACMSVMSLLVLLLLLLLYKYKQKPKYQVRWKIIERY
FT                   EGNSYTFIDPTQLPYNEKWEFPRNNLQFGKTLGAGAFGKVVEATAFGLGKEDAVLKVAV
FT                   KMLKSTAHADEKEALMSELKIMSHLGQHENIVNLLGACTHGGPVLVITEYCCYGDLLNF
FT                   LRRKAEAMLGPSLSPGQDSEGDSSYKNIHLEKKYVRR"
FT   CDS             join(<23759863..23759977,23763575..23763832,
FT                   23764180..23764464,23765917..23766053,23766661..23766820,
FT                   23768710..23768896,23771000..23771115,23771251..23771371,
FT                   23771491..23771722,23772911..23773026,23778160..23778286,
FT                   23778436..23778447)
FT                   /codon_start=1
FT                   /gene="Csf1r"
FT                   /locus_tag="mCG_6021"
FT                   /product="colony stimulating factor 1 receptor, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG6021.2 transcript_id=mCT190306.0
FT                   protein_id=mCP111287.0 isoform=CRA_a"
FT                   /protein_id="EDL09784.1"
FT                   /translation="QLGAPCPADSPTCIGSRYPLEAMELGPPLVLLLATVWHGQGAPVI
FT                   EPSGPELVVEPGETVTLRCVSNGSVEWDGPISPYWTLDPESPGSTLTTRNATFKNTGTY
FT                   RCTELEDPMAGSTTIHLYVKDPAHSWNLLAQEVTVVEGQEAVLPCLITDPALKDSVSLM
FT                   REGGRQVLRKTVYFFSPWRGFIIRKAKVLDSNTYVCKTMVNGRESTSTGIWLKVNRVHP
FT                   EPPQIKLEPSKLVRIRGEAAQIVCSATNAEVGFNVILKRGDTKLEIPLNSDFQDNYYKK
FT                   VRALSLNAVDFQDAGIYSCVASNDVGTRTATMNFQVVESAYLNLTSEQSLLQEVSVGDS
FT                   LILTVHADAYPSIQHYNWTYLGPFFEDQRKLEFITQRAIYRYTFKLFLNRVKASEAGQY
FT                   FLMAQNKAGWNNLTFELTLRYPPEVSVTWMPVNGSDVLFCDVSGYPQPSVTWMECRGHT
FT                   DRCDEAQALQVWNDTHPEVLSQKPFDKVIIQSQLPIGTLKHNMTYFCKTHNSVGNSSQY
FT                   FRAVSLGNPSFLLLSKNGHQDKASSSPMSPSSLRWWWPVCLSCLCWCYCCCCSCTSTSR
FT                   SRSTRCAGRSSRDTKAIATPSLTLPSCPTMRSGSSLGTTCSLVRL"
FT   CDS             join(23759929..23759977,23763575..23763832,
FT                   23764180..23764464,23765917..23766053,23766661..23766820,
FT                   23768710..23768896,23771000..23771115,23771251..23771371,
FT                   23771491..23771681,23772911..23773026,23778160..23778286,
FT                   23778436..23778540,23778772..23778882,23779337..23779499,
FT                   23781528..23781616,23781732..23781829,23782650..23782772,
FT                   23782933..23783044,23783366..23783465,23783767..23783875,
FT                   23783967..23784143)
FT                   /codon_start=1
FT                   /gene="Csf1r"
FT                   /locus_tag="mCG_6021"
FT                   /product="colony stimulating factor 1 receptor, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG6021.2 transcript_id=mCT4715.1
FT                   protein_id=mCP21560.2 isoform=CRA_c"
FT                   /db_xref="GOA:Q0P635"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR001824"
FT                   /db_xref="InterPro:IPR003598"
FT                   /db_xref="InterPro:IPR003599"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR008266"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR013098"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016243"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR020635"
FT                   /db_xref="MGI:MGI:1339758"
FT                   /db_xref="UniProtKB/TrEMBL:Q0P635"
FT                   /protein_id="EDL09786.1"
FT                   /translation="MELGPPLVLLLATVWHGQGAPVIEPSGPELVVEPGETVTLRCVSN
FT                   GSVEWDGPISPYWTLDPESPGSTLTTRNATFKNTGTYRCTELEDPMAGSTTIHLYVKDP
FT                   AHSWNLLAQEVTVVEGQEAVLPCLITDPALKDSVSLMREGGRQVLRKTVYFFSPWRGFI
FT                   IRKAKVLDSNTYVCKTMVNGRESTSTGIWLKVNRVHPEPPQIKLEPSKLVRIRGEAAQI
FT                   VCSATNAEVGFNVILKRGDTKLEIPLNSDFQDNYYKKVRALSLNAVDFQDAGIYSCVAS
FT                   NDVGTRTATMNFQVVESAYLNLTSEQSLLQEVSVGDSLILTVHADAYPSIQHYNWTYLG
FT                   PFFEDQRKLEFITQRAIYRYTFKLFLNRVKASEAGQYFLMAQNKAGWNNLTFELTLRYP
FT                   PEVSVTWMPVNGSDVLFCDVSGYPQPSVTWMECRGHTDRCDEAQALQVWNDTHPEVLSQ
FT                   KPFDKVIIQSQLPIGTLKHNMTYFCKTHNSVGNSSQYFRAVSLGQSKQLPDESLFTPVV
FT                   VACMSVMSLLVLLLLLLLYKYKQKPKYQVRWKIIERYEGNSYTFIDPTQLPYNEKWEFP
FT                   RNNLQFGKTLGAGAFGKVVEATAFGLGKEDAVLKVAVKMLKSTAHADEKEALMSELKIM
FT                   SHLGQHENIVNLLGACTHGGPVLVITEYCCYGDLLNFLRRKAEAMLGPSLSPGQDSEGD
FT                   SSYKNIHLEKKYVRRDSGFSSQGVDTYVEMRPVSTSSSDSFFKQDLDKEASRPLELWDL
FT                   LHFSSQVAQGMAFLASKNCIHRDVAARNVLLTSGHVAKIGDFGLARDIMNDSNYVVKGN
FT                   ARLPVKWMAPESIFDCVYTVQSDVWSYGILLWEIFSLGLNPYPGILVNNKFYKLVKDGY
FT                   QMAQPVFAPKNIYSIMQSCWDLEPTRRPTFQQICFLLQEQARLERRDQDYANLPSSGGS
FT                   SGSDSGGGSSGGSSSEPEEESSSEHLACCEPGDIAQPLLQPNNYQFC"
FT   gene            complement(23784842..23830593)
FT                   /gene="A630042L21Rik"
FT                   /locus_tag="mCG_130312"
FT                   /note="gene_id=mCG130312.1"
FT   mRNA            complement(join(23784842..23785444,23789850..23789909,
FT                   23790952..23791171,23794335..23794519,23795203..23795334,
FT                   23799973..23800100,23800791..23801092,23803913..23804062,
FT                   23805727..23805825,23808570..23808667,23808802..23808974,
FT                   23810884..23811302,23816438..23816569,23819033..23819131,
FT                   23820742..23821239,23824752..23824926,23825695..23825830,
FT                   23830121..23830540))
FT                   /gene="A630042L21Rik"
FT                   /locus_tag="mCG_130312"
FT                   /product="RIKEN cDNA A630042L21, transcript variant
FT                   mCT173869"
FT                   /note="gene_id=mCG130312.1 transcript_id=mCT173869.0
FT                   created on 04-OCT-2002"
FT   mRNA            complement(join(23784942..23786258,23787515..23787724,
FT                   23789020..23789136,23789776..23789909,23790952..23791171,
FT                   23794335..23794519,23795203..23795334,23799973..23800100,
FT                   23800791..23801092,23803913..23804062,23805727..23805825,
FT                   23808570..23808667,23808802..23808974,23810884..23811302,
FT                   23816438..23816569,23819033..23819131,23820742..23821239,
FT                   23824752..23824926,23825695..23825830,23830121..23830593))
FT                   /gene="A630042L21Rik"
FT                   /locus_tag="mCG_130312"
FT                   /product="RIKEN cDNA A630042L21, transcript variant
FT                   mCT173868"
FT                   /note="gene_id=mCG130312.1 transcript_id=mCT173868.0
FT                   created on 04-OCT-2002"
FT   mRNA            complement(join(23784942..23786258,23787515..23787724,
FT                   23789020..23789136,23789776..23789909,23790952..23791171,
FT                   23794335..23794519,23795203..23795334,23799973..23800100,
FT                   23800791..23801092,23803913..23804062,23805727..23805825,
FT                   23808570..23808667,23808802..23808974,23810884..23811302,
FT                   23812699..23813346))
FT                   /gene="A630042L21Rik"
FT                   /locus_tag="mCG_130312"
FT                   /product="RIKEN cDNA A630042L21, transcript variant
FT                   mCT173867"
FT                   /note="gene_id=mCG130312.1 transcript_id=mCT173867.0
FT                   created on 04-OCT-2002"
FT   mRNA            complement(join(23784943..23786258,23787515..23787724,
FT                   23789020..23789136,23789776..23789909,23790952..23791171,
FT                   23794335..23794519,23795203..23795334,23799973..23800100,
FT                   23800791..23801092,23803913..23804062,23805727..23805825,
FT                   23808570..23808667,23808802..23808974,23810884..23811059,
FT                   23811156..23811302,23816438..23816569,23819033..23819131,
FT                   23820742..23821239,23824752..23824926,23825695..23825830,
FT                   23830121..23830593))
FT                   /gene="A630042L21Rik"
FT                   /locus_tag="mCG_130312"
FT                   /product="RIKEN cDNA A630042L21, transcript variant
FT                   mCT131635"
FT                   /note="gene_id=mCG130312.1 transcript_id=mCT131635.1
FT                   created on 04-OCT-2002"
FT   CDS             complement(join(23785137..23785444,23789850..23789909,
FT                   23790952..23791171,23794335..23794519,23795203..23795334,
FT                   23799973..23800100,23800791..23801092,23803913..23804062,
FT                   23805727..23805825,23808570..23808667,23808802..23808974,
FT                   23810884..23811302,23816438..23816569,23819033..23819131,
FT                   23820742..23821239,23824752..23824926,23825695..23825828))
FT                   /codon_start=1
FT                   /gene="A630042L21Rik"
FT                   /locus_tag="mCG_130312"
FT                   /product="RIKEN cDNA A630042L21, isoform CRA_d"
FT                   /note="gene_id=mCG130312.1 transcript_id=mCT173869.0
FT                   protein_id=mCP96786.0 isoform=CRA_d"
FT                   /protein_id="EDL09783.1"
FT                   /translation="MDAPYDGAEVTVLMEEIEEAYYTSPGPPKKKKKYKIHGEKAKKPR
FT                   SAYLLYYYDIYLKVQQELPHLPQSEINKKISESWRLLSVAERSYYLEKAKLEKEGLDPN
FT                   SKLSALTAVVPDIPGFRKILPRSEYIIIPKSTLQEDRSCPQLELCVAQNQMSPKGSTLM
FT                   SNASPDVVASHAGMAEQCLAVEALAEEVGALPQPGTVQEIATSEILSHDMLLEEASLEV
FT                   GESHQPYQTSLVIEETLVNGSSDLPTGSLAVPHSQVGESLSVVTVMRDSSESSPSAPAT
FT                   QFIMLPLPAYSVVENPSSIKLTTTYTRRGHGTCTSPGCSFTYVTRHKPPKCPTCGNFLG
FT                   GKWIPKEKPAKVKVELASGVSSKGSVIKRNQQSVTTEQNPSKENASKLTLENSEAVSQL
FT                   LNVAPPGEGGEDREWEEVIVSDAHVLVKEVPGNRGTAVTKMPVVKSGAQAEISLGTTEN
FT                   DSPGPDILPSAEGTSSSSLLQAHKKSPGVDLFTTGPKAPELKGRARGKPSLLAAARPMR
FT                   AILPAPTSVGRGSGVGLPRARQAFPLDKTPSVRTCGLKPSTLKQLGQPIQQPPSTGEVK
FT                   LSNCASSRTPQLKIVEVKPDLFPPYKYSCTVTLDLGLATSRGRGKCKNPSCSYVYTNRH
FT                   KPRICPSCGFNLAKDRTEKTPKAIEASSPHPDVPSTTEALNPTQREVQRQSTLQLLRKV
FT                   LQIPENESELAEVFALIHELNSSRLILSNVSEETVTIEQTSWSNYYESPSTQCLLCSSP
FT                   LFKGGHNSLAGPQECWLLTANRLQVVTAQVKMCLNPHCLALHSFTDIYTGLFNVGNKLL
FT                   VSLDLLFAIRNQIKLGEDPRVSVGVVLKSVQEQTEKTLTSEELSQLQELLCNGYWAFEC
FT                   LTVRDYNDMICGICGVAPKVEMAQRNEENVLALKSVEFTWPEFLGSSEVNVEDFWTTME
FT                   TEVIEQVAFPASIPITKFDASVIAPFFPPLMRGAVVVNTEKDKTQDMQPVPGNGSALVR
FT                   LLQEGTCKLEELGSCLVGFLACLAGLFTLGIPWGPSFSLKEGCILCSSNSPCSHTLGQL
FT                   RRRNSSSRTLSAPGLGEENPSSFLWPLLLYPTSSGSSDPHHRGDVARGCDIADKQ"
FT   CDS             complement(join(23785803..23786258,23787515..23787724,
FT                   23789020..23789136,23789776..23789909,23790952..23791171,
FT                   23794335..23794519,23795203..23795334,23799973..23800100,
FT                   23800791..23801092,23803913..23804062,23805727..23805825,
FT                   23808570..23808667,23808802..23808974,23810884..23811059,
FT                   23811156..23811302,23816438..23816569,23819033..23819131,
FT                   23820742..23821239,23824752..23824926,23825695..23825828))
FT                   /codon_start=1
FT                   /gene="A630042L21Rik"
FT                   /locus_tag="mCG_130312"
FT                   /product="RIKEN cDNA A630042L21, isoform CRA_a"
FT                   /note="gene_id=mCG130312.1 transcript_id=mCT131635.1
FT                   protein_id=mCP77712.1 isoform=CRA_a"
FT                   /db_xref="GOA:G3X9M3"
FT                   /db_xref="InterPro:IPR009071"
FT                   /db_xref="MGI:MGI:2441817"
FT                   /db_xref="UniProtKB/TrEMBL:G3X9M3"
FT                   /protein_id="EDL09780.1"
FT                   /translation="MDAPYDGAEVTVLMEEIEEAYYTSPGPPKKKKKYKIHGEKAKKPR
FT                   SAYLLYYYDIYLKVQQELPHLPQSEINKKISESWRLLSVAERSYYLEKAKLEKEGLDPN
FT                   SKLSALTAVVPDIPGFRKILPRSEYIIIPKSTLQEDRSCPQLELCVAQNQMSPKGSTLM
FT                   SNASPDVVASHAGMAEQCLAVEALAEEVGALPQPGTVQEIATSEILSHDMLLEEASLEV
FT                   GESHQPYQTSLVIEETLVNGSSDLPTGSLAVPHSQVGESLSVVTVMRDSSESSPSAPAT
FT                   QFIMLPLPAYSVVENPSSIKLTTTYTRRGHGTCTSPGCSFTYVTRHKPPKCPTCGNFLG
FT                   GKWIPKEKPAKVKVELASGVSSKGSVIKRNQQSVTTEQNPSKENASKLTLENSEAEVPG
FT                   NRGTAVTKMPVVKSGAQAEISLGTTENDSPGPDILPSAEGTSSSSLLQAHKKSPGVDLF
FT                   TTGPKAPELKGRARGKPSLLAAARPMRAILPAPTSVGRGSGVGLPRARQAFPLDKTPSV
FT                   RTCGLKPSTLKQLGQPIQQPPSTGEVKLSNCASSRTPQLKIVEVKPDLFPPYKYSCTVT
FT                   LDLGLATSRGRGKCKNPSCSYVYTNRHKPRICPSCGFNLAKDRTEKTPKAIEASSPHPD
FT                   VPSTTEALNPTQREVQRQSTLQLLRKVLQIPENESELAEVFALIHELNSSRLILSNVSE
FT                   ETVTIEQTSWSNYYESPSTQCLLCSSPLFKGGHNSLAGPQECWLLTANRLQVVTAQVKM
FT                   CLNPHCLALHSFTDIYTGLFNVGNKLLVSLDLLFAIRNQIKLGEDPRVSVGVVLKSVQE
FT                   QTEKTLTSEELSQLQELLCNGYWAFECLTVRDYNDMICGICGVAPKVEMAQRNEENVLA
FT                   LKSVEFTWPEFLGSSEVNVEDFWTTMETEVIEQVAFPASIPITKFDASVIAPFFPPLMR
FT                   GAVVVNTEKDKTQDMQPVPGNGSALVRLLQEGTCKLEELGSYSGEELQYLLEQCDIPFS
FT                   PEDSRDQLCFSLLALYESVQNGARARPPPAHFTGGKIYKVCPHQVVCGSKYLVRGESAR
FT                   DHVDLLASSRHWPPVYVVDMATPVALCADLCYPELTSQMWGKNQGCFSNPTEPVVSVSC
FT                   PELLDQHYSVDVTEAENSVQHPVTKSATRRIVHANTKPDPSDPSAGHRSLSLCPELAPY
FT                   ASTTDSKLSSVRQRPIAFDNATHYYLYNRLMDFLTSREIVNRQIHDIVQSCQPGEVVIR
FT                   DTLYRLGVAQIKTEAQEEGEEEEVASVVE"
FT   CDS             complement(join(23785803..23786258,23787515..23787724,
FT                   23789020..23789136,23789776..23789909,23790952..23791171,
FT                   23794335..23794519,23795203..23795334,23799973..23800100,
FT                   23800791..23801092,23803913..23804062,23805727..23805825,
FT                   23808570..23808667,23808802..23808974,23810884..23811302,
FT                   23816438..23816569,23819033..23819131,23820742..23821239,
FT                   23824752..23824926,23825695..23825828))
FT                   /codon_start=1
FT                   /gene="A630042L21Rik"
FT                   /locus_tag="mCG_130312"
FT                   /product="RIKEN cDNA A630042L21, isoform CRA_c"
FT                   /note="gene_id=mCG130312.1 transcript_id=mCT173868.0
FT                   protein_id=mCP96788.0 isoform=CRA_c"
FT                   /db_xref="GOA:Q6AXF8"
FT                   /db_xref="InterPro:IPR009071"
FT                   /db_xref="MGI:MGI:2441817"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AXF8"
FT                   /protein_id="EDL09782.1"
FT                   /translation="MDAPYDGAEVTVLMEEIEEAYYTSPGPPKKKKKYKIHGEKAKKPR
FT                   SAYLLYYYDIYLKVQQELPHLPQSEINKKISESWRLLSVAERSYYLEKAKLEKEGLDPN
FT                   SKLSALTAVVPDIPGFRKILPRSEYIIIPKSTLQEDRSCPQLELCVAQNQMSPKGSTLM
FT                   SNASPDVVASHAGMAEQCLAVEALAEEVGALPQPGTVQEIATSEILSHDMLLEEASLEV
FT                   GESHQPYQTSLVIEETLVNGSSDLPTGSLAVPHSQVGESLSVVTVMRDSSESSPSAPAT
FT                   QFIMLPLPAYSVVENPSSIKLTTTYTRRGHGTCTSPGCSFTYVTRHKPPKCPTCGNFLG
FT                   GKWIPKEKPAKVKVELASGVSSKGSVIKRNQQSVTTEQNPSKENASKLTLENSEAVSQL
FT                   LNVAPPGEGGEDREWEEVIVSDAHVLVKEVPGNRGTAVTKMPVVKSGAQAEISLGTTEN
FT                   DSPGPDILPSAEGTSSSSLLQAHKKSPGVDLFTTGPKAPELKGRARGKPSLLAAARPMR
FT                   AILPAPTSVGRGSGVGLPRARQAFPLDKTPSVRTCGLKPSTLKQLGQPIQQPPSTGEVK
FT                   LSNCASSRTPQLKIVEVKPDLFPPYKYSCTVTLDLGLATSRGRGKCKNPSCSYVYTNRH
FT                   KPRICPSCGFNLAKDRTEKTPKAIEASSPHPDVPSTTEALNPTQREVQRQSTLQLLRKV
FT                   LQIPENESELAEVFALIHELNSSRLILSNVSEETVTIEQTSWSNYYESPSTQCLLCSSP
FT                   LFKGGHNSLAGPQECWLLTANRLQVVTAQVKMCLNPHCLALHSFTDIYTGLFNVGNKLL
FT                   VSLDLLFAIRNQIKLGEDPRVSVGVVLKSVQEQTEKTLTSEELSQLQELLCNGYWAFEC
FT                   LTVRDYNDMICGICGVAPKVEMAQRNEENVLALKSVEFTWPEFLGSSEVNVEDFWTTME
FT                   TEVIEQVAFPASIPITKFDASVIAPFFPPLMRGAVVVNTEKDKTQDMQPVPGNGSALVR
FT                   LLQEGTCKLEELGSYSGEELQYLLEQCDIPFSPEDSRDQLCFSLLALYESVQNGARARP
FT                   PPAHFTGGKIYKVCPHQVVCGSKYLVRGESARDHVDLLASSRHWPPVYVVDMATPVALC
FT                   ADLCYPELTSQMWGKNQGCFSNPTEPVVSVSCPELLDQHYSVDVTEAENSVQHPVTKSA
FT                   TRRIVHANTKPDPSDPSAGHRSLSLCPELAPYASTTDSKLSSVRQRPIAFDNATHYYLY
FT                   NRLMDFLTSREIVNRQIHDIVQSCQPGEVVIRDTLYRLGVAQIKTEAQEEGEEEEVASV
FT                   VE"
FT   CDS             complement(join(23785803..23786258,23787515..23787724,
FT                   23789020..23789136,23789776..23789909,23790952..23791171,
FT                   23794335..23794519,23795203..23795334,23799973..23800100,
FT                   23800791..23801092,23803913..23804062,23805727..23805825,
FT                   23808570..23808667,23808802..23808974,23810884..23811023))
FT                   /codon_start=1
FT                   /gene="A630042L21Rik"
FT                   /locus_tag="mCG_130312"
FT                   /product="RIKEN cDNA A630042L21, isoform CRA_b"
FT                   /note="gene_id=mCG130312.1 transcript_id=mCT173867.0
FT                   protein_id=mCP96787.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q6NZP6"
FT                   /db_xref="MGI:MGI:2441817"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NZP6"
FT                   /protein_id="EDL09781.1"
FT                   /translation="MPVVKSGAQAEISLGTTENDSPGPDILPSAEGTSSSSLLQAHKKS
FT                   PGVDLFTTGPKAPELKGRARGKPSLLAAARPMRAILPAPTSVGRGSGVGLPRARQAFPL
FT                   DKTPSVRTCGLKPSTLKQLGQPIQQPPSTGEVKLSNCASSRTPQLKIVEVKPDLFPPYK
FT                   YSCTVTLDLGLATSRGRGKCKNPSCSYVYTNRHKPRICPSCGFNLAKDRTEKTPKAIEA
FT                   SSPHPDVPSTTEALNPTQREVQRQSTLQLLRKVLQIPENESELAEVFALIHELNSSRLI
FT                   LSNVSEETVTIEQTSWSNYYESPSTQCLLCSSPLFKGGHNSLAGPQECWLLTANRLQVV
FT                   TAQVKMCLNPHCLALHSFTDIYTGLFNVGNKLLVSLDLLFAIRNQIKLGEDPRVSVGVV
FT                   LKSVQEQTEKTLTSEELSQLQELLCNGYWAFECLTVRDYNDMICGICGVAPKVEMAQRN
FT                   EENVLALKSVEFTWPEFLGSSEVNVEDFWTTMETEVIEQVAFPASIPITKFDASVIAPF
FT                   FPPLMRGAVVVNTEKDKTQDMQPVPGNGSALVRLLQEGTCKLEELGSYSGEELQYLLEQ
FT                   CDIPFSPEDSRDQLCFSLLALYESVQNGARARPPPAHFTGGKIYKVCPHQVVCGSKYLV
FT                   RGESARDHVDLLASSRHWPPVYVVDMATPVALCADLCYPELTSQMWGKNQGCFSNPTEP
FT                   VVSVSCPELLDQHYSVDVTEAENSVQHPVTKSATRRIVHANTKPDPSDPSAGHRSLSLC
FT                   PELAPYASTTDSKLSSVRQRPIAFDNATHYYLYNRLMDFLTSREIVNRQIHDIVQSCQP
FT                   GEVVIRDTLYRLGVAQIKTEAQEEGEEEEVASVVE"
FT   gene            complement(23850216..23864878)
FT                   /gene="Slc26a2"
FT                   /locus_tag="mCG_6033"
FT                   /note="gene_id=mCG6033.1"
FT   mRNA            complement(join(23850216..23853015,23855077..23855799,
FT                   23857706..23857841,23864794..23864878))
FT                   /gene="Slc26a2"
FT                   /locus_tag="mCG_6033"
FT                   /product="solute carrier family 26 (sulfate transporter),
FT                   member 2"
FT                   /note="gene_id=mCG6033.1 transcript_id=mCT4705.1 created on
FT                   04-OCT-2002"
FT   CDS             complement(join(23851495..23853015,23855077..23855775))
FT                   /codon_start=1
FT                   /gene="Slc26a2"
FT                   /locus_tag="mCG_6033"
FT                   /product="solute carrier family 26 (sulfate transporter),
FT                   member 2"
FT                   /note="gene_id=mCG6033.1 transcript_id=mCT4705.1
FT                   protein_id=mCP21551.1"
FT                   /db_xref="GOA:Q62273"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR018045"
FT                   /db_xref="MGI:MGI:892977"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q62273"
FT                   /protein_id="EDL09779.1"
FT                   /translation="MSSENKEQHDLSPRDLPEEAFGFPSELPLETQRRSGTDLRQSETG
FT                   HGRRAFRRIHMELREKPDTDIKQFVIRELQKSCQCSAAKVRDGAFDFFPVLRWLPKYDL
FT                   KKNILGDVMSGLIVGILLVPQSIAYSLLAGQEPIYGLYTSFFASIIYFLFGTSRHISVG
FT                   IFGILCLMIGEVVDRELHKACPDTDATSSSIAVFSSGCVVVNHTLDGLCDKSCYAIKIG
FT                   STVTFMAGVYQVAMGFFQVGFVSVYLSDALLSGFVTGASFTILTSQAKYLLGLSLPRSH
FT                   GVGSVITTWIHIFRNIRNTNICDLITSLLCLLVLVPSKELNEHFKDKLKAPIPVELIVV
FT                   VAATLASHFGKLNGNYNSSIAGHIPTGFMPPKAPDWSLIPNVAVDAIAISIIGFAITVS
FT                   LSEMFAKKHGYTVKANQEMYAIGFCNIIPSFFHCITTSAALAKTLVKESTGCQTQLSAI
FT                   VTALVLLLVLLVIAPLFYSLQKCVLGVITIVNLRGALLKFRDLPKMWRLSRMDTVIWFV
FT                   TMLSSALLSTEIGLLVGVCFSMFCVILRTQKPKNSLLGLEEESETFESISTYKNLRSKS
FT                   GIKVFRFIAPLYYINKECFKSALYKKALNPVLVKAAWKKAAKRKLKEEMVTFRGDPDEV
FT                   SMQLSHDPLEVHTIVIDCSAIQFLDTAGIHTLKEVRRDYEAVGIQVLLAQCNPSVRDSL
FT                   ARGEYCKKEEETLLFYSLSEAVAFAEDSQNQKGVCVVNGLSLSGD"
FT   gene            23873888..23939460
FT                   /gene="Pde6a"
FT                   /locus_tag="mCG_130305"
FT                   /note="gene_id=mCG130305.0"
FT   mRNA            join(23873888..23874470,23884720..23884872,
FT                   23886212..23886301,23888100..23888240,23891870..23891944,
FT                   23898744..23898808,23903151..23903217,23906335..23906382,
FT                   23906872..23907021,23907508..23907651,23910195..23910260,
FT                   23910392..23910538,23911417..23911524,23914750..23914859,
FT                   23916259..23916346,23916509..23916609,23917294..23917401,
FT                   23933335..23933398,23933642..23933716,23934741..23934824,
FT                   23936646..23936793,23938859..23939460)
FT                   /gene="Pde6a"
FT                   /locus_tag="mCG_130305"
FT                   /product="phosphodiesterase 6A, cGMP-specific, rod, alpha"
FT                   /note="gene_id=mCG130305.0 transcript_id=mCT131628.0
FT                   created on 17-JUN-2003"
FT   CDS             join(23873997..23874470,23884720..23884872,
FT                   23886212..23886301,23888100..23888240,23891870..23891944,
FT                   23898744..23898808,23903151..23903217,23906335..23906382,
FT                   23906872..23907021,23907508..23907651,23910195..23910260,
FT                   23910392..23910538,23911417..23911524,23914750..23914859,
FT                   23916259..23916346,23916509..23916609,23917294..23917401,
FT                   23933335..23933398,23933642..23933716,23934741..23934824,
FT                   23936646..23936793,23938859..23938935)
FT                   /codon_start=1
FT                   /gene="Pde6a"
FT                   /locus_tag="mCG_130305"
FT                   /product="phosphodiesterase 6A, cGMP-specific, rod, alpha"
FT                   /note="gene_id=mCG130305.0 transcript_id=mCT131628.0
FT                   protein_id=mCP78050.1"
FT                   /db_xref="GOA:Q8K0A8"
FT                   /db_xref="InterPro:IPR002073"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR023088"
FT                   /db_xref="InterPro:IPR023174"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="MGI:MGI:97524"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K0A8"
FT                   /protein_id="EDL09778.1"
FT                   /translation="MGEVTAEEVEKFLDSNIGFAKQYYNFHYRGKVISDLLGAKEAAVD
FT                   FSNYHDVNSVEESEIIFDLLRDVQENLQAEKCTFNVMKKLCFLLRADRMSLFMYRTRNG
FT                   IAELATRLFNVHKDAVLEDCLVMPDSEIVFPLDMGVVGHVAHSKKIANVPNTEEDEHFC
FT                   DFVDNLTEYQTKNILASPIMNGKDVVAIIMAVNKIDEPHFTKRDEEILLKYLNFVNLIM
FT                   KVFHLSYLHNCETRRGQILLWSGSKVFEELTDIERQFHKALYTVRAFLNCDRYSVGLLD
FT                   MTKQKEFFDVWPVLMGEAPAYSGPRTPDGREINFYKVIDYILHGKEDIKVIPNPPADHW
FT                   ALVSGLPTYVAQNGLICNIMNAPAEDFFEFQKEPLDESGWMIKNVLSMPIVNKKEEIVG
FT                   VATFYNRKDGKPFDDMDETLMESLTQFLGWSVLNPDTYESMNKLENRKDIFQDIVKYHV
FT                   KCDNEEIQKILKTREVYGKEPWECEEEELAEILQGELPDAESYEINKFHFSDLPLTELE
FT                   LVKCGIQMYYELRVVDKFHIPQEALVRFMYSLSKGYRRITYHNWRHGFNVGQTMFSLLV
FT                   TGKLKRYFTDLEALAMVTAAFCHDIDHRGTNNLYQMKSQNPLAKLHGSSILERHHLEFG
FT                   KTLLRDESLNIFQNLNRRQHEHAIHMMDIAIIATDLALYFKKRTMFQKIVDQSKTYEST
FT                   QEWTQYMMLEQTRKEIVMAMMMTACDLSAITKPWEVQSKVALLVAAEFWEQGDLERTVL
FT                   QQNPIPMMDRNKADELPKLQVGFIDFVCTFVYKEFSRFHEEITPMLDGITNNRKEWKAL
FT                   ADEYEAKMKALEEEKQKQQAAKQAASGNQPGGNPTPGGAPASKSCCIQ"
FT   gene            complement(23948875..24050869)
FT                   /gene="Ppargc1b"
FT                   /locus_tag="mCG_130315"
FT                   /note="gene_id=mCG130315.1"
FT   mRNA            complement(join(23948875..23949501,23950304..23950458,
FT                   23953337..23953458,23955426..23955501,23957925..23958732,
FT                   23959751..23959812,23960364..23960400,23961125..23962226,
FT                   23962872..23962988,23966458..23966670,23973860..23974033,
FT                   24050728..24050869))
FT                   /gene="Ppargc1b"
FT                   /locus_tag="mCG_130315"
FT                   /product="peroxisome proliferative activated receptor,
FT                   gamma, coactivator 1 beta, transcript variant mCT131638"
FT                   /note="gene_id=mCG130315.1 transcript_id=mCT131638.1
FT                   created on 04-OCT-2002"
FT   mRNA            complement(join(23948881..23949501,23950304..23950458,
FT                   23953337..23953458,23955426..23955501,23957925..23958096,
FT                   23961529..23961881))
FT                   /gene="Ppargc1b"
FT                   /locus_tag="mCG_130315"
FT                   /product="peroxisome proliferative activated receptor,
FT                   gamma, coactivator 1 beta, transcript variant mCT173870"
FT                   /note="gene_id=mCG130315.1 transcript_id=mCT173870.0
FT                   created on 04-OCT-2002"
FT   mRNA            complement(join(23949226..23949501,23950304..23950458,
FT                   23953337..23953458,23955426..23955501,23957925..23958732,
FT                   23959751..23959812,23960364..23960400,23961125..23962226,
FT                   23962872..23962988,23966458..23966670,23973860..23974033,
FT                   24032900..24032978,24050728..>24050840))
FT                   /gene="Ppargc1b"
FT                   /locus_tag="mCG_130315"
FT                   /product="peroxisome proliferative activated receptor,
FT                   gamma, coactivator 1 beta, transcript variant mCT190269"
FT                   /note="gene_id=mCG130315.1 transcript_id=mCT190269.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(23949401..23949501,23950304..23950458,
FT                   23953337..23953458,23955426..23955501,23957925..23958732,
FT                   23959751..23959812,23960364..23960400,23961125..23962226,
FT                   23962872..23962988,23966458..23966670,23973860..23974033,
FT                   24032900..24032978,24050728..>24050840))
FT                   /codon_start=1
FT                   /gene="Ppargc1b"
FT                   /locus_tag="mCG_130315"
FT                   /product="peroxisome proliferative activated receptor,
FT                   gamma, coactivator 1 beta, isoform CRA_b"
FT                   /note="gene_id=mCG130315.1 transcript_id=mCT190269.0
FT                   protein_id=mCP111265.0 isoform=CRA_b"
FT                   /protein_id="EDL09776.1"
FT                   /translation="LTPPHAAAAAGRWRGTTAARCWMKSSRPSSSTISLTRRSAEGLEE
FT                   VDHEALDRDGCGRRRLADMGGDSGEEQLCADLPELDLSQLDASDFDSATCFGELQWCPE
FT                   TSETEPSQYSPDDSELFQIDSENEALLAALTKTLDDIPEDDVGLAAFPELDEGDTPSCT
FT                   PASPAPLSAPPSPTLERLLSPASDVDELSLLQKLLLATSSPTASSDALKDGATWSQTSL
FT                   SSRSQRPCVKVDGTQDKKTPTLRAQSRPCTELHKHLTSVLPCPRVKACSPTPHPSPRLL
FT                   SKEEEEEVGEDCPSPWPTPASPQDSLAQDTASPDSAQPPEEDVRAMVQLIRYMHTYCLP
FT                   QRKLPQRAPEPIPQACSSLSRQVQPRSRHPPKAFWTEFSILRELLAQDILCDVSKPYRL
FT                   AIPVYASLTPQSRPRPPKDSQASPAHSAMAEEVRITASPKSTGPRPSLRPLRLEVKRDV
FT                   NKPTRQKREEDEEEEEEEEEEEEEKEEEEEEWGRKRPGRGLPWTKLGRKMDSSVCPVRR
FT                   SRRLNPELGPWLTFTDEPLGALPSMCLDTETHNLEEDLGSLTDSSQGRQLPQGSQIPAL
FT                   ESPCESGCGDTDEDPSCPQPTSRDSSRCLMLALSQSDSLGKKSFEESLTVELCGTAGLT
FT                   PPTTPPYKPMEEDPFKPDTKLSPGQDTAPSLPSPEALPLTATPGASHKLPKRHPERSEL
FT                   LSHLQHATTQPVSQAGQKRPFSCSFGDHDYCQVLRPEAALQRKVLRSWEPIGVHLEDLA
FT                   QQGAPLPTETKAPRREANQNCDPTHKDSMQLRDHEIRASLTKHFGLLETALEGEDLASC
FT                   KSPEYDTVFEDSSSSSGESSFLLEEEEEEEEGGEEDDEGEDSGVSPPCSDHCPYQSPPS
FT                   KASRQLCSRSRSSSGSSSCSSWSPATRKNFRRESRGPCSDGTPSVRHARKRREKAIGEG
FT                   RVVYIRNLSSDMSSRELKKRFEVFGEIVECQVLTRSKRGQKHGFITFRCSEHAALSVRN
FT                   GATLRKRNEPSFHLSYGGLRHFRWPRYTDYDPTSEESLPSSGKSKYEAMDFDSLLKEAQ
FT                   QSLH"
FT   CDS             complement(join(23949401..23949501,23950304..23950458,
FT                   23953337..23953458,23955426..23955501,23957925..23958732,
FT                   23959751..23959812,23960364..23960400,23961125..23962226,
FT                   23962872..23962988,23966458..23966670,23973860..23974033,
FT                   24050728..24050805))
FT                   /codon_start=1
FT                   /gene="Ppargc1b"
FT                   /locus_tag="mCG_130315"
FT                   /product="peroxisome proliferative activated receptor,
FT                   gamma, coactivator 1 beta, isoform CRA_c"
FT                   /note="gene_id=mCG130315.1 transcript_id=mCT131638.1
FT                   protein_id=mCP77755.1 isoform=CRA_c"
FT                   /protein_id="EDL09777.1"
FT                   /translation="MAGNDCGALLDEELSSFFLNYLSDTQGGDSGEEQLCADLPELDLS
FT                   QLDASDFDSATCFGELQWCPETSETEPSQYSPDDSELFQIDSENEALLAALTKTLDDIP
FT                   EDDVGLAAFPELDEGDTPSCTPASPAPLSAPPSPTLERLLSPASDVDELSLLQKLLLAT
FT                   SSPTASSDALKDGATWSQTSLSSRSQRPCVKVDGTQDKKTPTLRAQSRPCTELHKHLTS
FT                   VLPCPRVKACSPTPHPSPRLLSKEEEEEVGEDCPSPWPTPASPQDSLAQDTASPDSAQP
FT                   PEEDVRAMVQLIRYMHTYCLPQRKLPQRAPEPIPQACSSLSRQVQPRSRHPPKAFWTEF
FT                   SILRELLAQDILCDVSKPYRLAIPVYASLTPQSRPRPPKDSQASPAHSAMAEEVRITAS
FT                   PKSTGPRPSLRPLRLEVKRDVNKPTRQKREEDEEEEEEEEEEEEEKEEEEEEWGRKRPG
FT                   RGLPWTKLGRKMDSSVCPVRRSRRLNPELGPWLTFTDEPLGALPSMCLDTETHNLEEDL
FT                   GSLTDSSQGRQLPQGSQIPALESPCESGCGDTDEDPSCPQPTSRDSSRCLMLALSQSDS
FT                   LGKKSFEESLTVELCGTAGLTPPTTPPYKPMEEDPFKPDTKLSPGQDTAPSLPSPEALP
FT                   LTATPGASHKLPKRHPERSELLSHLQHATTQPVSQAGQKRPFSCSFGDHDYCQVLRPEA
FT                   ALQRKVLRSWEPIGVHLEDLAQQGAPLPTETKAPRREANQNCDPTHKDSMQLRDHEIRA
FT                   SLTKHFGLLETALEGEDLASCKSPEYDTVFEDSSSSSGESSFLLEEEEEEEEGGEEDDE
FT                   GEDSGVSPPCSDHCPYQSPPSKASRQLCSRSRSSSGSSSCSSWSPATRKNFRRESRGPC
FT                   SDGTPSVRHARKRREKAIGEGRVVYIRNLSSDMSSRELKKRFEVFGEIVECQVLTRSKR
FT                   GQKHGFITFRCSEHAALSVRNGATLRKRNEPSFHLSYGGLRHFRWPRYTDYDPTSEESL
FT                   PSSGKSKYEAMDFDSLLKEAQQSLH"
FT   CDS             complement(join(23949401..23949501,23950304..23950458,
FT                   23953337..23953458,23955426..23955501,23957925..23958096,
FT                   23961529..23961553))
FT                   /codon_start=1
FT                   /gene="Ppargc1b"
FT                   /locus_tag="mCG_130315"
FT                   /product="peroxisome proliferative activated receptor,
FT                   gamma, coactivator 1 beta, isoform CRA_a"
FT                   /note="gene_id=mCG130315.1 transcript_id=mCT173870.0
FT                   protein_id=mCP96789.0 isoform=CRA_a"
FT                   /protein_id="EDL09775.1"
FT                   /translation="MLTSLQGKREEDDEGEDSGVSPPCSDHCPYQSPPSKASRQLCSRS
FT                   RSSSGSSSCSSWSPATRKNFRRESRGPCSDGTPSVRHARKRREKAIGEGRVVYIRNLSS
FT                   DMSSRELKKRFEVFGEIVECQVLTRSKRGQKHGFITFRCSEHAALSVRNGATLRKRNEP
FT                   SFHLSYGGLRHFRWPRYTDYDPTSEESLPSSGKSKYEAMDFDSLLKEAQQSLH"
FT   gene            complement(24119269..>24133807)
FT                   /locus_tag="mCG_144594"
FT                   /note="gene_id=mCG144594.0"
FT   mRNA            complement(join(24119269..24120206,24122932..24123053,
FT                   24123310..24123377,24133132..>24133807))
FT                   /locus_tag="mCG_144594"
FT                   /product="mCG144594"
FT                   /note="gene_id=mCG144594.0 transcript_id=mCT184018.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(24133509..>24133805)
FT                   /codon_start=1
FT                   /locus_tag="mCG_144594"
FT                   /product="mCG144594"
FT                   /note="gene_id=mCG144594.0 transcript_id=mCT184018.0
FT                   protein_id=mCP106238.0"
FT                   /protein_id="EDL09774.1"
FT                   /translation="SSRARTQPQESDHRQASWPLHGLTVALTKEVCMAAGEVASAERLA
FT                   PPWAWAPEPRDAGWRVGLELDHRLNLSSPSLLQDFRISFFFFLTSFELWLPLT"
FT   gene            24133964..>24138419
FT                   /locus_tag="mCG_147287"
FT                   /note="gene_id=mCG147287.0"
FT   mRNA            join(24133964..24134085,24135551..>24138419)
FT                   /locus_tag="mCG_147287"
FT                   /product="mCG147287"
FT                   /note="gene_id=mCG147287.0 transcript_id=mCT187550.0
FT                   created on 13-JAN-2004"
FT   CDS             24137579..>24138419
FT                   /codon_start=1
FT                   /locus_tag="mCG_147287"
FT                   /product="mCG147287"
FT                   /note="gene_id=mCG147287.0 transcript_id=mCT187550.0
FT                   protein_id=mCP109676.0"
FT                   /protein_id="EDL09773.1"
FT                   /translation="MRQDHREDHPLEDNRETGGGIPWLLPLASTSHESNPSPEQRTKEP
FT                   WKCFLQYTRKTGAGCSSSKHGCPGSMAVGLCSVPEPPGSKGWPQPAACEELGPYSGSKK
FT                   NQIQGGRQALKPFQVPYIPPKGPHNDNNHVTEHRGAKGQGQGIYQYVILLAQRILVTSS
FT                   PWSSLIKSKESQKLSINDNRKRNDSEGNVTLPKDPRERNLCPMKSRHETSSLEKMLQQE
FT                   EQRWACCRPCEDFHRKRGQSRAWWCRPGIPVLRGLRRENCQSVWVTTKPNQGSIIKAK"
FT   gene            complement(24143048..>24158537)
FT                   /gene="4933429F08Rik"
FT                   /locus_tag="mCG_49565"
FT                   /note="gene_id=mCG49565.3"
FT   mRNA            complement(join(24143048..24143213,24143371..24143811,
FT                   24144054..24144303,24147346..24147506,24148959..24149154,
FT                   24151062..24151190,24153511..24153840,24154928..24155038,
FT                   24155669..24155773,24156454..24156584,24157895..>24158537))
FT                   /gene="4933429F08Rik"
FT                   /locus_tag="mCG_49565"
FT                   /product="RIKEN cDNA 4933429F08, transcript variant
FT                   mCT190313"
FT                   /note="gene_id=mCG49565.3 transcript_id=mCT190313.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(24143048..24143213,24143371..24143811,
FT                   24144054..24144291,24147346..24147506,24148959..24149154,
FT                   24151062..24151190,24153511..24153840,24156421..24156584,
FT                   24157895..24158533))
FT                   /gene="4933429F08Rik"
FT                   /locus_tag="mCG_49565"
FT                   /product="RIKEN cDNA 4933429F08, transcript variant
FT                   mCT49748"
FT                   /note="gene_id=mCG49565.3 transcript_id=mCT49748.2 created
FT                   on 04-OCT-2002"
FT   CDS             complement(join(24144094..24144303,24147346..24147506,
FT                   24148959..24149154,24151062..24151190,24153511..24153840,
FT                   24154928..24155038,24155669..24155773,24156454..24156584,
FT                   24157895..>24158135))
FT                   /codon_start=1
FT                   /gene="4933429F08Rik"
FT                   /locus_tag="mCG_49565"
FT                   /product="RIKEN cDNA 4933429F08, isoform CRA_a"
FT                   /note="gene_id=mCG49565.3 transcript_id=mCT190313.0
FT                   protein_id=mCP111301.0 isoform=CRA_a"
FT                   /protein_id="EDL09771.1"
FT                   /translation="KMVSTCLTATFSLRPQAGPSGLSFFLVIPLQRITKYPLLLQKILE
FT                   NTPADASAHPALQRATSALQDVNGNINEYKMRKEVALKYTKVEQLSLRERLARINTHTL
FT                   SKKTTRLSQMLKQEAGLVSRTEDKEFDDLEERFQWVSLCVKELRNNVVDFMGNLEVFLS
FT                   FRPHERSLDIPGGPAEQYCSLARDLQLHAFLQFKQRLRSLVWQPLCSLARALAGPQNLI
FT                   KKRLDKLLDFDRVEEKLLDVGSVTWEEEAARHEYQALNSLLVAELPQFNQLVMQWLGQI
FT                   LCTFVVLQRDLADQVLRRAESTMALLPHHHVSEPDFQKLLEHTLGQSSSQLRLFQESFE
FT                   KVLPPSTTQPLLPGSEHQMQALLTRYGPEKLYQVSSNINGTGTLDLTLLRGQIVALLQN
FT                   KDTKGNNSRWLVDTGGHRGYVPAGKLQLYHPIIPSEKELRGQTGTHEDSWLPAPEPTQL
FT                   SVPTVPTMSQVVAVYPFVARSTHELSLQAGQPVTILEAQDKKGNPEWSLVEANGQRGYV
FT                   PSNFLARTPSPTPWGWNLPS"
FT   CDS             complement(join(24144094..24144291,24147346..24147506,
FT                   24148959..24149154,24151062..24151190,24153511..24153840,
FT                   24156421..24156584,24157895..24158132))
FT                   /codon_start=1
FT                   /gene="4933429F08Rik"
FT                   /locus_tag="mCG_49565"
FT                   /product="RIKEN cDNA 4933429F08, isoform CRA_b"
FT                   /note="gene_id=mCG49565.3 transcript_id=mCT49748.2
FT                   protein_id=mCP41592.2 isoform=CRA_b"
FT                   /protein_id="EDL09772.1"
FT                   /translation="MVSTCLTATFSLRPQAGPSGLSFFLVIPLQRITKYPLLLQKILEN
FT                   TPADASAHPALQRATSALQDVNGNINEYKMRKEVALKYTKVEQLSLRERLARINTHTLS
FT                   KKTTRLSQMLKQEAGLVSRVSASSVGNESRKQRLRSLVWQPLCSLARALAGPQNLIKKR
FT                   LDKLLDFDRVEEKLLDVGSVTWEEEAARHEYQALNSLLVAELPQFNQLVMQWLGQILCT
FT                   FVVLQRDLADQVLRRAESTMALLPHHHVSEPDFQKLLEHTLGQSSSQLRLFQESFEKVL
FT                   PPSTTQPLLPGSEHQMQALLTRYGPEKLYQVSSNINGTGTLDLTLLRGQIVALLQNKDT
FT                   KGNNSRWLVDTGGHRGYVPAGKLQLYHPIIPSEKELRGQTGTHEDSWLPAPEPTQLSVP
FT                   TVPTMSQYPFVARSTHELSLQAGQPVTILEAQDKKGNPEWSLVEANGQRGYVPSNFLAR
FT                   TPSPTPWGWNLPS"
FT   gene            complement(24167570..24185852)
FT                   /locus_tag="mCG_141256"
FT                   /note="gene_id=mCG141256.0"
FT   mRNA            complement(join(24167570..24167676,24172054..24172177,
FT                   24173285..24173481,24185756..24185852))
FT                   /locus_tag="mCG_141256"
FT                   /product="mCG141256"
FT                   /note="gene_id=mCG141256.0 transcript_id=mCT174173.0
FT                   created on 11-OCT-2002"
FT   CDS             complement(join(24172120..24172177,24173285..24173481,
FT                   24185756..24185800))
FT                   /codon_start=1
FT                   /locus_tag="mCG_141256"
FT                   /product="mCG141256"
FT                   /note="gene_id=mCG141256.0 transcript_id=mCT174173.0
FT                   protein_id=mCP97092.0"
FT                   /protein_id="EDL09770.1"
FT                   /translation="MPPGGLRGNSCWTDENLWTWLTLEQMRPLPSQRVLSRKIRALRTD
FT                   RCSIRGWPSESSLTQKSPTYTCSDSVPLTSEATYNSCHQAIWTSCSPTSMTSSK"
FT   gene            24204719..24237718
FT                   /gene="Csnk1a1"
FT                   /locus_tag="mCG_12653"
FT                   /note="gene_id=mCG12653.3"
FT   mRNA            join(24204719..24205318,24205948..24206054,
FT                   24217711..24217837,24218911..24219009,24224857..24224996,
FT                   24225947..24226025,24226618..24226692,24228107..24228207,
FT                   24229779..24229927,24236841..24237714)
FT                   /gene="Csnk1a1"
FT                   /locus_tag="mCG_12653"
FT                   /product="casein kinase 1, alpha 1, transcript variant
FT                   mCT173851"
FT                   /note="gene_id=mCG12653.3 transcript_id=mCT173851.0 created
FT                   on 04-OCT-2002"
FT   mRNA            join(24204719..24205318,24205948..24206054,
FT                   24217711..24217837,24218911..24219009,24224857..24224996,
FT                   24225947..24226025,24226618..24226692,24228107..24228213,
FT                   24229779..24229891,24236841..24237697)
FT                   /gene="Csnk1a1"
FT                   /locus_tag="mCG_12653"
FT                   /product="casein kinase 1, alpha 1, transcript variant
FT                   mCT13340"
FT                   /note="gene_id=mCG12653.3 transcript_id=mCT13340.2 created
FT                   on 04-OCT-2002"
FT   mRNA            join(24204749..24204799,24205175..24205318,
FT                   24205948..24206054,24217711..24217837,24218911..24219009,
FT                   24224857..24224996,24225947..24226025,24226618..24226692,
FT                   24228107..24228213,24229779..24229891,24236841..24237714)
FT                   /gene="Csnk1a1"
FT                   /locus_tag="mCG_12653"
FT                   /product="casein kinase 1, alpha 1, transcript variant
FT                   mCT173852"
FT                   /note="gene_id=mCG12653.3 transcript_id=mCT173852.0 created
FT                   on 04-OCT-2002"
FT   mRNA            join(<24204778..24205318,24205948..24206054,
FT                   24217711..24217837,24218911..24219009,24224857..24224996,
FT                   24225947..24226025,24226618..24226692,24228107..24228213,
FT                   24229779..24229927,24236841..24237718)
FT                   /gene="Csnk1a1"
FT                   /locus_tag="mCG_12653"
FT                   /product="casein kinase 1, alpha 1, transcript variant
FT                   mCT190274"
FT                   /note="gene_id=mCG12653.3 transcript_id=mCT190274.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(24204778..24205318,24205948..24207683)
FT                   /gene="Csnk1a1"
FT                   /locus_tag="mCG_12653"
FT                   /product="casein kinase 1, alpha 1, transcript variant
FT                   mCT173853"
FT                   /note="gene_id=mCG12653.3 transcript_id=mCT173853.0 created
FT                   on 04-OCT-2002"
FT   CDS             join(24204794..24204799,24205175..24205318,
FT                   24205948..24206054,24217711..24217837,24218911..24219009,
FT                   24224857..24224996,24225947..24226025,24226618..24226692,
FT                   24228107..24228213,24229779..24229891,24236841..24236848)
FT                   /codon_start=1
FT                   /gene="Csnk1a1"
FT                   /locus_tag="mCG_12653"
FT                   /product="casein kinase 1, alpha 1, isoform CRA_e"
FT                   /note="gene_id=mCG12653.3 transcript_id=mCT173852.0
FT                   protein_id=mCP96771.0 isoform=CRA_e"
FT                   /protein_id="EDL09767.1"
FT                   /translation="MAPPSSRLRMASSSGSKAEFIVGGKYKLVRKIGSGSFGDIYLAIN
FT                   ITNGEEVAVKLESQKARHPQLLYESKLYKILQGGVGIPHIRWYGQEKDYNVLVMDLLGP
FT                   SLEDLFNFCSRRFTMKTVLMLADQMISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKLF
FT                   LIDFGLAKKYRDNRTRQHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLMY
FT                   FNRTSLPWQGLKAATKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAP
FT                   DYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAAQQAASSSGQGQQAQTPTGF"
FT   CDS             join(<24205085..24205318,24205948..24206054,
FT                   24217711..24217837,24218911..24219009,24224857..24224996,
FT                   24225947..24226025,24226618..24226692,24228107..24228213,
FT                   24229779..24229927,24236841..24236848)
FT                   /codon_start=1
FT                   /gene="Csnk1a1"
FT                   /locus_tag="mCG_12653"
FT                   /product="casein kinase 1, alpha 1, isoform CRA_d"
FT                   /note="gene_id=mCG12653.3 transcript_id=mCT190274.0
FT                   protein_id=mCP111260.0 isoform=CRA_d"
FT                   /protein_id="EDL09766.1"
FT                   /translation="VARRASHFCRGWNSPGGFHPLPEVSGLGPPPPSSRLRMASSSGSK
FT                   AEFIVGGKYKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKIL
FT                   QGGVGIPHIRWYGQEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEY
FT                   VHTKNFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKNLTGTA
FT                   RYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKKMSTP
FT                   VEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQ
FT                   KAAQQAASSSGQGQQAQTPTGKQTDKTKSNMKGF"
FT   CDS             join(24205196..24205318,24205948..24206054,
FT                   24217711..24217837,24218911..24219009,24224857..24224996,
FT                   24225947..24226025,24226618..24226692,24228107..24228213,
FT                   24229779..24229891,24236841..24236848)
FT                   /codon_start=1
FT                   /gene="Csnk1a1"
FT                   /locus_tag="mCG_12653"
FT                   /product="casein kinase 1, alpha 1, isoform CRA_a"
FT                   /note="gene_id=mCG12653.3 transcript_id=mCT13340.2
FT                   protein_id=mCP21558.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q6PJ87"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="MGI:MGI:1934950"
FT                   /db_xref="UniProtKB/TrEMBL:Q6PJ87"
FT                   /protein_id="EDL09763.1"
FT                   /translation="MASSSGSKAEFIVGGKYKLVRKIGSGSFGDIYLAINITNGEEVAV
FT                   KLESQKARHPQLLYESKLYKILQGGVGIPHIRWYGQEKDYNVLVMDLLGPSLEDLFNFC
FT                   SRRFTMKTVLMLADQMISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKK
FT                   YRDNRTRQHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQ
FT                   GLKAATKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLF
FT                   RILFRTLNHQYDYTFDWTMLKQKAAQQAASSSGQGQQAQTPTGF"
FT   CDS             join(24205196..24205318,24205948..24206054,
FT                   24217711..24217837,24218911..24219009,24224857..24224996,
FT                   24225947..24226025,24226618..24226692,24228107..24228207,
FT                   24229779..24229927,24236841..24236848)
FT                   /codon_start=1
FT                   /gene="Csnk1a1"
FT                   /locus_tag="mCG_12653"
FT                   /product="casein kinase 1, alpha 1, isoform CRA_f"
FT                   /note="gene_id=mCG12653.3 transcript_id=mCT173851.0
FT                   protein_id=mCP96770.0 isoform=CRA_f"
FT                   /protein_id="EDL09768.1"
FT                   /translation="MASSSGSKAEFIVGGKYKLVRKIGSGSFGDIYLAINITNGEEVAV
FT                   KLESQKARHPQLLYESKLYKILQGGVGIPHIRWYGQEKDYNVLVMDLLGPSLEDLFNFC
FT                   SRRFTMKTVLMLADQMISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKK
FT                   YRDNRTRQHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQ
FT                   GLKAATKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLF
FT                   RILTLNHQYDYTFDWTMLKQKAAQQAASSSGQGQQAQTPTGKQTDKTKSNMKGF"
FT   CDS             join(24205196..24205318,24205948..24206058)
FT                   /codon_start=1
FT                   /gene="Csnk1a1"
FT                   /locus_tag="mCG_12653"
FT                   /product="casein kinase 1, alpha 1, isoform CRA_c"
FT                   /note="gene_id=mCG12653.3 transcript_id=mCT173853.0
FT                   protein_id=mCP96769.0 isoform=CRA_c"
FT                   /protein_id="EDL09765.1"
FT                   /translation="MASSSGSKAEFIVGGKYKLVRKIGSGSFGDIYLAINITNGEEVAV
FT                   KLESQKARHPQLLYESKLYKILQGGVGIPHIR"
FT   mRNA            join(24221334..24221404,24224857..24224996,
FT                   24225947..24226025,24226618..24226692,24228107..24228213,
FT                   24229779..24229891,24236841..24237714)
FT                   /gene="Csnk1a1"
FT                   /locus_tag="mCG_12653"
FT                   /product="casein kinase 1, alpha 1, transcript variant
FT                   mCT173850"
FT                   /note="gene_id=mCG12653.3 transcript_id=mCT173850.0 created
FT                   on 04-OCT-2002"
FT   CDS             join(24221357..24221404,24224857..24224996,
FT                   24225947..24226025,24226618..24226692,24228107..24228213,
FT                   24229779..24229891,24236841..24236848)
FT                   /codon_start=1
FT                   /gene="Csnk1a1"
FT                   /locus_tag="mCG_12653"
FT                   /product="casein kinase 1, alpha 1, isoform CRA_b"
FT                   /note="gene_id=mCG12653.3 transcript_id=mCT173850.0
FT                   protein_id=mCP96772.0 isoform=CRA_b"
FT                   /protein_id="EDL09764.1"
FT                   /translation="MTVSPSQDPSFSGLNQLFLIDFGLAKKYRDNRTRQHIPYREDKNL
FT                   TGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKK
FT                   MSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWT
FT                   MLKQKAAQQAASSSGQGQQAQTPTGF"
FT   gene            24232259..24235913
FT                   /locus_tag="mCG_147305"
FT                   /note="gene_id=mCG147305.0"
FT   mRNA            join(24232259..24233820,24234583..24235913)
FT                   /locus_tag="mCG_147305"
FT                   /product="mCG147305"
FT                   /note="gene_id=mCG147305.0 transcript_id=mCT187568.0
FT                   created on 13-JAN-2004"
FT   CDS             24232432..24232602
FT                   /codon_start=1
FT                   /locus_tag="mCG_147305"
FT                   /product="mCG147305"
FT                   /note="gene_id=mCG147305.0 transcript_id=mCT187568.0
FT                   protein_id=mCP109694.0"
FT                   /protein_id="EDL09769.1"
FT                   /translation="MSWYLPIMVIPYYFSLLKNYGKWLRVVVHIFNLSSQETGVWISEF
FT                   ENSQGYVVRLS"
FT   gene            complement(24300640..24315208)
FT                   /locus_tag="mCG_144593"
FT                   /note="gene_id=mCG144593.0"
FT   mRNA            complement(join(24300640..24302072,24304096..24304204,
FT                   24314972..24315208))
FT                   /locus_tag="mCG_144593"
FT                   /product="mCG144593"
FT                   /note="gene_id=mCG144593.0 transcript_id=mCT184017.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(24301324..24301734)
FT                   /codon_start=1
FT                   /locus_tag="mCG_144593"
FT                   /product="mCG144593"
FT                   /note="gene_id=mCG144593.0 transcript_id=mCT184017.0
FT                   protein_id=mCP106236.0"
FT                   /protein_id="EDL09762.1"
FT                   /translation="MKGFFKYFFSGRLHLREPGVRTSSAYQPRTCMFMGPEKKGIPSCP
FT                   TVPSHHPSPHPTPSRRPFELLKGWGEGTSLATSSWQSFHGLSRVPMSLPPCPPRCLPSP
FT                   SASVSCKDKDSIKAAVQGHTPLAHRDGSGSAE"
FT   gene            24334588..24342845
FT                   /gene="Il17b"
FT                   /locus_tag="mCG_12649"
FT                   /note="gene_id=mCG12649.2"
FT   mRNA            join(24334588..24334820,24337773..24337816,
FT                   24340417..24340706,24342514..24342845)
FT                   /gene="Il17b"
FT                   /locus_tag="mCG_12649"
FT                   /product="interleukin 17B"
FT                   /note="gene_id=mCG12649.2 transcript_id=mCT13336.2 created
FT                   on 10-APR-2002"
FT   CDS             join(24337796..24337816,24340417..24340706,
FT                   24342514..24342745)
FT                   /codon_start=1
FT                   /gene="Il17b"
FT                   /locus_tag="mCG_12649"
FT                   /product="interleukin 17B"
FT                   /note="gene_id=mCG12649.2 transcript_id=mCT13336.2
FT                   protein_id=mCP21552.2"
FT                   /protein_id="EDL09761.1"
FT                   /translation="MDWLHSLLFLLAISIFLAPSHPRNTKGKRKGQGRPSPLAPGPHQV
FT                   PLDLVSRVKPYARMEEYERTLGEMVAQLRNSSEPAKKKCEVNLQLWLSNKRSLSPWGYS
FT                   INHDPSRIPADLPEARCLCLGCVNPFTMQEDRSMVSVPVFSQVPVRRRLCPQPPRPGPC
FT                   RQRVVMETIAVGCTCIF"
FT   gene            complement(24348246..24360082)
FT                   /gene="BC060677"
FT                   /locus_tag="mCG_12647"
FT                   /note="gene_id=mCG12647.2"
FT   mRNA            complement(join(24348246..24348631,24349115..24349868,
FT                   24350256..24350396,24351185..24351396,24354486..24354660,
FT                   24355797..24356003,24359940..24360082))
FT                   /gene="BC060677"
FT                   /locus_tag="mCG_12647"
FT                   /product="cDNA sequence BC060677"
FT                   /note="gene_id=mCG12647.2 transcript_id=mCT13334.2 created
FT                   on 19-JUN-2003"
FT   CDS             complement(join(24349204..24349868,24350256..24350396,
FT                   24351185..24351396,24354486..24354660,24355797..24356003,
FT                   24359940..24360027))
FT                   /codon_start=1
FT                   /gene="BC060677"
FT                   /locus_tag="mCG_12647"
FT                   /product="cDNA sequence BC060677"
FT                   /note="gene_id=mCG12647.2 transcript_id=mCT13334.2
FT                   protein_id=mCP21475.2"
FT                   /protein_id="EDL09760.1"
FT                   /translation="MARAAPLLAVLATVLTTAAAGGDAPPGKIAVIGAGIGGSAVAHFL
FT                   QQHFGPRVQIVVYEKGTVGGRLATISVNKQNYESGAASFHSLSLHMQDFVKLLGLRQRR
FT                   EVVGRSAIFGGEHFVLEETDWYLLNLFRLWWYYGISFLRLQMWVEEVMEKFMRIYKYQA
FT                   HGYAFSGVEELLYSLGEATFVNMTQRSVAESLLQVGVTQRFIDDVVSAVLRASYGQSAS
FT                   MPAFAGAMSLAGAQGNLWSVEGGNKLVCSGLLKLAKATVIHATVTSVTLHSTEGKALYQ
FT                   VAYESDKGNSSDFYDIVVIATPLHLDNSSNNNITFEGFTPPIEDIQGSFQPTVVSLVHG
FT                   YLNSSYFGFPDPKLFPFANILTTDFPSFFCTLDNICPVNISASFRRKQPQEAAVWRVQS
FT                   PKPLFRTELKTLFRSYYSVQTAEWQAHPLYGSRRTLPRFALHDQLFYLNALEWAASSVE
FT                   VTAVAAKNVALLAYNRWYQDLDKIDQKDLIHKVKTEL"
FT   gene            complement(24362792..24378707)
FT                   /gene="Grpel2"
FT                   /locus_tag="mCG_12654"
FT                   /note="gene_id=mCG12654.3"
FT   mRNA            complement(join(24362792..24362924,24365688..24365773,
FT                   24366842..24368573,24371200..24371281,24372148..24372301,
FT                   24378611..24378707))
FT                   /gene="Grpel2"
FT                   /locus_tag="mCG_12654"
FT                   /product="GrpE-like 2, mitochondrial"
FT                   /note="gene_id=mCG12654.3 transcript_id=mCT173854.1 created
FT                   on 19-JUN-2003"
FT   CDS             complement(join(24368209..24368573,24371200..24371281,
FT                   24372148..24372301,24378611..24378684))
FT                   /codon_start=1
FT                   /gene="Grpel2"
FT                   /locus_tag="mCG_12654"
FT                   /product="GrpE-like 2, mitochondrial"
FT                   /note="gene_id=mCG12654.3 transcript_id=mCT173854.1
FT                   protein_id=mCP96773.1"
FT                   /db_xref="GOA:Q0VB85"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="MGI:MGI:1334416"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VB85"
FT                   /protein_id="EDL09759.1"
FT                   /translation="MAARSLWAVQRLQRLLASGAMSESRGWLHPFSTATQRTAGEDCSS
FT                   EDPPDGLGPSLAEQALRLKAVKLEKEVQDLTLRYQRAVADCENIRRRTQRCVEDAKIFG
FT                   IQSFCKDLVEVADILEKTAKCCSEGAEPEDHRRTLEKVFQGLSLLEARLKSVFTKHGLE
FT                   KMTPIGDKYDPHEHELICHMPAGVGVQPGTVALVRQDGYKLHGRTIRLAQVEVAVESQR
FT                   RL"
FT   gene            complement(24382647..24439088)
FT                   /gene="AI173486"
FT                   /locus_tag="mCG_130309"
FT                   /note="gene_id=mCG130309.0"
FT   mRNA            complement(join(24382647..24383695,24386087..24386215,
FT                   24387951..24388129,24389166..24389330,24389879..24389990,
FT                   24391067..24391139,24391520..24391665,24394039..24394250,
FT                   24395687..24395839,24396076..24396169,24399229..24399321,
FT                   24401147..24401326,24404119..24404330,24404961..24405059,
FT                   24408023..24408134,24409300..24409394,24410112..24410195,
FT                   24411060..24411188,24438975..24439088))
FT                   /gene="AI173486"
FT                   /locus_tag="mCG_130309"
FT                   /product="expressed sequence AI173486, transcript variant
FT                   mCT131632"
FT                   /note="gene_id=mCG130309.0 transcript_id=mCT131632.0
FT                   created on 04-OCT-2002"
FT   mRNA            complement(join(24382647..24383695,24386087..24386215,
FT                   24387951..24388129,24389166..24389330,24389879..24389990,
FT                   24391067..24391139,24391520..24391665,24394039..24394250,
FT                   24395687..24395839,24396076..24396169,24399229..24399321,
FT                   24401147..24401240,24409300..24409394,24410112..24410195,
FT                   24411060..24411188,24438975..24439010))
FT                   /gene="AI173486"
FT                   /locus_tag="mCG_130309"
FT                   /product="expressed sequence AI173486, transcript variant
FT                   mCT173866"
FT                   /note="gene_id=mCG130309.0 transcript_id=mCT173866.0
FT                   created on 04-OCT-2002"
FT   mRNA            complement(join(24383324..24383695,24386087..24386215,
FT                   24387951..24388129,24389166..24389330,24389879..24389990,
FT                   24391067..24391139,24391520..24391665,24394039..24394250,
FT                   24395687..24396169,24399229..24399321,24401147..24401326,
FT                   24404119..24404330,24404961..24405059,24408023..24408134,
FT                   24409300..24409394,24410112..24410195,24411060..24411188,
FT                   24438975..>24439061))
FT                   /gene="AI173486"
FT                   /locus_tag="mCG_130309"
FT                   /product="expressed sequence AI173486, transcript variant
FT                   mCT190293"
FT                   /note="gene_id=mCG130309.0 transcript_id=mCT190293.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(24383672..24383695,24386087..24386215,
FT                   24387951..24388129,24389166..24389330,24389879..24389990,
FT                   24391067..24391139,24391520..24391665,24394039..24394250,
FT                   24395687..24395839,24396076..24396169,24399229..24399321,
FT                   24401147..24401326,24404119..24404330,24404961..24405059,
FT                   24408023..24408134,24409300..24409394,24410112..24410195,
FT                   24411060..24411188,24438975..24438990))
FT                   /codon_start=1
FT                   /gene="AI173486"
FT                   /locus_tag="mCG_130309"
FT                   /product="expressed sequence AI173486, isoform CRA_c"
FT                   /note="gene_id=mCG130309.0 transcript_id=mCT131632.0
FT                   protein_id=mCP77658.1 isoform=CRA_c"
FT                   /db_xref="GOA:B2RSM5"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="MGI:MGI:2147199"
FT                   /db_xref="UniProtKB/TrEMBL:B2RSM5"
FT                   /protein_id="EDL09758.1"
FT                   /translation="MDRSRVLEQLIPELTGLLSLLDHEYLSDSTLEKKMAVASLLQSLQ
FT                   PLPAKEVSFLYVNTADLHSGPSFVESLFEEFDCDLGDLRDMSDDGEPSKGASPEPTKSP
FT                   SLRSAAADVPPPLPNKPPPEDYYEEALPLGPGKSPEYISSHNGCSPAQSIVDGYYEDAD
FT                   NSYPTTRMNGELKNSYNDSDAMSSSYESYDEEEEEEKGRQPKHQWPSEEASMHLVRDCR
FT                   ICAFLLRKKRFGQWAKQLTVIKEEQLLCYKSSKDRQPHLRLALDVCTVIYVPKDSRHKR
FT                   HELRFSQGATEVLVLALQSREQAEEWLKVIREVSRPIVGAEGLEVPRSPVILCKADQDK
FT                   RLSQEKQNSDSDSLGMNDSGSTLGRREACEHGKGKKNSLAELKGSMSRAAGRKITRIIS
FT                   FSKKKALSEDLQTFSSEDEVPCCGYLNVLVNQGWKERWCRLRCNTLYFHKDRTDLHTHV
FT                   NSIALRGCEVAPGFGPRHPFAFRILRNRQEVAILEASCSEDMGRWLGLLLVEMGSKVTP
FT                   EALHYDYVDVETLTSIVSAGRNSFLYAQSCQDQWPEPRIYDEVPYEKVQDEEPQRPTGA
FT                   QVKRHASSCSEKSHRADPQVKVKRHASSANQYKYGKNRAEEDARRYLVEKERLEKEKET
FT                   IRTELTALRQEKKELKEAIRNNPGAKSKALEEAVATLEAQCRAKEEQRIDLELKLVAVK
FT                   ERLQQSLAGGPALGLSVSNKNKSQDTTNKPQSNAPEQSLPVNCVSELRKRSPSIVTSNQ
FT                   GRVLQKAKEWEMKKT"
FT   CDS             complement(join(24383672..24383695,24386087..24386215,
FT                   24387951..24388129,24389166..24389330,24389879..24389990,
FT                   24391067..24391139,24391520..24391665,24394039..24394250,
FT                   24395687..24395839,24396076..24396124))
FT                   /codon_start=1
FT                   /gene="AI173486"
FT                   /locus_tag="mCG_130309"
FT                   /product="expressed sequence AI173486, isoform CRA_a"
FT                   /note="gene_id=mCG130309.0 transcript_id=mCT173866.0
FT                   protein_id=mCP96785.0 isoform=CRA_a"
FT                   /protein_id="EDL09756.1"
FT                   /translation="MNDSGSTLGRREACEHGKGKKNSLAELKGSMSRAAGRKITRIISF
FT                   SKKKALSEDLQTFSSEDEVPCCGYLNVLVNQGWKERWCRLRCNTLYFHKDRTDLHTHVN
FT                   SIALRGCEVAPGFGPRHPFAFRILRNRQEVAILEASCSEDMGRWLGLLLVEMGSKVTPE
FT                   ALHYDYVDVETLTSIVSAGRNSFLYAQSCQDQWPEPRIYDEVPYEKVQDEEPQRPTGAQ
FT                   VKRHASSCSEKSHRADPQVKVKRHASSANQYKYGKNRAEEDARRYLVEKERLEKEKETI
FT                   RTELTALRQEKKELKEAIRNNPGAKSKALEEAVATLEAQCRAKEEQRIDLELKLVAVKE
FT                   RLQQSLAGGPALGLSVSNKNKSQDTTNKPQSNAPEQSLPVNCVSELRKRSPSIVTSNQG
FT                   RVLQKAKEWEMKKT"
FT   CDS             complement(join(24395795..24396169,24399229..24399321,
FT                   24401147..24401326,24404119..24404330,24404961..24405059,
FT                   24408023..24408134,24409300..24409394,24410112..24410195,
FT                   24411060..24411188,24438975..>24439059))
FT                   /codon_start=1
FT                   /gene="AI173486"
FT                   /locus_tag="mCG_130309"
FT                   /product="expressed sequence AI173486, isoform CRA_b"
FT                   /note="gene_id=mCG130309.0 transcript_id=mCT190293.0
FT                   protein_id=mCP111264.0 isoform=CRA_b"
FT                   /protein_id="EDL09757.1"
FT                   /translation="ERTPPGAAAAAPWAECSRIHAGAMDRSRVLEQLIPELTGLLSLLD
FT                   HEYLSDSTLEKKMAVASLLQSLQPLPAKEVSFLYVNTADLHSGPSFVESLFEEFDCDLG
FT                   DLRDMSDDGEPSKGASPEPTKSPSLRSAAADVPPPLPNKPPPEDYYEEALPLGPGKSPE
FT                   YISSHNGCSPAQSIVDGYYEDADNSYPTTRMNGELKNSYNDSDAMSSSYESYDEEEEEE
FT                   KGRQPKHQWPSEEASMHLVRDCRICAFLLRKKRFGQWAKQLTVIKEEQLLCYKSSKDRQ
FT                   PHLRLALDVCTVIYVPKDSRHKRHELRFSQGATEVLVLALQSREQAEEWLKVIREVSRP
FT                   IVGAEGLEVPRSPVILCKADQDKRLSQEKQNSDSDSLGMNDSGSTLGRREACEHGRSYH
FT                   ELPLVHAGECQRWEGLCYRSTVTEQITGTRVRPLGLSYLVITGRLQGLLGRPEVGRSGT
FT                   VASFPIPVSPLLWCQAKGRRTAWLSLRAP"
FT   gene            complement(24451892..>24564458)
FT                   /gene="Ablim3"
FT                   /locus_tag="mCG_12650"
FT                   /note="gene_id=mCG12650.3"
FT   mRNA            complement(join(24451892..24453909,24457568..24457648,
FT                   24458879..24458949,24460860..24460918,24461412..24461441,
FT                   24463791..24463938,24466030..24466094,24466686..24466820,
FT                   24469408..24469455,24471459..24471557,24472261..24472387,
FT                   24472837..24472866,24474343..24474498,24476339..24476410,
FT                   24478973..24479031,24492127..24492214,24498224..24498317,
FT                   24501780..24501906,24507685..24507797,24509484..24509667,
FT                   24524041..24524178,24563864..24563966,24564314..>24564458))
FT                   /gene="Ablim3"
FT                   /locus_tag="mCG_12650"
FT                   /product="actin binding LIM protein family, member 3,
FT                   transcript variant mCT190271"
FT                   /note="gene_id=mCG12650.3 transcript_id=mCT190271.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(24451893..24453909,24457568..24457648,
FT                   24458139..24458146,24458889..24458949,24460860..24460918,
FT                   24461412..24461441,24463791..24463938,24466030..24466094,
FT                   24466686..24466820,24471459..24471557,24472261..24472387,
FT                   24472837..24472866,24474343..24474498,24476339..24476410,
FT                   24478973..24479031,24492127..24492214,24498224..24498317,
FT                   24501780..24501996,24507685..24507797,24509484..24509667,
FT                   24524041..24524178,24563864..24564233))
FT                   /gene="Ablim3"
FT                   /locus_tag="mCG_12650"
FT                   /product="actin binding LIM protein family, member 3,
FT                   transcript variant mCT174098"
FT                   /note="gene_id=mCG12650.3 transcript_id=mCT174098.0 created
FT                   on 04-OCT-2002"
FT   mRNA            complement(join(24451893..24453909,24457568..24457648,
FT                   24458139..24458146,24458889..24458949,24460860..24460918,
FT                   24461412..24461441,24463791..24463938,24466030..24466094,
FT                   24466686..24466820,24469408..24469455,24471459..24471557,
FT                   24472261..24472387,24472837..24472866,24474343..24474498,
FT                   24476339..24476410,24478973..24479031,24492127..24492214,
FT                   24498224..24498317,24501780..24501906,24507685..24507797,
FT                   24509484..24509667,24524041..24524178,24563864..>24563876))
FT                   /gene="Ablim3"
FT                   /locus_tag="mCG_12650"
FT                   /product="actin binding LIM protein family, member 3,
FT                   transcript variant mCT13337"
FT                   /note="gene_id=mCG12650.3 transcript_id=mCT13337.2 created
FT                   on 04-OCT-2002"
FT   mRNA            complement(join(24451893..24453909,24457568..24457648,
FT                   24458139..24458146,24458889..24458949,24460860..24460918,
FT                   24461412..24461441,24463791..24463938,24466030..24466094,
FT                   24466686..24466820,24472261..24472387,24476339..24476410,
FT                   24478973..24479031,24485291..24485350))
FT                   /gene="Ablim3"
FT                   /locus_tag="mCG_12650"
FT                   /product="actin binding LIM protein family, member 3,
FT                   transcript variant mCT174097"
FT                   /note="gene_id=mCG12650.3 transcript_id=mCT174097.0 created
FT                   on 04-OCT-2002"
FT   mRNA            complement(join(24453626..24453909,24457568..24457648,
FT                   24458879..24458949,24460860..24460918,24461412..24461441,
FT                   24463791..24463938,24466030..24466094,24466686..24466820,
FT                   24469408..24469455,24471459..24471557,24472261..24472387,
FT                   24472837..24472866,24474343..24474498,24476339..24476410,
FT                   24478973..24479031,24492127..24492214,24498224..24498317,
FT                   24501780..24501906,24507685..24507797,24509484..24509667,
FT                   24524041..24524178,24563864..>24564239))
FT                   /gene="Ablim3"
FT                   /locus_tag="mCG_12650"
FT                   /product="actin binding LIM protein family, member 3,
FT                   transcript variant mCT190272"
FT                   /note="gene_id=mCG12650.3 transcript_id=mCT190272.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(24453796..24453909,24457568..24457648,
FT                   24458139..24458146,24458889..24458949,24460860..24460918,
FT                   24461412..24461441,24463791..24463938,24466030..24466094,
FT                   24466686..24466820,24469408..24469455,24471459..24471557,
FT                   24472261..24472387,24472837..24472866,24474343..24474498,
FT                   24476339..24476410,24478973..24479031,24492127..24492214,
FT                   24498224..24498317,24501780..24501906,24507685..24507797,
FT                   24509484..24509667,24524041..24524178,24563864..24563876))
FT                   /codon_start=1
FT                   /gene="Ablim3"
FT                   /locus_tag="mCG_12650"
FT                   /product="actin binding LIM protein family, member 3,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG12650.3 transcript_id=mCT13337.2
FT                   protein_id=mCP21484.2 isoform=CRA_c"
FT                   /protein_id="EDL09754.1"
FT                   /translation="MNTSIPYQQSPYSPRGGSNVIQCYRCGDTCKGEVVRVHNNHFHIR
FT                   CFTCQVCGCGLAQSGFFFKNQEYICTQDYQQLYGTRCDSCRDFITGEVISALGRTYHPK
FT                   CFVCSLCRKPFPIGDKVTFSGKECVCQTCSQSMTSSKPIKIRGPSHCAGCKEEIKHGQS
FT                   LLALDKQWHVSCFKCQTCSVILTGEYISKDGVPYCESDYHSQFGIKCETCDRYISGRVL
FT                   EAGGKHYHPTCARCVRCHQMFTEGEEMYLTGSEVWHPICKQAARAEKKLKHRRTSETSI
FT                   SPPGSSIGSPNRVICAKVDNEILNYKDLAALPKVKSIYEVQRPDLISYEPHSRYTSDEM
FT                   LERCGYGESLGTLSPYSQDIYENLDLRQRRASSPGYIDSPTYSRQGMSPTFSRSPHYYR
FT                   SGPESGRSSPYHSQLDVRSSTPTSYQAPKHFHIPAGESNIYRKPPIYKRHGDLSTATKS
FT                   KTSEDISQASKYSPAYSPDPYYASESEYWTYHGSPKVPRARRFSSGGEEEDFDRSMHKL
FT                   QSGIGRLILKEEMKARSSSYADPWTPPRSSTSSREALHTTGYEMSFNGSPRSHYLADSD
FT                   PLISKSASLPAYRRNGLHRTPSADLFHYDSMNAVNWGMREYKIYPYELLLVTTRGRNRL
FT                   PKDVDRTRLERHLSQEEFYQVFGMTISEFERLALWKRNELKKQARLF"
FT   CDS             complement(join(24453796..24453909,24457568..24457648,
FT                   24458139..24458146,24458889..24458949,24460860..24460918,
FT                   24461412..24461441,24463791..24463938,24466030..24466094,
FT                   24466686..24466820,24471459..24471557,24472261..24472387,
FT                   24472837..24472866,24474343..24474498,24476339..24476410,
FT                   24478973..24479031,24492127..24492214,24498224..24498317,
FT                   24501780..24501996,24507685..24507797,24509484..24509667,
FT                   24524041..24524178,24563864..24563876))
FT                   /codon_start=1
FT                   /gene="Ablim3"
FT                   /locus_tag="mCG_12650"
FT                   /product="actin binding LIM protein family, member 3,
FT                   isoform CRA_d"
FT                   /note="gene_id=mCG12650.3 transcript_id=mCT174098.0
FT                   protein_id=mCP97016.0 isoform=CRA_d"
FT                   /protein_id="EDL09755.1"
FT                   /translation="MNTSIPYQQSPYSPRGGSNVIQCYRCGDTCKGEVVRVHNNHFHIR
FT                   CFTCQVCGCGLAQSGFFFKNQEYICTQDYQQLYGTRCDSCRDFITGEVISALGRTYHPK
FT                   CFVCSLCRKPFPIGDKVTFSGKECVCQTCSQSMTSSKPIKIRGPSRWGIKWYPGIQVPL
FT                   AGDDGQTQDVLPFVFSDCAGCKEEIKHGQSLLALDKQWHVSCFKCQTCSVILTGEYISK
FT                   DGVPYCESDYHSQFGIKCETCDRYISGRVLEAGGKHYHPTCARCVRCHQMFTEGEEMYL
FT                   TGSEVWHPICKQAARAEKKLKHRRTSETSISPPGSSIGSPNRVICAKVDNEILNYKDLA
FT                   ALPKVKSIYEVQRPDLISYEPHSRYTSDEMLERCGYGESLGTLSPYSQDIYENLDLRQR
FT                   RASSPGYIDSPTYSRQGMSPTFSRSPHYYRSGPESGRSSPYHSQLDVRSSTPTSYQAPK
FT                   HFHIPGDLSTATKSKTSEDISQASKYSPAYSPDPYYASESEYWTYHGSPKVPRARRFSS
FT                   GGEEEDFDRSMHKLQSGIGRLILKEEMKARSSSYADPWTPPRSSTSSREALHTTGYEMS
FT                   FNGSPRSHYLADSDPLISKSASLPAYRRNGLHRTPSADLFHYDSMNAVNWGMREYKIYP
FT                   YELLLVTTRGRNRLPKDVDRTRLERHLSQEEFYQVFGMTISEFERLALWKRNELKKQAR
FT                   LF"
FT   CDS             complement(join(24453796..24453909,24457568..24457648,
FT                   24458139..24458146,24458889..24458949,24460860..24460918,
FT                   24461412..24461441,24463791..24463938,24466030..24466094,
FT                   24466686..24466820,24472261..24472303))
FT                   /codon_start=1
FT                   /gene="Ablim3"
FT                   /locus_tag="mCG_12650"
FT                   /product="actin binding LIM protein family, member 3,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG12650.3 transcript_id=mCT174097.0
FT                   protein_id=mCP97017.0 isoform=CRA_a"
FT                   /protein_id="EDL09751.1"
FT                   /translation="MSPTFSRSPHYYRSGDLSTATKSKTSEDISQASKYSPAYSPDPYY
FT                   ASESEYWTYHGSPKVPRARRFSSGGEEEDFDRSMHKLQSGIGRLILKEEMKARSSSYAD
FT                   PWTPPRSSTSSREALHTTGYEMSFNGSPRSHYLADSDPLISKSASLPAYRRNGLHRTPS
FT                   ADLFHYDSMNAVNWGMREYKIYPYELLLVTTRGRNRLPKDVDRTRLERHLSQEEFYQVF
FT                   GMTISEFERLALWKRNELKKQARLF"
FT   CDS             complement(join(24457648,24458879..24458949,
FT                   24460860..24460918,24461412..24461441,24463791..24463938,
FT                   24466030..24466094,24466686..24466820,24469408..24469455,
FT                   24471459..24471557,24472261..24472387,24472837..24472866,
FT                   24474343..24474498,24476339..24476410,24478973..24479031,
FT                   24492127..24492214,24498224..24498317,24501780..24501906,
FT                   24507685..24507797,24509484..24509667,24524041..24524178,
FT                   24563864..>24563900))
FT                   /codon_start=1
FT                   /gene="Ablim3"
FT                   /locus_tag="mCG_12650"
FT                   /product="actin binding LIM protein family, member 3,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG12650.3 transcript_id=mCT190271.0
FT                   protein_id=mCP111257.0 isoform=CRA_b"
FT                   /protein_id="EDL09752.1"
FT                   /translation="TTQSKGITMNTSIPYQQSPYSPRGGSNVIQCYRCGDTCKGEVVRV
FT                   HNNHFHIRCFTCQVCGCGLAQSGFFFKNQEYICTQDYQQLYGTRCDSCRDFITGEVISA
FT                   LGRTYHPKCFVCSLCRKPFPIGDKVTFSGKECVCQTCSQSMTSSKPIKIRGPSHCAGCK
FT                   EEIKHGQSLLALDKQWHVSCFKCQTCSVILTGEYISKDGVPYCESDYHSQFGIKCETCD
FT                   RYISGRVLEAGGKHYHPTCARCVRCHQMFTEGEEMYLTGSEVWHPICKQAARAEKKLKH
FT                   RRTSETSISPPGSSIGSPNRVICAKVDNEILNYKDLAALPKVKSIYEVQRPDLISYEPH
FT                   SRYTSDEMLERCGYGESLGTLSPYSQDIYENLDLRQRRASSPGYIDSPTYSRQGMSPTF
FT                   SRSPHYYRSGPESGRSSPYHSQLDVRSSTPTSYQAPKHFHIPAGESNIYRKPPIYKRHG
FT                   DLSTATKSKTSEDISQASKYSPAYSPDPYYASESEYWTYHGSPKVPRARRFSSGGEEED
FT                   FDRSMHKLQSGIGRLILKEEMKARSSSYADPWTPPRSSTSSREALHTTGYEMSFNGSPR
FT                   SHYLADSDPLISKSASLPAYRRNGLHRTPSADLFHYDSMNAVNWGMRGEH"
FT   CDS             complement(join(24457648,24458879..24458949,
FT                   24460860..24460918,24461412..24461441,24463791..24463938,
FT                   24466030..24466094,24466686..24466820,24469408..24469455,
FT                   24471459..24471557,24472261..24472387,24472837..24472866,
FT                   24474343..24474498,24476339..24476410,24478973..24479031,
FT                   24492127..24492214,24498224..24498317,24501780..24501906,
FT                   24507685..24507797,24509484..24509667,24524041..24524178,
FT                   24563864..>24563900))
FT                   /codon_start=1
FT                   /gene="Ablim3"
FT                   /locus_tag="mCG_12650"
FT                   /product="actin binding LIM protein family, member 3,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG12650.3 transcript_id=mCT190272.0
FT                   protein_id=mCP111258.0 isoform=CRA_b"
FT                   /protein_id="EDL09753.1"
FT                   /translation="TTQSKGITMNTSIPYQQSPYSPRGGSNVIQCYRCGDTCKGEVVRV
FT                   HNNHFHIRCFTCQVCGCGLAQSGFFFKNQEYICTQDYQQLYGTRCDSCRDFITGEVISA
FT                   LGRTYHPKCFVCSLCRKPFPIGDKVTFSGKECVCQTCSQSMTSSKPIKIRGPSHCAGCK
FT                   EEIKHGQSLLALDKQWHVSCFKCQTCSVILTGEYISKDGVPYCESDYHSQFGIKCETCD
FT                   RYISGRVLEAGGKHYHPTCARCVRCHQMFTEGEEMYLTGSEVWHPICKQAARAEKKLKH
FT                   RRTSETSISPPGSSIGSPNRVICAKVDNEILNYKDLAALPKVKSIYEVQRPDLISYEPH
FT                   SRYTSDEMLERCGYGESLGTLSPYSQDIYENLDLRQRRASSPGYIDSPTYSRQGMSPTF
FT                   SRSPHYYRSGPESGRSSPYHSQLDVRSSTPTSYQAPKHFHIPAGESNIYRKPPIYKRHG
FT                   DLSTATKSKTSEDISQASKYSPAYSPDPYYASESEYWTYHGSPKVPRARRFSSGGEEED
FT                   FDRSMHKLQSGIGRLILKEEMKARSSSYADPWTPPRSSTSSREALHTTGYEMSFNGSPR
FT                   SHYLADSDPLISKSASLPAYRRNGLHRTPSADLFHYDSMNAVNWGMRGEH"
FT   gene            24605715..24668515
FT                   /gene="Sh3tc2"
FT                   /locus_tag="mCG_140806"
FT                   /note="gene_id=mCG140806.0"
FT   mRNA            join(24605715..24605807,24613873..24613971,
FT                   24620556..24620683,24623513..24623618,24625865..24626008,
FT                   24627027..24627225,24628148..24628221,24630457..24630652,
FT                   24640042..24640175,24641678..24641719,24641829..24643529,
FT                   24643623..24643803,24660094..24660244,24660903..24661025,
FT                   24664269..24664419,24665495..24665691,24667694..24668515)
FT                   /gene="Sh3tc2"
FT                   /locus_tag="mCG_140806"
FT                   /product="SH3 domain and tetratricopeptide repeats 2,
FT                   transcript variant mCT171604"
FT                   /note="gene_id=mCG140806.0 transcript_id=mCT171604.0
FT                   created on 04-OCT-2002"
FT   mRNA            join(24605716..24605807,24613873..24613971,
FT                   24620556..24620683,24623513..24623618,24625865..24626008,
FT                   24627027..24627225,24628148..24628221,24630457..24630652,
FT                   24641860..24643529,24643623..24643803,24660094..24660248,
FT                   24660906..24661025,24664269..24664419)
FT                   /gene="Sh3tc2"
FT                   /locus_tag="mCG_140806"
FT                   /product="SH3 domain and tetratricopeptide repeats 2,
FT                   transcript variant mCT173876"
FT                   /note="gene_id=mCG140806.0 transcript_id=mCT173876.0
FT                   created on 04-OCT-2002"
FT   mRNA            join(<24605723..24605807,24613873..24613971,
FT                   24620556..24620683,24623513..24623618,24625865..24626008,
FT                   24627027..24627225,24628148..24628221,24630457..24630652,
FT                   24640042..24640175,24641678..24641719,24641829..24643529,
FT                   24643663..24643803,24660094..24660244,24660903..24661025,
FT                   24664269..24664419,24665495..24665691,24667694..24668510)
FT                   /gene="Sh3tc2"
FT                   /locus_tag="mCG_140806"
FT                   /product="SH3 domain and tetratricopeptide repeats 2,
FT                   transcript variant mCT190278"
FT                   /note="gene_id=mCG140806.0 transcript_id=mCT190278.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<24605723..24605807,24613873..24613971,
FT                   24620556..24620683,24623513..24623618,24625865..24626008,
FT                   24627027..24627225,24628148..24628221,24630457..24630652,
FT                   24640042..24640175,24641678..24641719,24641829..24643529,
FT                   24643663..24643793)
FT                   /codon_start=1
FT                   /gene="Sh3tc2"
FT                   /locus_tag="mCG_140806"
FT                   /product="SH3 domain and tetratricopeptide repeats 2,
FT                   isoform CRA_d"
FT                   /note="gene_id=mCG140806.0 transcript_id=mCT190278.0
FT                   protein_id=mCP111268.0 isoform=CRA_d"
FT                   /protein_id="EDL09750.1"
FT                   /translation="QGPWPREDGAHMGGCFCIPGERSLPWGPGKEGSSKDPPGLAEDTS
FT                   SLENKRKCFLPQNMTQDLVLSFCVKSRSRRCVNAALQEAARRRLWALENEAQEVHALFK
FT                   DLSARLVSVQSQKDQFLITFKTLEEIWKFSTYLNLGYVSICLEHLFFDHTYWLNSRLVD
FT                   DTEIQVSVDDNHLENIYLGLLLQEGHFFCRAVCSVAQPADKEGEYLTLCKNELISVLSG
FT                   GESECEAMSLVTGQRGLVPMSALEPLPVPFHQWFLKNHPGICGLPRKRDWTGSGQIGRG
FT                   RCKALMDYEQEERDELCFLQGESIDVIGFVIPGLQWFIGKSVSSGEVGFVPTRSIDLDS
FT                   CSPMSKNSAFFSDEERSSLWSPGSERKAECSGFLCSLAHTDITSIYRLSEFEAIQNLQN
FT                   DLSASQPEGFREARSGGTWMERQTIGSRRSSGSGDSSPEEDELISASSDSYHLPEPEDL
FT                   DDPELFMDLSTSLEEDDVEHFAPILAFLDHEGYTDHFKSLYDFSFSFLTSSFYSFSEED
FT                   ELVAYLETSRKWAKMSHMTWAHARLCFLLGRLSIRKTKLSQARVYFEEAIRVLDGAFED
FT                   LSLVAALYINLAAIYLRQRLRHKGPTLLEKAGALLACLPDHEFSTKNELDVVTYVLRQG
FT                   IVVGSGLLEARSCFLAIRLLLSLGRHEEVVPFAERLQLLSGHPPASEATATMLSSLYDK
FT                   KYLPHLAVASVQKRGPQSARGMSLSIWQAYLVLQNATKILGVPSSNWCEVSALACPTLR
FT                   QALAACEELSDQDIQRTLCLILSKMYLQHQSPDGSVHYLSQAHVLGKLLGEEEAFESSL
FT                   CLAWAYLLGRQTEKALEILEPLLCSLRETECVTQRGVVHNLLGLAFEDEGRTSRAAKSY
FT                   LRALIRAREMGNIRNQAVSMANLGHLTLKSCMQQSARGYLLQAVRLYSELQASKETDME
FT                   LVQVLLWLGQASVSGHQLVHSRLCYEMALLFGLRHQHLSTRCPRTPMRALPIMNTGWPW
FT                   LSNSGIGRWRDSYWSPLGSFIGT"
FT   CDS             join(24605756..24605807,24613873..24613971,
FT                   24620556..24620683,24623513..24623618,24625865..24626008,
FT                   24627027..24627225,24628148..24628221,24630457..24630652,
FT                   24640042..24640175,24641678..24641719,24641829..24643529,
FT                   24643623..24643803,24660094..24660244,24660903..24661025,
FT                   24664269..24664419,24665495..24665691,24667694..24667885)
FT                   /codon_start=1
FT                   /gene="Sh3tc2"
FT                   /locus_tag="mCG_140806"
FT                   /product="SH3 domain and tetratricopeptide repeats 2,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG140806.0 transcript_id=mCT171604.0
FT                   protein_id=mCP94524.0 isoform=CRA_a"
FT                   /protein_id="EDL09747.1"
FT                   /translation="MGGCFCIPGERSLPWGPGKEGSSKDPPGLAEDTSSLENKRKCFLP
FT                   QNMTQDLVLSFCVKSRSRRCVNAALQEAARRRLWALENEAQEVHALFKDLSARLVSVQS
FT                   QKDQFLITFKTLEEIWKFSTYLNLGYVSICLEHLFFDHTYWLNSRLVDDTEIQVSVDDN
FT                   HLENIYLGLLLQEGHFFCRAVCSVAQPADKEGEYLTLCKNELISVLSGGESECEAMSLV
FT                   TGQRGLVPMSALEPLPVPFHQWFLKNHPGICGLPRKRDWTGSGQIGRGRCKALMDYEQE
FT                   ERDELCFLQGESIDVIGFVIPGLQWFIGKSVSSGEVGFVPTRSIDLDSCSPMSKNSAFF
FT                   SDEERSSLWSPGSERKAECSGFLCSLAHTDITSIYRLSEFEAIQNLQNDLSASQPEGFR
FT                   EARSGGTWMERQTIGSRRSSGSGDSSPEEDELISASSDSYHLPEPEDLDDPELFMDLST
FT                   SLEEDDVEHFAPILAFLDHEGYTDHFKSLYDFSFSFLTSSFYSFSEEDELVAYLETSRK
FT                   WAKMSHMTWAHARLCFLLGRLSIRKTKLSQARVYFEEAIRVLDGAFEDLSLVAALYINL
FT                   AAIYLRQRLRHKGPTLLEKAGALLACLPDHEFSTKNELDVVTYVLRQGIVVGSGLLEAR
FT                   SCFLAIRLLLSLGRHEEVVPFAERLQLLSGHPPASEATATMLSSLYDKKYLPHLAVASV
FT                   QKRGPQSARGMSLSIWQAYLVLQNATKILGVPSSNWCEVSALACPTLRQALAACEELSD
FT                   QDIQRTLCLILSKMYLQHQSPDGSVHYLSQAHVLGKLLGEEEAFESSLCLAWAYLLGRQ
FT                   TEKALEILEPLLCSLRETECVTQRGVVHNLLGLAFEDEGRTSRAAKSYLRALIRAREMG
FT                   NIRNQAVSMANLGHLTLKSCMQQSARGYLLQAVRLYSELQASKETDMELVQVLLWLGQA
FT                   SVSGHQLVHSRLCYEMALLFGLRHQHLSSQLQVTKSLCHFYSSVSPNPDACITYHEHWL
FT                   ALAQQLRDREMEGQLLESLGQLYRNLNTSRSLRRSLACIKESLRIFVDLGERDKAAEAW
FT                   LGAGRLHYLMQEDELVELYLQEAIQTALRSEEPSLALKLYEEAGDVFFNGTRHRHRAVE
FT                   YYRAGAVPLARRMKALRTELRIFNKLTELQISLEGYEKALEFATLAARLSVLTGDQKQE
FT                   LVAFHRLATVYFSLNMYEMAEDCYLKTLSLCPPWLQSPKEALYYAKVYCRLGRLTFYQL
FT                   KDAHDATEYFLLALAAAVLMGDEELQNTIKNRLDSICQSPLWHSNPFGCSSERARWLSG
FT                   GSLAL"
FT   CDS             join(24605756..24605807,24613873..24613971,
FT                   24620556..24620683,24623513..24623618,24625865..24626008,
FT                   24627027..24627225,24628148..24628221,24630457..24630652,
FT                   24641860..24643529,24643623..24643803,24660094..24660248,
FT                   24660906..24660973)
FT                   /codon_start=1
FT                   /gene="Sh3tc2"
FT                   /locus_tag="mCG_140806"
FT                   /product="SH3 domain and tetratricopeptide repeats 2,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG140806.0 transcript_id=mCT173876.0
FT                   protein_id=mCP96795.0 isoform=CRA_c"
FT                   /protein_id="EDL09749.1"
FT                   /translation="MGGCFCIPGERSLPWGPGKEGSSKDPPGLAEDTSSLENKRKCFLP
FT                   QNMTQDLVLSFCVKSRSRRCVNAALQEAARRRLWALENEAQEVHALFKDLSARLVSVQS
FT                   QKDQFLITFKTLEEIWKFSTYLNLGYVSICLEHLFFDHTYWLNSRLVDDTEIQVSVDDN
FT                   HLENIYLGLLLQEGHFFCRAVCSVAQPADKEGEYLTLCKNELISVLSGGESECEAMSLV
FT                   TGQRGLVPMSALEPLPVPFHQWFLKNHPGICGLPRKRDWTGSGQIGRGRCKALMDYEQE
FT                   ERDELCFLQGESIDVIGFVIPGLQWFIGKSVSSGEVGFVPTRSIDLDSCSPMSGGTWME
FT                   RQTIGSRRSSGSGDSSPEEDELISASSDSYHLPEPEDLDDPELFMDLSTSLEEDDVEHF
FT                   APILAFLDHEGYTDHFKSLYDFSFSFLTSSFYSFSEEDELVAYLETSRKWAKMSHMTWA
FT                   HARLCFLLGRLSIRKTKLSQARVYFEEAIRVLDGAFEDLSLVAALYINLAAIYLRQRLR
FT                   HKGPTLLEKAGALLACLPDHEFSTKNELDVVTYVLRQGIVVGSGLLEARSCFLAIRLLL
FT                   SLGRHEEVVPFAERLQLLSGHPPASEATATMLSSLYDKKYLPHLAVASVQKRGPQSARG
FT                   MSLSIWQAYLVLQNATKILGVPSSNWCEVSALACPTLRQALAACEELSDQDIQRTLCLI
FT                   LSKMYLQHQSPDGSVHYLSQAHVLGKLLGEEEAFESSLCLAWAYLLGRQTEKALEILEP
FT                   LLCSLRETECVTQRGVVHNLLGLAFEDEGRTSRAAKSYLRALIRAREMGNIRNQAVSMA
FT                   NLGHLTLKSCMQQSARGYLLQAVRLYSELQASKETDMELVQVLLWLGQASVSGHQLVHS
FT                   RLCYEMALLFGLRHQHLSSQLQVTKSLCHFYSSVSPNPDACITYHEHWLALAQQLRDRE
FT                   MEGQLLESLGQLYRNLNTSRSLRRSLACIKESLRIFVDLGERDKAAEAWLGAGRLHYLM
FT                   QEDELVELYLQVGHPDSLEVRRALPCSQALRRSR"
FT   mRNA            join(24606198..24606619,24613873..24613971,
FT                   24620556..24620683,24623513..24624185)
FT                   /gene="Sh3tc2"
FT                   /locus_tag="mCG_140806"
FT                   /product="SH3 domain and tetratricopeptide repeats 2,
FT                   transcript variant mCT171605"
FT                   /note="gene_id=mCG140806.0 transcript_id=mCT171605.0
FT                   created on 04-OCT-2002"
FT   CDS             join(24613962..24613971,24620556..24620683,
FT                   24623513..24623704)
FT                   /codon_start=1
FT                   /gene="Sh3tc2"
FT                   /locus_tag="mCG_140806"
FT                   /product="SH3 domain and tetratricopeptide repeats 2,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG140806.0 transcript_id=mCT171605.0
FT                   protein_id=mCP94523.0 isoform=CRA_b"
FT                   /protein_id="EDL09748.1"
FT                   /translation="MTQDLVLSFCVKSRSRRCVNAALQEAARRRLWALENEAQEVHALF
FT                   KDLSARLVSVQSQKDQFLITFKTLEEIWKFSTYLNLGMPWVGGGEHLSPSSRLVEPDTG
FT                   ELVCL"
FT   gene            complement(24829494..24832441)
FT                   /gene="Adrb2"
FT                   /locus_tag="mCG_49564"
FT                   /note="gene_id=mCG49564.2"
FT   mRNA            complement(24829494..24832441)
FT                   /gene="Adrb2"
FT                   /locus_tag="mCG_49564"
FT                   /product="adrenergic receptor, beta 2"
FT                   /note="gene_id=mCG49564.2 transcript_id=mCT49747.2 created
FT                   on 19-SEP-2002"
FT   CDS             complement(24830359..24831615)
FT                   /codon_start=1
FT                   /gene="Adrb2"
FT                   /locus_tag="mCG_49564"
FT                   /product="adrenergic receptor, beta 2"
FT                   /note="gene_id=mCG49564.2 transcript_id=mCT49747.2
FT                   protein_id=mCP41580.2"
FT                   /db_xref="GOA:P18762"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000332"
FT                   /db_xref="InterPro:IPR002233"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:87938"
FT                   /db_xref="UniProtKB/Swiss-Prot:P18762"
FT                   /protein_id="EDL09746.1"
FT                   /translation="MGPHGNDSDFLLAPNGSRAPDHDVTQERDEAWVVGMAILMSVIVL
FT                   AIVFGNVLVITAIAKFERLQTVTNYFIISLACADLVMGLAVVPFGASHILMKMWNFGNF
FT                   WCEFWTSIDVLCVTASIETLCVIAVDRYVAITSPFKYQSLLTKNKARVVILMVWIVSGL
FT                   TSFLPIQMHWYRATHKKAIDCYTEETCCDFFTNQAYAIASSIVSFYVPLVVMVFVYSRV
FT                   FQVAKRQLQKIDKSEGRFHAQNLSQVEQDGRSGHGLRRSSKFCLKEHKALKTLGIIMGT
FT                   FTLCWLPFFIVNIVHVIRDNLIPKEVYILLNWLGYVNSAFNPLIYCRSPDFRIAFQELL
FT                   CLRRSSSKTYGNGYSSNSNGRTDYTGEPNTCQLGQEREQELLCEDPPGMEGFVNCQGTV
FT                   PSLSVDSQGRNCSTNDSPL"
FT   gene            complement(24960330..24962577)
FT                   /locus_tag="mCG_147323"
FT                   /note="gene_id=mCG147323.0"
FT   mRNA            complement(24960330..24962577)
FT                   /locus_tag="mCG_147323"
FT                   /product="mCG147323"
FT                   /note="gene_id=mCG147323.0 transcript_id=mCT187586.0
FT                   created on 13-JAN-2004"
FT   gene            24961965..25135180
FT                   /gene="Htr4"
FT                   /locus_tag="mCG_12651"
FT                   /note="gene_id=mCG12651.2"
FT   mRNA            join(24961965..24962343,24979208..24979235,
FT                   25050165..25050290,25051533..25051733,25066522..25066675,
FT                   25075903..25076471,25121732..25121770,25135031..25135180)
FT                   /gene="Htr4"
FT                   /locus_tag="mCG_12651"
FT                   /product="5 hydroxytryptamine (serotonin) receptor 4,
FT                   transcript variant mCT173545"
FT                   /note="gene_id=mCG12651.2 transcript_id=mCT173545.0 created
FT                   on 19-SEP-2002"
FT   mRNA            join(24961965..24962343,24979208..24979235,
FT                   25050165..25050290,25051533..25051733,25066522..25066675,
FT                   25075903..25076471,25135031..25135155)
FT                   /gene="Htr4"
FT                   /locus_tag="mCG_12651"
FT                   /product="5 hydroxytryptamine (serotonin) receptor 4,
FT                   transcript variant mCT173544"
FT                   /note="gene_id=mCG12651.2 transcript_id=mCT173544.0 created
FT                   on 19-SEP-2002"
FT   mRNA            join(24961965..24962343,24979208..24979235,
FT                   25050165..25050290,25051533..25051733,25066522..25066675,
FT                   25075903..25076471,25103139..25103355)
FT                   /gene="Htr4"
FT                   /locus_tag="mCG_12651"
FT                   /product="5 hydroxytryptamine (serotonin) receptor 4,
FT                   transcript variant mCT13338"
FT                   /note="gene_id=mCG12651.2 transcript_id=mCT13338.2 created
FT                   on 19-SEP-2002"
FT   CDS             complement(24962042..24962431)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147323"
FT                   /product="mCG147323"
FT                   /note="gene_id=mCG147323.0 transcript_id=mCT187586.0
FT                   protein_id=mCP109711.0"
FT                   /db_xref="GOA:Q8CBV7"
FT                   /db_xref="MGI:MGI:3642095"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CBV7"
FT                   /protein_id="EDL09745.1"
FT                   /translation="MPAPAPALGKRQEGGHLALAWAGDPSLGSPGHAEHPPAPNQAGFG
FT                   RLHSPQLGCPCGPARCRPHRARGVPPVQRGALGSGRRGCPDLTSLGWPAYALSEQNRTH
FT                   SLGTGRKPWPHCRLLGDLGQIRSPL"
FT   mRNA            join(24979208..24979235,25050165..25050290,
FT                   25051533..25051733,25066522..25066675,25075903..25076471,
FT                   25121708..25121770,25135031..25135155)
FT                   /gene="Htr4"
FT                   /locus_tag="mCG_12651"
FT                   /product="5 hydroxytryptamine (serotonin) receptor 4,
FT                   transcript variant mCT190273"
FT                   /note="gene_id=mCG12651.2 transcript_id=mCT190273.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(24979210..24979235,25050165..25050290,
FT                   25051533..25051733,25066522..25066675,25075903..25076471,
FT                   25135031..25135118)
FT                   /codon_start=1
FT                   /gene="Htr4"
FT                   /locus_tag="mCG_12651"
FT                   /product="5 hydroxytryptamine (serotonin) receptor 4,
FT                   isoform CRA_d"
FT                   /note="gene_id=mCG12651.2 transcript_id=mCT173544.0
FT                   protein_id=mCP96463.0 isoform=CRA_d"
FT                   /protein_id="EDL09744.1"
FT                   /translation="MDKLDANVSSNEGFRSVEKVVLLTFLAVVILMAILGNLLVMVAVC
FT                   RDRQLRKIKTNYFIVSLAFADLLVSVLVMPFGAIELVQDIWAYGEMFCLVRTSLDVLLT
FT                   TASIFHLCCISLDRYYAICCQPLVYRNKMTPLRIALMLGGCWVLPMFISFLPIMQGWNN
FT                   IGIVDVIEKRKFSHNSNSTWCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEH
FT                   AQQIQMLQRAGATSESRPQPADQHSTHRMRTETKAAKTLCVIMGCFCFCWAPFFVTNIV
FT                   DPFIDYTVPEQVWTAFLWLGYINSGLNPFLYAFLNKSFRRAFLIILCCDDERYKRPPIL
FT                   GQTVPCSTTTINGSTHVLRYTVLHSGHHQELEKLPIHNDPESLESCF"
FT   CDS             join(24979210..24979235,25050165..25050290,
FT                   25051533..25051733,25066522..25066675,25075903..25076471,
FT                   25121708..25121747)
FT                   /codon_start=1
FT                   /gene="Htr4"
FT                   /locus_tag="mCG_12651"
FT                   /product="5 hydroxytryptamine (serotonin) receptor 4,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG12651.2 transcript_id=mCT190273.0
FT                   protein_id=mCP111259.0 isoform=CRA_b"
FT                   /protein_id="EDL09742.1"
FT                   /translation="MDKLDANVSSNEGFRSVEKVVLLTFLAVVILMAILGNLLVMVAVC
FT                   RDRQLRKIKTNYFIVSLAFADLLVSVLVMPFGAIELVQDIWAYGEMFCLVRTSLDVLLT
FT                   TASIFHLCCISLDRYYAICCQPLVYRNKMTPLRIALMLGGCWVLPMFISFLPIMQGWNN
FT                   IGIVDVIEKRKFSHNSNSTWCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEH
FT                   AQQIQMLQRAGATSESRPQPADQHSTHRMRTETKAAKTLCVIMGCFCFCWAPFFVTNIV
FT                   DPFIDYTVPEQVWTAFLWLGYINSGLNPFLYAFLNKSFRRAFLIILCCDDERYKRPPIL
FT                   GQTVPCSTTTINGSTHVLSFPLLFRNRPVPV"
FT   CDS             join(24979210..24979235,25050165..25050290,
FT                   25051533..25051733,25066522..25066675,25075903..25076471,
FT                   25121732..25121747)
FT                   /codon_start=1
FT                   /gene="Htr4"
FT                   /locus_tag="mCG_12651"
FT                   /product="5 hydroxytryptamine (serotonin) receptor 4,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG12651.2 transcript_id=mCT173545.0
FT                   protein_id=mCP96464.0 isoform=CRA_a"
FT                   /protein_id="EDL09741.1"
FT                   /translation="MDKLDANVSSNEGFRSVEKVVLLTFLAVVILMAILGNLLVMVAVC
FT                   RDRQLRKIKTNYFIVSLAFADLLVSVLVMPFGAIELVQDIWAYGEMFCLVRTSLDVLLT
FT                   TASIFHLCCISLDRYYAICCQPLVYRNKMTPLRIALMLGGCWVLPMFISFLPIMQGWNN
FT                   IGIVDVIEKRKFSHNSNSTWCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEH
FT                   AQQIQMLQRAGATSESRPQPADQHSTHRMRTETKAAKTLCVIMGCFCFCWAPFFVTNIV
FT                   DPFIDYTVPEQVWTAFLWLGYINSGLNPFLYAFLNKSFRRAFLIILCCDDERYKRPPIL
FT                   GQTVPCSTTTINGSTHVLRPVPV"
FT   CDS             join(24979210..24979235,25050165..25050290,
FT                   25051533..25051733,25066522..25066675,25075903..25076471,
FT                   25103139..25103229)
FT                   /codon_start=1
FT                   /gene="Htr4"
FT                   /locus_tag="mCG_12651"
FT                   /product="5 hydroxytryptamine (serotonin) receptor 4,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG12651.2 transcript_id=mCT13338.2
FT                   protein_id=mCP21557.2 isoform=CRA_c"
FT                   /db_xref="GOA:P97288"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR001520"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:109246"
FT                   /db_xref="UniProtKB/Swiss-Prot:P97288"
FT                   /protein_id="EDL09743.1"
FT                   /translation="MDKLDANVSSNEGFRSVEKVVLLTFLAVVILMAILGNLLVMVAVC
FT                   RDRQLRKIKTNYFIVSLAFADLLVSVLVMPFGAIELVQDIWAYGEMFCLVRTSLDVLLT
FT                   TASIFHLCCISLDRYYAICCQPLVYRNKMTPLRIALMLGGCWVLPMFISFLPIMQGWNN
FT                   IGIVDVIEKRKFSHNSNSTWCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEH
FT                   AQQIQMLQRAGATSESRPQPADQHSTHRMRTETKAAKTLCVIMGCFCFCWAPFFVTNIV
FT                   DPFIDYTVPEQVWTAFLWLGYINSGLNPFLYAFLNKSFRRAFLIILCCDDERYKRPPIL
FT                   GQTVPCSTTTINGSTHVLRDTVECGGQWESRCHLTATSPLVAAQPSDT"
FT   gene            complement(25142749..25189904)
FT                   /gene="Fbxo38"
FT                   /locus_tag="mCG_124663"
FT                   /note="gene_id=mCG124663.1"
FT   mRNA            complement(join(25142749..25143563,25144157..25144270,
FT                   25144620..25144723,25145286..25145431,25146516..25146682,
FT                   25149395..25149497,25149699..25149799,25153451..25154200,
FT                   25155626..25155805,25157144..25157263,25158406..25158619,
FT                   25159335..25159477,25161002..25161172,25164786..25164916,
FT                   25165831..25165924,25168204..25168341,25169341..25169478,
FT                   25172159..25172324,25172550..25172713,25174562..25174695,
FT                   25181406..25181571,25189822..25189904))
FT                   /gene="Fbxo38"
FT                   /locus_tag="mCG_124663"
FT                   /product="F-box protein 38, transcript variant mCT173833"
FT                   /note="gene_id=mCG124663.1 transcript_id=mCT173833.0
FT                   created on 04-OCT-2002"
FT   mRNA            complement(join(25142749..25143563,25144157..25144270,
FT                   25144620..25144723,25145286..25145431,25146516..25146682,
FT                   25149395..25149497,25149699..25149799,25153451..25154200,
FT                   25155626..25155805,25157144..25157263,25158406..25158619,
FT                   25159335..25159477,25161002..25161172,25164786..25164916,
FT                   25165831..25165924,25168204..25168341,25169341..25169478,
FT                   25172159..25172324,25172550..25172713,25174562..25174695,
FT                   25181406..25181571,25189781..25189885))
FT                   /gene="Fbxo38"
FT                   /locus_tag="mCG_124663"
FT                   /product="F-box protein 38, transcript variant mCT125911"
FT                   /note="gene_id=mCG124663.1 transcript_id=mCT125911.1
FT                   created on 04-OCT-2002"
FT   mRNA            complement(join(25142749..25143563,25144157..25144270,
FT                   25144620..25144723,25145286..25145431,25146516..25146682,
FT                   25149395..25149497,25149699..25149799,25153451..25154200,
FT                   25155626..25155805,25157144..25157263,25158406..25158619,
FT                   25159335..25159477,25160000..25160072))
FT                   /gene="Fbxo38"
FT                   /locus_tag="mCG_124663"
FT                   /product="F-box protein 38, transcript variant mCT173832"
FT                   /note="gene_id=mCG124663.1 transcript_id=mCT173832.0
FT                   created on 04-OCT-2002"
FT   CDS             complement(join(25143385..25143563,25144157..25144270,
FT                   25144620..25144723,25145286..25145431,25146516..25146682,
FT                   25149395..25149497,25149699..25149799,25153451..25154200,
FT                   25155626..25155805,25157144..25157263,25158406..25158619,
FT                   25159335..25159477,25161002..25161172,25164786..25164916,
FT                   25165831..25165924,25168204..25168341,25169341..25169478,
FT                   25172159..25172324,25172550..25172713,25174562..25174695,
FT                   25181406..25181533))
FT                   /codon_start=1
FT                   /gene="Fbxo38"
FT                   /locus_tag="mCG_124663"
FT                   /product="F-box protein 38, isoform CRA_a"
FT                   /note="gene_id=mCG124663.1 transcript_id=mCT125911.1
FT                   protein_id=mCP77404.1 isoform=CRA_a"
FT                   /protein_id="EDL09738.1"
FT                   /translation="MGPRKKSAKVCVMDSEVAEEMTADEEKDYMNQLSHEVLCHIFRYL
FT                   PLQDIMCMECLSRKLKEAVTLYLRVVRVVDLCAGRWWEYMPSGFTDSSFLTLLKKMPDV
FT                   EQLYGLHPRYLERRRVRGQEAFSIPGVLEALQACPNLVGVETSHLELVESIWTYMPHVH
FT                   ILGKFRNRNGAFPIPPENKLKIPIGAKIQTLHLVGVNVPEIPCIPMLRHLYMKWVRLTK
FT                   PQPFKDFLCISLRTFVMRNCAGPTNSLKYVPLVTGLASARNLEHLEMVRVPFLGGLIQH
FT                   VVEDSWRSGGFRNLHTIVLGACKNALEVDLGYLIITAARRLHEVRIQPSLTKDGVFSAL
FT                   KMAELEFPQFETLHLGYVDEFLLQSRMANADLVKYGLADVVENPGIITDIGMKAVNEVF
FT                   SCIKYLAIYNCPHLHNPYNWISDHSRWMRLVDINLVRCHALKLDSFGQFVELLPSLEFI
FT                   SLDQMFREPPKGCARVGLSAGTGIGVSSALVSNQNSNNDNDNNAPNNNANLHDNNHHHP
FT                   DDSDDDNDFRPDLQAGEAQFAADALNEMEDMVQEDGELVAESGNGMPAHNREVLPVDAD
FT                   EEQAGPSGLQRVVKPTPIADHDSESDDEEDSLELQEVWAPKNGTRRYSEREEKTGDSGQ
FT                   SRETAVSGKGKTPLRKRCNNSHQMGQAKPFPLEESSCEKGCQVTSEQIKADMKAARDVS
FT                   EKKKSKDVYPSCSSSSSSTAASTAGNASSPSTASQSPDFARTVTSSGSSEPSPPEVDVS
FT                   RQCVCSPGGSEDSEAMEEGDAESSVCPRCCCLRPQESQRRTGRCSDEERPSTSRACVVN
FT                   GADGTRSAFSFRTLPQGGSSGPAHDERTNGSGCGATGEDRRGSSQPESCDVQSNEDYPR
FT                   RPLTRARSRLSHVPLISESEVAKTKPCHAMKRKRTADKSTSTSDPVIEDDHVQVLVLKS
FT                   KNLVGVTMTNCGITDLVLKDCPKMMFIHATRCRVLKHLKVENAPIVNRFDYAQCKKLNM
FT                   DQVLDQILRMPPERNRIIYLRPMQQVDTLTLEQKLFSGPYPYHICIIHEFSNPPNVRNK
FT                   VRIRNWMDTIANINQELIKYEFFLEATRTEEDLKKYPKYPWGREIYTLEGVVDGAPYSM
FT                   ISDFPWLRSLRTAEPNSFARYDFEDDEESTIYAPRRKGQLSADICMETIGEEISEMRQM
FT                   KRGIFQRVVAIFIHYCDVNGEPVEDDYI"
FT   CDS             complement(join(25143385..25143563,25144157..25144270,
FT                   25144620..25144723,25145286..25145431,25146516..25146682,
FT                   25149395..25149497,25149699..25149799,25153451..25154200,
FT                   25155626..25155805,25157144..25157263,25158406..25158619,
FT                   25159335..25159477,25161002..25161172,25164786..25164916,
FT                   25165831..25165924,25168204..25168341,25169341..25169478,
FT                   25172159..25172324,25172550..25172713,25174562..25174695,
FT                   25181406..25181533))
FT                   /codon_start=1
FT                   /gene="Fbxo38"
FT                   /locus_tag="mCG_124663"
FT                   /product="F-box protein 38, isoform CRA_a"
FT                   /note="gene_id=mCG124663.1 transcript_id=mCT173833.0
FT                   protein_id=mCP96751.0 isoform=CRA_a"
FT                   /protein_id="EDL09740.1"
FT                   /translation="MGPRKKSAKVCVMDSEVAEEMTADEEKDYMNQLSHEVLCHIFRYL
FT                   PLQDIMCMECLSRKLKEAVTLYLRVVRVVDLCAGRWWEYMPSGFTDSSFLTLLKKMPDV
FT                   EQLYGLHPRYLERRRVRGQEAFSIPGVLEALQACPNLVGVETSHLELVESIWTYMPHVH
FT                   ILGKFRNRNGAFPIPPENKLKIPIGAKIQTLHLVGVNVPEIPCIPMLRHLYMKWVRLTK
FT                   PQPFKDFLCISLRTFVMRNCAGPTNSLKYVPLVTGLASARNLEHLEMVRVPFLGGLIQH
FT                   VVEDSWRSGGFRNLHTIVLGACKNALEVDLGYLIITAARRLHEVRIQPSLTKDGVFSAL
FT                   KMAELEFPQFETLHLGYVDEFLLQSRMANADLVKYGLADVVENPGIITDIGMKAVNEVF
FT                   SCIKYLAIYNCPHLHNPYNWISDHSRWMRLVDINLVRCHALKLDSFGQFVELLPSLEFI
FT                   SLDQMFREPPKGCARVGLSAGTGIGVSSALVSNQNSNNDNDNNAPNNNANLHDNNHHHP
FT                   DDSDDDNDFRPDLQAGEAQFAADALNEMEDMVQEDGELVAESGNGMPAHNREVLPVDAD
FT                   EEQAGPSGLQRVVKPTPIADHDSESDDEEDSLELQEVWAPKNGTRRYSEREEKTGDSGQ
FT                   SRETAVSGKGKTPLRKRCNNSHQMGQAKPFPLEESSCEKGCQVTSEQIKADMKAARDVS
FT                   EKKKSKDVYPSCSSSSSSTAASTAGNASSPSTASQSPDFARTVTSSGSSEPSPPEVDVS
FT                   RQCVCSPGGSEDSEAMEEGDAESSVCPRCCCLRPQESQRRTGRCSDEERPSTSRACVVN
FT                   GADGTRSAFSFRTLPQGGSSGPAHDERTNGSGCGATGEDRRGSSQPESCDVQSNEDYPR
FT                   RPLTRARSRLSHVPLISESEVAKTKPCHAMKRKRTADKSTSTSDPVIEDDHVQVLVLKS
FT                   KNLVGVTMTNCGITDLVLKDCPKMMFIHATRCRVLKHLKVENAPIVNRFDYAQCKKLNM
FT                   DQVLDQILRMPPERNRIIYLRPMQQVDTLTLEQKLFSGPYPYHICIIHEFSNPPNVRNK
FT                   VRIRNWMDTIANINQELIKYEFFLEATRTEEDLKKYPKYPWGREIYTLEGVVDGAPYSM
FT                   ISDFPWLRSLRTAEPNSFARYDFEDDEESTIYAPRRKGQLSADICMETIGEEISEMRQM
FT                   KRGIFQRVVAIFIHYCDVNGEPVEDDYI"
FT   CDS             complement(join(25143385..25143563,25144157..25144270,
FT                   25144620..25144723,25145286..25145431,25146516..25146682,
FT                   25149395..25149497,25149699..25149799,25153451..25154200,
FT                   25155626..25155805,25157144..25157263,25158406..25158619,
FT                   25159335..25159477,25160000..25160021))
FT                   /codon_start=1
FT                   /gene="Fbxo38"
FT                   /locus_tag="mCG_124663"
FT                   /product="F-box protein 38, isoform CRA_b"
FT                   /note="gene_id=mCG124663.1 transcript_id=mCT173832.0
FT                   protein_id=mCP96752.0 isoform=CRA_b"
FT                   /protein_id="EDL09739.1"
FT                   /translation="MKVSSSQDHSRWMRLVDINLVRCHALKLDSFGQFVELLPSLEFIS
FT                   LDQMFREPPKGCARVGLSAGTGIGVSSALVSNQNSNNDNDNNAPNNNANLHDNNHHHPD
FT                   DSDDDNDFRPDLQAGEAQFAADALNEMEDMVQEDGELVAESGNGMPAHNREVLPVDADE
FT                   EQAGPSGLQRVVKPTPIADHDSESDDEEDSLELQEVWAPKNGTRRYSEREEKTGDSGQS
FT                   RETAVSGKGKTPLRKRCNNSHQMGQAKPFPLEESSCEKGCQVTSEQIKADMKAARDVSE
FT                   KKKSKDVYPSCSSSSSSTAASTAGNASSPSTASQSPDFARTVTSSGSSEPSPPEVDVSR
FT                   QCVCSPGGSEDSEAMEEGDAESSVCPRCCCLRPQESQRRTGRCSDEERPSTSRACVVNG
FT                   ADGTRSAFSFRTLPQGGSSGPAHDERTNGSGCGATGEDRRGSSQPESCDVQSNEDYPRR
FT                   PLTRARSRLSHVPLISESEVAKTKPCHAMKRKRTADKSTSTSDPVIEDDHVQVLVLKSK
FT                   NLVGVTMTNCGITDLVLKDCPKMMFIHATRCRVLKHLKVENAPIVNRFDYAQCKKLNMD
FT                   QVLDQILRMPPERNRIIYLRPMQQVDTLTLEQKLFSGPYPYHICIIHEFSNPPNVRNKV
FT                   RIRNWMDTIANINQELIKYEFFLEATRTEEDLKKYPKYPWGREIYTLEGVVDGAPYSMI
FT                   SDFPWLRSLRTAEPNSFARYDFEDDEESTIYAPRRKGQLSADICMETIGEEISEMRQMK
FT                   RGIFQRVVAIFIHYCDVNGEPVEDDYI"
FT   gene            25190083..25299316
FT                   /gene="A230091H23Rik"
FT                   /locus_tag="mCG_65960"
FT                   /note="gene_id=mCG65960.2"
FT   mRNA            join(25190083..25190253,25288189..25288249,
FT                   25288768..25288841,25289666..25289697,25291335..25291450,
FT                   25295806..25295882,25296762..25296799,25297821..25297936,
FT                   25298891..25299316)
FT                   /gene="A230091H23Rik"
FT                   /locus_tag="mCG_65960"
FT                   /product="RIKEN cDNA A230091H23, transcript variant
FT                   mCT66143"
FT                   /note="gene_id=mCG65960.2 transcript_id=mCT66143.2 created
FT                   on 04-OCT-2002"
FT   mRNA            join(25190083..25190253,25288189..25288249,
FT                   25288768..25288841,25289666..25289697,25290114..25290267)
FT                   /gene="A230091H23Rik"
FT                   /locus_tag="mCG_65960"
FT                   /product="RIKEN cDNA A230091H23, transcript variant
FT                   mCT173933"
FT                   /note="gene_id=mCG65960.2 transcript_id=mCT173933.0 created
FT                   on 04-OCT-2002"
FT   mRNA            join(<25190112..25190253,25288189..25288249,
FT                   25288768..25288841,25289666..25289697,25291335..25291450,
FT                   25295806..25295882,25296762..25296799,25297825..>25297938)
FT                   /gene="A230091H23Rik"
FT                   /locus_tag="mCG_65960"
FT                   /product="RIKEN cDNA A230091H23, transcript variant
FT                   mCT190264"
FT                   /note="gene_id=mCG65960.2 transcript_id=mCT190264.0 created
FT                   on 08-MAR-2004"
FT   gene            complement(<25232100..25235948)
FT                   /gene="Ecg2"
FT                   /locus_tag="mCG_1050966"
FT                   /note="gene_id=mCG1050966.0"
FT   mRNA            complement(join(<25232100..25232145,25233924..25234048,
FT                   25235888..25235948))
FT                   /gene="Ecg2"
FT                   /locus_tag="mCG_1050966"
FT                   /product="esophagus cancer-related gene-2"
FT                   /note="gene_id=mCG1050966.0 transcript_id=mCT194755.0
FT                   created on 27-JAN-2005"
FT   CDS             complement(join(25232100..25232145,25233924..25234048,
FT                   25235888..25235905))
FT                   /codon_start=1
FT                   /gene="Ecg2"
FT                   /locus_tag="mCG_1050966"
FT                   /product="esophagus cancer-related gene-2"
FT                   /note="gene_id=mCG1050966.0 transcript_id=mCT194755.0
FT                   protein_id=mCP115786.0"
FT                   /protein_id="EDL09737.1"
FT                   /translation="MSATALVDCDIYKKYPVVAIPCPIVNIPVCGSDYITYGNKCKLCT
FT                   EILRSNGKIQFLHEGHC"
FT   gene            complement(25250424..25382025)
FT                   /locus_tag="mCG_59945"
FT                   /note="gene_id=mCG59945.2"
FT   mRNA            complement(join(25250424..25250662,25250917..25251044,
FT                   25251674..25251711,25257800..25257895,25381865..25382025))
FT                   /locus_tag="mCG_59945"
FT                   /product="mCG59945"
FT                   /note="gene_id=mCG59945.2 transcript_id=mCT60128.2 created
FT                   on 04-OCT-2002"
FT   CDS             complement(join(25250614..25250662,25250917..25251044,
FT                   25251674..25251711,25257800..25257878))
FT                   /codon_start=1
FT                   /locus_tag="mCG_59945"
FT                   /product="mCG59945"
FT                   /note="gene_id=mCG59945.2 transcript_id=mCT60128.2
FT                   protein_id=mCP41512.2"
FT                   /protein_id="EDL09732.1"
FT                   /translation="MKRSGCWHQRMLLSLVLLTWTHVTFSALIRSHNFSRWPKPPCKMY
FT                   YPIDPDYEANCPDVKAYVCATNGLTYKNECFFCIDRWEFGPHIQFVKYGKCE"
FT   CDS             join(<25288769..25288841,25289666..25289697,
FT                   25291335..25291450,25295806..25295882,25296762..25296799,
FT                   25297825..>25297938)
FT                   /codon_start=1
FT                   /gene="A230091H23Rik"
FT                   /locus_tag="mCG_65960"
FT                   /product="RIKEN cDNA A230091H23, isoform CRA_c"
FT                   /note="gene_id=mCG65960.2 transcript_id=mCT190264.0
FT                   protein_id=mCP111292.0 isoform=CRA_c"
FT                   /protein_id="EDL09735.1"
FT                   /translation="FAQMKLSSLWSNAFVINVAIALYAETAFLSAPKLKIDCRPYLDSN
FT                   DKCTREYHPVCSTSGKTYCNKCTFCKALRLDTMSSSLLWIKITFILALVVPFYYGTTFA
FT                   FSKEARRQIATSTEHSQTSVPENGTQSVGLMDSLTATSVFSATQRC"
FT   CDS             join(25288778..25288841,25289666..25289697,
FT                   25291335..25291450,25295806..25295882,25296762..25296799,
FT                   25297821..25297936,25298891..25298936)
FT                   /codon_start=1
FT                   /gene="A230091H23Rik"
FT                   /locus_tag="mCG_65960"
FT                   /product="RIKEN cDNA A230091H23, isoform CRA_d"
FT                   /note="gene_id=mCG65960.2 transcript_id=mCT66143.2
FT                   protein_id=mCP41524.2 isoform=CRA_d"
FT                   /protein_id="EDL09736.1"
FT                   /translation="MKLSSLWSNAFVINVAIALYAETAFLSAPKLKIDCRPYLDSNDKC
FT                   TREYHPVCSTSGKTYCNKCTFCKALRLDTMSSSLLWIKITFILALVVPFYYGTTFAFSK
FT                   EARRQPDCDKYRTFPNQCTREWNPVCGTNGFTYSNECVFCNAKIAAKEKIDYRHFGPC"
FT   CDS             join(25288778..25288841,25289666..25289697,
FT                   25290114..25290248)
FT                   /codon_start=1
FT                   /gene="A230091H23Rik"
FT                   /locus_tag="mCG_65960"
FT                   /product="RIKEN cDNA A230091H23, isoform CRA_b"
FT                   /note="gene_id=mCG65960.2 transcript_id=mCT173933.0
FT                   protein_id=mCP96852.0 isoform=CRA_b"
FT                   /protein_id="EDL09734.1"
FT                   /translation="MKLSSLWSNAFVINVAIALYAETAFLSAPKLKTHQKRASDPIADA
FT                   WEPPCGCWKLNSRPLEEQSVLLITEPSLQPK"
FT   mRNA            join(25295303..25295354,25295806..25295882,
FT                   25296762..25296799,25297821..25297936,25298891..25299188)
FT                   /gene="A230091H23Rik"
FT                   /locus_tag="mCG_65960"
FT                   /product="RIKEN cDNA A230091H23, transcript variant
FT                   mCT173932"
FT                   /note="gene_id=mCG65960.2 transcript_id=mCT173932.0 created
FT                   on 04-OCT-2002"
FT   CDS             join(25295816..25295882,25296762..25296799,
FT                   25297821..25297936,25298891..25298936)
FT                   /codon_start=1
FT                   /gene="A230091H23Rik"
FT                   /locus_tag="mCG_65960"
FT                   /product="RIKEN cDNA A230091H23, isoform CRA_a"
FT                   /note="gene_id=mCG65960.2 transcript_id=mCT173932.0
FT                   protein_id=mCP96851.0 isoform=CRA_a"
FT                   /db_xref="GOA:E0CXG7"
FT                   /db_xref="InterPro:IPR001239"
FT                   /db_xref="InterPro:IPR002350"
FT                   /db_xref="MGI:MGI:3584533"
FT                   /db_xref="UniProtKB/TrEMBL:E0CXG7"
FT                   /protein_id="EDL09733.1"
FT                   /translation="MSSSLLWIKITFILALVVPFYYGTTFAFSKEARRQPDCDKYRTFP
FT                   NQCTREWNPVCGTNGFTYSNECVFCNAKIAAKEKIDYRHFGPC"
FT   gene            complement(25392502..25398220)
FT                   /locus_tag="mCG_55779"
FT                   /note="gene_id=mCG55779.2"
FT   mRNA            complement(join(25392502..25394159,25396997..25397045,
FT                   25397795..25398147))
FT                   /locus_tag="mCG_55779"
FT                   /product="mCG55779, transcript variant mCT55962"
FT                   /note="gene_id=mCG55779.2 transcript_id=mCT55962.1 created
FT                   on 10-MAR-2003"
FT   CDS             complement(join(25394091..25394159,25396997..25397045,
FT                   25397795..25397976))
FT                   /codon_start=1
FT                   /locus_tag="mCG_55779"
FT                   /product="mCG55779, isoform CRA_b"
FT                   /note="gene_id=mCG55779.2 transcript_id=mCT55962.1
FT                   protein_id=mCP41550.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q8BT94"
FT                   /db_xref="MGI:MGI:1919803"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BT94"
FT                   /protein_id="EDL09731.1"
FT                   /translation="MRAAQAGASFHPAALKATGGQGAGRNPVMAGENKQAWSRKPSPLQ
FT                   RTTLQPPQLQECLLTRSRLTEDNEAGENLNSLGLPEQAFITMPHLQQWTTLLEL"
FT   mRNA            complement(join(25396663..25397045,25397795..25398220))
FT                   /locus_tag="mCG_55779"
FT                   /product="mCG55779, transcript variant mCT181049"
FT                   /note="gene_id=mCG55779.2 transcript_id=mCT181049.0 created
FT                   on 10-MAR-2003"
FT   CDS             complement(join(25396826..25397045,25397795..25397976))
FT                   /codon_start=1
FT                   /locus_tag="mCG_55779"
FT                   /product="mCG55779, isoform CRA_a"
FT                   /note="gene_id=mCG55779.2 transcript_id=mCT181049.0
FT                   protein_id=mCP103971.0 isoform=CRA_a"
FT                   /db_xref="GOA:G3X976"
FT                   /db_xref="MGI:MGI:1919803"
FT                   /db_xref="UniProtKB/TrEMBL:G3X976"
FT                   /protein_id="EDL09730.1"
FT                   /translation="MRAAQAGASFHPAALKATGGQGAGRNPVMAGENKQAWSRKPSPLQ
FT                   RTTLQPPQLQECLLTRSRLTEDNEAGENLNSLVREGTGIEGIRKGLCQFGSLIQGPGLP
FT                   DPAVGKLSGCTSTLCTHRAPGAVVGSCWH"
FT   gene            25565738..25597712
FT                   /locus_tag="mCG_124661"
FT                   /note="gene_id=mCG124661.1"
FT   mRNA            join(25565738..25566155,25577472..25577655,
FT                   25580503..25581034,25593781..25594102,25595736..25596090,
FT                   25596316..25597712)
FT                   /locus_tag="mCG_124661"
FT                   /product="mCG124661"
FT                   /note="gene_id=mCG124661.1 transcript_id=mCT125909.1
FT                   created on 04-OCT-2002"
FT   CDS             join(25566098..25566155,25577472..25577655,
FT                   25580503..25581034,25593781..25594102,25595736..25596090,
FT                   25596316..25596403)
FT                   /codon_start=1
FT                   /locus_tag="mCG_124661"
FT                   /product="mCG124661"
FT                   /note="gene_id=mCG124661.1 transcript_id=mCT125909.1
FT                   protein_id=mCP77384.0"
FT                   /protein_id="EDL09729.1"
FT                   /translation="MSRVRRLLLGYLFPALLLHGLGEGSALLHPDSRSHPRSLEKSAWR
FT                   AFKESQCHHMLKHLHNGARITVQMPPTIEGHWVSTGCEVRSGPEFMTRSYRFYNNNTFK
FT                   AYQFYYGSNRCTNPTYTLIIRGKIRLRQASWIIRGGTEADYQLHGVQVICHTEAVAEQL
FT                   SRLVNRTCPGFLAPGGPWVQDVAYDLWQEESNHECTKAVNFAMHELQLIRVEKQYPHHS
FT                   LDHLVEELFLGDIHTDATQRVFYRPSSYQPPLQNAKNHNHACIACRIIFRSDEHHPPIL
FT                   PPKADLTIGLHGEWVSQRCEVRPEVLFLTRHFIFHDNNNTWEGHYYHYSDPVCKHPTFT
FT                   IYARGRYSRGVLSSKVMGGTEFVFKVNHMKVTPMDAATASLLNVFSGNECGAEGSWQVG
FT                   IQQDVTHTNGCVALGIKLPHTEYEIFKMEQDTRGRYLLFNGQRPSDGSSPDRPEKRATS
FT                   YQMPLVQCASSSPRAEELLEDSQGHLLCAMSSVFEVSALNVFPPDPWPENFIEV"
FT   gene            25621553..25643356
FT                   /locus_tag="mCG_21812"
FT                   /note="gene_id=mCG21812.2"
FT   mRNA            join(25621553..25621720,25624162..25624229,
FT                   25626315..25626420,25627738..25627766,25629875..25629984,
FT                   25630107..25630173,25630651..25630721,25635499..25635577,
FT                   25638204..25638283,25638860..25638989,25640724..25643356)
FT                   /locus_tag="mCG_21812"
FT                   /product="mCG21812, transcript variant mCT173893"
FT                   /note="gene_id=mCG21812.2 transcript_id=mCT173893.0 created
FT                   on 04-OCT-2002"
FT   mRNA            join(25621559..25621720,25624162..25624229,
FT                   25626315..25626399,25627070..25627087,25627736..25627766,
FT                   25629875..25629984,25630107..25630173,25630651..25630721,
FT                   25635499..25635577,25638204..25638283,25638860..25638989,
FT                   25640724..25643356)
FT                   /locus_tag="mCG_21812"
FT                   /product="mCG21812, transcript variant mCT21244"
FT                   /note="gene_id=mCG21812.2 transcript_id=mCT21244.2 created
FT                   on 04-OCT-2002"
FT   mRNA            join(25621594..25621720,25624162..25624229,
FT                   25626315..25626354,25630107..25630173,25630651..25630721,
FT                   25635499..25635577,25638204..25638283,25638860..25638989,
FT                   25640724..25643355)
FT                   /locus_tag="mCG_21812"
FT                   /product="mCG21812, transcript variant mCT173892"
FT                   /note="gene_id=mCG21812.2 transcript_id=mCT173892.0 created
FT                   on 04-OCT-2002"
FT   mRNA            join(25621617..25621720,25624162..25624229,
FT                   25626315..25626408,25627736..25627766,25629875..25629984,
FT                   25630107..25630173,25630651..25630721,25635499..25635577,
FT                   25638204..25638283,25638860..25638989,25640724..25643356)
FT                   /locus_tag="mCG_21812"
FT                   /product="mCG21812, transcript variant mCT173895"
FT                   /note="gene_id=mCG21812.2 transcript_id=mCT173895.0 created
FT                   on 04-OCT-2002"
FT   mRNA            join(25621655..25621720,25624162..25624229,
FT                   25626315..25626408,25627736..25627766,25629875..25629984,
FT                   25630107..25630173,25630651..25630721,25635499..25635691)
FT                   /locus_tag="mCG_21812"
FT                   /product="mCG21812, transcript variant mCT173894"
FT                   /note="gene_id=mCG21812.2 transcript_id=mCT173894.0 created
FT                   on 04-OCT-2002"
FT   CDS             join(25621665..25621720,25624162..25624229,
FT                   25626315..25626408,25627736..25627766,25629875..25629984,
FT                   25630107..25630173,25630651..25630721,25635499..25635577,
FT                   25638204..25638283,25638860..25638989,25640724..25640867)
FT                   /codon_start=1
FT                   /locus_tag="mCG_21812"
FT                   /product="mCG21812, isoform CRA_c"
FT                   /note="gene_id=mCG21812.2 transcript_id=mCT173895.0
FT                   protein_id=mCP96812.0 isoform=CRA_c"
FT                   /protein_id="EDL09726.1"
FT                   /translation="MAAQKINEGLEHLAKAEKYLKTGFLKWKPDYDSAASEYGKAAVAF
FT                   KNAKQFEQAKDACLREAVAHENNRAYLLAYEQAGMMLKEMQKLPEAVQLIEKASMMYLE
FT                   NGTPDTAAMALERAGKLIENVDPEKAVQLYQQTANVFENEERLRQAVELLGKASRLLVR
FT                   GRRFDEAALSIQKEKNIYKEIENYPTCYKKTIAQVLVHLHRNDYVAAERCVRESYSIPG
FT                   FNGSEDCAALEQLLEGYDQQDQDQVSEVCNSPLFKYMDNDYAKLGLSLVVPGGGIKKKS
FT                   PATPQAKPDGAAGMAAEEEEDEYSGGLC"
FT   CDS             join(25621665..25621720,25624162..25624229,
FT                   25626315..25626399,25627070..25627087,25627736..25627766,
FT                   25629875..25629984,25630107..25630173,25630651..25630721,
FT                   25635499..25635577,25638204..25638283,25638860..25638989,
FT                   25640724..25640867)
FT                   /codon_start=1
FT                   /locus_tag="mCG_21812"
FT                   /product="mCG21812, isoform CRA_e"
FT                   /note="gene_id=mCG21812.2 transcript_id=mCT21244.2
FT                   protein_id=mCP21512.2 isoform=CRA_e"
FT                   /protein_id="EDL09728.1"
FT                   /translation="MAAQKINEGLEHLAKAEKYLKTGFLKWKPDYDSAASEYGKAAVAF
FT                   KNAKQFEQAKDACLREAVAHENNRALFHAAKAYEQAGMMLKEMQKLPEAVQLIEKASMM
FT                   YLENGTPDTAAMALERAGKLIENVDPEKAVQLYQQTANVFENEERLRQAVELLGKASRL
FT                   LVRGRRFDEAALSIQKEKNIYKEIENYPTCYKKTIAQVLVHLHRNDYVAAERCVRESYS
FT                   IPGFNGSEDCAALEQLLEGYDQQDQDQVSEVCNSPLFKYMDNDYAKLGLSLVVPGGGIK
FT                   KKSPATPQAKPDGAAGMAAEEEEDEYSGGLC"
FT   CDS             join(25621665..25621720,25624162..25624229,
FT                   25626315..25626354,25630107..25630173,25630651..25630721,
FT                   25635499..25635577,25638204..25638283,25638860..25638989,
FT                   25640724..25640867)
FT                   /codon_start=1
FT                   /locus_tag="mCG_21812"
FT                   /product="mCG21812, isoform CRA_a"
FT                   /note="gene_id=mCG21812.2 transcript_id=mCT173892.0
FT                   protein_id=mCP96811.0 isoform=CRA_a"
FT                   /protein_id="EDL09724.1"
FT                   /translation="MAAQKINEGLEHLAKAEKYLKTGFLKWKPDYDSAASEYGKAAVAF
FT                   KNAKQFEQAKLIENVDPEKAVQLYQQTANVFENEERLRQAVELLGKASRLLVRGRRFDE
FT                   AALSIQKEKNIYKEIENYPTCYKKTIAQVLVHLHRNDYVAAERCVRESYSIPGFNGSED
FT                   CAALEQLLEGYDQQDQDQVSEVCNSPLFKYMDNDYAKLGLSLVVPGGGIKKKSPATPQA
FT                   KPDGAAGMAAEEEEDEYSGGLC"
FT   CDS             join(25621665..25621720,25624162..25624229,
FT                   25626315..25626408,25627736..25627766,25629875..25629984,
FT                   25630107..25630173,25630651..25630721,25635499..25635598)
FT                   /codon_start=1
FT                   /locus_tag="mCG_21812"
FT                   /product="mCG21812, isoform CRA_d"
FT                   /note="gene_id=mCG21812.2 transcript_id=mCT173894.0
FT                   protein_id=mCP96814.0 isoform=CRA_d"
FT                   /protein_id="EDL09727.1"
FT                   /translation="MAAQKINEGLEHLAKAEKYLKTGFLKWKPDYDSAASEYGKAAVAF
FT                   KNAKQFEQAKDACLREAVAHENNRAYLLAYEQAGMMLKEMQKLPEAVQLIEKASMMYLE
FT                   NGTPDTAAMALERAGKLIENVDPEKAVQLYQQTANVFENEERLRQAVELLGKASRLLVR
FT                   GRRFDEAALSIQKEKNIYKEIENYPTCYKVFFENA"
FT   CDS             join(25624197..25624229,25626315..25626420,
FT                   25627738..25627766,25629875..25629984,25630107..25630173,
FT                   25630651..25630721,25635499..25635577,25638204..25638283,
FT                   25638860..25638989,25640724..25640867)
FT                   /codon_start=1
FT                   /locus_tag="mCG_21812"
FT                   /product="mCG21812, isoform CRA_b"
FT                   /note="gene_id=mCG21812.2 transcript_id=mCT173893.0
FT                   protein_id=mCP96813.0 isoform=CRA_b"
FT                   /protein_id="EDL09725.1"
FT                   /translation="MTVPLLNMGKQLLLLKMPNNLSKQRMPASGKLLPMKITGRIFFSL
FT                   KTYEQAGMMLKEMQKLPEAVQLIEKASMMYLENGTPDTAAMALERAGKLIENVDPEKAV
FT                   QLYQQTANVFENEERLRQAVELLGKASRLLVRGRRFDEAALSIQKEKNIYKEIENYPTC
FT                   YKKTIAQVLVHLHRNDYVAAERCVRESYSIPGFNGSEDCAALEQLLEGYDQQDQDQVSE
FT                   VCNSPLFKYMDNDYAKLGLSLVVPGGGIKKKSPATPQAKPDGAAGMAAEEEEDEYSGGL
FT                   C"
FT   gene            complement(25653745..>25683720)
FT                   /locus_tag="mCG_21814"
FT                   /note="gene_id=mCG21814.3"
FT   mRNA            complement(join(25653745..25655331,25656165..25656348,
FT                   25658864..25658943,25660619..25660747,25662307..25662479,
FT                   25663733..25663825,25664260..25664448,25665515..25665662,
FT                   25667529..25667687,25670331..25670545,25670650..25670797,
FT                   25671869..25672001,25673089..25673341,25675655..25675837,
FT                   25683545..>25683720))
FT                   /locus_tag="mCG_21814"
FT                   /product="mCG21814, transcript variant mCT21246"
FT                   /note="gene_id=mCG21814.3 transcript_id=mCT21246.3 created
FT                   on 04-JUN-2004"
FT   CDS             complement(join(25655079..25655331,25656165..25656348,
FT                   25658864..25658943,25660619..25660747,25662307..25662479,
FT                   25663733..25663825,25664260..25664448,25665515..25665662,
FT                   25667529..25667687,25670331..25670545,25670650..25670797,
FT                   25671869..25672001,25673089..25673341,25675655..25675837,
FT                   25683545..>25683718))
FT                   /codon_start=1
FT                   /locus_tag="mCG_21814"
FT                   /product="mCG21814, isoform CRA_b"
FT                   /note="gene_id=mCG21814.3 transcript_id=mCT21246.3
FT                   protein_id=mCP21521.3 isoform=CRA_b"
FT                   /protein_id="EDL09723.1"
FT                   /translation="NTLVARSEMVCYFVIILNHMTSASIITLLLPILIFLWAMLSVPRP
FT                   SRRFWMMAIVYTEVAIVVKYFFQFGFFPWNKDLEIYKERPYFPPNIIGVEKKEGYVLYD
FT                   LIQLLALFFHRSILKCHGLWDEDDIVDSNTDKEGSDDELSLDQGRRGSSDSLKSINLAA
FT                   SVESVHVTFPEQPAAIRRKRSCSSSQISPRSSFSSNRSKRGSTSTRNSSQKGSSVLSLK
FT                   QKSKRELYMEKLQEHLIKAKAFTIKKTLQIYVPIRQFFYDLIHPDYSAVTDVYVLMFLA
FT                   DTVDFIIIVFGFWAFGKHSAAADITSSLSEDQVPGPFLVMVLIQFGTMVVDRALYLRKT
FT                   VLGKVIFQVILVFGIHFWMFFILPGVTERKFSQNLVAQLWYFVKCVYFGLSAYQIRCGY
FT                   PTRVLGNFLTKSYNYVNLFLFQGFRLVPFLTELRAVMDWVWTDTTLSLSSWICVEDIYA
FT                   HIFILKCWRESEKRYPQPRGQKKKKAVKYGMGGMIIVLLICIVWFPLLFMSLIKSVAGV
FT                   INQPLDVSVTITLGGYQPIFTMSAQQSQLKVMDNSKYNEFLKSFGPNSGAMQFLENYER
FT                   EDVTVAELEGNSNSLWTISPPSKQKMIQELTDPNSCFSVVFSWSIQRNMTLGAKAEIAT
FT                   DKLSFPLAVATRNSIAKMIAGNDTESSNTPVTIEKIYPYYVKAPSDSNSKPIKQLLSEN
FT                   NFMNITIILFRDNVTKSNSEWWVLNLTGSRIFNQGSQALELVVFNDKVSPPSLGFLAGY
FT                   GIMGLYASVVLVIGKFVREFFSGISHSIMFEELPNVDRILKLCTDIFLVRETGELELEE
FT                   DLYAKLIFLYRSPETMIKWTREKTN"
FT   mRNA            complement(join(25662567..25663825,25664260..25665662,
FT                   25667529..25667687,25670331..25670545,25670650..25670797,
FT                   25671869..25672001,25673089..25673341,25675655..25675837,
FT                   25683545..>25683720))
FT                   /locus_tag="mCG_21814"
FT                   /product="mCG21814, transcript variant mCT173897"
FT                   /note="gene_id=mCG21814.3 transcript_id=mCT173897.1 created
FT                   on 04-JUN-2004"
FT   CDS             complement(join(25665368..25665662,25667529..25667687,
FT                   25670331..25670545,25670650..25670797,25671869..25672001,
FT                   25673089..25673341,25675655..25675837,25683545..>25683718))
FT                   /codon_start=1
FT                   /locus_tag="mCG_21814"
FT                   /product="mCG21814, isoform CRA_a"
FT                   /note="gene_id=mCG21814.3 transcript_id=mCT173897.1
FT                   protein_id=mCP96816.1 isoform=CRA_a"
FT                   /protein_id="EDL09722.1"
FT                   /translation="NTLVARSEMVCYFVIILNHMTSASIITLLLPILIFLWAMLSVPRP
FT                   SRRFWMMAIVYTEVAIVVKYFFQFGFFPWNKDLEIYKERPYFPPNIIGVEKKEGYVLYD
FT                   LIQLLALFFHRSILKCHGLWDEDDIVDSNTDKEGSDDELSLDQGRRGSSDSLKSINLAA
FT                   SVESVHVTFPEQPAAIRRKRSCSSSQISPRSSFSSNRSKRGSTSTRNSSQKGSSVLSLK
FT                   QKSKRELYMEKLQEHLIKAKAFTIKKTLQIYVPIRQFFYDLIHPDYSAVTDVYVLMFLA
FT                   DTVDFIIIVFGFWAFGKHSAAADITSSLSEDQVPGPFLVMVLIQFGTMVVDRALYLRKT
FT                   VLGKVIFQVILVFGIHFWMFFILPGVTERKFSQNLVAQLWYFVKCVYFGLSAYQIRCGY
FT                   PTRVLGNFLTKSYNYVNLFLFQGFRLVPFLTELRAVMDWVWTDTTLSLSSWICVEDIYA
FT                   HIFILKCWRESEKVKSRWKCLCPACRPRAQVCYKINMDTAWLVARWMEAGDTTCREPEI
FT                   QH"
FT   gene            complement(<25701741..26024255)
FT                   /locus_tag="mCG_21813"
FT                   /note="gene_id=mCG21813.3"
FT   mRNA            complement(join(<25701741..25701788,25706696..25706802,
FT                   25710927..25710998,25711979..25712100,25716690..25716855,
FT                   25717884..25717985,25718100..25718304,25719707..25719907,
FT                   25721192..25721317,25721606..25721782,25725887..25726047,
FT                   25727808..25728022,25737026..25737199,25741183..25741331,
FT                   25742980..25743275,25744869..25744992,25748878..25749108,
FT                   25749901..25750049,25752649..25752787,25753906..25753944,
FT                   25755886..25756005,25759229..25759391,25779554..25779767,
FT                   25781435..25781645,25791886..25792048,25817583..25817625,
FT                   25880406..25880531,25961523..25961618,26024002..26024255))
FT                   /locus_tag="mCG_21813"
FT                   /product="mCG21813, transcript variant mCT173896"
FT                   /note="gene_id=mCG21813.3 transcript_id=mCT173896.1 created
FT                   on 04-JUN-2004"
FT   CDS             complement(join(<25701741..25701788,25706696..25706802,
FT                   25710927..25710998,25711979..25712100,25716690..25716855,
FT                   25717884..25717985,25718100..25718304,25719707..25719907,
FT                   25721192..25721317,25721606..25721782,25725887..25726047,
FT                   25727808..25728022,25737026..25737199,25741183..25741331,
FT                   25742980..25743275,25744869..25744992,25748878..25749108,
FT                   25749901..25750049,25752649..25752787,25753906..25753944,
FT                   25755886..25756005,25759229..25759391,25779554..25779767,
FT                   25781435..25781645,25791886..25792048,25817583..25817625,
FT                   25880406..25880531,25961523..25961618,26024002..26024065))
FT                   /codon_start=1
FT                   /locus_tag="mCG_21813"
FT                   /product="mCG21813, isoform CRA_b"
FT                   /note="gene_id=mCG21813.3 transcript_id=mCT173896.1
FT                   protein_id=mCP96815.1 isoform=CRA_b"
FT                   /protein_id="EDL09721.1"
FT                   /translation="MASEVVCGLIFRLLLPICLAVACAFRYNGLSFVYLIYLLLIPLFS
FT                   EPTKATMQGHTGRLLQSLCITSLSFLLLHIIFHITLASLEAQHRITPAYNCSTWEKTFR
FT                   QIGFESLKGADAGNGIRVFVPDIGMFIASLTIWLVCRTIVKKPDTEEIAQLNSECENEE
FT                   LAGGEKMDSEEALIYEEDLDGEEGMEGELEESTKLKILRRFASVASKLKEFIGNMITTA
FT                   GKVVVTILLGSSGMMLPSLTSAVYFFVFLGLCTWWSWCRTFDPLLFGCLCVLLAIFTAG
FT                   HLIGLYLYQFQFFQEAVPPNDYYARLFGIKSVIQTDCASTWKIIVNPDLSWYHHANPIL
FT                   LLVMYYTLATLIRIWLQEPLVQEEMAKEDEGALDCSSNQNTAERRRSLWYATQYPTDER
FT                   KLLSMTQDDYKPSDGLLVTVNGNPVDYHTIHPSLPIENGPAKTDLYTTPQYRWEPSEES
FT                   SEKKEEEEDKREDSEGEGSQEEKRSVRMHAMVAVFQFIMKQSYICALIAMMAWSITYHS
FT                   WLTFVLLIWSCTLWMIRNRRKYAMISSPFMVVYANLLLVLQYIWSFELPEIKKVPGFLE
FT                   KKEPGELASKILFTITFWLLLRQHLTEQKALREKEALLSEVKIGSQELEEKDEELQDVQ
FT                   VEGEPTEKEEEEEEEIKEERHEVKKEEEEEVEEDDDQDIMKVLGNLVVALFIKYWIYVC
FT                   GGMFFFVSFEGKIVMYKIIYMVLFLFCVALYQVHYEWWRKILKYFWMSVVIYTMLVLIF
FT                   IYTYQFENFPGLWQNMTGLKKEKLEDLGLKQFTVAELFTRIFIPTSFLLVCILHLHYFH
FT                   DRFLELTDLKSIPSKEDNTIYRLAHPEGSLPDLAIMNMTASLDKPEVQKLAESGEERPE
FT                   ECVKKTEKGEAGKDSDESEEEEDEEEESEEEESSDLRNKWHLVIDRLTVLFLKFLEYFH
FT                   KLQVFMWWILELHIIKIVSSYIIWVTVKEVSLFNYVFLISWAFALPYAKLRRAASSVCT
FT                   VWTCVIIVCKMLYQLQTIKPENFSVNCSLPNENQTNIPLHELNKSLLYSAPVDPTEWVG
FT                   LRKSSPLLVYLRNNLLMLAILAFEVTVYRHQEYYRGRNNLTAPVSKTIFHDITRLHLDD
FT                   GLINCAKYFVNYFFYKFGLETCFLMSVNVIGQRMDFYAMIHACWLIGVLYRRRRKAIAE
FT                   VWPKYCCFLACIITFQYFVCIGIPPAPCRDYPWRFKGAYFNDNIIKWLYFPDFIVRPNP
FT                   VFLVYDFMLLLCASLQRQIFEDENKAAVRIMAGDNVEICMNLDAASFSQHNPVPDFIHC
FT                   RMDRIKARQQKYKKGKERMLSLTQESGEGQDIQKVSEEDDEREADKQKAKGKKKQWWRP
FT                   WVDHASMVRSGDYYLFETDSEEEEEEELKKEDEEPPRKSAFQFVYQAWITDPKTALRQ"
FT   mRNA            complement(join(25744527..25744629,25744869..25744992,
FT                   25748878..25749108,25749901..25750049,25752649..25752787,
FT                   25753906..25753944,25755886..25756005,25759229..25759391,
FT                   25779554..25779767,25781435..25781645,25791886..25792048,
FT                   25817583..25817625,25880406..25880531,25961523..25961618,
FT                   26024002..26024255))
FT                   /locus_tag="mCG_21813"
FT                   /product="mCG21813, transcript variant mCT21245"
FT                   /note="gene_id=mCG21813.3 transcript_id=mCT21245.3 created
FT                   on 04-JUN-2004"
FT   CDS             complement(join(25744577..25744629,25744869..25744992,
FT                   25748878..25749108,25749901..25750049,25752649..25752787,
FT                   25753906..25753944,25755886..25756005,25759229..25759391,
FT                   25779554..25779767,25781435..25781645,25791886..25792048,
FT                   25817583..25817625,25880406..25880531,25961523..25961618,
FT                   26024002..26024065))
FT                   /codon_start=1
FT                   /locus_tag="mCG_21813"
FT                   /product="mCG21813, isoform CRA_a"
FT                   /note="gene_id=mCG21813.3 transcript_id=mCT21245.3
FT                   protein_id=mCP21498.3 isoform=CRA_a"
FT                   /protein_id="EDL09720.1"
FT                   /translation="MASEVVCGLIFRLLLPICLAVACAFRYNGLSFVYLIYLLLIPLFS
FT                   EPTKATMQGHTGRLLQSLCITSLSFLLLHIIFHITLASLEAQHRITPAYNCSTWEKTFR
FT                   QIGFESLKGADAGNGIRVFVPDIGMFIASLTIWLVCRTIVKKPDTEEIAQLNSECENEE
FT                   LAGGEKMDSEEALIYEEDLDGEEGMEGELEESTKLKILRRFASVASKLKEFIGNMITTA
FT                   GKVVVTILLGSSGMMLPSLTSAVYFFVFLGLCTWWSWCRTFDPLLFGCLCVLLAIFTAG
FT                   HLIGLYLYQFQFFQEAVPPNDYYARLFGIKSVIQTDCASTWKIIVNPDLSWYHHANPIL
FT                   LLVMYYTLATLIRIWLQEPLVQEEMAKEDEGALDCSSNQNTAERRRSLWYATQYPTDER
FT                   KLLSMTQDDYKPSDGLLVTVNGNPVDYHTIHPSLPIENGPAKTDLYTTPQYRWEPSEES
FT                   SEKKEEEEDKREDSEGEGSQEEKRSVRMHAMVAVFQFIMKQSYICALIAMMAWSITYHS
FT                   WLTFVLLIWSCTLWMIRNRRKYAMISSPFMVVYANLLLVLQYIWSFELPEIKKVPGFLE
FT                   KKEPGELASKILFTITFWLLLRQHLTEQKALREKEALLSEVKIGSQELEEKEMLFPMKD
FT                   NTKCQRNFL"
FT   gene            complement(26173686..26175461)
FT                   /pseudo
FT                   /locus_tag="mCG_18051"
FT                   /note="gene_id=mCG18051.2"
FT   mRNA            complement(26173686..26175461)
FT                   /pseudo
FT                   /locus_tag="mCG_18051"
FT                   /note="gene_id=mCG18051.2 transcript_id=mCT19065.2 created
FT                   on 04-OCT-2002"
FT   gene            complement(26297032..26342544)
FT                   /gene="Txnl1"
FT                   /locus_tag="mCG_18056"
FT                   /note="gene_id=mCG18056.2"
FT   mRNA            complement(join(26297032..26298359,26305609..26305713,
FT                   26308076..26308248,26309465..26309534,26310900..26311022,
FT                   26313374..26313547,26316232..26316328,26326103..26326215))
FT                   /gene="Txnl1"
FT                   /locus_tag="mCG_18056"
FT                   /product="thioredoxin-like 1, transcript variant mCT19070"
FT                   /note="gene_id=mCG18056.2 transcript_id=mCT19070.2 created
FT                   on 03-OCT-2002"
FT   mRNA            complement(join(26297032..26298256,26308154..26308248,
FT                   26309465..26309534,26310900..26311022,26313374..26313547,
FT                   26316232..26316328,26326103..26326129))
FT                   /gene="Txnl1"
FT                   /locus_tag="mCG_18056"
FT                   /product="thioredoxin-like 1, transcript variant mCT173879"
FT                   /note="gene_id=mCG18056.2 transcript_id=mCT173879.0 created
FT                   on 03-OCT-2002"
FT   mRNA            complement(join(26298135..26298359,26305609..26305713,
FT                   26308076..26308248,26309465..26309534,26310900..26311022,
FT                   26313374..26313547,26316232..26316328,26342474..26342544))
FT                   /gene="Txnl1"
FT                   /locus_tag="mCG_18056"
FT                   /product="thioredoxin-like 1, transcript variant mCT173880"
FT                   /note="gene_id=mCG18056.2 transcript_id=mCT173880.0 created
FT                   on 03-OCT-2002"
FT   CDS             complement(join(26298191..26298256,26308154..26308248,
FT                   26309465..26309534,26310900..26311022,26313374..26313547,
FT                   26316232..26316328,26326103..26326110))
FT                   /codon_start=1
FT                   /gene="Txnl1"
FT                   /locus_tag="mCG_18056"
FT                   /product="thioredoxin-like 1, isoform CRA_b"
FT                   /note="gene_id=mCG18056.2 transcript_id=mCT173879.0
FT                   protein_id=mCP96798.0 isoform=CRA_b"
FT                   /protein_id="EDL09718.1"
FT                   /translation="MRGCGPCLRIAPAFSSMSNKYPQAVFLEVDVHQCQGTAATNNISA
FT                   TPTFLFFRNKVRIDQYQGADAVGLEEKIKQHLENDPGSNEDADIPKGYMDLMPFINKAG
FT                   CECLNESDEHGFDNCLRKDMSFLESDCDEQLLITVAFNQPVKLYSMKFQGPDNGQGPKY
FT                   VKIFINLPRSMDFEEAERSEPTQALETVNLLFVASTNKSLLLFRWHH"
FT   CDS             complement(join(26298330..26298359,26305609..26305713,
FT                   26308076..26308248,26309465..26309534,26310900..26311022,
FT                   26313374..26313547,26316232..26316328,26342474..26342481))
FT                   /codon_start=1
FT                   /gene="Txnl1"
FT                   /locus_tag="mCG_18056"
FT                   /product="thioredoxin-like 1, isoform CRA_c"
FT                   /note="gene_id=mCG18056.2 transcript_id=mCT173880.0
FT                   protein_id=mCP96799.0 isoform=CRA_c"
FT                   /protein_id="EDL09719.1"
FT                   /translation="MERCGPCLRIAPAFSSMSNKYPQAVFLEVDVHQCQGTAATNNISA
FT                   TPTFLFFRNKVRIDQYQGADAVGLEEKIKQHLENDPGSNEDADIPKGYMDLMPFINKAG
FT                   CECLNESDEHGFDNCLRKDMSFLESDCDEQLLITVAFNQPVKLYSMKFQGPDNGQGPKY
FT                   VKIFINLPRSMDFEEAERSEPTQALELTEDDIKEDGIVPLRYVKFQNVNSVTLFVQSNQ
FT                   GEEETTRISYFTFIGTPVQATNMNDFKRVVGKKGESH"
FT   CDS             complement(join(26298330..26298359,26305609..26305713,
FT                   26308076..26308248,26309465..26309534,26310900..26311022,
FT                   26313374..26313547,26316232..26316328,26326103..26326200))
FT                   /codon_start=1
FT                   /gene="Txnl1"
FT                   /locus_tag="mCG_18056"
FT                   /product="thioredoxin-like 1, isoform CRA_a"
FT                   /note="gene_id=mCG18056.2 transcript_id=mCT19070.2
FT                   protein_id=mCP21486.1 isoform=CRA_a"
FT                   /protein_id="EDL09717.1"
FT                   /translation="MVGVKPVGSDPDFQPELSGAGSRLAVVKFTMRGCGPCLRIAPAFS
FT                   SMSNKYPQAVFLEVDVHQCQGTAATNNISATPTFLFFRNKVRIDQYQGADAVGLEEKIK
FT                   QHLENDPGSNEDADIPKGYMDLMPFINKAGCECLNESDEHGFDNCLRKDMSFLESDCDE
FT                   QLLITVAFNQPVKLYSMKFQGPDNGQGPKYVKIFINLPRSMDFEEAERSEPTQALELTE
FT                   DDIKEDGIVPLRYVKFQNVNSVTLFVQSNQGEEETTRISYFTFIGTPVQATNMNDFKRV
FT                   VGKKGESH"
FT   gene            26342754..>26622060
FT                   /locus_tag="mCG_18052"
FT                   /note="gene_id=mCG18052.2"
FT   mRNA            join(26342754..26342949,26354263..26354434,
FT                   26354802..26354908,26358155..26358233,26361544..26361718,
FT                   26362364..26362440,26364014..26364133,26369505..26369650,
FT                   26370330..26370432,26372664..26372805,26373026..26373274,
FT                   26373948..26374168,26388952..26389147,26394501..26394715,
FT                   26412697..26413466,26415037..26415125,26429334..26429452,
FT                   26431267..26431390,26462530..26462643,26502709..26502930,
FT                   26541646..26541832,26559894..26560011,26561661..26561810,
FT                   26562298..26562380,26570848..26570947,26614244..26614348,
FT                   26621857..>26622057)
FT                   /locus_tag="mCG_18052"
FT                   /product="mCG18052, transcript variant mCT173878"
FT                   /note="gene_id=mCG18052.2 transcript_id=mCT173878.0 created
FT                   on 03-OCT-2002"
FT   mRNA            join(26342755..26342949,26354263..26354434,
FT                   26354802..26354908,26358155..26358233,26361544..26361718,
FT                   26362364..26362440,26364014..26364133,26369505..26369650,
FT                   26370330..26370432,26372664..26372805,26373026..26373274,
FT                   26373948..26374168,26388952..26389147,26394501..26394715,
FT                   26412697..26413466,26415037..26415125,26426905..26427000,
FT                   26429334..26429452,26431267..26431390,26462530..26462643,
FT                   26502709..26502930,26541646..26541832,26559894..26560011,
FT                   26561661..26561810,26562298..26562380,26570848..26570947,
FT                   26614244..26614348,26621857..>26622060)
FT                   /locus_tag="mCG_18052"
FT                   /product="mCG18052, transcript variant mCT19066"
FT                   /note="gene_id=mCG18052.2 transcript_id=mCT19066.2 created
FT                   on 03-OCT-2002"
FT   mRNA            join(26342807..26342949,26354263..26354434,
FT                   26354802..26354908,26358155..26358233,26361544..26361718,
FT                   26362364..26362440,26364014..26364133,26369505..26369650,
FT                   26370330..26370432,26372664..26372805,26373026..26373274,
FT                   26373948..26374418)
FT                   /locus_tag="mCG_18052"
FT                   /product="mCG18052, transcript variant mCT173877"
FT                   /note="gene_id=mCG18052.2 transcript_id=mCT173877.0 created
FT                   on 03-OCT-2002"
FT   CDS             join(26354276..26354434,26354802..26354908,
FT                   26358155..26358233,26361544..26361718,26362364..26362440,
FT                   26364014..26364133,26369505..26369650,26370330..26370432,
FT                   26372664..26372805,26373026..26373274,26373948..26374168,
FT                   26388952..26389147,26394501..26394715,26412697..26413466,
FT                   26415037..26415125,26426905..26427000,26429334..26429452,
FT                   26431267..26431390,26462530..26462643,26502709..26502930,
FT                   26541646..26541832,26559894..26560011,26561661..26561810,
FT                   26562298..26562380,26570848..26570947,26614244..26614348,
FT                   26621857..26622060)
FT                   /codon_start=1
FT                   /locus_tag="mCG_18052"
FT                   /product="mCG18052, isoform CRA_b"
FT                   /note="gene_id=mCG18052.2 transcript_id=mCT19066.2
FT                   protein_id=mCP21519.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q920I9"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="MGI:MGI:1860197"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q920I9"
FT                   /protein_id="EDL09715.1"
FT                   /translation="MAGNSLVLPIVLWGRKAPTHCISSILLTDDGGTIVTGCHDGQICL
FT                   WDVSVELEVNPRALLFGHTASITCLSKACASGDKRYTVSASANGEMCLWDVNDGRCIEF
FT                   TKLACTHTGIQFYQFSVGNQQEGRLLCHGHYPEILVVDATSLEVLYSLVSKISPDWISS
FT                   MSIIRSQRTQEDTVVALSVTGILKVWIVTSEMSGMQDTEPIFEEESKPIYCQNCQSISF
FT                   CAFTQRSLLVVCSKYWRVFDAGDYSLLCSGPSENGQTWTGGDFVSADKVIIWTENGQSY
FT                   IYKLPASCLPASDSFRSDVGKAVENLIPPVQHSLLDQKDKELVICPPVTRFFYGCKEYL
FT                   HKLLIQGDSSGRLNIWNIADIAEKQEADEGLKMTTCISLQEAFDKLKPCPAGIIDQLSV
FT                   IPNSNEPLKVTASVYIPAHGRLVCGREDGSIIIVPATQTAIVQLLQGEHMLRRGWPPHR
FT                   TLRGHRNKVTCLLYPHQVSARYDQRYLISGGVDFSVIIWDIFSGEMKHIFCVHGGEITQ
FT                   LLVPPENCSARVQHCICSVASDHSVGLLSLREKKCIMLASRHLFPIQVIKWRPSDDYLV
FT                   VGCTDGSVYVWQMDTGALDRCAMGITAVEILNACDEAVPAAVDSLSHPAVNLKQAMTRR
FT                   SLAALKNMAHHKLQTLATNLLASEASDKGNLPKYSHNSLMVQAIKTNLTDPDIHVLFFD
FT                   VEALIIQLLTEEASRPNTALISPENLQKASGSSDKGGSFLTGKRAAVLFQQVKETIKEN
FT                   IKEHLLDEEEDEEEARRQSREDSDPEYRASKSKPLTLLEYNLTMDTAKLFMSCLHAWGL
FT                   NEVLDEVCLDRLGMLKPHCTVSFGLLSRGGHMSLMLPGYNQAAGKLLHAKAEVGRKLPA
FT                   AEGVGKGTYTVSRAVTTQHLLSIISLANTLMSMTNATFIGDHMKKGPTRPPRPGTPDLS
FT                   KARDSPPPSSNIVQGQIKQAAAPVVSARSDADHSGSDSASPALPTCFLVNEGWSQLAAM
FT                   HCVMLPDLLGLERFRPPLLEMLARRWQDRCLEVREAAQALLLAELRRIEQAGRKETIDT
FT                   WAPYLPQYMDHVISPGVTAEAMQTMAAAPDASGPEAKVQEEEHDLVDDDITAGCLSSVP
FT                   QMKKISTSYEERRKQATAIVLLGVIGAEFGAEIEPPKLLTRPRSSSQIPEGFGLTSGGS
FT                   NYSLARHTCKALTYLLLQPPSPKLPPHSTIRRTATDLIGRGFTVWEPYMDVSAVLMGLL
FT                   ELCADAEKQLANITMGLPLSPAADSARSARHALSLIATARPPAFITTIAKEVHRHTALA
FT                   ANTQSQQSIHTTTLARAKGEILRVIEILIEKMPTDVVDLLVEVMDIIMYCLEGSLVKKK
FT                   GLQECFPAICRFYMVSYYERSHRIAVGARHGSVALYDIRTGKCQTIHGHKGPITAVSFA
FT                   PDGRYLATYSNTDSHISFWQMNTSLLGSIGMLNSAPQLRCIKTYQVPPVQPASPGSHNA
FT                   LKLARLIWTSNRNVILMAHDGKEHRFMV"
FT   CDS             join(26354276..26354434,26354802..26354908,
FT                   26358155..26358233,26361544..26361718,26362364..26362440,
FT                   26364014..26364133,26369505..26369650,26370330..26370432,
FT                   26372664..26372805,26373026..26373274,26373948..26374168,
FT                   26388952..26389147,26394501..26394715,26412697..26413466,
FT                   26415037..26415125,26429334..26429452,26431267..26431390,
FT                   26462530..26462643,26502709..26502930,26541646..26541832,
FT                   26559894..26560011,26561661..26561810,26562298..26562380,
FT                   26570848..26570947,26614244..26614348,26621857..>26622057)
FT                   /codon_start=1
FT                   /locus_tag="mCG_18052"
FT                   /product="mCG18052, isoform CRA_a"
FT                   /note="gene_id=mCG18052.2 transcript_id=mCT173878.0
FT                   protein_id=mCP96796.0 isoform=CRA_a"
FT                   /protein_id="EDL09714.1"
FT                   /translation="MAGNSLVLPIVLWGRKAPTHCISSILLTDDGGTIVTGCHDGQICL
FT                   WDVSVELEVNPRALLFGHTASITCLSKACASGDKRYTVSASANGEMCLWDVNDGRCIEF
FT                   TKLACTHTGIQFYQFSVGNQQEGRLLCHGHYPEILVVDATSLEVLYSLVSKISPDWISS
FT                   MSIIRSQRTQEDTVVALSVTGILKVWIVTSEMSGMQDTEPIFEEESKPIYCQNCQSISF
FT                   CAFTQRSLLVVCSKYWRVFDAGDYSLLCSGPSENGQTWTGGDFVSADKVIIWTENGQSY
FT                   IYKLPASCLPASDSFRSDVGKAVENLIPPVQHSLLDQKDKELVICPPVTRFFYGCKEYL
FT                   HKLLIQGDSSGRLNIWNIADIAEKQEADEGLKMTTCISLQEAFDKLKPCPAGIIDQLSV
FT                   IPNSNEPLKVTASVYIPAHGRLVCGREDGSIIIVPATQTAIVQLLQGEHMLRRGWPPHR
FT                   TLRGHRNKVTCLLYPHQVSARYDQRYLISGGVDFSVIIWDIFSGEMKHIFCVHGGEITQ
FT                   LLVPPENCSARVQHCICSVASDHSVGLLSLREKKCIMLASRHLFPIQVIKWRPSDDYLV
FT                   VGCTDGSVYVWQMDTGALDRCAMGITAVEILNACDEAVPAAVDSLSHPAVNLKQAMTRR
FT                   SLAALKNMAHHKLQTLATNLLASEASDKGNLPKYSHNSLMVQAIKTNLTDPDIHVLFFD
FT                   VEALIIQLLTEEASRPNTALISPENLQKASGSSDKGGSFLTGKRAAVLFQQVKETIKEN
FT                   IKEHLLDEEEDEEEARRQSREDSDPEYRASKSKPLTLLEYNLTMDTAKLFMSCLHAWGL
FT                   NEVLDEVCLDRLGMLKPHCTVSFGLLSRGGHMSLMLPGYNQAAGKLLHAKAEVGRKLPA
FT                   AEGVGKGTYTVSRAVTTQHLLSIISLANTLMSMTNATFIGDHMKKGPTRPPRPGTPDLS
FT                   KARDSPPPSSNIVQGQIKQGWSQLAAMHCVMLPDLLGLERFRPPLLEMLARRWQDRCLE
FT                   VREAAQALLLAELRRIEQAGRKETIDTWAPYLPQYMDHVISPGVTAEAMQTMAAAPDAS
FT                   GPEAKVQEEEHDLVDDDITAGCLSSVPQMKKISTSYEERRKQATAIVLLGVIGAEFGAE
FT                   IEPPKLLTRPRSSSQIPEGFGLTSGGSNYSLARHTCKALTYLLLQPPSPKLPPHSTIRR
FT                   TATDLIGRGFTVWEPYMDVSAVLMGLLELCADAEKQLANITMGLPLSPAADSARSARHA
FT                   LSLIATARPPAFITTIAKEVHRHTALAANTQSQQSIHTTTLARAKGEILRVIEILIEKM
FT                   PTDVVDLLVEVMDIIMYCLEGSLVKKKGLQECFPAICRFYMVSYYERSHRIAVGARHGS
FT                   VALYDIRTGKCQTIHGHKGPITAVSFAPDGRYLATYSNTDSHISFWQMNTSLLGSIGML
FT                   NSAPQLRCIKTYQVPPVQPASPGSHNALKLARLIWTSNRNVILMAHDGKEHRFMV"
FT   CDS             join(26354276..26354434,26354802..26354908,
FT                   26358155..26358233,26361544..26361718,26362364..26362440,
FT                   26364014..26364133,26369505..26369650,26370330..26370432,
FT                   26372664..26372805,26373026..26373274,26373948..26374186)
FT                   /codon_start=1
FT                   /locus_tag="mCG_18052"
FT                   /product="mCG18052, isoform CRA_c"
FT                   /note="gene_id=mCG18052.2 transcript_id=mCT173877.0
FT                   protein_id=mCP96797.0 isoform=CRA_c"
FT                   /db_xref="GOA:Q8C711"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="MGI:MGI:1860197"
FT                   /db_xref="UniProtKB/TrEMBL:Q8C711"
FT                   /protein_id="EDL09716.1"
FT                   /translation="MAGNSLVLPIVLWGRKAPTHCISSILLTDDGGTIVTGCHDGQICL
FT                   WDVSVELEVNPRALLFGHTASITCLSKACASGDKRYTVSASANGEMCLWDVNDGRCIEF
FT                   TKLACTHTGIQFYQFSVGNQQEGRLLCHGHYPEILVVDATSLEVLYSLVSKISPDWISS
FT                   MSIIRSQRTQEDTVVALSVTGILKVWIVTSEMSGMQDTEPIFEEESKPIYCQNCQSISF
FT                   CAFTQRSLLVVCSKYWRVFDAGDYSLLCSGPSENGQTWTGGDFVSADKVIIWTENGQSY
FT                   IYKLPASCLPASDSFRSDVGKAVENLIPPVQHSLLDQKDKELVICPPVTRFFYGCKEYL
FT                   HKLLIQGDSSGRLNIWNIADIAEKQEADEGLKMTTCISLQEAFDKLKPCPAGIIDQLSV
FT                   IPNSNEPLKVTASVYIPAHGRLVCGREDGSIIIVPATQTAIVQLLQGEHMLRRGWPPHR
FT                   TLRGHRNKVTCLLYPHQVSARYDQRYLISGGVDFSVIIWDIFSGEMKHIFCVHGGEITQ
FT                   LLVPPENCSVSRFI"
FT   gene            complement(<26712903..26713658)
FT                   /locus_tag="mCG_125162"
FT                   /note="gene_id=mCG125162.0"
FT   mRNA            complement(<26712903..26713658)
FT                   /locus_tag="mCG_125162"
FT                   /product="mCG125162"
FT                   /note="gene_id=mCG125162.0 transcript_id=mCT126420.0
FT                   created on 03-OCT-2002"
FT   CDS             complement(<26712903..26713434)
FT                   /codon_start=1
FT                   /locus_tag="mCG_125162"
FT                   /product="mCG125162"
FT                   /note="gene_id=mCG125162.0 transcript_id=mCT126420.0
FT                   protein_id=mCP77936.1"
FT                   /protein_id="EDL09713.1"
FT                   /translation="MIGLKAKLYHKQRHAKKIQMKKTIKMHEKRNTKQKDDEKTPQGAV
FT                   PAYLLDREGQSRAKVLSNMIKQKRKEKAGKWEVPLPKVRAQGETEVLKVIRTGKRKKKA
FT                   WKRMVTKVCFVGDGFTRKPPKYERFIRPMGLRFKKAHVTHPELKATFCLPILGVKKNPS
FT                   SPLYTTLGVITKGF"
FT   gene            complement(26789864..>26909961)
FT                   /locus_tag="mCG_145141"
FT                   /note="gene_id=mCG145141.0"
FT   mRNA            complement(join(26789864..26789987,26790323..26790380,
FT                   26800886..26801024,26802517..26802619,26882161..26882295,
FT                   26909857..>26909961))
FT                   /locus_tag="mCG_145141"
FT                   /product="mCG145141"
FT                   /note="gene_id=mCG145141.0 transcript_id=mCT184565.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(26801003..26801024,26802517..26802619,
FT                   26882161..>26882284))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145141"
FT                   /product="mCG145141"
FT                   /note="gene_id=mCG145141.0 transcript_id=mCT184565.0
FT                   protein_id=mCP106249.0"
FT                   /protein_id="EDL09710.1"
FT                   /translation="GRQACASIKLVMREESQLLEIKRIWKVKEIQIGTHWALSVSDSGE
FT                   DLAALDLRDDRTQRGKSTEVLQRTQAFKGGSKDLLKP"
FT   gene            26886524..26904630
FT                   /gene="St8sia3"
FT                   /locus_tag="mCG_18058"
FT                   /note="gene_id=mCG18058.2"
FT   mRNA            join(26886524..26886841,26888880..26888956,
FT                   26897226..26897783,26899080..26899202,26901560..26902117,
FT                   26903648..26904629)
FT                   /gene="St8sia3"
FT                   /locus_tag="mCG_18058"
FT                   /product="ST8 alpha-N-acetyl-neuraminide
FT                   alpha-2,8-sialyltransferase 3, transcript variant mCT19072"
FT                   /note="gene_id=mCG18058.2 transcript_id=mCT19072.2 created
FT                   on 03-OCT-2002"
FT   CDS             join(26897605..26897783,26899080..26899202,
FT                   26901560..26902117,26903648..26903930)
FT                   /codon_start=1
FT                   /gene="St8sia3"
FT                   /locus_tag="mCG_18058"
FT                   /product="ST8 alpha-N-acetyl-neuraminide
FT                   alpha-2,8-sialyltransferase 3, isoform CRA_b"
FT                   /note="gene_id=mCG18058.2 transcript_id=mCT19072.2
FT                   protein_id=mCP21497.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q64689"
FT                   /db_xref="InterPro:IPR001675"
FT                   /db_xref="InterPro:IPR012163"
FT                   /db_xref="MGI:MGI:106019"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q64689"
FT                   /protein_id="EDL09712.1"
FT                   /translation="MRNCKMARVASVLGLVMLSVALLILSLISYVSLKKENIFTTPKYA
FT                   SPGAPRMYMFHAGFRSQFALKFLDQSFVPITNSLTHELQEKPSKWTFNRTAFLHQRQEI
FT                   LQHVDVIKNFSLTKSSVRIGQLMHYDYSSHKYVFSISNNFRSLLPDVSPIMNKRYNVCA
FT                   VVGNSGILTGSQCGQEIDKSDFVFRCNFAPTEAFHKDVGRKTNLTTFNPSILEKYYNNL
FT                   LTIQDRNNFFLSLKKLDGAILWIPAFFFHTSATVTRTLVDFFVEHRGQLKVQLAWPGNI
FT                   MQHVNRYWKNKHLSPKRLSTGILMYTLASAICEEIHLYGFWPFGFDPNTREDLPYHYYD
FT                   KKGTKFTTKWQESHQLPAEFQLLYRMHGEGLTKLTLSHCA"
FT   mRNA            join(26898310..26898448,26899080..26899202,
FT                   26901560..26902117,26903648..26904630)
FT                   /gene="St8sia3"
FT                   /locus_tag="mCG_18058"
FT                   /product="ST8 alpha-N-acetyl-neuraminide
FT                   alpha-2,8-sialyltransferase 3, transcript variant
FT                   mCT173884"
FT                   /note="gene_id=mCG18058.2 transcript_id=mCT173884.0 created
FT                   on 03-OCT-2002"
FT   CDS             join(26901636..26902117,26903648..26903930)
FT                   /codon_start=1
FT                   /gene="St8sia3"
FT                   /locus_tag="mCG_18058"
FT                   /product="ST8 alpha-N-acetyl-neuraminide
FT                   alpha-2,8-sialyltransferase 3, isoform CRA_a"
FT                   /note="gene_id=mCG18058.2 transcript_id=mCT173884.0
FT                   protein_id=mCP96803.0 isoform=CRA_a"
FT                   /protein_id="EDL09711.1"
FT                   /translation="MHYDYSSHKYVFSISNNFRSLLPDVSPIMNKRYNVCAVVGNSGIL
FT                   TGSQCGQEIDKSDFVFRCNFAPTEAFHKDVGRKTNLTTFNPSILEKYYNNLLTIQDRNN
FT                   FFLSLKKLDGAILWIPAFFFHTSATVTRTLVDFFVEHRGQLKVQLAWPGNIMQHVNRYW
FT                   KNKHLSPKRLSTGILMYTLASAICEEIHLYGFWPFGFDPNTREDLPYHYYDKKGTKFTT
FT                   KWQESHQLPAEFQLLYRMHGEGLTKLTLSHCA"
FT   gene            26920979..26921483
FT                   /pseudo
FT                   /locus_tag="mCG_18060"
FT                   /note="gene_id=mCG18060.0"
FT   mRNA            26920979..26921483
FT                   /pseudo
FT                   /locus_tag="mCG_18060"
FT                   /note="gene_id=mCG18060.0 transcript_id=mCT19073.0 created
FT                   on 03-OCT-2002"
FT   gene            <26973683..27019915
FT                   /gene="Onecut2"
FT                   /locus_tag="mCG_18054"
FT                   /note="gene_id=mCG18054.2"
FT   mRNA            join(<26973683..26974319,27019393..27019915)
FT                   /gene="Onecut2"
FT                   /locus_tag="mCG_18054"
FT                   /product="one cut domain, family member 2"
FT                   /note="gene_id=mCG18054.2 transcript_id=mCT19067.2 created
FT                   on 03-OCT-2002"
FT   CDS             join(26973683..26974319,27019393..27019679)
FT                   /codon_start=1
FT                   /gene="Onecut2"
FT                   /locus_tag="mCG_18054"
FT                   /product="one cut domain, family member 2"
FT                   /note="gene_id=mCG18054.2 transcript_id=mCT19067.2
FT                   protein_id=mCP21483.1"
FT                   /protein_id="EDL09709.1"
FT                   /translation="MRDERGLPSMNNLYSPYKEMPSMSQSLSPLAATPLGNGLGGLHNA
FT                   QQSLPNYGPPGHDKMLSPNFDAHHTAMLTRGEQHLSRGLGTPPAAMMSHLNGLHHPGHT
FT                   QSHGPVLAPSRERPPSSSSGSQVATSGQLEEINTKEVAQRITAELKRYSIPQAIFAQRV
FT                   LCRSQGTLSDLLRNPKPWSKLKSGRETFRRMWKWLQEPEFQRMSALRLAACKRKEQEPN
FT                   KDRNNSQKKSRLVFTDLQRRTLFAIFKENKRPSKEMQITISQQLGLELTTVSNFFMNAR
FT                   RRSLEKWQDDLGTGGSSSTSSTCTKA"
FT   gene            complement(27081976..27083794)
FT                   /locus_tag="mCG_125160"
FT                   /note="gene_id=mCG125160.0"
FT   mRNA            complement(27081976..27083794)
FT                   /locus_tag="mCG_125160"
FT                   /product="mCG125160"
FT                   /note="gene_id=mCG125160.0 transcript_id=mCT126418.0
FT                   created on 03-OCT-2002"
FT   CDS             complement(27082536..27083540)
FT                   /codon_start=1
FT                   /locus_tag="mCG_125160"
FT                   /product="mCG125160"
FT                   /note="gene_id=mCG125160.0 transcript_id=mCT126418.0
FT                   protein_id=mCP77920.1"
FT                   /db_xref="GOA:P82184"
FT                   /db_xref="InterPro:IPR001985"
FT                   /db_xref="InterPro:IPR016067"
FT                   /db_xref="InterPro:IPR018166"
FT                   /db_xref="InterPro:IPR018167"
FT                   /db_xref="MGI:MGI:1333111"
FT                   /db_xref="UniProtKB/Swiss-Prot:P82184"
FT                   /protein_id="EDL09708.1"
FT                   /translation="MEAAHFFEGTEKLLEVWFSRQQSDASQGSGDLRTIPRSEWDVLLK
FT                   DVQCSIISVTKTDKQEAYVLSESSMFVSKRRFILKTCGTTLLLKALVPLLKLARDYSGF
FT                   DSIQSFFYSRKNFMKPSHQGYPHRNFQEEIEFLNAIFPNGAAYCMGRMNSDCWYLYTLD
FT                   FPESRVISQPDQTLEILMSELDPAVMDQFYMKDGVTAKDVTRESGIRDLIPGSVIDATL
FT                   FNPCGYSMNGMKSDGTYWTIHITPEPEFSYVSFETNLSQTSYDDLIRKVVEVFKPGKFV
FT                   TTLFVNQSSKCRTVLSSPQKIDGFKRLDCQSAMFNDYNFVFTSFAKKQQQQQS"
FT   gene            complement(27090383..27122326)
FT                   /gene="Fech"
FT                   /locus_tag="mCG_125158"
FT                   /note="gene_id=mCG125158.0"
FT   mRNA            complement(join(27090383..27092058,27092496..27092555,
FT                   27095364..27095528,27095950..27096057,27097929..27098027,
FT                   27101569..27101675,27104524..27104658,27108340..27108489,
FT                   27111915..27112034,27116598..27116721,27122168..27122326))
FT                   /gene="Fech"
FT                   /locus_tag="mCG_125158"
FT                   /product="ferrochelatase, transcript variant mCT126416"
FT                   /note="gene_id=mCG125158.0 transcript_id=mCT126416.0
FT                   created on 03-OCT-2002"
FT   mRNA            complement(join(27091106..27092555,27095364..27095528,
FT                   27095950..27096057,27097929..27098027,27101569..27101675,
FT                   27104524..27104658,27108340..27108489,27111915..27112034,
FT                   27116598..27116721,27122168..27122325))
FT                   /gene="Fech"
FT                   /locus_tag="mCG_125158"
FT                   /product="ferrochelatase, transcript variant mCT173835"
FT                   /note="gene_id=mCG125158.0 transcript_id=mCT173835.0
FT                   created on 03-OCT-2002"
FT   CDS             complement(join(27108357..27108489,27111915..27112034,
FT                   27116598..27116721,27122168..27122234))
FT                   /codon_start=1
FT                   /gene="Fech"
FT                   /locus_tag="mCG_125158"
FT                   /product="ferrochelatase, isoform CRA_a"
FT                   /note="gene_id=mCG125158.0 transcript_id=mCT126416.0
FT                   protein_id=mCP77899.1 isoform=CRA_a"
FT                   /protein_id="EDL09705.1"
FT                   /translation="MLSASANMAAALRAAGALLREPLVHGSSRACQPWRCQSGAAVAAT
FT                   TEKVHHAKTTKPQAQPERRKPKTGILMLNMGGPETLGEVQDFLQRLFLDRDLMTLPIQN
FT                   KLAPFIAKRRTPKIQEQYRRIGGGSPIKMWTSKQGRRHGEAAG"
FT   CDS             complement(join(27108357..27108489,27111915..27112034,
FT                   27116598..27116721,27122168..27122234))
FT                   /codon_start=1
FT                   /gene="Fech"
FT                   /locus_tag="mCG_125158"
FT                   /product="ferrochelatase, isoform CRA_a"
FT                   /note="gene_id=mCG125158.0 transcript_id=mCT173835.0
FT                   protein_id=mCP96754.0 isoform=CRA_a"
FT                   /protein_id="EDL09707.1"
FT                   /translation="MLSASANMAAALRAAGALLREPLVHGSSRACQPWRCQSGAAVAAT
FT                   TEKVHHAKTTKPQAQPERRKPKTGILMLNMGGPETLGEVQDFLQRLFLDRDLMTLPIQN
FT                   KLAPFIAKRRTPKIQEQYRRIGGGSPIKMWTSKQGRRHGEAAG"
FT   mRNA            complement(join(27115957..27116721,27122168..27122301))
FT                   /gene="Fech"
FT                   /locus_tag="mCG_125158"
FT                   /product="ferrochelatase, transcript variant mCT173834"
FT                   /note="gene_id=mCG125158.0 transcript_id=mCT173834.0
FT                   created on 03-OCT-2002"
FT   CDS             complement(join(27116594..27116721,27122168..27122234))
FT                   /codon_start=1
FT                   /gene="Fech"
FT                   /locus_tag="mCG_125158"
FT                   /product="ferrochelatase, isoform CRA_b"
FT                   /note="gene_id=mCG125158.0 transcript_id=mCT173834.0
FT                   protein_id=mCP96753.0 isoform=CRA_b"
FT                   /protein_id="EDL09706.1"
FT                   /translation="MLSASANMAAALRAAGALLREPLVHGSSRACQPWRCQSGAAVAAT
FT                   TEKVHHAKTTKPQAQPERR"
FT   gene            complement(27132913..27149803)
FT                   /gene="Nars"
FT                   /locus_tag="mCG_18057"
FT                   /note="gene_id=mCG18057.1"
FT   mRNA            complement(join(27132913..27133914,27134568..27134699,
FT                   27135009..27135140,27136763..27136876,27137593..27137728,
FT                   27138103..27138302,27138412..27138633,27141028..27141114,
FT                   27142501..27142571,27143709..27143787,27144868..27144957,
FT                   27145042..27145134,27145241..27145306,27148583..27148662,
FT                   27149673..27149803))
FT                   /gene="Nars"
FT                   /locus_tag="mCG_18057"
FT                   /product="asparaginyl-tRNA synthetase, transcript variant
FT                   mCT19071"
FT                   /note="gene_id=mCG18057.1 transcript_id=mCT19071.2 created
FT                   on 03-OCT-2002"
FT   mRNA            complement(join(27133063..27133914,27134568..27134699,
FT                   27135009..27135140,27136763..27136876,27137593..27137728,
FT                   27138103..27138302,27138412..27138633,27141028..27141114,
FT                   27142501..27142571,27143709..27143787,27144868..27144957,
FT                   27145042..27145134,27145241..27145306,27148583..27148665,
FT                   27149744..27149785))
FT                   /gene="Nars"
FT                   /locus_tag="mCG_18057"
FT                   /product="asparaginyl-tRNA synthetase, transcript variant
FT                   mCT173883"
FT                   /note="gene_id=mCG18057.1 transcript_id=mCT173883.0 created
FT                   on 03-OCT-2002"
FT   mRNA            complement(join(27133063..27133914,27134568..27134699,
FT                   27135009..27135140,27136763..27136876,27137593..27137728,
FT                   27138103..27138302,27138412..27138633,27141028..27141114,
FT                   27142501..27142571,27143709..27143787,27144868..27144957,
FT                   27145042..27145134,27145241..27145306,27148072..27148121,
FT                   27148583..27148662,27149673..27149765))
FT                   /gene="Nars"
FT                   /locus_tag="mCG_18057"
FT                   /product="asparaginyl-tRNA synthetase, transcript variant
FT                   mCT173882"
FT                   /note="gene_id=mCG18057.1 transcript_id=mCT173882.0 created
FT                   on 03-OCT-2002"
FT   mRNA            complement(join(27133063..27133914,27134568..27134699,
FT                   27135009..27135140,27136763..27136876,27137593..27137728,
FT                   27138103..27138302,27138412..27138633,27141028..27141114,
FT                   27142501..27142571,27143709..27143787,27144868..27144957,
FT                   27145042..27145134,27145241..27145306,27148583..27148665,
FT                   27149673..27149735))
FT                   /gene="Nars"
FT                   /locus_tag="mCG_18057"
FT                   /product="asparaginyl-tRNA synthetase, transcript variant
FT                   mCT173881"
FT                   /note="gene_id=mCG18057.1 transcript_id=mCT173881.0 created
FT                   on 03-OCT-2002"
FT   CDS             complement(join(27133783..27133914,27134568..27134699,
FT                   27135009..27135140,27136763..27136876,27137593..27137728,
FT                   27138103..27138302,27138412..27138633,27141028..27141114,
FT                   27142501..27142571,27143709..27143787,27144868..27144957,
FT                   27145042..27145134,27145241..27145306,27148583..27148662,
FT                   27149673..27149715))
FT                   /codon_start=1
FT                   /gene="Nars"
FT                   /locus_tag="mCG_18057"
FT                   /product="asparaginyl-tRNA synthetase, isoform CRA_c"
FT                   /note="gene_id=mCG18057.1 transcript_id=mCT19071.2
FT                   protein_id=mCP21562.2 isoform=CRA_c"
FT                   /protein_id="EDL09704.1"
FT                   /translation="MSSEVIRGTAEMVLELYVSDREGNDATGDGTKEKPFKTGLKALMT
FT                   VGKEPFPTIYVDSQKENERWDVISKSQMKNIKKMWHREQMKNDSREKKEAEDNLRREKN
FT                   LEEAKKIIIKNDPSLPEPACVKISALEGYRGQRVKVFGWVHRLRRQGKNLMFLVLRDGT
FT                   GYLQCVLSDDLCQCYNGVVLSTESSVAVYGTLNLTPKGKQAPGGHELSCDFWELVGLAP
FT                   AGGADNLINEESDVDVQLNNRHMMIRGENMSKILKARSMITRCFRDHFFDRGYCEVTTP
FT                   TLVQTQVEGGATLFKLDYFGEEAFLTQSSQLYLETCLPALGDVFCIAQSYRAEQSRTRR
FT                   HLAEFTHVEAECPFLTFEDLLNRLEDLVCDVVDRVLKSPVASIVYELNPNFKPPKRPFR
FT                   RMNYSDAIEWLKEHDVKKEDGTFYEFGDDIPEAPERLMTDTINEPILLCRFPVEIKSFY
FT                   MQRCPEDPRLTESVDVLMPNVGEIVGGSMRSWDSEEILEGYKREGIDPAPYYWYTDQRK
FT                   YGTCPHGGYGLGLERFLSWILNRYHIRDVCLYPRFLQRCRP"
FT   CDS             complement(join(27133783..27133914,27134568..27134699,
FT                   27135009..27135140,27136763..27136876,27137593..27137728,
FT                   27138103..27138302,27138412..27138633,27141028..27141114,
FT                   27142501..27142571,27143709..27143787,27144868..27144957,
FT                   27145042..27145134,27145241..27145306,27148583..27148665,
FT                   27149673..27149715))
FT                   /codon_start=1
FT                   /gene="Nars"
FT                   /locus_tag="mCG_18057"
FT                   /product="asparaginyl-tRNA synthetase, isoform CRA_a"
FT                   /note="gene_id=mCG18057.1 transcript_id=mCT173881.0
FT                   protein_id=mCP96800.0 isoform=CRA_a"
FT                   /protein_id="EDL09701.1"
FT                   /translation="MSSEVIRGTAEMVLAELYVSDREGNDATGDGTKEKPFKTGLKALM
FT                   TVGKEPFPTIYVDSQKENERWDVISKSQMKNIKKMWHREQMKNDSREKKEAEDNLRREK
FT                   NLEEAKKIIIKNDPSLPEPACVKISALEGYRGQRVKVFGWVHRLRRQGKNLMFLVLRDG
FT                   TGYLQCVLSDDLCQCYNGVVLSTESSVAVYGTLNLTPKGKQAPGGHELSCDFWELVGLA
FT                   PAGGADNLINEESDVDVQLNNRHMMIRGENMSKILKARSMITRCFRDHFFDRGYCEVTT
FT                   PTLVQTQVEGGATLFKLDYFGEEAFLTQSSQLYLETCLPALGDVFCIAQSYRAEQSRTR
FT                   RHLAEFTHVEAECPFLTFEDLLNRLEDLVCDVVDRVLKSPVASIVYELNPNFKPPKRPF
FT                   RRMNYSDAIEWLKEHDVKKEDGTFYEFGDDIPEAPERLMTDTINEPILLCRFPVEIKSF
FT                   YMQRCPEDPRLTESVDVLMPNVGEIVGGSMRSWDSEEILEGYKREGIDPAPYYWYTDQR
FT                   KYGTCPHGGYGLGLERFLSWILNRYHIRDVCLYPRFLQRCRP"
FT   CDS             complement(join(27133783..27133914,27134568..27134699,
FT                   27135009..27135140,27136763..27136876,27137593..27137728,
FT                   27138103..27138302,27138412..27138633,27141028..27141114,
FT                   27142501..27142571,27143709..27143787,27144868..27144957,
FT                   27145042..27145134,27145241..27145300))
FT                   /codon_start=1
FT                   /gene="Nars"
FT                   /locus_tag="mCG_18057"
FT                   /product="asparaginyl-tRNA synthetase, isoform CRA_b"
FT                   /note="gene_id=mCG18057.1 transcript_id=mCT173882.0
FT                   protein_id=mCP96802.0 isoform=CRA_b"
FT                   /protein_id="EDL09702.1"
FT                   /translation="MTVGKEPFPTIYVDSQKENERWDVISKSQMKNIKKMWHREQMKND
FT                   SREKKEAEDNLRREKNLEEAKKIIIKNDPSLPEPACVKISALEGYRGQRVKVFGWVHRL
FT                   RRQGKNLMFLVLRDGTGYLQCVLSDDLCQCYNGVVLSTESSVAVYGTLNLTPKGKQAPG
FT                   GHELSCDFWELVGLAPAGGADNLINEESDVDVQLNNRHMMIRGENMSKILKARSMITRC
FT                   FRDHFFDRGYCEVTTPTLVQTQVEGGATLFKLDYFGEEAFLTQSSQLYLETCLPALGDV
FT                   FCIAQSYRAEQSRTRRHLAEFTHVEAECPFLTFEDLLNRLEDLVCDVVDRVLKSPVASI
FT                   VYELNPNFKPPKRPFRRMNYSDAIEWLKEHDVKKEDGTFYEFGDDIPEAPERLMTDTIN
FT                   EPILLCRFPVEIKSFYMQRCPEDPRLTESVDVLMPNVGEIVGGSMRSWDSEEILEGYKR
FT                   EGIDPAPYYWYTDQRKYGTCPHGGYGLGLERFLSWILNRYHIRDVCLYPRFLQRCRP"
FT   CDS             complement(join(27133783..27133914,27134568..27134699,
FT                   27135009..27135140,27136763..27136876,27137593..27137728,
FT                   27138103..27138302,27138412..27138633,27141028..27141114,
FT                   27142501..27142571,27143709..27143787,27144868..27144957,
FT                   27145042..27145134,27145241..27145300))
FT                   /codon_start=1
FT                   /gene="Nars"
FT                   /locus_tag="mCG_18057"
FT                   /product="asparaginyl-tRNA synthetase, isoform CRA_b"
FT                   /note="gene_id=mCG18057.1 transcript_id=mCT173883.0
FT                   protein_id=mCP96801.0 isoform=CRA_b"
FT                   /protein_id="EDL09703.1"
FT                   /translation="MTVGKEPFPTIYVDSQKENERWDVISKSQMKNIKKMWHREQMKND
FT                   SREKKEAEDNLRREKNLEEAKKIIIKNDPSLPEPACVKISALEGYRGQRVKVFGWVHRL
FT                   RRQGKNLMFLVLRDGTGYLQCVLSDDLCQCYNGVVLSTESSVAVYGTLNLTPKGKQAPG
FT                   GHELSCDFWELVGLAPAGGADNLINEESDVDVQLNNRHMMIRGENMSKILKARSMITRC
FT                   FRDHFFDRGYCEVTTPTLVQTQVEGGATLFKLDYFGEEAFLTQSSQLYLETCLPALGDV
FT                   FCIAQSYRAEQSRTRRHLAEFTHVEAECPFLTFEDLLNRLEDLVCDVVDRVLKSPVASI
FT                   VYELNPNFKPPKRPFRRMNYSDAIEWLKEHDVKKEDGTFYEFGDDIPEAPERLMTDTIN
FT                   EPILLCRFPVEIKSFYMQRCPEDPRLTESVDVLMPNVGEIVGGSMRSWDSEEILEGYKR
FT                   EGIDPAPYYWYTDQRKYGTCPHGGYGLGLERFLSWILNRYHIRDVCLYPRFLQRCRP"
FT   gene            complement(27164228..>27238570)
FT                   /gene="Atp8b1"
FT                   /locus_tag="mCG_125165"
FT                   /note="gene_id=mCG125165.0"
FT   mRNA            complement(join(27164228..27164839,27166872..27167002,
FT                   27171797..27171959,27172301..27172546,27173554..27173637,
FT                   27174543..27174766,27178384..27178672,27179258..27179390,
FT                   27183648..27183723,27185117..27185228,27186291..27186455,
FT                   27188391..27188503,27190118..27190306,27194839..27194995,
FT                   27195429..27195472,27197603..27197811,27201326..27201516,
FT                   27204269..27204357,27204635..27204793,27204911..27204993,
FT                   27206491..27206561,27206739..27206811,27210647..27210708,
FT                   27210824..27210922,27212330..27212443,27215138..27215235,
FT                   27238390..>27238570))
FT                   /gene="Atp8b1"
FT                   /locus_tag="mCG_125165"
FT                   /product="ATPase, class I, type 8B, member 1"
FT                   /note="gene_id=mCG125165.0 transcript_id=mCT126423.0
FT                   created on 03-OCT-2002"
FT   CDS             complement(join(27164615..27164839,27166872..27167002,
FT                   27171797..27171959,27172301..27172546,27173554..27173637,
FT                   27174543..27174766,27178384..27178672,27179258..27179390,
FT                   27183648..27183723,27185117..27185228,27186291..27186455,
FT                   27188391..27188503,27190118..27190306,27194839..27194995,
FT                   27195429..27195472,27197603..27197811,27201326..27201516,
FT                   27204269..27204357,27204635..27204793,27204911..27204993,
FT                   27206491..27206561,27206739..27206811,27210647..27210708,
FT                   27210824..27210922,27212330..27212443,27215138..27215235,
FT                   27238390..27238570))
FT                   /codon_start=1
FT                   /gene="Atp8b1"
FT                   /locus_tag="mCG_125165"
FT                   /product="ATPase, class I, type 8B, member 1"
FT                   /note="gene_id=mCG125165.0 transcript_id=mCT126423.0
FT                   protein_id=mCP77943.0"
FT                   /protein_id="EDL09700.1"
FT                   /translation="MSTERDSETTFDEESQPNDEVVPYSDDETEDELEDQGSTVEPEQN
FT                   RVNREAEKKRETFRKDCTWQVKANDRKFHEQPHFMNTKFFCIKESKYASNAIKTYKYNG
FT                   FTFLPMNLFEQFKRAANFYFLILLILQAIPQISTLAWYTTLVPLLLVLGITAIKDLVDD
FT                   VARHKMDKEINNRTCEVIKDGRFKIIKWKDIQVGDVIRLKKNDFIPADILLLSSSEPNS
FT                   LCYVETAELDGETNLKFKMALEITDQYLQIEDNLATFDGFIECEEPNNRLDKFTGTLFW
FT                   KNQSFPLDADKILLRGCVIRNTDVCHGLVIFAGADTKIMKNSGKTRFKRTKIDYLMNYM
FT                   VYTIFIVLILVSAGLAIGHAYWEAQVGNYSWYLYDGENATPSYRGFLNFWGYIIVLNTM
FT                   VPISLYVSVEVIRLGQSHFINWDLQMYYAEKDTPAKARTTTLNEQLGQIHYIFSDKTGT
FT                   LTQNIMTFKKCCINGTIYGDHRDASQHSHSKIELVDFSWNTFADGKLAFYDHYLIEQIQ
FT                   SGKEPEVRQFFFLLSICHTVMVDRIDGQINYQAASPDEGALVNAARNFGFAFLARTQNT
FT                   ITVSELGSERTYNVLAILDFNSDRKRMSIIVRTPEGSIRLYCKGADTVIYERLHRMNPT
FT                   KQETQDALDIFASETLRTLCLCYKEIEEKEFTEWNNKFMAASVASSNRDEALDKVYEEI
FT                   EKDLILLGATAIEDKLQDGVPETISKLAKADIKIWVLTGDKKETAENIGFACELLTEDT
FT                   TICYGEDINSLLHTRMENQRNRGGVSAKFAPPVYEPFFPPGENRALIITGSWLNEILLE
FT                   KKTKRSKILKLKFPRTEEERRMRSQSRRRLEEKKEQRQKNFVDLACECSAVICCRVTPK
FT                   QKAMVVDLVKRYKKAITLAIGDGANDVNMIKTAHIGVGISGQEGMQAVMSSDYSFAQFR
FT                   YLQRLLLVHGRWSYIRMCKFLRYFFYKNFAFTLVHFWYSFFNGYSAQTAYEDWFITLYN
FT                   VLYSSLPVLLMGLLDQDVSDKLSLRFPGLYVVGQRDLLFNYKRFFVSLLHGVLTSMVLF
FT                   FIPLGAYLQTVGQDGEAPSDYQSFAVTVASALVITVNFQIGLDTSYWTFVNAFSIFGSI
FT                   ALYFGIMFDFHSAGIHVLFPSAFQFTGWYRSDSESTASNALRQPYIWLTIILTVAVCLL
FT                   PVVAIRFLSMTIWPSESDKIQKHRKRLKAEEQWKRRQSVFRRGVSSRRSAYAFSHQRGY
FT                   ADLISSGRSIRKKRSPLDAIIADGTAEYRRTVES"
FT   gene            complement(27244791..27246320)
FT                   /locus_tag="mCG_12604"
FT                   /note="gene_id=mCG12604.1"
FT   mRNA            complement(join(27244791..27245733,27246248..27246320))
FT                   /locus_tag="mCG_12604"
FT                   /product="mCG12604"
FT                   /note="gene_id=mCG12604.1 transcript_id=mCT13283.1 created
FT                   on 03-OCT-2002"
FT   CDS             complement(27244921..27245559)
FT                   /codon_start=1
FT                   /locus_tag="mCG_12604"
FT                   /product="mCG12604"
FT                   /note="gene_id=mCG12604.1 transcript_id=mCT13283.1
FT                   protein_id=mCP21527.2"
FT                   /protein_id="EDL09699.1"
FT                   /translation="MSSWRRLHNKPTFSQTIALLNIYRNPQNSSQSADGLRCAVSDVEM
FT                   QEHYDEFFEEVFTEMEEKYGEVEEMNVCDNLGDHLVGNVYVKFRREEDAEKAMIDLNNR
FT                   WFNGQPIHAELSPVTDFREACCRQYEMGECTRGGFCNFMHLKPISRELRRELYGRRRKK
FT                   HRSRSRSREWRSRARDRERGGRGRGGGGGGRGRERDRRQSRDWERSGRF"
FT   gene            27526863..27856456
FT                   /gene="Nedd4l"
FT                   /locus_tag="mCG_131856"
FT                   /note="gene_id=mCG131856.1"
FT   mRNA            join(27526863..27526946,27638225..27638298,
FT                   27715718..27715799,27718785..27718823,27721107..27721160,
FT                   27785490..27785540,27796950..27797011,27797341..27797443,
FT                   27799540..27799706,27803210..27803345,27804690..27804866,
FT                   27807267..27807341,27809209..27809268,27813970..27814101,
FT                   27814611..27814730,27815740..27815937,27820643..27820720,
FT                   27823052..27823106,27828070..27828128,27833202..27833267,
FT                   27834841..27835070,27836825..27836946,27837682..27837752,
FT                   27840399..27840494,27846089..27846162,27847854..27847914,
FT                   27850243..27850302,27850586..27850693,27851847..27851943,
FT                   27852425..27852497,27855099..27856456)
FT                   /gene="Nedd4l"
FT                   /locus_tag="mCG_131856"
FT                   /product="neural precursor cell expressed, developmentally
FT                   down-regulated gene 4-like, transcript variant mCT173871"
FT                   /note="gene_id=mCG131856.1 transcript_id=mCT173871.0
FT                   created on 03-OCT-2002"
FT   CDS             join(27526938..27526946,27638225..27638298,
FT                   27715718..27715799,27718785..27718823,27721107..27721160,
FT                   27785490..27785540,27796950..27797011,27797341..27797443,
FT                   27799540..27799706,27803210..27803345,27804690..27804866,
FT                   27807267..27807341,27809209..27809268,27813970..27814101,
FT                   27814611..27814730,27815740..27815937,27820643..27820720,
FT                   27823052..27823106,27828070..27828128,27833202..27833267,
FT                   27834841..27835070,27836825..27836946,27837682..27837752,
FT                   27840399..27840494,27846089..27846162,27847854..27847914,
FT                   27850243..27850302,27850586..27850693,27851847..27851943,
FT                   27852425..27852497,27855099..27855201)
FT                   /codon_start=1
FT                   /gene="Nedd4l"
FT                   /locus_tag="mCG_131856"
FT                   /product="neural precursor cell expressed, developmentally
FT                   down-regulated gene 4-like, isoform CRA_b"
FT                   /note="gene_id=mCG131856.1 transcript_id=mCT173871.0
FT                   protein_id=mCP96793.0 isoform=CRA_b"
FT                   /protein_id="EDL09695.1"
FT                   /translation="MEQGESRILRVKVVSGIDLAKKDIFGASDPYVKLSLYVADENREL
FT                   ALVQTKTIKKTLNPKWNEEFYFRVNPSNHRLLFEVFDENRLTRDDFLGQVDVPLSHLPT
FT                   EDPTMERPYTFKDFLLRPRSHKSRVKGFLRLKMAYMPKNGGQDEENSEQRDDMEHGWEV
FT                   VDSNDSASQHQEELPPPPLPPGWEEKVDNLGRTYYVNHNNRSTQWHRPSLMDVSSESDN
FT                   NIRQINQEAAHRRFRSRRHISEDLEPEASEGGGEGPEPWETISEEMNMAGDSLSLALPP
FT                   PPASPVSRTSPQELSEEVSRRLQITPDSNGEQFSSLIQREPSSRLRSCSVTDTVAEQAH
FT                   LPPPSTPTRRARSSTVTGGEESTPSVAYVHTTPGLPSGWEERKDAKGRTYYVNHNNRTT
FT                   TWTRPIMQLAEDGASGSATNSNNHLVEPQIRRPRSLSSPTVTLSAPLEGAKDSPIRRAV
FT                   KDTLSNPQSPQPSPYNSPKPQHKVTQSFLPPGWEMRIAPNGRPFFIDHNTKTTTWEDPR
FT                   LKFPVHMRSKASLNPNDLGPLPPGWEERIHLDGRTFYIDHNSKITQWEDPRLQNPAITG
FT                   PAVPYSREFKQKYDYFRKKLKKPADIPNRFEMKLHRNNIFEESYRRIMSVKRPDVLKAR
FT                   LWIEFESEKGLDYGGVAREWFFLLSKEMFNPYYGLFEYSATDNYTLQINPNSGLCNEDH
FT                   LSYFTFIGRVAGLAVFHGKLLDGFFIRPFYKMMLGKQITLNDMESVDSEYYNSLKWILE
FT                   NDPTELDLMFCIDEENFGQTYQVDLKPNGSEIMVTNENKREYIDLVIQWRFVNRVQKQM
FT                   NAFLEGFTELLPIDLIKIFDENELELLMCGLGDVDVNDWRQHSIYKNGYCPNHPVIQWF
FT                   WKAVLLMDAEKRIRLLQFVTGTSRVPMNGFAELYGSNGPQLFTIEQWGSPEKLPRAHTC
FT                   FNRLDLPPYETFEDLREKLLMAVENAQGFEGVD"
FT   mRNA            join(27559157..27559293,27638225..27638298,
FT                   27715718..27715799,27718785..27718823,27721107..27721160,
FT                   27785490..27785540,27796950..27797011,27797341..27797443,
FT                   27799540..27799706,27803210..27803345,27804690..27804866,
FT                   27807267..27807341,27809209..27809268,27813970..27814101,
FT                   27814611..27814730,27815740..27815937,27820643..27820720,
FT                   27823052..27823106,27828070..27828128,27833202..27833267,
FT                   27834841..27835070,27836825..27836946,27837682..27837752,
FT                   27840399..27840494,27846089..27846162,27847854..27847914,
FT                   27850243..27850302,27850586..27850693,27851847..27851943,
FT                   27852425..27852497,27855099..27855622)
FT                   /gene="Nedd4l"
FT                   /locus_tag="mCG_131856"
FT                   /product="neural precursor cell expressed, developmentally
FT                   down-regulated gene 4-like, transcript variant mCT173872"
FT                   /note="gene_id=mCG131856.1 transcript_id=mCT173872.0
FT                   created on 03-OCT-2002"
FT   CDS             join(27559162..27559293,27638225..27638298,
FT                   27715718..27715799,27718785..27718823,27721107..27721160,
FT                   27785490..27785540,27796950..27797011,27797341..27797443,
FT                   27799540..27799706,27803210..27803345,27804690..27804866,
FT                   27807267..27807341,27809209..27809268,27813970..27814101,
FT                   27814611..27814730,27815740..27815937,27820643..27820720,
FT                   27823052..27823106,27828070..27828128,27833202..27833267,
FT                   27834841..27835070,27836825..27836946,27837682..27837752,
FT                   27840399..27840494,27846089..27846162,27847854..27847914,
FT                   27850243..27850302,27850586..27850693,27851847..27851943,
FT                   27852425..27852497,27855099..27855201)
FT                   /codon_start=1
FT                   /gene="Nedd4l"
FT                   /locus_tag="mCG_131856"
FT                   /product="neural precursor cell expressed, developmentally
FT                   down-regulated gene 4-like, isoform CRA_c"
FT                   /note="gene_id=mCG131856.1 transcript_id=mCT173872.0
FT                   protein_id=mCP96791.0 isoform=CRA_c"
FT                   /protein_id="EDL09696.1"
FT                   /translation="MSLCEAPVHVGDKELKYFQIPQMLSQLSLLASHHSRGLEFSGGQG
FT                   ESRILRVKVVSGIDLAKKDIFGASDPYVKLSLYVADENRELALVQTKTIKKTLNPKWNE
FT                   EFYFRVNPSNHRLLFEVFDENRLTRDDFLGQVDVPLSHLPTEDPTMERPYTFKDFLLRP
FT                   RSHKSRVKGFLRLKMAYMPKNGGQDEENSEQRDDMEHGWEVVDSNDSASQHQEELPPPP
FT                   LPPGWEEKVDNLGRTYYVNHNNRSTQWHRPSLMDVSSESDNNIRQINQEAAHRRFRSRR
FT                   HISEDLEPEASEGGGEGPEPWETISEEMNMAGDSLSLALPPPPASPVSRTSPQELSEEV
FT                   SRRLQITPDSNGEQFSSLIQREPSSRLRSCSVTDTVAEQAHLPPPSTPTRRARSSTVTG
FT                   GEESTPSVAYVHTTPGLPSGWEERKDAKGRTYYVNHNNRTTTWTRPIMQLAEDGASGSA
FT                   TNSNNHLVEPQIRRPRSLSSPTVTLSAPLEGAKDSPIRRAVKDTLSNPQSPQPSPYNSP
FT                   KPQHKVTQSFLPPGWEMRIAPNGRPFFIDHNTKTTTWEDPRLKFPVHMRSKASLNPNDL
FT                   GPLPPGWEERIHLDGRTFYIDHNSKITQWEDPRLQNPAITGPAVPYSREFKQKYDYFRK
FT                   KLKKPADIPNRFEMKLHRNNIFEESYRRIMSVKRPDVLKARLWIEFESEKGLDYGGVAR
FT                   EWFFLLSKEMFNPYYGLFEYSATDNYTLQINPNSGLCNEDHLSYFTFIGRVAGLAVFHG
FT                   KLLDGFFIRPFYKMMLGKQITLNDMESVDSEYYNSLKWILENDPTELDLMFCIDEENFG
FT                   QTYQVDLKPNGSEIMVTNENKREYIDLVIQWRFVNRVQKQMNAFLEGFTELLPIDLIKI
FT                   FDENELELLMCGLGDVDVNDWRQHSIYKNGYCPNHPVIQWFWKAVLLMDAEKRIRLLQF
FT                   VTGTSRVPMNGFAELYGSNGPQLFTIEQWGSPEKLPRAHTCFNRLDLPPYETFEDLREK
FT                   LLMAVENAQGFEGVD"
FT   mRNA            join(27664336..27664798,27715718..27715803,
FT                   27834841..27835070,27836825..27836946,27837682..27837752,
FT                   27840399..27840494,27846089..27846162,27847854..27847914,
FT                   27850243..27850302,27850586..27850693,27851847..27851943,
FT                   27852425..27852497,27855099..27856456)
FT                   /gene="Nedd4l"
FT                   /locus_tag="mCG_131856"
FT                   /product="neural precursor cell expressed, developmentally
FT                   down-regulated gene 4-like, transcript variant mCT173873"
FT                   /note="gene_id=mCG131856.1 transcript_id=mCT173873.0
FT                   created on 03-OCT-2002"
FT   mRNA            join(27664336..27664798,27715718..27715799,
FT                   27718785..27718823,27721107..27721160,27785490..27785540,
FT                   27796950..27797011,27797341..27797443,27799540..27799706,
FT                   27803210..27803345,27804690..27804866,27807267..27807341,
FT                   27809209..27809268,27813970..27814101,27814611..27814730,
FT                   27815740..27815937,27820643..27820720,27823052..27823106,
FT                   27828070..27828128,27833202..27833267,27834841..27835070,
FT                   27836825..27836946,27837682..27837752,27840399..27840494,
FT                   27846089..27846162,27847854..27847914,27850243..27850302,
FT                   27850586..27850693,27851847..27851943,27852425..27852497,
FT                   27855099..27855622)
FT                   /gene="Nedd4l"
FT                   /locus_tag="mCG_131856"
FT                   /product="neural precursor cell expressed, developmentally
FT                   down-regulated gene 4-like, transcript variant mCT133198"
FT                   /note="gene_id=mCG131856.1 transcript_id=mCT133198.1
FT                   created on 03-OCT-2002"
FT   mRNA            join(27664337..27664798,27715718..27715799,
FT                   27718785..27718823,27721107..27721160,27785490..27785540,
FT                   27796950..27797011,27797341..27797443,27799540..27799706,
FT                   27803210..27803345,27804690..27804866,27807267..27807341,
FT                   27813970..27814101,27814611..27814730,27815740..27815937,
FT                   27820643..27820720,27823052..27823106,27828070..27828128,
FT                   27833202..27833267,27834841..27835070,27836825..27836946,
FT                   27837682..27837752,27840399..27840494,27846089..27846174,
FT                   27847854..27847914,27850243..27850302,27850586..27850693,
FT                   27851847..27851943,27852425..27852497,27855099..27856456)
FT                   /gene="Nedd4l"
FT                   /locus_tag="mCG_131856"
FT                   /product="neural precursor cell expressed, developmentally
FT                   down-regulated gene 4-like, transcript variant mCT173874"
FT                   /note="gene_id=mCG131856.1 transcript_id=mCT173874.0
FT                   created on 03-OCT-2002"
FT   CDS             join(27796965..27797011,27797341..27797443,
FT                   27799540..27799706,27803210..27803345,27804690..27804866,
FT                   27807267..27807341,27809209..27809268,27813970..27814101,
FT                   27814611..27814730,27815740..27815937,27820643..27820720,
FT                   27823052..27823106,27828070..27828128,27833202..27833267,
FT                   27834841..27835070,27836825..27836946,27837682..27837752,
FT                   27840399..27840494,27846089..27846162,27847854..27847914,
FT                   27850243..27850302,27850586..27850693,27851847..27851943,
FT                   27852425..27852497,27855099..27855201)
FT                   /codon_start=1
FT                   /gene="Nedd4l"
FT                   /locus_tag="mCG_131856"
FT                   /product="neural precursor cell expressed, developmentally
FT                   down-regulated gene 4-like, isoform CRA_a"
FT                   /note="gene_id=mCG131856.1 transcript_id=mCT133198.1
FT                   protein_id=mCP77799.1 isoform=CRA_a"
FT                   /db_xref="GOA:G3X9H8"
FT                   /db_xref="InterPro:IPR000569"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="InterPro:IPR024928"
FT                   /db_xref="MGI:MGI:1933754"
FT                   /db_xref="UniProtKB/TrEMBL:G3X9H8"
FT                   /protein_id="EDL09694.1"
FT                   /translation="MERPYTFKDFLLRPRSHKSRVKGFLRLKMAYMPKNGGQDEENSEQ
FT                   RDDMEHGWEVVDSNDSASQHQEELPPPPLPPGWEEKVDNLGRTYYVNHNNRSTQWHRPS
FT                   LMDVSSESDNNIRQINQEAAHRRFRSRRHISEDLEPEASEGGGEGPEPWETISEEMNMA
FT                   GDSLSLALPPPPASPVSRTSPQELSEEVSRRLQITPDSNGEQFSSLIQREPSSRLRSCS
FT                   VTDTVAEQAHLPPPSTPTRRARSSTVTGGEESTPSVAYVHTTPGLPSGWEERKDAKGRT
FT                   YYVNHNNRTTTWTRPIMQLAEDGASGSATNSNNHLVEPQIRRPRSLSSPTVTLSAPLEG
FT                   AKDSPIRRAVKDTLSNPQSPQPSPYNSPKPQHKVTQSFLPPGWEMRIAPNGRPFFIDHN
FT                   TKTTTWEDPRLKFPVHMRSKASLNPNDLGPLPPGWEERIHLDGRTFYIDHNSKITQWED
FT                   PRLQNPAITGPAVPYSREFKQKYDYFRKKLKKPADIPNRFEMKLHRNNIFEESYRRIMS
FT                   VKRPDVLKARLWIEFESEKGLDYGGVAREWFFLLSKEMFNPYYGLFEYSATDNYTLQIN
FT                   PNSGLCNEDHLSYFTFIGRVAGLAVFHGKLLDGFFIRPFYKMMLGKQITLNDMESVDSE
FT                   YYNSLKWILENDPTELDLMFCIDEENFGQTYQVDLKPNGSEIMVTNENKREYIDLVIQW
FT                   RFVNRVQKQMNAFLEGFTELLPIDLIKIFDENELELLMCGLGDVDVNDWRQHSIYKNGY
FT                   CPNHPVIQWFWKAVLLMDAEKRIRLLQFVTGTSRVPMNGFAELYGSNGPQLFTIEQWGS
FT                   PEKLPRAHTCFNRLDLPPYETFEDLREKLLMAVENAQGFEGVD"
FT   CDS             join(27796965..27797011,27797341..27797443,
FT                   27799540..27799706,27803210..27803345,27804690..27804866,
FT                   27807267..27807341,27813970..27814101,27814611..27814730,
FT                   27815740..27815937,27820643..27820720,27823052..27823106,
FT                   27828070..27828128,27833202..27833267,27834841..27835070,
FT                   27836825..27836946,27837682..27837752,27840399..27840494,
FT                   27846089..27846174,27847854..27847914,27850243..27850302,
FT                   27850586..27850693,27851847..27851943,27852425..27852497,
FT                   27855099..27855201)
FT                   /codon_start=1
FT                   /gene="Nedd4l"
FT                   /locus_tag="mCG_131856"
FT                   /product="neural precursor cell expressed, developmentally
FT                   down-regulated gene 4-like, isoform CRA_e"
FT                   /note="gene_id=mCG131856.1 transcript_id=mCT173874.0
FT                   protein_id=mCP96790.0 isoform=CRA_e"
FT                   /protein_id="EDL09698.1"
FT                   /translation="MERPYTFKDFLLRPRSHKSRVKGFLRLKMAYMPKNGGQDEENSEQ
FT                   RDDMEHGWEVVDSNDSASQHQEELPPPPLPPGWEEKVDNLGRTYYVNHNNRSTQWHRPS
FT                   LMDVSSESDNNIRQINQEAAHRRFRSRRHISEDLEPEASEGGGEGPEPWETISEEMNMA
FT                   GDSLSLALPPPPASPVSRTSPQELSEEVSRRLQITPDSNGEQFSSLIQREPSSRLRSCS
FT                   VTDTVAEQAHLPPPSVAYVHTTPGLPSGWEERKDAKGRTYYVNHNNRTTTWTRPIMQLA
FT                   EDGASGSATNSNNHLVEPQIRRPRSLSSPTVTLSAPLEGAKDSPIRRAVKDTLSNPQSP
FT                   QPSPYNSPKPQHKVTQSFLPPGWEMRIAPNGRPFFIDHNTKTTTWEDPRLKFPVHMRSK
FT                   ASLNPNDLGPLPPGWEERIHLDGRTFYIDHNSKITQWEDPRLQNPAITGPAVPYSREFK
FT                   QKYDYFRKKLKKPADIPNRFEMKLHRNNIFEESYRRIMSVKRPDVLKARLWIEFESEKG
FT                   LDYGGVAREWFFLLSKEMFNPYYGLFEYSATDNYTLQINPNSGLCNEDHLSYFTFIGRV
FT                   AGLAVFHGKLLDGFFIRPFYKMMLGKQITLNDMESVDSEYYNSLKWILENDPTELDLMF
FT                   CIDEENFGQTYQVDLKPNGSEIMVTNENKREYIEYVCTLVIQWRFVNRVQKQMNAFLEG
FT                   FTELLPIDLIKIFDENELELLMCGLGDVDVNDWRQHSIYKNGYCPNHPVIQWFWKAVLL
FT                   MDAEKRIRLLQFVTGTSRVPMNGFAELYGSNGPQLFTIEQWGSPEKLPRAHTCFNRLDL
FT                   PPYETFEDLREKLLMAVENAQGFEGVD"
FT   CDS             join(27834865..27835070,27836825..27836946,
FT                   27837682..27837752,27840399..27840494,27846089..27846162,
FT                   27847854..27847914,27850243..27850302,27850586..27850693,
FT                   27851847..27851943,27852425..27852497,27855099..27855201)
FT                   /codon_start=1
FT                   /gene="Nedd4l"
FT                   /locus_tag="mCG_131856"
FT                   /product="neural precursor cell expressed, developmentally
FT                   down-regulated gene 4-like, isoform CRA_d"
FT                   /note="gene_id=mCG131856.1 transcript_id=mCT173873.0
FT                   protein_id=mCP96792.0 isoform=CRA_d"
FT                   /protein_id="EDL09697.1"
FT                   /translation="MKLHRNNIFEESYRRIMSVKRPDVLKARLWIEFESEKGLDYGGVA
FT                   REWFFLLSKEMFNPYYGLFEYSATDNYTLQINPNSGLCNEDHLSYFTFIGRVAGLAVFH
FT                   GKLLDGFFIRPFYKMMLGKQITLNDMESVDSEYYNSLKWILENDPTELDLMFCIDEENF
FT                   GQTYQVDLKPNGSEIMVTNENKREYIDLVIQWRFVNRVQKQMNAFLEGFTELLPIDLIK
FT                   IFDENELELLMCGLGDVDVNDWRQHSIYKNGYCPNHPVIQWFWKAVLLMDAEKRIRLLQ
FT                   FVTGTSRVPMNGFAELYGSNGPQLFTIEQWGSPEKLPRAHTCFNRLDLPPYETFEDLRE
FT                   KLLMAVENAQGFEGVD"
FT   gene            complement(27907910..27989516)
FT                   /locus_tag="mCG_12606"
FT                   /note="gene_id=mCG12606.2"
FT   mRNA            complement(join(27907910..27908666,27919065..27919113,
FT                   27923313..27923530,27929784..27929872,27931362..27931636,
FT                   27934190..27934225,27934322..27934449,27940067..27940214,
FT                   27944489..27947852,27989008..27989516))
FT                   /locus_tag="mCG_12606"
FT                   /product="mCG12606, transcript variant mCT13285"
FT                   /note="gene_id=mCG12606.2 transcript_id=mCT13285.2 created
FT                   on 03-OCT-2002"
FT   CDS             complement(join(27908447..27908666,27919065..27919113,
FT                   27923313..27923530,27929784..27929872,27931362..27931636,
FT                   27934190..27934225,27934322..27934449,27940067..27940214,
FT                   27944489..27947852,27989008..27989499))
FT                   /codon_start=1
FT                   /locus_tag="mCG_12606"
FT                   /product="mCG12606, isoform CRA_a"
FT                   /note="gene_id=mCG12606.2 transcript_id=mCT13285.2
FT                   protein_id=mCP21533.2 isoform=CRA_a"
FT                   /protein_id="EDL09692.1"
FT                   /translation="MDKAETEASVKPLSGGSDKTEVKQGLESLARERTDEKYPGSKKAA
FT                   LRPTRARRPGMKANTKKQLLRDSAPKGTLDLLPKEPTRQPLPGSYGQEPTHTEAGAPGW
FT                   DSHFHAEVCIPLPAEQDSKILRPPADPLSKEEDSSFEGGGALLNKLFEASQIPDRTDHL
FT                   QMQIQETIGESSSLDQMLAFSVPAEESSTFAGATTHSVSNLSEINRENLSLAQYPGLES
FT                   CPQSLQQEGRPNRDRDLPGALWAESACELSLLEDNEEEESQPPASVALPQGDGVPCREP
FT                   EGLSDSFPQPTAPSLPLENVGSGSRVREAAGGVGCFEAGDQETCYATMDLLVGAPVDKY
FT                   LPQEICPEDLELTEGQSEVCDLCSPDKILAVLQTQGSEPPRSTDKRSQDGKSAEGLLFN
FT                   STFTWDTAKEASEDAVGETAADVENPPSTFSSTLPYSERGFGETQPLCSETISFVKDSE
FT