spacer

EBI Dbfetch

ID   CH466528; SV 2; linear; genomic DNA; CON; MUS; 49650983 BP.
XX
AC   CH466528;
XX
PR   Project:PRJNA11785;
XX
DT   04-AUG-2005 (Rel. 84, Created)
DT   10-JUN-2007 (Rel. 92, Last updated, Version 7)
XX
DE   Mus musculus 232000009757810 genomic scaffold, whole genome shotgun
DE   sequence.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-49650983
RX   DOI; 10.1126/science.1069193.
RX   PUBMED; 12040188.
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Miklos G.L., Wides R.,
RA   Halpern A., Li P.W., Sutton G.G., Nadeau J., Salzberg S.L., Holt R.A.,
RA   Kodira C.D., Lu F., Chen L., Deng Z., Evangelista C.C., Gan W.,
RA   Heiman T.J., Li J., Li Z., Merkulov G.V., Milshina N.V., Naik A.K., Qi R.,
RA   Shue B.C., Wang A., Wang J., Wang X., Yan X., Ye J., Yooseph S., Zhao Q.,
RA   Zheng L., Zhu S.C., Biddick K., Bolanos R., Delcher A.L., Dew I.M.,
RA   Fasulo D., Flanigan M.J., Huson D.H., Kravitz S.A., Miller J.R.,
RA   Mobarry C.M., Reinert K., Remington K.A., Zhang Q., Zheng X.H.,
RA   Nusskern D.R., Lai Z., Lei Y., Zhong W., Yao A., Guan P., Ji R.R., Gu Z.,
RA   Wang Z.Y., Zhong F., Xiao C., Chiang C.C., Yandell M., Wortman J.R.,
RA   Amanatides P.G., Hladun S.L., Pratts E.C., Johnson J.E., Dodson K.L.,
RA   Woodford K.J., Evans C.A., Gropman B., Rusch D.B., Venter E., Wang M.,
RA   Smith T.J., Houck J.T., Tompkins D.E., Haynes C., Jacob D., Chin S.H.,
RA   Allen D.R., Dahlke C.E., Sanders R., Li K., Liu X., Levitsky A.A.,
RA   Majoros W.H., Chen Q., Xia A.C., Lopez J.R., Donnelly M.T., Newman M.H.,
RA   Glodek A., Kraft C.L., Nodell M., Ali F., An H.J., Baldwin-Pitts D.,
RA   Beeson K.Y., Cai S., Carnes M., Carver A., Caulk P.M., Center A.,
RA   Chen Y.H., Cheng M.L., Coyne M.D., Crowder M., Danaher S., Davenport L.B.,
RA   Desilets R., Dietz S.M., Doup L., Dullaghan P., Ferriera S., Fosler C.R.,
RA   Gire H.C., Gluecksmann A., Gocayne J.D., Gray J., Hart B., Haynes J.,
RA   Hoover J., Howland T., Ibegwam C., Jalali M., Johns D., Kline L., Ma D.S.,
RA   MacCawley S., Magoon A., Mann F., May D., McIntosh T.C., Mehta S., Moy L.,
RA   Moy M.C., Murphy B.J., Murphy S.D., Nelson K.A., Nuri Z., Parker K.A.,
RA   Prudhomme A.C., Puri V.N., Qureshi H., Raley J.C., Reardon M.S.,
RA   Regier M.A., Rogers Y.H., Romblad D.L., Schutz J., Scott J.L., Scott R.,
RA   Sitter C.D., Smallwood M., Sprague A.C., Stewart E., Strong R.V., Suh E.,
RA   Sylvester K., Thomas R., Tint N.N., Tsonis C., Wang G., Wang G.,
RA   Williams M.S., Williams S.M., Windsor S.M., Wolfe K., Wu M.M., Zaveri J.,
RA   Chaturvedi K., Gabrielian A.E., Ke Z., Sun J., Subramanian G., Venter J.C.,
RA   Pfannkoch C.M., Barnstead M., Stephenson L.D.;
RT   "A comparison of whole-genome shotgun-derived mouse chromosome 16 and the
RT   human genome";
RL   Science 296(5573):1661-1671(2002).
XX
RN   [2]
RP   1-49650983
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (05-JUL-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
RN   [3]
RP   1-49650983
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (02-SEP-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
DR   MD5; 6193fa81d88c83e5c4bcf6d10f693280.
DR   ENA; AAHY010000000; SET.
DR   ENA; AAHY000000000; SET.
DR   ENA-CON; CM000226.
DR   Ensembl-Gn; ENSMUSG00000001473; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000007480; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000008301; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000023036; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024427; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024431; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024440; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024454; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024471; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024480; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024493; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024497; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024498; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024500; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024502; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024505; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024511; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024512; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024515; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024516; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024518; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024525; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024526; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024529; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024534; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024538; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024544; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024552; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024560; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024570; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024571; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024575; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024576; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024580; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024589; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024610; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024617; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024621; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024622; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024644; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024645; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024646; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025423; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025428; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025880; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025885; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026322; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000033032; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000033319; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000033323; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000034320; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000035394; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000036412; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000036585; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000036880; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038791; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000040560; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000041607; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000042705; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000043079; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000043313; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000043458; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000044022; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000044024; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000044176; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000045569; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000045657; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000045730; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000045876; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000046387; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000046886; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000047033; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000047307; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000047466; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000047910; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000048347; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000048410; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000049090; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000050304; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000051050; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000051242; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000051486; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000051732; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000052102; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000052713; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000053477; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000053624; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000053846; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000054072; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000054477; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000056812; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000057561; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000058152; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000059336; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000060450; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000060534; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000062328; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000071855; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000071856; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000071858; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000073542; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000073555; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000073591; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000075232; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000078963; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000079608; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000079614; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000090942; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000001513; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000003599; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025295; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025300; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025311; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025349; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025357; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025374; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025375; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025377; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025383; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025390; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025393; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025394; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025396; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025403; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025404; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025409; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025413; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025419; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025421; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025434; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025444; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025462; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025463; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025468; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025477; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025523; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025546; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025547; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025549; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000026495; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000026999; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027560; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031549; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000032473; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000036226; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000040359; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000040647; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000041053; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000043498; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000049388; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000050034; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000050487; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000051126; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000051163; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000051442; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000052347; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000053073; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000053640; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000053856; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000055495; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000055725; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000055935; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000055949; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000056915; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000057228; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000058635; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000059571; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000060223; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000060328; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000061405; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000062991; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000063219; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000063775; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000063814; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000064763; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000066140; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000066149; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000066193; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000066532; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000066890; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000066912; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000069749; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000072376; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000072666; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000072726; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000072835; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000073379; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000074157; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000074653; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000078079; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000079716; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000080418; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000080721; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000082254; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000091789; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000091813; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000091884; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000091932; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000096570; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000097542; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000097563; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000097590; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000097609; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000099945; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114748; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114895; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114939; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114943; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114959; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114977; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115268; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115297; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115318; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115498; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115567; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115571; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115582; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000117687; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000117692; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000120472; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000120632; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000121693; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000121875; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000125127; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000125763; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000126432; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000127234; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000130163; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000131348; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000143275; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000146409; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000155195; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000160180; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000160292; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000160639; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000161003; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000162265; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000162511; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000163367; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000163516; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000163590; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000163742; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000164223; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000164666; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000165123; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000166219; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000167610; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000168249; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000168382; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000168419; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000168882; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000168918; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000170811; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000171297; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000171461; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000171470; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000172148; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000174118; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000178011; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000178678; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000183850; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000187157; mus_musculus.
XX
CC   On Sep 6, 2005 this sequence version replaced gi:70980452.
CC   This is the July 2001 combined whole genome shotgun assembly of Mus
CC   musculus. It contains 27 million Celera reads on four Mus musculus
CC   strains (129X1/SvJ, 129S1/SvImJ, DBA/2J and A/J), 13 million reads
CC   on C57BL/6J from the NCBI Trace Archive, 0.4 million BAC end
CC   sequences from TIGR, and unfinished and finished BACs pulled from
CC   NCBI (Nature 2002. 420:520-562). The assembly process relied on
CC   Celera's paired reads and BAC end reads for long range order and
CC   orientation. Its scaffolds were mapped to chromosomes using STS
CC   maps. For more detailed information about whole genome sequencing
CC   and Celera's assembly process, please refer to Venter, J.C. et al.
CC   Science 2001. 291:1304-1351.
CC   This version of genes, transcripts, and proteins was
CC   computationally created in November 2001 from the whole-genome
CC   mapping of transcript and protein sequences on the Celera mouse
CC   genome assembly by Celera Chromosome Team and Content Systems.  The
CC   data sets used by this annotation process were collected in 2001
CC   and include RefSeq (NM_ from mouse and human) sequences, GenBank
CC   mRNA and dbEST sequences, mammalian SwissProt sequences,  and NRAA
CC   sequences (all mouse unless noted otherwise).  The initial gene set
CC   was manually curated between 2002 and 2003. Subsequently, automated
CC   annotation updates were performed.  The CDS of each transcript was
CC   manually or computationally defined by either the longest
CC   ATG-to-Stop or the longest open reading frame. All CDSs
CC   corresponding to the longest open reading frames with no starting
CC   ATG were flagged as partial.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..49650983
FT                   /organism="Mus musculus"
FT                   /chromosome="18"
FT                   /strain="mixed"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   gene            7019..9823
FT                   /locus_tag="mCG_141302"
FT                   /note="gene_id=mCG141302.1"
FT   mRNA            7019..9823
FT                   /locus_tag="mCG_141302"
FT                   /product="mCG141302"
FT                   /note="gene_id=mCG141302.1 transcript_id=mCT174371.1
FT                   created on 23-APR-2004"
FT   CDS             7186..9585
FT                   /codon_start=1
FT                   /locus_tag="mCG_141302"
FT                   /product="mCG141302"
FT                   /note="gene_id=mCG141302.1 transcript_id=mCT174371.1
FT                   protein_id=mCP97287.1"
FT                   /protein_id="EDL10169.1"
FT                   /translation="MEAGEEMEQILKKRQVLLFFVLLGIAQAGSTIRRYSVEEEAENGV
FT                   FVANLLKDLGLEVEELAARGPRVISKGKKLNLEFNRQTGDLLLREKLDREELCGPAEPC
FT                   VVPFQVLLGNPLQIFQAELQIRDINDHSPVFLDKEITLKISESTASGTTFLIERAQDLD
FT                   VGSNGLQTYTINPNFYFHLNLQNSPDGTVLPQLVLDKVLDREERSEIRLILTALDGGNP
FT                   PRSGTVQILIEVLDINDNAPVFSKLRYEVQIPENSPVGSQVATVSARDLDIGDHGNIAY
FT                   AFSQASEDIRKTFRMNATSGEILLVKTLDFESIQAYTICVQATDGGGLSGGSVVIVQVM
FT                   DLNDNPPELTMSTFTNHIPENALETVIAVFSVADSDSGDNGKMVCSIQEDLPFILKPSF
FT                   ENFYTLMTNTALDRETRSQYNITIMVSDLGTPRLTAQHTIIVQVSDINDNAPAFTQTSY
FT                   TIFVRENNSPALHIGTISATDSDSGSNAHITYSLLPPQDPQLALHSLVSINADNGQLFA
FT                   LRALDYEDQQTFKFHVGATDGGSPALSSQTLVRVVVLDDNDNAPFVLYPLQNSSVPCTE
FT                   LLPRAAEPGYLVTKVVAVDRDSGQNAWLSFQLLKATEPGLFSVWAHNGEVRTTRLLSER
FT                   DAPKHRLLLLVKDNGDPPHSASVTLQVLVVDGFSQPYLPLPEVARDPAQDEDILTLYLV
FT                   IALASVSSLFLLSVLLFVGVRLCRRARATSLGGCSMPEGHFPAHLVDVGGAGTLSQSYQ
FT                   YEVCLTGDTGTPDFKFLKPIIPNFLLQSSETENDTNPSYRNSFEFS"
FT   gene            <13194..16191
FT                   /gene="Pcdhb3"
FT                   /locus_tag="mCG_141301"
FT                   /note="gene_id=mCG141301.0"
FT   mRNA            <13194..16191
FT                   /gene="Pcdhb3"
FT                   /locus_tag="mCG_141301"
FT                   /product="protocadherin beta 3"
FT                   /note="gene_id=mCG141301.0 transcript_id=mCT174370.0
FT                   created on 15-OCT-2002"
FT   CDS             13194..15548
FT                   /codon_start=1
FT                   /gene="Pcdhb3"
FT                   /locus_tag="mCG_141301"
FT                   /product="protocadherin beta 3"
FT                   /note="gene_id=mCG141301.0 transcript_id=mCT174370.0
FT                   protein_id=mCP97288.0"
FT                   /protein_id="EDL10168.1"
FT                   /translation="MEAREERFLKQRQVLLLFVFLGGSLAGSMSRRYSVAEEKEKGFVI
FT                   ANLATDLGLSIEELAERRAQAISKGNIQYFQLSHQTGDLLLVEKLDREELCGSTEPCVL
FT                   HFQILLHDPLQFITNELEVIDVNDHAPEFFEKAMQLKVLENFVPGTVIPLGNAVDLDVG
FT                   RNGLQNYTVSPTSHFHVHTRRRRDGRKYPELVLDRALDREEQSEISLTLTALDGGSPPR
FT                   SGTTQVHILVLDTNDNAPEFTQSLYEVQILEKSPIGSVITTVSASDLDTGNFGAISYVF
FT                   FHASEEILETFRLNSSTGNIQLLKGLDYEAINTYEVDVEAKDGGGLSGKCTVIVQILDV
FT                   NDNPPELTLSSVNSLIPENSAETVVAVFSVSDLDSGDNGRVTCSIQNDLPFILKPSVEN
FT                   FYTIASEWALDREIRAEYNITITVSDLGTPRLTTQHTITVQVSDLNDNAPAFTQTSYTM
FT                   SVRENNSPALHIGTISATDSDSGSNAHITYSLLPPHDPQLALDSLISINADNGQLFALR
FT                   ALDYEALQAFEFHVGATDGGSPALSSQALVRVVVLDDNDNAPFVLYPLQNASAPCTELL
FT                   PRAAEPGYLVTKVVAVDRDSGQNAWLSFQLLKSTEPGLFSVWAHNGEVRTARLLSERDM
FT                   LKQKLLLLVKDNGDPPRSASVTLNVLLVDGFSQPYLPLPEMARDSVQNDVDLLTLYLVI
FT                   ALASVSSLFLLSVLLFVGVRLCRRARAASMGGCSVPEGHFPGHLVDVSGMGTLSQSYQY
FT                   EVCLTGDAGTGEFKLLNPVIPNLFLEESERS"
FT   gene            19530..23289
FT                   /gene="Pcdhb4"
FT                   /locus_tag="mCG_141299"
FT                   /note="gene_id=mCG141299.1"
FT   mRNA            19530..23289
FT                   /gene="Pcdhb4"
FT                   /locus_tag="mCG_141299"
FT                   /product="protocadherin beta 4"
FT                   /note="gene_id=mCG141299.1 transcript_id=mCT174369.1
FT                   created on 23-APR-2004"
FT   CDS             19755..22109
FT                   /codon_start=1
FT                   /gene="Pcdhb4"
FT                   /locus_tag="mCG_141299"
FT                   /product="protocadherin beta 4"
FT                   /note="gene_id=mCG141299.1 transcript_id=mCT174369.1
FT                   protein_id=mCP97289.1"
FT                   /protein_id="EDL10167.1"
FT                   /translation="METALAKMSQQRQVVFLTMLLLLWVSGSEAIKYSMPEETESGYLV
FT                   ANLAQDLGIRVGELAAREARVHHRGNKDLLQLDAETGNLFLKEKLDREGLCGATEPCVL
FT                   HFQIILKNPVQFFQTELQLTDINDHSPEFPDTEMLLTIPESAQPGTVFPLKAAQDPDMG
FT                   SNAIQNYTVSPNLHFHVVTLSRSDGRKYPELVLDRALDREEQPELTLILTALDGGAPRR
FT                   SGMTTVHIEIMDINDNAPQFVQSLYEVQVPENFPLDALLVTVSARDLDAGIYGNVAYSL
FT                   FQGDGDSQPFVIDEITGEIRLSKKLDFEVTPYYNVEIAATDGGGLSGKCTVAVQVLDVN
FT                   DNAPELTVSTLSSPIPENSPETVVAVFGVFDPDSGDNGRMVCSIQNELPFLLKSTFENY
FT                   YTLATERPLDRESIAEYNITITVSDMGTPRLTTQHTIKVQVSDINDNAPAFTQTSYTLF
FT                   VHENNSPALHIGTISATDSDSGSNAHITYSLLPPQDPQLALSSLISINADNGQLFALRA
FT                   LDYEALQAFEFHVGATDGGSPALSSQTLVRVVVLDDNDNAPFVLYPLQNASAPYTELLP
FT                   RAAEPGYLVTKVVAVDRDSGQNAWLSFQLLKATEPGLFSVWAHNGEVRTTRLLSERDAP
FT                   KHRLLLLVKDNGEPLRSASVTMHVLVVDGFSQPYLPLPEVALDPTREEDNLTLYLVISL
FT                   ASVSSLFLLSVLLFVGARLCRRAREASLGGYSLPEGHFPGHLVDVSGAGTLSQSYQYEV
FT                   CLSGDSGITDFKFLKPSNPNSLIPDNYMLNS"
FT   gene            <32703..>35081
FT                   /locus_tag="mCG_141297"
FT                   /note="gene_id=mCG141297.0"
FT   mRNA            <32703..>35081
FT                   /locus_tag="mCG_141297"
FT                   /product="mCG141297"
FT                   /note="gene_id=mCG141297.0 transcript_id=mCT174366.0
FT                   created on 15-OCT-2002"
FT   CDS             32703..35081
FT                   /codon_start=1
FT                   /locus_tag="mCG_141297"
FT                   /product="mCG141297"
FT                   /note="gene_id=mCG141297.0 transcript_id=mCT174366.0
FT                   protein_id=mCP97290.0"
FT                   /protein_id="EDL10166.1"
FT                   /translation="MEKLERNHRNRQVIPFLFMLLWDEVLMVPTRYSVLEESESGSFVA
FT                   HLAKDLGLGAGELAARSARVVSDHDKQQLILDPETGDLLLREKLDREELCGSVDPCVLH
FT                   FQVFLEKPVQFFQGELLIQDINDNSPEFPDKELLLKIPENSQPGTRFSLKLAQDLDVGS
FT                   NGLQQYTVNPNSHFHVLTRNNSEGKKYPELVQDRALDREEQAELSLILTALDGGSPPRS
FT                   GTALVRILIMDINDNAPEFVNNPYEVQVLESSPPDSPVLTVFAQDADAGNFGRVSYGLF
FT                   QASDEIQKTFSINEFTGEIRLKTKLDFEKTKSYHVEIEATDGGGLSGKGSVVIEVLDVN
FT                   DNAPELTISSLTSSVPENSPETVVAIIRIRDRDAGENGKMICSISDHVPFILKPSYKNF
FT                   YTLVTESPLDRESRAEYNITITVSDLGTPRLTTQHTITVQVSDVNDNAPAFTRTSYTMF
FT                   VRENNSPALHIGTISATDSDSGSNAHITYSLLPPHDPQLALHSLISINADNGQLFALSA
FT                   LDYEALQGFEFYVGATDRGSPELSSRALVRVVVLDDNDNAPFVLYPLQNASAPCTELLP
FT                   RAAEPGYLVTKVVAVDRDSGQNAWLSFQLLKATEPGLFSVWAHNGEVRTTRLLSERDAP
FT                   KHRLLLLVKDNGEPQRSASVTLHVLLVDGFSQPYLPLPEVARDPAQDDTDVLTLYLVIA
FT                   LASVSSLFLLSVLMFVGVRLCRRAREPSLSGCSVPEGHFPGHLVDVSHAGTLSQSYQYD
FT                   VCLTGESGTGEFKFLKPIVPNLMVQDTGNLHCRDSFVFS"
FT   assembly_gap    37525..37544
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <48681..>50309
FT                   /locus_tag="mCG_141295"
FT                   /note="gene_id=mCG141295.0"
FT   mRNA            <48681..>50309
FT                   /locus_tag="mCG_141295"
FT                   /product="mCG141295"
FT                   /note="gene_id=mCG141295.0 transcript_id=mCT174376.0
FT                   created on 15-OCT-2002"
FT   CDS             48681..>50309
FT                   /codon_start=1
FT                   /locus_tag="mCG_141295"
FT                   /product="mCG141295"
FT                   /note="gene_id=mCG141295.0 transcript_id=mCT174376.0
FT                   protein_id=mCP97293.0"
FT                   /protein_id="EDL10165.1"
FT                   /translation="METTLAKTPEKRQVVFLAILLLLWEAGSEAIRYSIPEETESGYLV
FT                   AHLAKDLGFRVGELATRRARIHHRGNKELLQLDVETGNLLLKEKPDREALCGATEPCVL
FT                   HFQIILENPVQFFQTELQLTDINDHSPEFPDTEMLLKIQESTQPATVFLLKAAQDSDIG
FT                   SNAVQNYTVSPNLHFHVVTLSRSDGRKYPELVLDRALDREEQPELTLILTALDGGAPPK
FT                   SGTTTVRIEVVDINDNAPEFVQSLYSVEVPENSPLDALVVTVSARDLDAGIHGNVAYSL
FT                   FQGGGGPQPFVIDEITGEIRLKGALDFEATSYYTMEIVATDSGGLSGKCTVAIQVLDVN
FT                   DNAPKLTISSLTSSIPENAPEAVVAVFSVSDPDSGDNGRMVCSIQNELPFLLKPTFENY
FT                   YTLAAEGPLDREIREEYNITIIVSDLGTPRLTTQHTITVQVVDINDNAPAFTQTSYTMF
FT                   VHENNNPALHIGTISATDSDSGSNAHITYSLLPPHDLQLSLASLVSINADNGQLFALRA
FT                   MDYEALQAFEFHVGATDGGSPALSSQ"
FT   assembly_gap    50311..50330
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    55337..55356
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <60572..63469
FT                   /locus_tag="mCG_141294"
FT                   /note="gene_id=mCG141294.0"
FT   mRNA            <60572..63469
FT                   /locus_tag="mCG_141294"
FT                   /product="mCG141294"
FT                   /note="gene_id=mCG141294.0 transcript_id=mCT174364.0
FT                   created on 15-OCT-2002"
FT   CDS             60572..62968
FT                   /codon_start=1
FT                   /locus_tag="mCG_141294"
FT                   /product="mCG141294"
FT                   /note="gene_id=mCG141294.0 transcript_id=mCT174364.0
FT                   protein_id=mCP97291.0"
FT                   /db_xref="GOA:Q925M2"
FT                   /db_xref="InterPro:IPR002126"
FT                   /db_xref="InterPro:IPR013164"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR020894"
FT                   /db_xref="MGI:MGI:2136741"
FT                   /db_xref="UniProtKB/TrEMBL:Q925M2"
FT                   /protein_id="EDL10164.1"
FT                   /translation="MEKLEKAHPKRQVIAFIFMMVLVQVCSEPTTQYSILEETESGSFV
FT                   AHLAKDLGLGARELAARSARVVSDDYKQRLLLDPETGDLLLREKVDREEVCSTVDPCVL
FT                   HFQVTLEKPVQYFQGELLIQDINDHAPEFPEGEMLLNIPENSQPGTLLPLNLAQDLDVG
FT                   SNGLQQYTVSPNSHFHVLTRNNSEGKKYPELVQDRALDREEQAELSLTLIALDGGSPPR
FT                   SGTALVRILIMDINDNAPEFVNSPYEVQVLESSLPDSPVLTVFAQDADAGNFGRVSYGF
FT                   FQASDEIQRTFSINKVTGEIQLKKELDFEKIKFYHVKIEATDGGGLSGKGLVIVEVLDV
FT                   NDNAPELTISSLTSSVPENAPETIISIFRVGDRDSGENAKVVCSIPENLPFILKSTFKN
FT                   FYTLVTESPLDRESRAEYNITIMVSDLGTPRLTTWHTITVQVSDVNDNAPAFTRTSYTM
FT                   FVRENNSPALHIGTISATDSDSGSNAHITYSLLLPHDPELPLSSLISINADNGQLFALR
FT                   ALDYEVLQAFEFHVGATDRGSPALSSQALVRVVVLDDNDNAPFVLYPMQNTSAPCTELL
FT                   PRAAEPGYLVTKVVAVDRDSGQNAWLSFQLLKATEPGLFSVWAHNGEVRTSRLLSERDA
FT                   LKHRLLMLVKDNGEPPRSASVTLHVLLVDGFSQPYLSLPEVAPDPTQEVEDALTVYLVI
FT                   ALASVSSLFLLSVVLFVGVKLCRRAREPSLGGCSVPEELFPGHMVDVSGTGTLSHNYQY
FT                   EVCLTRDSGIGEFKFLKPMIPNLLVQDAGRELNENLHCRDSFVFS"
FT   gene            <73913..>76252
FT                   /locus_tag="mCG_141292"
FT                   /note="gene_id=mCG141292.0"
FT   mRNA            <73913..>76252
FT                   /locus_tag="mCG_141292"
FT                   /product="mCG141292"
FT                   /note="gene_id=mCG141292.0 transcript_id=mCT174363.0
FT                   created on 15-OCT-2002"
FT   CDS             73913..76252
FT                   /codon_start=1
FT                   /locus_tag="mCG_141292"
FT                   /product="mCG141292"
FT                   /note="gene_id=mCG141292.0 transcript_id=mCT174363.0
FT                   protein_id=mCP97292.0"
FT                   /db_xref="GOA:Q91XZ2"
FT                   /db_xref="InterPro:IPR002126"
FT                   /db_xref="InterPro:IPR013164"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR020894"
FT                   /db_xref="MGI:MGI:2136742"
FT                   /db_xref="UniProtKB/TrEMBL:Q91XZ2"
FT                   /protein_id="EDL10163.1"
FT                   /translation="METALTKTPEKRQVIFLAILLLLWEASSEAISYSMPEETESGYLV
FT                   ANLAQDLGLRVGELTTRGARIHHNGNKELLQLDAERGNLLLKEKPDREALCGATEPCVL
FT                   HFQIILENPVQFFQTDLQFTDINDHFPEFPDTEMLLKIQEIAQPGTVFPLKAAQDPDIG
FT                   SNAVQNYTVSPNLHFHVVTLSRSDDRKYPELVLDRALDREEQPELTLILTALDGGAPPK
FT                   SGTTTVRIEVVDINDNAPQFLQSLYAVEVPENSPLNALVVTVSARDLDAGIHGNVAYSL
FT                   FQGGGGPQPFVIDEITGEIRLKGALDFEATSYYTMEIVATDSGGLSGKCTVAIQVLDVN
FT                   DNAPKLTISSLTSSIPENAPEAVVAVFSVSDPDSGDNGRMVCSIQNGLPFLLKPTFKNF
FT                   YTLVTERPLDRESNAEYNITITVSDLGTPRLTTQHTITVQVSDINDNAPAFTQTSYTLF
FT                   VHENNSPALHIGTISATDSDSGSNGLIIYSLLPPHDQQLGLASLISINSDNGQLFALRA
FT                   LDYEALQAFEFHVGATDRGSPALSSEALVRVVVLDDNDNAPFVLYPLQNASAPCTELLP
FT                   RAAEPGYLITKVVAVDRDSGQNAWLSFQLLKATEPGLFSVWAHNGEVRTTRLLSERDAP
FT                   KHRLLLLVKDNGEPLRSASVMLQVLVVDGFSQPYLPLPEVALNPTQEEDMLTLYLVIAL
FT                   ASVSSLFLLSVLLFVGVKLCKKAREASLADCSIPEGHFPSHLVDVSGAGTLSQSYHYEV
FT                   CLTEDSGTSDFKFMNPIIPSSLLQDS"
FT   assembly_gap    88456..88475
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <119252..>121633
FT                   /locus_tag="mCG_141289"
FT                   /note="gene_id=mCG141289.0"
FT   mRNA            <119252..>121633
FT                   /locus_tag="mCG_141289"
FT                   /product="mCG141289"
FT                   /note="gene_id=mCG141289.0 transcript_id=mCT174358.0
FT                   created on 15-OCT-2002"
FT   CDS             119252..121633
FT                   /codon_start=1
FT                   /locus_tag="mCG_141289"
FT                   /product="mCG141289"
FT                   /note="gene_id=mCG141289.0 transcript_id=mCT174358.0
FT                   protein_id=mCP97286.0"
FT                   /db_xref="GOA:Q91XZ1"
FT                   /db_xref="InterPro:IPR002126"
FT                   /db_xref="InterPro:IPR013164"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR020894"
FT                   /db_xref="MGI:MGI:2136744"
FT                   /db_xref="UniProtKB/TrEMBL:Q91XZ1"
FT                   /protein_id="EDL10162.1"
FT                   /translation="MEKLGRIHLNRQVMAFIFMMVLVQVCSEPTIRYSILEETESGSFV
FT                   AHLAKDLGLGARELAARSARVLSDDYKQRLLLDPETGDLLLREKVDREEVCSTVDPCVL
FT                   HFQVTLEKPVQYFQRELLIQDINDHAPEFPDRELLLRIPENSQQGTQFSLNLAQDLDVG
FT                   SNGLQQYTVSPNPYFHVLTQNNSKGKKYPELVQDRGLDREEQAELSLTLTALDGGSPPR
FT                   SGTALVRILIMDINDNAPEFVNSPYEVQVLESSPPDSPVLTVLARDADAGNFGRVSYGF
FT                   FQASDEIQQTFSINATSGDMRLKKKLDFEKIKSYHVEIEAIDGGGLSGKGSVTIEVVDV
FT                   NDNAPELTISSLTSSVPENAPETIISIFRVGDRDSGENGKMVCSIPENLPFILKSTFKN
FT                   FYTLVTESPLDRESRAEYNITIMVSDMGTPRLTTWHTIKVQVSDINDNTPAFTQTSYTM
FT                   FVRENNSPALHIGTISATDSDSGSNAHITYSLLPPHDPELALSSLISINADNGQLFALR
FT                   ALDYEALQVFEFHVGATDGGSPPLSSQALVRVVVLDDNDNAPFVLYPMQNASAPFTELL
FT                   PRAAEPGYLVTKVVAVDRDSGQNAWLSFQLLKATEPGLFSVWAHNGEVRTTRLLSERDV
FT                   PKHRLLLVVKDNGEPQRSASVTLQVLLVDGFSQSYLPLPEVARDPAHEDEDVLTLYLVI
FT                   ALASVSSLFLLSVLLFVGVRLCRRAREVSLGGCSMPGEHFPGHLVDVSGAGTLSQSYQY
FT                   EVCLRGDSGTGEFKFLKPMIPNAGIEIMESPHCRDSFVFN"
FT   gene            <130063..>132456
FT                   /gene="Pcdhb10"
FT                   /locus_tag="mCG_141287"
FT                   /note="gene_id=mCG141287.0"
FT   mRNA            <130063..>132456
FT                   /gene="Pcdhb10"
FT                   /locus_tag="mCG_141287"
FT                   /product="protocadherin beta 10"
FT                   /note="gene_id=mCG141287.0 transcript_id=mCT174359.0
FT                   created on 15-OCT-2002"
FT   CDS             130063..132456
FT                   /codon_start=1
FT                   /gene="Pcdhb10"
FT                   /locus_tag="mCG_141287"
FT                   /product="protocadherin beta 10"
FT                   /note="gene_id=mCG141287.0 transcript_id=mCT174359.0
FT                   protein_id=mCP97285.0"
FT                   /db_xref="GOA:Q91VE5"
FT                   /db_xref="InterPro:IPR002126"
FT                   /db_xref="InterPro:IPR013164"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR020894"
FT                   /db_xref="MGI:MGI:2136745"
FT                   /db_xref="UniProtKB/TrEMBL:Q91VE5"
FT                   /protein_id="EDL10161.1"
FT                   /translation="MEMTLAKTPENRQVLFFTILLLLWKSCADAIIYSIPEETESGYLV
FT                   ANLAKDLGLRVGELAIRGARIHYKGNKELLQLDAETGNLFLKEKPDREVLCRATEPCVL
FT                   HFQIILENPVQFFQTELQLTDINDHSPEFPDRKMLLKIPESAQPGTTFPLKAAQDPDIG
FT                   SNAVQNYTVSPNLHFHVVTLSRSDGRKYPELVLDRALDREEQPELTLILTALDGGAPPR
FT                   SGTTEVHIEVVDINDNAPQFIQSLYEVQILENSPLDALVATVSARDLDAGIYGKVAYSL
FT                   FQDDGISQPFVIDEITGEIRLKGALDFEATPYYNMEIVATDPGGFSGKCTVVIQVVDVN
FT                   DNAPKLTISSLNSSIPENAPETVVAVFSVSDPDSGENGRMVCSIQNELPFLLKSTFENY
FT                   YTLVTEGTLDRESKAEYNITISVTDLGTPRLTTQHTITVQVSDINDNAPTFTRTSYTMF
FT                   IRENNSPALHIGTISATDSDAGSNAHITYSLLPPHDPQLTLTSLVSINEDNGQLFALRA
FT                   LDYEALRAFEFHVRATDRGSPALSSQALVLVVVLDDNDNEPFVLYPLQNSSAPCKELVP
FT                   RAAEAGYLVTKVVAVDRDSGQNAWLSFQLLKATEPGLFSVWAHNGEVRTTRLLSERDAP
FT                   KHRLLLVVKDNGDPPRSASVTLHVLLVDGFSQPYLPLSEVVQDPAQEGDDALTLYLVIA
FT                   LASVSSLFLISVLLFVGMKLCKRARSPSLGVCSVPEGHFPGHLVDVSGTGTLSQSYQYE
FT                   VCLSGDSGTGEFKFLKPMISNLMVQDPEREVKESPHCRDSFVFS"
FT   gene            139587..142898
FT                   /locus_tag="mCG_141285"
FT                   /note="gene_id=mCG141285.1"
FT   mRNA            139587..142898
FT                   /locus_tag="mCG_141285"
FT                   /product="mCG141285"
FT                   /note="gene_id=mCG141285.1 transcript_id=mCT174372.1
FT                   created on 23-APR-2004"
FT   CDS             139790..142183
FT                   /codon_start=1
FT                   /locus_tag="mCG_141285"
FT                   /product="mCG141285"
FT                   /note="gene_id=mCG141285.1 transcript_id=mCT174372.1
FT                   protein_id=mCP97278.1"
FT                   /db_xref="GOA:Q91UZ8"
FT                   /db_xref="InterPro:IPR002126"
FT                   /db_xref="InterPro:IPR013164"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR020894"
FT                   /db_xref="MGI:MGI:2136746"
FT                   /db_xref="UniProtKB/TrEMBL:Q91UZ8"
FT                   /protein_id="EDL10160.1"
FT                   /translation="METALAKMPEQRQVFFLTILLLLWKSGSGATRYSMPEEKESGYLV
FT                   ANVAKDLGLRVGELATRGAQIHYKGNKELLQMDAETGNLFLKEKLDREALCGATEPCVL
FT                   HFQVILENPVQFFQTELQLTDINDHSPEFPDREMLLKIPENAQPGTVFPLKAAQDSDIG
FT                   SNAVQNYTVSPNIHFHVITHSRSDGRKYPELVLDRALDREEQPELTLILTALDGGAPPR
FT                   SGTTIVHIEVVDINDNAPQFIQSLYEVQILENSPIDTLVVTVSARDLDSGIYGNVAYSL
FT                   FQGDGLSQPFVIDEVTGEIRLSKELDFEGISHYNIEIAATDGGDLLGKCTVVIQVLDVN
FT                   DNAPELMIRKLTVPVPENSAETVVAVFSVSDSDSGDNGRIVCSIQNNIPFLLKPTFENY
FT                   YTLVTEGPLDRESRAEYNITITVWDLGTPRLTTQHTITVQVSDINDNAPAFTQTSYTLF
FT                   VQENNSPALQIGTISATDSDSGSNAHITYSLLLPQDPQLALASLISINPDNGQLFVLRA
FT                   LDYESLQAFEFRVGATDQGSPALSSQTLVRVVVLDDNDNAPFVLYPMQNASAPCTELLP
FT                   REAESGYLVTKVVAVDRDSGQNAWLSFQLLKATEPGLFSVWAHNGEVRTTRLLSERDVP
FT                   KHRLLLLVKDNGEPQLSASVTLQVLLVNSFSQPYLSLPEVAQDPIQEDGEMLTLYLVIA
FT                   LASVSSLFLLSVLMFVGMRLCRRAREASLGVCSVPEGHFPGHLMDVSGTGTLSHSYQYD
FT                   VCLSGDSRTGEFKFLKPMIPNVMVQEAGREVKENPPCRDSFVFS"
FT   gene            153807..156825
FT                   /locus_tag="mCG_141300"
FT                   /note="gene_id=mCG141300.1"
FT   mRNA            153807..156825
FT                   /locus_tag="mCG_141300"
FT                   /product="mCG141300"
FT                   /note="gene_id=mCG141300.1 transcript_id=mCT174373.1
FT                   created on 25-JUN-2004"
FT   CDS             153974..156343
FT                   /codon_start=1
FT                   /locus_tag="mCG_141300"
FT                   /product="mCG141300"
FT                   /note="gene_id=mCG141300.1 transcript_id=mCT174373.1
FT                   protein_id=mCP97277.1"
FT                   /db_xref="GOA:Q91Y07"
FT                   /db_xref="InterPro:IPR002126"
FT                   /db_xref="InterPro:IPR013164"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR020894"
FT                   /db_xref="MGI:MGI:2136747"
FT                   /db_xref="UniProtKB/TrEMBL:Q91Y07"
FT                   /protein_id="EDL10159.1"
FT                   /translation="MPGQRQVFFLTILLLFWKSDSEAIRYSMPEEKESGYLVANVAKDL
FT                   GLRVEELATRGAQIHYRGNKELLQMDAETGNLFLKEKLDREALCGATEPCVLHFQIILE
FT                   NPVQFFQTELQLTDINDHSPEFSDTEMLLTIPENAQPGTVFPLKAAHDSDIGSNAVQNY
FT                   TVNPNIHFHVVTLSRSDGRKYPELVLDRALDREEQPELTLTLTALDGGSPPRSGTTEVH
FT                   IEVVDINDNAPQFIQSLYEVQVPENSPLNALVVMVSATDLDAGIYGNVAYSLFQGDGLS
FT                   QPFVIDKITGEIRLTKELDFEVSHHYTIEIAATDGGGLSGKCTVVIQVLDVNDNAPELA
FT                   IRKLTVPVPENSAETVVAVFSVSDSDSGDNGRIVCSIQNNIPFLLKPTFENYYTLVTEG
FT                   PLDRESRAEYNITITVWDLGTPRLTTQHTITVQVADINDNAPAFTQTSYTLFVQENNSP
FT                   ALHIGTISATDSDSGSNAHITYSLLPPHDSQLALASLVSINSDNGQLFALRAMDYEMLQ
FT                   AFELHVDATDGGSPALSSQALVRVVVLDDNDNSPFVLYPMQNASAPCTELLPRAAEPGY
FT                   LITKVVAVDRDSGQNAWLSFQLLKATEPGLFSVWAHNGEVRTTRLLSERDAPKHKLLLL
FT                   VKDNGDPPRSASVTLHVLVVDGFSQPYLPLPEVARDSTQDDYDVLTLYLVVALASVSSL
FT                   FLLSVLLFVGVRLCRRARAASLGDYSVPEGHFPSHLVDVSRAGTLSQSYQYEVCLNGGT
FT                   GTNEFNFLKPLFPILPTQAAAEERENAVVRNSVEFY"
FT   gene            <160742..>163132
FT                   /gene="Pcdhb13"
FT                   /locus_tag="mCG_141298"
FT                   /note="gene_id=mCG141298.0"
FT   mRNA            <160742..>163132
FT                   /gene="Pcdhb13"
FT                   /locus_tag="mCG_141298"
FT                   /product="protocadherin beta 13"
FT                   /note="gene_id=mCG141298.0 transcript_id=mCT174375.0
FT                   created on 15-OCT-2002"
FT   CDS             160742..163132
FT                   /codon_start=1
FT                   /gene="Pcdhb13"
FT                   /locus_tag="mCG_141298"
FT                   /product="protocadherin beta 13"
FT                   /note="gene_id=mCG141298.0 transcript_id=mCT174375.0
FT                   protein_id=mCP97294.0"
FT                   /db_xref="GOA:Q91Y06"
FT                   /db_xref="InterPro:IPR002126"
FT                   /db_xref="InterPro:IPR013164"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR020894"
FT                   /db_xref="MGI:MGI:2136748"
FT                   /db_xref="UniProtKB/TrEMBL:Q91Y06"
FT                   /protein_id="EDL10158.1"
FT                   /translation="MSHAKMWCKTRQVMVLITSMLLWEVGSGSIQYAMLEETESGTFVA
FT                   NLTKHLGLRVGELAARDARVVFKGNRQYLQLDPQTQDLMLNENLDREELCGSTEPCVLS
FT                   FRVLLKNPLQFYQAELRVIDINDHAPEFPAREMLLKISEIAPPGKIFPLKMAQDLDTGS
FT                   HSIQSYTVSDNPHFHVLTRNRSDGKKFPELVLDKALDREKQDQLRLKLTAVDGGSPPRS
FT                   GTTEIQILVLDINDNTPEFAQELYEVQVPENSPIGSLLITVSARDLDAGPFGEVSYGLS
FT                   QDDDVNEPFEINTKTGEIRLKSTLDFEAFQSYHVDVEALDGGGLTGKCSLVVQVLDVND
FT                   NAPEVILSSLNSPIPENLPGIIVAVFSVSDADSGNNQQVMCSIDDNLPFLLRPSMENFY
FT                   TLETDGALDRESRSEYNITITVTDMGTPRLTTQHNITVQVSDINDNAPAFTQTSYTLFV
FT                   HENNSPALHIGTISATDSDSGSNAHITYSLLLPQDKQLTLTSLVSINADNGQLFALRAL
FT                   DYEALQAFEFRVDATDQGSPALSSQVLVRVVVLDDNDNAPFVLYPMQNASAPCTELLPR
FT                   AAEPGYLVTKVVAVDRDSGQNAWLSFQLFKATEPGLFSVWAHNGEVRTTRLLSERDVPK
FT                   HRLLLLVKDNGEPPRSASVTLHVLLVDGFSQPYLPLPEVAQDSTEDAEDALTLYLVIAL
FT                   ASVSSLFLLSVVLFVGVRLCKKFRAASLGGYSVPEGHFPGHLVDVSGAGTLSQSYQYEV
FT                   CLRGDTGTGEFKLRKAINPHFPSVPSERNTEESPTLRNSFLFI"
FT   gene            165826..169265
FT                   /gene="Pcdhb14"
FT                   /locus_tag="mCG_141296"
FT                   /note="gene_id=mCG141296.1"
FT   mRNA            165826..169265
FT                   /gene="Pcdhb14"
FT                   /locus_tag="mCG_141296"
FT                   /product="protocadherin beta 14"
FT                   /note="gene_id=mCG141296.1 transcript_id=mCT174374.1
FT                   created on 23-APR-2004"
FT   CDS             165978..168404
FT                   /codon_start=1
FT                   /gene="Pcdhb14"
FT                   /locus_tag="mCG_141296"
FT                   /product="protocadherin beta 14"
FT                   /note="gene_id=mCG141296.1 transcript_id=mCT174374.1
FT                   protein_id=mCP97295.1"
FT                   /protein_id="EDL10157.1"
FT                   /translation="MIICCIFWSRGTMETSLHKAPQKRQVTAIIFLLLLWEAGSATITY
FT                   SVLEETDRGSLVGNLAKDLGLSLRELITRGAQILSKGNKQLLQLEQKSGNLLLKEKLDR
FT                   EELCGSTNPCILHFQVLLKSPVQFIQGEIQLQDVNDHAPEFMEDEILLKILESSLPGAV
FT                   FPLKIAQDLDVGSNTVQNYTISTNAHFHLLTRNHSDGRKYPELVLDKALDREEQAQIRL
FT                   TLTAMDSGSPPKTGTTQVVIVVLDINDNAPEFAQGLYEVQVQENSPVGSLVLTVSARDL
FT                   DAGTHGELSYSLFQSSNQVLQAFEVNTDTGEIRVRKLLDFEEIQSYRMEIEASDGGGLS
FT                   GKCTVVIHVMDVNDNAPELTMSVLISEIPENSPETIVAIFGISDPDSGDNGKMVCSVQD
FT                   RLPFLLKPNEENFYTLVTERALDRESRAEYNITITVSDMGTPRLTTQHTITVQVSDIND
FT                   NAPAFTHTSYTMFVRENNSPALHIGTISATDSDSGSNAHITYSLLPPHDPQLALNSLIS
FT                   INADNGQLFALRALDYEALQAFEFHVGATDGGSPALSSQALVRVVVLDDNDNAPFVLYP
FT                   MQNASAPCTELLPRAAEPGYLVTKVVAVDRDSGQNAWLSFQLLKTTEPGLFSVWAHNGE
FT                   VRTTRLLSERDVPKHRLLLLVKDNGEPPHSASVTLHVLLVDGFSQPYLPLPEVARDPAQ
FT                   EDVLTLYLVIALASVSSLFLVSVLLFVGVRLCRKAGETSLGGCSVPEGHFPGHLVDVSG
FT                   TGTLSQSYQYEVCLTGGTGTNEFKFLKPVLPNFLNEGGYRNTEENSNFRDSLGFS"
FT   gene            191715..194510
FT                   /gene="Pcdhb15"
FT                   /locus_tag="mCG_141293"
FT                   /note="gene_id=mCG141293.1"
FT   mRNA            191715..194510
FT                   /gene="Pcdhb15"
FT                   /locus_tag="mCG_141293"
FT                   /product="protocadherin beta 15"
FT                   /note="gene_id=mCG141293.1 transcript_id=mCT174361.1
FT                   created on 23-APR-2004"
FT   CDS             191887..194247
FT                   /codon_start=1
FT                   /gene="Pcdhb15"
FT                   /locus_tag="mCG_141293"
FT                   /product="protocadherin beta 15"
FT                   /note="gene_id=mCG141293.1 transcript_id=mCT174361.1
FT                   protein_id=mCP97283.1"
FT                   /db_xref="GOA:Q91Y04"
FT                   /db_xref="InterPro:IPR002126"
FT                   /db_xref="InterPro:IPR013164"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR020894"
FT                   /db_xref="MGI:MGI:2136750"
FT                   /db_xref="UniProtKB/TrEMBL:Q91Y04"
FT                   /protein_id="EDL10156.1"
FT                   /translation="MEARLEQAVQKRQVLFLYVFLGASWASAEQLQYSVAEETERGTFL
FT                   ANLAKDLGLGLGELSAREARIVSDQNTRFLLLSPLTGELILNEKLDREELCGPTEPCVL
FT                   TFQLLLERPFQIYRAALHIKDINDNSPVFLDKEILLKISESTTPGATLLLERAQDADVG
FT                   TNSLSNYTISPNDYFHIHVHDGGEGPIIPELVLDKMLDREEIPEFTLTLTALDGGSPPR
FT                   SGTALVQILVLDINDNSPQFVQSLYKVQSPENTPVGSLVVAVSARDLDTGSYGQIDYTF
FT                   FYATERILQTFQINSTSGELYLKRELNYEAIQTYSITIQARDGGGLSGKCAVVVEVMDV
FT                   NDNPPEFLLSSLNSPIPENSQETVVAVFKIRDRDSGNNGKTLCSIANDLPFVLKPSVEN
FT                   FYTLVTEKPLDRESNTEYNITITVTDMGIPRLTTQHTITVQVSDINDNAPTFTQTSYTM
FT                   FVRENNSPALHIGTISATDSDSGSNAHITYSLRLPHDPQLALDSLISINADNGQLFALR
FT                   ALDYEALQAFEFHVGAIDQGSPALSSQALVRVVILDDNDNAPFVLYPMQNASAPYTELL
FT                   PRAAEPGYLVTKVVAVDRDSGQNAWLSFQLLKATEPGLFSVWAHNGEVRTTRLLSERDV
FT                   PKHKLLVVVKDNGEPPRSASVTLHVLLVDGFSQPFLILPEVARDPAQEDDELTLYLVIA
FT                   LASVSSLFLVSVLLFVGVRLCRRARAASPGVCFVPEEHFPGHLVDVSGAGTLSQNYQYE
FT                   VCLTGGSGITSEFKFLSPIASNFLTESTGREIE"
FT   gene            <196157..>198565
FT                   /locus_tag="mCG_141291"
FT                   /note="gene_id=mCG141291.0"
FT   mRNA            <196157..>198565
FT                   /locus_tag="mCG_141291"
FT                   /product="mCG141291"
FT                   /note="gene_id=mCG141291.0 transcript_id=mCT174360.0
FT                   created on 15-OCT-2002"
FT   CDS             196157..198565
FT                   /codon_start=1
FT                   /locus_tag="mCG_141291"
FT                   /product="mCG141291"
FT                   /note="gene_id=mCG141291.0 transcript_id=mCT174360.0
FT                   protein_id=mCP97284.0"
FT                   /db_xref="GOA:Q91Y03"
FT                   /db_xref="InterPro:IPR002126"
FT                   /db_xref="InterPro:IPR013164"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR020894"
FT                   /db_xref="MGI:MGI:2136752"
FT                   /db_xref="UniProtKB/TrEMBL:Q91Y03"
FT                   /protein_id="EDL10155.1"
FT                   /translation="MEASRKLICRQRQVLFFFLLLGFPLTTAGELRRYSVVEEKEGRSF
FT                   VTNLVKDLGLGQLELSRRGAKVISKGNKLHLQLDQETGDLLLNEKVDREKLCGHTEPCL
FT                   LSFQVLLDNPLDIFQAELEVTDINDHSPEFLDKEIMLKISESSLPGATFPLKNAQDMDV
FT                   GQNGIDKYLISSNSYFRVLTRKRSDGKKYPELVLDRALDREEEAELRLTLTAQDGGSLP
FT                   RSGTTEVHIEVLDINDNAPQFEQLFYKAQIPEDSPIGFLIITVSATDKDIGVNGQISYS
FT                   LFQVSDDISKTFSIHPLTGEVRLKEHLDFEKTQSYEINIEARDAGTFSGKCTILAQVLD
FT                   VNDHAPEIILSAFTNSILENLPETMVAVFSVSDLDSGENGKVSCSIQDDLPFFLKPSGE
FT                   NFYTLLSQKPLDRESVAEYNITITVADMGSPILKTQVNLTVQVSDINDNAPIFTQTSYT
FT                   MFIRENNSPALHIGTISATDSDSGSNAHITYSLLPPHDHQLALASFISINADNGQLFVL
FT                   RALDYEALQAFEFHVGATDGGSPALSSQALVRMVVLDDNDNAPFVLYPMQNASAPYTEL
FT                   LPRAAEPGYLVTKVVAVDRDSGQNAWLSFQLLKATEPGLFSVWAHNGEVHTSRLLSERD
FT                   VHKHRLILLVKDNGDPPRSASVTLHVLLVDGFSQPYLPLPEVARDPDHEDSELTLYLVI
FT                   ALASVSSLFLVSVLLFVGVRLCRRAREVSLGGCSVPEGHFPGHLVDVSGTGTLSQSYQY
FT                   EVCLTGDSGTGEFKYLKPILPNFQDHSFRPEMGENPNSRNDWSFGIQLK"
FT   gene            <203336..206466
FT                   /locus_tag="mCG_141290"
FT                   /note="gene_id=mCG141290.0"
FT   mRNA            <203336..206466
FT                   /locus_tag="mCG_141290"
FT                   /product="mCG141290"
FT                   /note="gene_id=mCG141290.0 transcript_id=mCT174362.0
FT                   created on 15-OCT-2002"
FT   CDS             203336..205735
FT                   /codon_start=1
FT                   /locus_tag="mCG_141290"
FT                   /product="mCG141290"
FT                   /note="gene_id=mCG141290.0 transcript_id=mCT174362.0
FT                   protein_id=mCP97282.0"
FT                   /db_xref="GOA:Q91VD8"
FT                   /db_xref="InterPro:IPR002126"
FT                   /db_xref="InterPro:IPR010221"
FT                   /db_xref="InterPro:IPR013164"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR020894"
FT                   /db_xref="MGI:MGI:2136754"
FT                   /db_xref="UniProtKB/TrEMBL:Q91VD8"
FT                   /protein_id="EDL10154.1"
FT                   /translation="METAWMCNLRQRQVLAFFVLLHVSGAGAELGPYSIEEETERGSFV
FT                   ANLGKDLGVDLAEISNRRARIISQENKEHLQLNLQSGDLLINEKLDREELCGPIEPCVL
FT                   HFQVLMENPLEVFQAELRVMDINDYSPVFSEREMILRILENSALGDTFPLNNALDSDVA
FT                   INNIQTYRLSSNSHFLVVTRNRSDGRKYPELVLEKELDREEEPELRLTLTALDGGAPPR
FT                   SGTAQVLIEVVDINDNAPKFQQPTYRVQIPENSPTGSLVLTVSANDLDSGDYGKVLYAL
FT                   SQPSEDISKTLEVNPVTGEIRLRKEVDFETIPSYEVDIKATDGGGLSGKCTLLLKVVDV
FT                   NDNAPEVMLSALTSPVPENSPDEVVAVFSVKDPDSANNGKMIASIEEDLPFLLKSSGKN
FT                   FYTLVTKRALDREEREKYNITITVSDLGTPRLTTQHTITVQVSDTNDNAPAFNQTSYTL
FT                   FVRENNSPAMHIGTISATDSDAGSNSHISYSLLPSHDPQLALDSLISINADNGQLFALR
FT                   ALDYEALQAFEFHVGAIDQGSPALSSQALVRVVVLDDNDNAPFVLYPMQNSSAPCTELL
FT                   PRAAEPGYLVTKVVAVDRDSGQNAWLSFQLLKATEPGLFSVWAHNGEVRTTRLLSERDV
FT                   PKHRLVLLVKDNGDPPRSASVTLHVLVVDGFSQPYLPLPEVARNPAHDEDALTLYLVIA
FT                   LASVSSLFLLSVLLFVGVRLCRRARSASLSGYSVPEGHIPGHLVDVRGVGTLSQSYQYD
FT                   VCLMGDSSGTSEFNFLKPVFPSSLDQCSGKEIEENSSLHNSFGFHH"
FT   gene            <207797..>210175
FT                   /gene="Pcdhb18"
FT                   /locus_tag="mCG_141288"
FT                   /note="gene_id=mCG141288.0"
FT   mRNA            <207797..>210175
FT                   /gene="Pcdhb18"
FT                   /locus_tag="mCG_141288"
FT                   /product="protocadherin beta 18"
FT                   /note="gene_id=mCG141288.0 transcript_id=mCT174365.0
FT                   created on 15-OCT-2002"
FT   CDS             207797..210175
FT                   /codon_start=1
FT                   /gene="Pcdhb18"
FT                   /locus_tag="mCG_141288"
FT                   /product="protocadherin beta 18"
FT                   /note="gene_id=mCG141288.0 transcript_id=mCT174365.0
FT                   protein_id=mCP97281.0"
FT                   /db_xref="GOA:Q91Y02"
FT                   /db_xref="InterPro:IPR002126"
FT                   /db_xref="InterPro:IPR013164"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR020894"
FT                   /db_xref="MGI:MGI:2136756"
FT                   /db_xref="UniProtKB/TrEMBL:Q91Y02"
FT                   /protein_id="EDL10153.1"
FT                   /translation="MAARGSCVSRQRQVLFLFLLGGLCLAGSELGRYSVTEETERGSFV
FT                   ANLAKDLGLGVEALAAKRTRVVCDDNKQHLFLDSHTGDLLTNEKLDREKLCGPTEPCML
FT                   YFQILMDNPFQIYRAELRILDINDHSPIFQDKKMILKILENTAVGTTFRLERAQDSDGG
FT                   RNGIQNYTISPNTFFHITVHNSDEGMIYPELVLDKALDWEGQPEFSLTLTALDGGSPPR
FT                   SGTATIHILVLDINDNAPQFPQELYEIQAPENSPIGLVVIKVTGEDVDSGVNAEISYSF
FT                   FDASEDIRATFQINPFSGEITLKALLDYEFIKSYKLNVQAVDGGGLSARCTVLVRVLDV
FT                   NDNAPELIMSSLVNEVVENSPETVLAVFRINDRDSGENGKMVCHIQENLPFLLKPSVDN
FT                   FYILMTEGALDRESRAEYNITITVSDLGTPRLTTQHTIRVQVSDINDNAPAFNQTSYTL
FT                   FVRENNSPAMHIGTISATDSDAGSNAHITYSLLPTQDLQMTLTSLVSINADNGQLFAIK
FT                   ALDYEALQAFEFHVGATDRGSPELSSQALVRVVVLDDNDNAPFVLYPMQNASAPYTELL
FT                   PRTAEPGYLVTKVVAVDRDSGQNAWLSFQLLKATEPGLFSVWAHNGEVRTTRLLSERDV
FT                   PKHRLLLLVKDNGDPPRSASVTLQVLLVDGFSQPYLPLPEVAHNPTQGEEDVLTLYLVI
FT                   ALASVSSLFLLSVLLFVGVRLCRRARAASLGGCSVPEGHFPGHLVDVSGTGTLSQNYQY
FT                   EVCLMGGSSGTSDFKFLKSIYPEVHAYSSQDNSDGNPTF"
FT   gene            <215332..218011
FT                   /locus_tag="mCG_141286"
FT                   /note="gene_id=mCG141286.0"
FT   mRNA            <215332..218011
FT                   /locus_tag="mCG_141286"
FT                   /product="mCG141286"
FT                   /note="gene_id=mCG141286.0 transcript_id=mCT174368.0
FT                   created on 15-OCT-2002"
FT   CDS             215332..217737
FT                   /codon_start=1
FT                   /locus_tag="mCG_141286"
FT                   /product="mCG141286"
FT                   /note="gene_id=mCG141286.0 transcript_id=mCT174368.0
FT                   protein_id=mCP97279.0"
FT                   /db_xref="GOA:Q91Y01"
FT                   /db_xref="InterPro:IPR002126"
FT                   /db_xref="InterPro:IPR013164"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR020894"
FT                   /db_xref="MGI:MGI:2136757"
FT                   /db_xref="UniProtKB/TrEMBL:Q91Y01"
FT                   /protein_id="EDL10152.1"
FT                   /translation="MENQEGLYLQTRQVLLLFVFLGMSQAHSEAGRLSVVEEMLSGALV
FT                   GNLVKDLGLQVDELSAREAQVASSDNKLPLQLNINTGDLLLSEPLDREELCGSTEPCVL
FT                   HFQVLLKNPLKILQAELQVTDVNDNSPVFLEKEMVLEIPENSPVGAVFLLESAIDLDVG
FT                   INAVKSYEISQNSHFHVTMRVNPDGRKYPELVLDKALDYEEQHELRLILTALDGGTPPR
FT                   SGTALVRVEVIDINDNSPEFDHMFYEVTVPENSMLGSLLITASAWDLDSGINGEVSYAF
FT                   SHASEDIRKTFAINEHSGEIRLKGYLDFETTESYSIIIKATDRGGLFGKSTVRIQVMDV
FT                   NDNFPEIIVSSFISPIPENTAETLVMIFSIRDKDSGENGKMVCTIPEGLPFVLKSSIEN
FT                   YYHLETDGALDRESIAEYNITISVTDLGTPRLTTQHTIIVQVADINDNAPAFTQTSYTM
FT                   FFHENNSPALHIGTISATDSDAGSNAHITYSLMSAQDLQMALSSLISINADNGQLFALR
FT                   ALDYEVLQAFEFQVGATDRGSPALSSQALVRVVVLDDNDNAPFVLYPMQNASAPCTELL
FT                   PRAAEPGYLVTKVVAVDRDSGQNAWLSFQLLKATEPGLFSVWAHNGEVRTTRLLSERDA
FT                   PKHRLLLLVKDNGDPPRSASVTLHVLVVDGFSQPYLPLPEVARNPAHEEDALTLYLVTA
FT                   LASVSSLFLLSVMLFVGVRLCRRARAASLGGCTVPEGHFPDHLMGINSAGTLSQSYQYE
FT                   VCLMGGSGTNEFRFLKPVSPNLQPQFPGKEIEESSTLRNSFGLFRDCN"
FT   gene            <222447..226005
FT                   /locus_tag="mCG_141284"
FT                   /note="gene_id=mCG141284.1"
FT   mRNA            <222447..226005
FT                   /locus_tag="mCG_141284"
FT                   /product="mCG141284"
FT                   /note="gene_id=mCG141284.1 transcript_id=mCT174367.1
FT                   created on 23-APR-2004"
FT   CDS             <222586..225006
FT                   /codon_start=1
FT                   /locus_tag="mCG_141284"
FT                   /product="mCG141284"
FT                   /note="gene_id=mCG141284.1 transcript_id=mCT174367.1
FT                   protein_id=mCP97280.1"
FT                   /protein_id="EDL10151.1"
FT                   /translation="KKSPEGTMGRRRALILQKRQVLVFFVFLGLSQASAESLRYSVAEE
FT                   TEIGSFVANLAKDLGLGVAELSSREARVVSDDNKKHLLLNLLTGDMLLNERLDREELCG
FT                   STQPCVLPFQVVLENPLQFYRAELHVRDINDHSPTFLDKEITIKISESTTIGATFLIEN
FT                   AQDLDIGSNSLQDYSISPSSYFYVKIHDSGDGKIYPELVLDKALDHEEESELRLTLTAL
FT                   DGGSPPRSGTTLIVIKVLDINDNAPEFAQSFYEVQVPEDMPIGSSITAISAKDLDMGIY
FT                   GKISYSFLHASEDIRKTFEINPTSGEVNLRSLMDFEVIQSYSVNIQATDGGGLSAKCTL
FT                   SVKVLDINDNAPEVIMSSVTKAIPENASETLVALFSVRDQDSGDNGRILCSIQDDLPFI
FT                   LKPSFKNFFTLLSEKALDRERRAEYNITITASDMGTPRLTTQHTIRVQVSDINDNAPAF
FT                   TQTSYTMFIYENNSPALHIGTISATDKDSGSNAHITYSLLPAQDPELALASLISINADN
FT                   GQLFALRALDYEVLQAFEFQVGATDRGSPALSSQTLVRVVVLDDNDNAPFVLYPMQNAS
FT                   APCTELLPRVAEPGYLVTKVVAVDRDSGQNAWLSFQLLKATEPGLFSVWAHNGEVRTTR
FT                   LLSERDVPKHRLVLLVKDNGDPPRSASVTLHVLVVDGFSQPYLPLPEVARDPAQEEDVL
FT                   TLYLVIALASVSSLFLLSVLLFVGVRLCRRARAASLGGCSVPEGHFPGHLVDVTGTGTL
FT                   SQNYQYEVCFTGGTGTNEFKFLRPVMPSLQLHDPDSNMLEKENFRNSLGFNIQ"
FT   gene            <232014..234557
FT                   /locus_tag="mCG_1033322"
FT                   /note="gene_id=mCG1033322.1"
FT   mRNA            <232014..234557
FT                   /locus_tag="mCG_1033322"
FT                   /product="mCG1033322"
FT                   /note="gene_id=mCG1033322.1 transcript_id=mCT151026.1
FT                   created on 15-OCT-2002"
FT   CDS             232014..234338
FT                   /codon_start=1
FT                   /locus_tag="mCG_1033322"
FT                   /product="mCG1033322"
FT                   /note="gene_id=mCG1033322.1 transcript_id=mCT151026.1
FT                   protein_id=mCP77965.0"
FT                   /db_xref="GOA:Q91V48"
FT                   /db_xref="InterPro:IPR002126"
FT                   /db_xref="InterPro:IPR013164"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR020894"
FT                   /db_xref="MGI:MGI:2136759"
FT                   /db_xref="UniProtKB/TrEMBL:Q91V48"
FT                   /protein_id="EDL10150.1"
FT                   /translation="MEPGVGAAQHIRQVLLFFVFLEGSSVLATTWRYSVPEEMETGSSI
FT                   ANIIKDMDVGDLAARGARVIFDDYQPYLRLELETGNLLLNEKLDREALCSSSEPCILHF
FT                   QVLLENPLQFFQAELLIEDINDHTPTFLEKLIFLNISESATPGTSFQMDDAQDLDIGMN
FT                   GIQNYSISPNPYFYLKLKDSGKGRRYPELVLVRSLDREKEASISLILTAMDGGSLPRSG
FT                   TVLVQVVVLDVNDNAPEFERTLYEVQVPENSSVDSLVIKVSATDLDSGINGEISYSFSH
FT                   ISRDVQKTFEIHPTSGEVRLKRLLDFEVIQSYTINIQAIDGGGLSGKSAIIVQVTDVND
FT                   NPPEIVITSLMSSIPENGLSEMVVAVFSLRDQDSGENGRMMCSIEDKLPFLLKPTFKNF
FT                   YTLVTEHPLDRESRAEYNITVMISDLGTPRLTTQHTITVHISDINDNAPAFTQTTYTMF
FT                   VRENNSPALHIGTISATDSDLGSNAHITYSLLPPQDQRLALTSLISINADNGQLFALRA
FT                   LDYETLQAFEFRVGATDRGSPALSSQALVRVVVLDDNDNAPFVLYPMQNASAPCTELLP
FT                   RAAEPGYLVTKVVAVDRDSGQNAWLSFQLLKATEPGLFSVWAHNGEVRTTRLLSERDVP
FT                   KHRLLLLVKDNGDPPRSASVTLHLLVVDGFSQPYLPLPEVAHDSTQVDEEALTLYLVIA
FT                   LASVSSLFLLSVLLFVGVRLCRRARAASLSGYSEPDGHFSGHLVDVSGAGTLSQSYQYE
FT                   VCLTGMSDSNDIRFLKPVSQP"
FT   gene            236546..239613
FT                   /gene="Pcdhb22"
FT                   /locus_tag="mCG_1033321"
FT                   /note="gene_id=mCG1033321.2"
FT   mRNA            236546..239613
FT                   /gene="Pcdhb22"
FT                   /locus_tag="mCG_1033321"
FT                   /product="protocadherin beta 22"
FT                   /note="gene_id=mCG1033321.2 transcript_id=mCT151025.2
FT                   created on 23-APR-2004"
FT   CDS             236675..239059
FT                   /codon_start=1
FT                   /gene="Pcdhb22"
FT                   /locus_tag="mCG_1033321"
FT                   /product="protocadherin beta 22"
FT                   /note="gene_id=mCG1033321.2 transcript_id=mCT151025.2
FT                   protein_id=mCP77954.2"
FT                   /db_xref="GOA:Q91XZ8"
FT                   /db_xref="InterPro:IPR002126"
FT                   /db_xref="InterPro:IPR013164"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR020894"
FT                   /db_xref="MGI:MGI:2136760"
FT                   /db_xref="UniProtKB/TrEMBL:Q91XZ8"
FT                   /protein_id="EDL10149.1"
FT                   /translation="MKIGREHRKRQVLLIFLLLGVVGAGSEPRRYFVMEETPSGTVLAD
FT                   LVQDLGLGVAELAARGAQVVSEEKESRLQLDLQTGKLILNEKLDREELCGSTEPCVTHF
FT                   QVLLKKPLEIFQAELRVGDINDHSPEFPEREMAVKIIENSPVGTAFLLKTAQDLDVGNN
FT                   SVQNYKIGTNSHFHVSIRNRGDGRKYPELVLDKELDREVQAAFRLTLTALDGGSPPRTG
FT                   TSQIRIVVLDVNDNAPEFAQAFYRVQIPENSPSGSMVAKVSAKDLDTGTNGEVSYSLFH
FT                   SSQEMSKTFELNALSGEVRLIKTLDFETTPSYELDIEATDGGGLSGKCSVSIQVVDVND
FT                   NYPELIISSLTNPIPENSPETEVALFRIRDRDSGENGRTICSIQDGVPFTLEPSVENFY
FT                   RLVTDGALDREIRAEYNITISVTDLGIPKLTTQHTITVQVSDINDNAPAFTQVSYTMLV
FT                   HENNSPALHIGTISATDSDSGSNAHITYSLLPAQEPQLALNSLISINADNGQLFALRAL
FT                   DYEALQAFEFHVSATDRGSPALSSQALVRIVVLDDNDNAPFVLYPMQNASAPCTELLPR
FT                   AAEPGYLVTKVVAVDRDSGQNAWLSFQLLKATEPGLFSVWAHNGEVRTTRLLSERDVPK
FT                   HRLLLVVKDNGEPPRSASVTLQVLMVDGFSQPYLPLPEVVRDPSHQEGDVLTLYLVIAL
FT                   ASVSSLFLLSVLLFVGVRLCRRAREVSLGGCSVPEGHFPGHLVDVSGAGTLSQSYQYEV
FT                   CLTGDSQSNEFKFLKPVFSGIVDQNYGRQPDDQSFSSVLGM"
FT   assembly_gap    258241..258260
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    262894..262913
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    273762..273781
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    290931..290950
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    298009..298028
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    308209..308228
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            324973..325833
FT                   /locus_tag="mCG_147296"
FT                   /note="gene_id=mCG147296.0"
FT   mRNA            join(324973..325075,325454..325833)
FT                   /locus_tag="mCG_147296"
FT                   /product="mCG147296"
FT                   /note="gene_id=mCG147296.0 transcript_id=mCT187559.0
FT                   created on 13-JAN-2004"
FT   CDS             join(325027..325075,325454..325548)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147296"
FT                   /product="mCG147296"
FT                   /note="gene_id=mCG147296.0 transcript_id=mCT187559.0
FT                   protein_id=mCP109684.0"
FT                   /protein_id="EDL10148.1"
FT                   /translation="MEPIGEDDEPEPRGAIIIWEEEPLLRKCLLLITYRQVCETFSCGT
FT                   FS"
FT   assembly_gap    336288..336307
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(336738..337942)
FT                   /locus_tag="mCG_1033320"
FT                   /note="gene_id=mCG1033320.1"
FT   mRNA            complement(336738..337942)
FT                   /locus_tag="mCG_1033320"
FT                   /product="mCG1033320"
FT                   /note="gene_id=mCG1033320.1 transcript_id=mCT151024.1
FT                   created on 16-OCT-2002"
FT   CDS             complement(337038..337835)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1033320"
FT                   /product="mCG1033320"
FT                   /note="gene_id=mCG1033320.1 transcript_id=mCT151024.1
FT                   protein_id=mCP77942.1"
FT                   /db_xref="GOA:Q99ML6"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="MGI:MGI:2137907"
FT                   /db_xref="UniProtKB/TrEMBL:Q99ML6"
FT                   /protein_id="EDL10147.1"
FT                   /translation="MQTFPQLYKGLADCFLKTYNQVGIRGLYRGTSPALLAYVTQGSVL
FT                   FMCFGFCQQFVRKVARVEQNAELNDLETATAGSLASAFAALALCPTELVKCRLQTMYEM
FT                   KMSGKIAQSYNTIWSMVKSIFMKDGPLGFYRGLSTTLAQEIPGYFFYFGGYEISRSFFA
FT                   SGGSKDELGPVPLMLSGGFAGICLWLIIFPVDCIKSRIQVLSMFGKPAGLIETFISVVR
FT                   NEGISALYSGLKATLIRAIPSNAALFLVYEYSRKMMMNMVEEY"
FT   gene            complement(341383..343513)
FT                   /gene="Taf7"
FT                   /locus_tag="mCG_133387"
FT                   /note="gene_id=mCG133387.0"
FT   mRNA            complement(join(341383..342893,343306..343513))
FT                   /gene="Taf7"
FT                   /locus_tag="mCG_133387"
FT                   /product="TAF7 RNA polymerase II, TATA box binding protein
FT                   (TBP)-associated factor"
FT                   /note="gene_id=mCG133387.0 transcript_id=mCT134753.0
FT                   created on 15-OCT-2002"
FT   CDS             complement(341848..342873)
FT                   /codon_start=1
FT                   /gene="Taf7"
FT                   /locus_tag="mCG_133387"
FT                   /product="TAF7 RNA polymerase II, TATA box binding protein
FT                   (TBP)-associated factor"
FT                   /note="gene_id=mCG133387.0 transcript_id=mCT134753.0
FT                   protein_id=mCP77549.1"
FT                   /protein_id="EDL10146.1"
FT                   /translation="MSKNKDDAPHELESQFILRLPPEYAATVRRAVQSGHVNLKDKLSI
FT                   ELHPDGRHGIVRVDRVPLAAKLVDLPCVTESLKTIDKKTFYKTADISQMLVATVDGDLY
FT                   PPVEEAAATADPKANKKKDKDKEKKFVWNHGITLPLKNVRKRRFRKTAKKKYIESPDVE
FT                   KEVKRLLSTDAEAVSTRWEIIAEDETKETENQGLDISSPGMSGHRQGHDSLEHDELREI
FT                   FNDLSSSSEDEEDVNILDTEEDLERQLQDKLNESDEQHQENEGTNQLVMGIQKQIDNMK
FT                   GKLQETQDRAKRQEDLIMKVENLALKNRFQAVLDELKQKEDREKEQLSSLQEELESLLE
FT                   K"
FT   gene            complement(351749..352312)
FT                   /pseudo
FT                   /locus_tag="mCG_133389"
FT                   /note="gene_id=mCG133389.0"
FT   mRNA            complement(351749..352312)
FT                   /pseudo
FT                   /locus_tag="mCG_133389"
FT                   /note="gene_id=mCG133389.0 transcript_id=mCT134755.0
FT                   created on 15-OCT-2002"
FT   gene            <355263..358064
FT                   /locus_tag="mCG_145145"
FT                   /note="gene_id=mCG145145.0"
FT   mRNA            join(<355263..356001,356008..356624,356645..358064)
FT                   /locus_tag="mCG_145145"
FT                   /product="mCG145145"
FT                   /note="gene_id=mCG145145.0 transcript_id=mCT184569.0
FT                   created on 05-JUN-2003"
FT   CDS             <356811..357248
FT                   /codon_start=1
FT                   /locus_tag="mCG_145145"
FT                   /product="mCG145145"
FT                   /note="gene_id=mCG145145.0 transcript_id=mCT184569.0
FT                   protein_id=mCP106256.0"
FT                   /protein_id="EDL10145.1"
FT                   /translation="FLFLPDQVTLHQESATVLCQQGQTAAVFLETTWKLVLSLIIRVWL
FT                   AQCHPEPPYWGGWLTQNTRSMLCQHLHKIRHCSAHCGACLPRDQSIHQLEAQELTALSH
FT                   ISDQLMWFFNLGTHTAKYVQHCSVSESEPTRAYVVDSHHVV"
FT   gene            <361336..552225
FT                   /locus_tag="mCG_133388"
FT                   /note="gene_id=mCG133388.1"
FT   mRNA            join(<361336..363756,535369..535427,543604..543692,
FT                   550253..552222)
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, transcript variant mCT174342"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174342.0
FT                   created on 14-OCT-2002"
FT   CDS             join(361336..363756,535369..535427,543604..543692,
FT                   550253..550479)
FT                   /codon_start=1
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, isoform CRA_t"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174342.0
FT                   protein_id=mCP97268.0 isoform=CRA_t"
FT                   /db_xref="GOA:Q91XZ0"
FT                   /db_xref="InterPro:IPR002126"
FT                   /db_xref="InterPro:IPR013164"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR020894"
FT                   /db_xref="MGI:MGI:1935212"
FT                   /db_xref="UniProtKB/TrEMBL:Q91XZ0"
FT                   /protein_id="EDL10137.1"
FT                   /translation="MAIPEKLTGWSLLVLVCLSLELLLEAGAGNIRYSVPEETDKGSFV
FT                   GSIAKDLGLETRELMERGIRIVSRGRSQLFSLNPRSGSLVTAGRIDREELCAQSTPCVV
FT                   SFNILMEDEMKLLPIEVEIIDINDNTPQFQLEELELKMSEITTPGTRIPLPLGQDLDVG
FT                   INSLQSYQLSANPHFSLDVQQGPEGPQQPEMVLQRPLDREKDAVHYLVLTASDGGSPIH
FT                   SGTLQIHVQVVDVNDNPPAFTKAEYHVSVPENVPLGTRLLKVNATDPDEGANGRVTYSF
FT                   HKVDHSVVRKFQLDAYTGELSNKEPLDFEEYKVYPMEIQAQDGAGLMARAKVLVTVLDV
FT                   NDNAPEVGITSVTNTVPENFPPGTTIALISVHDQDADNNGHITCSIPGNLPFKLEKLVD
FT                   NYYRLVTERTLDREQSSRHNITITATDQGTPPLSTQAHISLLVTDINDNPPVFEQDSYS
FT                   VYIPENNPRGASIFSVKAQDADHNENALVTYALVEDTIQGVPLSSYFSINSDTGVVYAL
FT                   QSFDYEQFRDLQLRVMAHDSGNPQLSSNVSLSLFMIDQNDNAPEILYPVLPTDGSTGVE
FT                   LAPRSAEPGYLVTKVVAVDKDSGQNSWLSYRLLKASEPGLFSVGLHTGEVRTARALLER
FT                   DALKQSLVVAVQDHGQPPLSTTVTFTIAVADSIPDLLADLGSMGTPADPQDSDLTLYLV
FT                   VAVAVVSCIFLAFVIVLLVLKLRHWYSSRLLQTEANGLTGLPASNFVGVDGVHAFLQTY
FT                   SREISLTADSRKSHLIFPQPNYADTLISHESCEKQEFLSAPQSLLEDKEEIFSQQAPPN
FT                   TDWRFSQAQRPGTSGSQNGDETGTWPNNQFDTEMLQAMILASASEAADGSSTLGGGAGT
FT                   MGLSARYGPQFTLQHVPDYRQNVYIPGSNATLTNAAGKRDGKAPAGGNGNKKKSGKKEK
FT                   K"
FT   mRNA            join(<368497..370917,535369..535427,543604..543692,
FT                   550253..552222)
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, transcript variant mCT174335"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174335.0
FT                   created on 14-OCT-2002"
FT   CDS             join(368497..370917,535369..535427,543604..543692,
FT                   550253..550479)
FT                   /codon_start=1
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, isoform CRA_c"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174335.0
FT                   protein_id=mCP97257.0 isoform=CRA_c"
FT                   /db_xref="GOA:Q91XY6"
FT                   /db_xref="InterPro:IPR002126"
FT                   /db_xref="InterPro:IPR013164"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR020894"
FT                   /db_xref="MGI:MGI:1935214"
FT                   /db_xref="UniProtKB/TrEMBL:Q91XY6"
FT                   /protein_id="EDL10120.1"
FT                   /translation="MATLQKLPQSRMLVLLCALWAALWEAKAGQIRYSVPEEIDKGSFV
FT                   GSIAKDLGLEPQALEERGVRIVSRGKSQLFALNPRSGSLVTAGRIDREELCAQSTPCLV
FT                   NFNLLLEDKLTIYSVEVEVTDVNDNAPRFGVEDPELKISETTTPGFRIPLKSAHDADVG
FT                   ENTLQKYKLNSNDHFSLDVRTGADGNKYPELVLERALDREEEAVHHLVLVASDGGNPVR
FT                   SGTCRIRVKVLDANDNAPAFTQAEYRVRVPENTPVGTRILTVTATDADEGYNAQVTYFQ
FT                   EHDPGETTDAFELKSTSGDITITKSLDYEKAKFHEIDIEAQDGPGLLTRTKVIVTVLDV
FT                   NDNAPEFYMTSATASVPEDAPLGTVIALFNVHDRDSGQNAVVTCSLPEMLPFKLERSVD
FT                   SYYRLVTTRALDREQFSFYNITVSAKDGGSPSLSTDAHLLLQVADINDNPPSFPRRVYS
FT                   AYIPENNPRGTSIFSVLASDPDSNDNAHVTYSLAEDSFQGAPLSSYVSINSDTGVLYAL
FT                   RSFDYEQFQDLQLWVIAADSGNPPLSSNVSLSLFLVDQNDNTPEILYPALPTDGSTGVE
FT                   LAPRSADPGYLVTKVVAVDKDSGQNAWLSYRLLKASEPGLFSVGLHTGEVRTARALLDR
FT                   DALKQSLVVAVQDHGQPPLSATVTLTIAIADNIPEVLADLGSIRTPANPDDSELTLYLV
FT                   VAVAVVSCVFLAFVIALLALRLRRWHLSRMLQASRDGLGGIPASHFVGVDGVRAFLQTY
FT                   SHEVSLTADSGKSHIIFPQPNYADTLISQESCEKTDFLSAPQSLLDDKREETPQQAPPN
FT                   TDWRFSQAQRPGTSGSQNGDETGTWPNNQFDTEMLQAMILASASEAADGSSTLGGGAGT
FT                   MGLSARYGPQFTLQHVPDYRQNVYIPGSNATLTNAAGKRDGKAPAGGNGNKKKSGKKEK
FT                   K"
FT   mRNA            join(<373886..374708,386834..387318,535369..535427,
FT                   543604..543692,550253..552222)
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, transcript variant mCT174345"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174345.0
FT                   created on 14-OCT-2002"
FT   CDS             373886..374389
FT                   /codon_start=1
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, isoform CRA_v"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174345.0
FT                   protein_id=mCP97263.0 isoform=CRA_v"
FT                   /protein_id="EDL10139.1"
FT                   /translation="MIRLGQGTAGALLCALLGTVCAAGFRQIRYSVPEELDKGSFVGNI
FT                   SKDLGLEPRELAVRGVRIISRGKSQLFSLDPRSGSLVTGGRIDREELCAQSAPCLVSFN
FT                   ILVEDKLKIFEVEVDITDINDNAPSFPTEELEIKIGELTDPGTRFPLKTAFDPGCGHER
FT                   PAEL"
FT   assembly_gap    374709..378048
FT                   /estimated_length=3340
FT                   /gap_type="unknown"
FT   assembly_gap    380058..380898
FT                   /estimated_length=841
FT                   /gap_type="unknown"
FT   mRNA            join(<380899..382770,535369..535427,543604..543692,
FT                   550253..552222)
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, transcript variant mCT174337"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174337.0
FT                   created on 14-OCT-2002"
FT   CDS             join(<380899..382770,535369..535427,543604..543692,
FT                   550253..550479)
FT                   /codon_start=1
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, isoform CRA_d"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174337.0
FT                   protein_id=mCP97254.0 isoform=CRA_d"
FT                   /protein_id="EDL10121.1"
FT                   /translation="KESPDGSKYPELLLENPLDREHQSSHHLILTAMDGGDPPLSSTTQ
FT                   VWIKVTDANDNAPVFSQDTYKVSLRENIPPGTLVLQVTATDQDESIHGEITYAFLNAPA
FT                   STNLVFNLNPNTGAITTNGTLDFEEKNRYTLGVEAKDGGVHTAHCNVQIEILDDNDNAP
FT                   EVTFMSFSNQVPEDSVLGTVIALIKVRDKDSGQNGLVACHIQEELPFKLQPTSKNYYKL
FT                   VIDKALNREQTPEYNVTITATDSGKPSLSSKTCVTVHITDINDNAPVFHQASYLVHVAE
FT                   NNPPGASIAQVSASDPDLGSNGLISYSIIASDLEPRALSSFVSVNQDSGVVFAQRAFDH
FT                   EQLRSFQLTLQARDHGSPTLSANVSMRVLVGDRNDNAPRVLYPTLEPDGSALFDMVPRA
FT                   AEPGYLVTKVVAVDADSGHNAWLSYHVLQASDPGLFSLGLRTGEVRTARALGDRDSARQ
FT                   RLLVAVRDGGQPPLSATATLHLIFADSLQEVLPDLSDDPLPSDPQSELQFYLVVALALI
FT                   SVLFLLSVILAIALRLRHSSRSAAWGCFQPGLSLKSQPVVPPNYSEGTLPYSYNLCVAS
FT                   HSMTMAGFNFHHVAPEVAPPQDLLCDDLSVVVCGNNEDPQVSDDSAFQQAPPNTDWRFS
FT                   QAQRPGTSGSQNGDETGTWPNNQFDTEMLQAMILASASEAADGSSTLGGGAGTMGLSAR
FT                   YGPQFTLQHVPDYRQNVYIPGSNATLTNAAGKRDGKAPAGGNGNKKKSGKKEKK"
FT   mRNA            join(<385331..387748,535369..535427,543604..543692,
FT                   550253..552222)
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, transcript variant mCT174339"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174339.0
FT                   created on 14-OCT-2002"
FT   CDS             join(385331..387748,535369..535427,543604..543692,
FT                   550253..550479)
FT                   /codon_start=1
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, isoform CRA_e"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174339.0
FT                   protein_id=mCP97276.0 isoform=CRA_e"
FT                   /protein_id="EDL10122.1"
FT                   /translation="MAAPYKSDRRGLIWICIFLGSLCDIRAEQIRYSVPEELERGSVVG
FT                   NLAADLGLEPGKLAERGVRIVSRGKTQLFALNPRSGSLVTAGRVDREGLCDRSPKCTAN
FT                   LEILLEDKVRILAIEVEIIDVNDNAPSFGAQQREIKVAESENPGTRFPLPEAFDLDIGV
FT                   NALQGYQLSSNDHFSLDVQSGPDGIKYPELVLENALDREEEAVHHLVLTAFDGGDPVRS
FT                   GTATIQVTLVDTNDNAPVFTQPEYHISVKENLPVGTRLLTIKATDPDEGANGEVTYSFR
FT                   NVREKISQLFQLNSLTGDITVLGELDYEDSGFYDVDVEAHDGPGLRARSKVLVTVLDVN
FT                   DNAPEVTVTSLTSSIQEASSPGTVIALFNVHDSDSGENGLVTCSIPDNLPFRLEKTYGN
FT                   YHRLLIHRTLDREEVSDYNITITATDQGTPPLSTETYISLQVVDINDNPPTFTHASYSA
FT                   YIPENNPRGASILSITAQDPDSGENAQVIYSLSEDTIQGAPLSSYVSINSNTGVLYALR
FT                   SFDYEQFQDLKLLVTARDSGTPPLSSNVSLSLFVLDQNDNIPEILYPTIPTDGSTGVEL
FT                   TPRSADPGYLVTKVVAVDKDSGQNAWLSYRLLKASEPGLFSVGLHTGEVRTARALLDRD
FT                   ALKQSLVVTVQDHGQPPLSATVTLTIAVSDNIPDILADLVNINAPIDQEDSDITLYLVV
FT                   AVAAVSCVFLAFVIVLLIHRLRRWHSTRLLQAAGNGLSSLPASHFVGVDGVHAFLQTYS
FT                   HEVSLTADSGKSHLIFPQPNYADTLISQESCGKSDPLLVSQDLLEIKGDSSLQQAPPNT
FT                   DWRFSQAQRPGTSGSQNGDETGTWPNNQFDTEMLQAMILASASEAADGSSTLGGGAGTM
FT                   GLSARYGPQFTLQHVPDYRQNVYIPGSNATLTNAAGKRDGKAPAGGNGNKKKSGKKEKK
FT                   "
FT   mRNA            join(<389903..392314,535369..535427,543604..543692,
FT                   550253..552222)
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, transcript variant mCT174340"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174340.0
FT                   created on 14-OCT-2002"
FT   CDS             join(389903..392314,535369..535427,543604..543692,
FT                   550253..550479)
FT                   /codon_start=1
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, isoform CRA_s"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174340.0
FT                   protein_id=mCP97272.0 isoform=CRA_s"
FT                   /protein_id="EDL10136.1"
FT                   /translation="MRRGSGSGPAWWLQVLSPFLLLLFHGALADQIRYSIPEELAKNSI
FT                   VGNLARDLGLSVQNLPTRKLRVSAEKDYFTVNPESGDLLVGDRIDREQVCGKQPQCVLE
FT                   FDIVAEKPLNIFHVAVILQDVNDNAPLFKQSEVDLNIGESARPGKAFPLDPALDLDAGS
FT                   NSLQKYYLTDNEYFEVTEKETPDGRKYPELILKRFLDREEHNFHQLVLTAVDGGDPPRS
FT                   GTTQIRIQVTDINDNPPMFSQDVFSVTLREDVPPGFSVLQVTATDQDEGVNAEITYAFH
FT                   NVDEQVERIFNLDKRTGEITTKDNLDFETAKSYTLNVEAKDPGDLASHCSIQVKILDEN
FT                   DCVPEVIVTSVFTPLPEDSPLGTVIALIKTRDRDSGENGDVYCHVLGNEGFVLKSSSKN
FT                   YYKLVTDRTLDREAIPEYNVTIVAADRGKPPLSSNVIITLHISDVNDNAPVFHQASYLV
FT                   HVAENNPPGTSIAQVSASDPDLGSNGLISYSIIASDLEPRALSSFVSVNQDSGVVFAQR
FT                   AFDHEQLRSFQLTLQARDHGSPTLSANVSMHVLVGDRNDNAPRVLYPTLEPDGSALFDM
FT                   VPRAAEPGYLVTKVVAVDADSGHNAWLSYHVLQASDPGLFSLGLRTGEVRTARALGDRD
FT                   SARQRLLVAVRDGGQPPLSATATLHLIFADSLQEVLPDLSDDPLPSDPQSELQFYLVVA
FT                   LALISVLFLLSVILAIALRLRHSSRSAAWGCFQPGLSSNLATGVLPNYNEGTLPYSYNV
FT                   CIASQSAKTEFNFLNVTPEVAPQDLLCGDDSWVPGTLGDTDVPFVSDSISKQAPPNTDW
FT                   RFSQAQRPGTSGSQNGDETGTWPNNQFDTEMLQAMILASASEAADGSSTLGGGAGTMGL
FT                   SARYGPQFTLQHVPDYRQNVYIPGSNATLTNAAGKRDGKAPAGGNGNKKKSGKKEKK"
FT   mRNA            join(<389945..392154,543604..543692,550253..552222)
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, transcript variant mCT174346"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174346.0
FT                   created on 14-OCT-2002"
FT   CDS             join(<389945..392154,543604)
FT                   /codon_start=1
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, isoform CRA_h"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174346.0
FT                   protein_id=mCP97273.0 isoform=CRA_h"
FT                   /protein_id="EDL10125.1"
FT                   /translation="VLSPFLLLLFHGALADQIRYSIPEELAKNSIVGNLARDLGLSVQN
FT                   LPTRKLRVSAEKDYFTVNPESGDLLVGDRIDREQVCGKQPQCVLEFDIVAEKPLNIFHV
FT                   AVILQDVNDNAPLFKQSEVDLNIGESARPGKAFPLDPALDLDAGSNSLQKYYLTDNEYF
FT                   EVTEKETPDGRKYPELILKRFLDREEHNFHQLVLTAVDGGDPPRSGTTQIRIQVTDIND
FT                   NPPMFSQDVFSVTLREDVPPGFSVLQVTATDQDEGVNAEITYAFHNVDEQVERIFNLDK
FT                   RTGEITTKDNLDFETAKSYTLNVEAKDPGDLASHCSIQVKILDENDCVPEVIVTSVFTP
FT                   LPEDSPLGTVIALIKTRDRDSGENGDVYCHVLGNEGFVLKSSSKNYYKLVTDRTLDREA
FT                   IPEYNVTIVAADRGKPPLSSNVIITLHISDVNDNAPVFHQASYLVHVAENNPPGTSIAQ
FT                   VSASDPDLGSNGLISYSIIASDLEPRALSSFVSVNQDSGVVFAQRAFDHEQLRSFQLTL
FT                   QARDHGSPTLSANVSMHVLVGDRNDNAPRVLYPTLEPDGSALFDMVPRAAEPGYLVTKV
FT                   VAVDADSGHNAWLSYHVLQASDPGLFSLGLRTGEVRTARALGDRDSARQRLLVAVRDGG
FT                   QPPLSATATLHLIFADSLQEVLPDLSDDPLPSDPQSELQFYLVVALALISVLFLLSVIL
FT                   AIALRLRHSSRSAAWGCFQPGLSSNLATGVLPNYNEGTLPYS"
FT   mRNA            join(<394439..396862,535369..535427,543604..543692,
FT                   550253..552222)
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, transcript variant mCT174350"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174350.0
FT                   created on 14-OCT-2002"
FT   CDS             join(394439..396862,535369..535427,543604..543692,
FT                   550253..550479)
FT                   /codon_start=1
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, isoform CRA_w"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174350.0
FT                   protein_id=mCP97267.0 isoform=CRA_w"
FT                   /db_xref="GOA:Q91XY3"
FT                   /db_xref="InterPro:IPR002126"
FT                   /db_xref="InterPro:IPR013164"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR020894"
FT                   /db_xref="MGI:MGI:1935217"
FT                   /db_xref="UniProtKB/TrEMBL:Q91XY3"
FT                   /protein_id="EDL10140.1"
FT                   /translation="MADPPRRWICNDLLTFFMLLGTLCAPGKGQIRYSVREELDKGSFV
FT                   GNISKDLGLEPRELAERGVRIISRGRSQLFSLNPRGGSLVTAGRIDREELCVQSSPCLV
FT                   SFNILVENKMKIYGVEVEILDINDNFPRFRDEELKVKVNENAAAGTRLVLPFARDGDVG
FT                   VNSLQGYKLSSNRHFSLDVKSGSDGQKHPELVLEQPLDREKESAHDLVLTALDGGNPVL
FT                   SSTVHISVTVLDANDNAPLFTQSEYRVSVPENTPVGTRLLTLTATDADEGINAKLTFSF
FT                   RNEEDKISETFQLDSNLGEISTIQSLDYEESRFYLMEVVAQDGGALLASAKVLVTVQDV
FT                   NDNAPEVILTSLTSSVSEDCLPGTIIALFSVHDADSGENGEISCSIPKNLPFKLEKSVD
FT                   NYYHLLTTRALDREETSDYNITVTVVDRGTPPLSTENHISLKVADINDNPPTFSRPFYS
FT                   TSISENNPRGVSIFSVYAYDADSGDNAQVTYSLAENTFQEVPVSSYVSINSDTGVLYAL
FT                   QSFDYEHLRDLQLLVTAKDSGTPPLSSNVSMSLFVLDQNDNIPEILYPTIPTDGSTGVE
FT                   LAPRSAEPGYLVTKVVAVDKDSGQNAWLSYRLLKASEPGLFSIGLHTGEVCTARALLDR
FT                   DVLKQSLVVAVQDHGQPPLSATVTLTIAVGDSIPDVLTDLGNHNTLAEPQDSDLTLYLV
FT                   VSVAVVSCVFLGFVTVLLALRLRHWHMSRLLQTSTGRLADMPASHFVGMDGVQAYLQTY
FT                   SHEISLTTDSKKSHLIFPQPNYADRLISEESCEKSEPLLIPHNIHTHKEEPGDAQQAPP
FT                   NTDWRFSQAQRPGTSGSQNGDETGTWPNNQFDTEMLQAMILASASEAADGSSTLGGGAG
FT                   TMGLSARYGPQFTLQHVPDYRQNVYIPGSNATLTNAAGKRDGKAPAGGNGNKKKSGKKE
FT                   KK"
FT   mRNA            join(<407171..409594,535369..535427,543604..543692,
FT                   550253..552222)
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, transcript variant mCT174351"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174351.0
FT                   created on 14-OCT-2002"
FT   CDS             join(407171..409594,535369..535427,543604..543692,
FT                   550253..550479)
FT                   /codon_start=1
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, isoform CRA_z"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174351.0
FT                   protein_id=mCP97260.0 isoform=CRA_z"
FT                   /protein_id="EDL10143.1"
FT                   /translation="MAALQRRPPCCELLLLLNLLWWLWGSEAGQLRYSIPEEVEKGSFV
FT                   GSIAKDLGLQPRELAERGIRIISRGRSQLFSLNQRSGSLVTAGRIDREELCAQSAPCLV
FT                   SFNILIEDKLNLYPVEVEIVDINDNAPRFLKEEMELKILENAALSSHFLLMDVYDPDVG
FT                   VNSIQGFKLSGSSHFSVHVQSQDHGPKYPELVLEHSLDREEEAVHHLVLVAMDGGDPVR
FT                   TGMARILVTVVDVNDNAPVFTQPIYRVSVPENLPVGTRVLTVNATDQDEGVHAEIRYSF
FT                   VRITEEISRIFCLDPFTGEISTSGTLDYENSRFYELDVEARDQPGLQDRAKVLITILDM
FT                   NDNAPEVVVTSGSRAIAENAPPGTIIALFQVYDKDSERNGLVICSISESLPFKLEESLD
FT                   NYFRLMTNTELDREQVSSYNITVTATDRGTPPLSTKIFISLDVADINDNPPVFSRSSYS
FT                   VYVSENNPKGVSIFSLNAVDPDSEENAEIIYSLAKETLQGTPLSSFLSINSITGVLYAL
FT                   CSFDYEQFRELNLLVTASDRGKPPLSSNVSLNLFVLDQNDNVPEILYPVLPTDGSTGVE
FT                   LAPRSAEPGYLVTKVVAVDKDSGQNAWLSYRLIKASEPGLFSVGLHTGEVRTARVLLDR
FT                   DALKQSLVVAVQDHGQPPLSATVTLTVAVASSIPDILADLGSLDLPHKSEDSSLTIYLV
FT                   VAVATVSCIFFAFVMGLLVLRLWHWHKSRLLKATRKGVSNMSTSHFVGIDGVQAFLQTY
FT                   SHEVSLTADSRKSHLIFPQPNYAHTLISQEGCEKNEPLLIQEDSAFCKEEDSLDQQAPP
FT                   NTDWRFSQAQRPGTSGSQNGDETGTWPNNQFDTEMLQAMILASASEAADGSSTLGGGAG
FT                   TMGLSARYGPQFTLQHVPDYRQNVYIPGSNATLTNAAGKRDGKAPAGGNGNKKKSGKKE
FT                   KK"
FT   mRNA            join(<414879..417311,535369..535427,543604..543692,
FT                   550253..552222)
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, transcript variant mCT174352"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174352.0
FT                   created on 14-OCT-2002"
FT   CDS             join(414879..417311,535369..535427,543604..543692,
FT                   550253..550479)
FT                   /codon_start=1
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, isoform CRA_l"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174352.0
FT                   protein_id=mCP97258.0 isoform=CRA_l"
FT                   /protein_id="EDL10129.1"
FT                   /translation="MAPEQRGWGSHYRGFVLLSILLGMRWEAWAGQILYSVSEETDKGS
FT                   FVGNITKDLGLQPRELAERGVRIITKGKTQLFSLNPRSGSLVTAGRIDREELCAQSPRC
FT                   LVSFNILIEDKMNLYPIEVEIMDVNDNAPRFLTEEINIKIMENAAPGVRFPLKEATDSD
FT                   VGKNSLQRYQLSPNHHFSLVVQSGDDGTKYPELVLEKALDREEEGLHHLVLTAYDGGDP
FT                   LRSGTASIRVTVVDVNDHMPVFSLPRYQATVPENVPVGTRLLTINAIDLDEGVNGEVTY
FT                   SFWKITPELLQIFHLSSLTGELSTLKGLDYEQSSYYELEVQAQDGAGSLTKAKVLITVL
FT                   DVNDNAPEVTVTSVSSPVPEDTPPGTVIALFYLQDKDSGKNGEVTCSLPENLPFKLEQS
FT                   IDNYYRLVTARNLDREKMSVYNITLKATDGGIPPLSTETRMSIHVSDTNDNPPTFSDSS
FT                   YSIYVPENNPRGASIFSVTAQDPDSDKNAQVTYALAEDTIQGVPVSSYVSINSDTGILY
FT                   ALGSFDYEQFRDLQLRVTARDSGDPPLSSNVSLKLFVLDKNDNAPEILYPALPTDGSTG
FT                   VELAPRSAEPGYLVTKVVAVDKDSGPNAWLSYRLLKASEPGLFSVGLHTGEVRTARALL
FT                   DRDALKQNLVVVVQDHGQPPLSATVTLTVAVANSIPDVLADLGSIRTPSEPDDSDITLY
FT                   LVVAVATVSCVFLVFVTVLLALRLWRWHKSHMLQASSGGGLEDVPASHFVGLDGVQAFL
FT                   QTYSHEVSLTADSRKSHIIFPQPNYVDTLISQDSCEKSDSLLTSIDFQECKGEAPSSQQ
FT                   APPNTDWRFSQAQRPGTSGSQNGDETGTWPNNQFDTEMLQAMILASASEAADGSSTLGG
FT                   GAGTMGLSARYGPQFTLQHVPDYRQNVYIPGSNATLTNAAGKRDGKAPAGGNGNKKKSG
FT                   KKEKK"
FT   mRNA            join(<420493..422856,535369..535427,543604..543692,
FT                   550253..552222)
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, transcript variant mCT174344"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174344.0
FT                   created on 14-OCT-2002"
FT   CDS             join(420493..422856,535369..535427,543604..543692,
FT                   550253..550479)
FT                   /codon_start=1
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, isoform CRA_u"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174344.0
FT                   protein_id=mCP97271.0 isoform=CRA_u"
FT                   /protein_id="EDL10138.1"
FT                   /translation="MREGTAERGRGQRRPMLLPFLLPLFCPTLSEQIRYKIPEEMPTGS
FT                   VVGNLAKDLGFSVQELPTRKLRISSEKPYFSVSSESGELLVSSRLDREQICGKKLVCAL
FT                   EFEAVAENPLNFYHLSVELEDINDHTPKFAHTSFELQISESSKPGTRFILGSAHDADIG
FT                   TNSLQNYQLSPNDHFSLVNKEKSDGSKYPEMILKTALDREKQKLYHLTLTALDFGHPPL
FT                   NSTAQIQVLVTDANDNPPVFSQDIYRVSLPENVYPGTTVLRVVATDQDEGVNSEITFSF
FT                   SEAGQVTQFNLDSNTGEITTLHTLDFEEVKEYSLVLEAKDGGGMIAQCTVEIEVLDEND
FT                   NVPEVLFQSLPDLIMEDAEPGTYIALLKTRDKDSGRNGEVICKLEGGAPFKILTSSGNT
FT                   YKLVTDGVLDREQNPEYNITIRATDKGDPPLSSSSSVTLHIGDVNDNAPVFTKVSYLVH
FT                   VAENNPPGASIAQVSASDPDLGANGQVTYYIIASDLEPESLWSYVTINAQSGVLFAQRA
FT                   FDHEQLRSFQLTLQARDHGSPTLSANVSMRLLVGDRNDNAPRVLYPTLEPDGSALFDMV
FT                   PRSAEPGYLVTKVVAVDADSGHNAWLSYHVLQASDPGLFSLGLRTGEVRTARALGDRDS
FT                   ARQRLLVAVRDGGQPPLSATATLHLIFADSLQEVLPDLSDDPLPPDPQSELQFYLVVAL
FT                   ALISVLFLLAVILAIALRLRHSSSRKAWGCFQSEVVVPPNYSEGTLPYSYNLCAAEFNS
FT                   LTCNDQLKSGQDLQFADSAGALFPLCNSNESTSHQQAPPNTDWRFSQAQRPGTSGSQNG
FT                   DETGTWPNNQFDTEMLQAMILASASEAADGSSTLGGGAGTMGLSARYGPQFTLQHVPDY
FT                   RQNVYIPGSNATLTNAAGKRDGKAPAGGNGNKKKSGKKEKK"
FT   mRNA            join(<425836..428259,535369..535427,543604..543692,
FT                   550253..552222)
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, transcript variant mCT174353"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174353.0
FT                   created on 14-OCT-2002"
FT   CDS             join(425836..428259,535369..535427,543604..543692,
FT                   550253..550479)
FT                   /codon_start=1
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, isoform CRA_m"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174353.0
FT                   protein_id=mCP97255.0 isoform=CRA_m"
FT                   /db_xref="GOA:Q91XY0"
FT                   /db_xref="InterPro:IPR002126"
FT                   /db_xref="InterPro:IPR013164"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR020894"
FT                   /db_xref="MGI:MGI:1935197"
FT                   /db_xref="UniProtKB/TrEMBL:Q91XY0"
FT                   /protein_id="EDL10130.1"
FT                   /translation="MAASKNQHRHGRLVLLCTLMGTLCKISVGQIRYSVPEETDKGTVV
FT                   GNISKDLGLEPRELAERGVRIVSRGRSQLFSLNPRGGSLVTAGRIDREELCAQSTPCLV
FT                   NINILVEEKGKLFGVEIEITDINDNNPKFHVGDLEVKINEIAAPGARYPLPEAVDPDVG
FT                   INSLQSYQLSPNRHFSLHLQTGDDGTINPELVLERTLDREEEPTHHLVLTASDGGEPRR
FT                   SSTALIQITVLDTNDNAPVFDQPVYRVKVLENVAPGTLLLTVRASDPDEGVNGKVTYKF
FT                   RKINEKQSLLFHLHENTGEMTVAKNLDYEECSLYEMEIQAEDVGALLGRSKVIIMVEDV
FT                   NDNRPEVTITSLFNPVLENSLPGTVIAFLNVHDQDSGKNGQVVCYTHDNLPFKLEKSID
FT                   NYYRLVTWKYLDREKVSTYNITVIASDLGAPPLSTETYIALTVADTNDNPPRFSHTSYT
FT                   AYLPENNLRGASIFSLTAHDPDSQENAQVTYSVSEDTIQGVPLSSYISINSDTGILYAL
FT                   QSFDFEKIQDLQLLVIATDSGSPPLSSNVSLSLFVLDQNDNAPEILYPSFPTDGSTGVE
FT                   LAPRSAEPGYLVTKVVAVDKDSGQNAWLSYRLLKASEPGLFSVGLHTGEVRTARALLDR
FT                   DALKQNLVMAVQDHGQPPLSATVTLTVAVANSIPEVLADLSSIMTPEVPEDSDLTLHLV
FT                   VAVAVVSCVFLVFVIVLLALRLQRWQKSRQLQGSRSGLAPAPPSHFVGIDGVQAFLQTY
FT                   SHEVSLTSGSQTSHIIFPQPNYADMLINQESCEKNDSLLTSIDFHENKDEDACAPQAPP
FT                   NTDWRFSQAQRPGTSGSQNGDETGTWPNNQFDTEMLQAMILASASEAADGSSTLGGGAG
FT                   TMGLSARYGPQFTLQHVPDYRQNVYIPGSNATLTNAAGKRDGKAPAGGNGNKKKSGKKE
FT                   KK"
FT   mRNA            join(<431097..433502,535369..535427,543604..543692,
FT                   550253..552222)
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, transcript variant mCT174343"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174343.0
FT                   created on 14-OCT-2002"
FT   CDS             join(431097..433502,535369..535427,543604..543692,
FT                   550253..550479)
FT                   /codon_start=1
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, isoform CRA_g"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174343.0
FT                   protein_id=mCP97262.0 isoform=CRA_g"
FT                   /protein_id="EDL10124.1"
FT                   /translation="MWEGTAERGRGQRRPMLLPFLLPLFCPALSEQIRYKIPEEMPTGS
FT                   VVGNLAKDLGFSVQELPTRKLRISSKKPYFSVSSESGELLVSSRLDREQICGKKLMCAL
FT                   EFEAVAENPLNFYHLSVELEDINDHTPKFAHTSTELQISESAQPGTRFILEVAEDADVA
FT                   LNSLQNYKLSPSPVFSMVNKEKQDGRKYPELVLEKTLDREQQNYYRLVLTALDGGDPPL
FT                   SGTTELRIQVTDANDNPPVFNQEVYKVRLPENVPPGTTVLRVTATDKDEGVNSEISYSL
FT                   HRAGQVFGLNSKSGEITTQTTLDFEEIKEYSLVVEARDGGGLVAQCTVEINIQDENDNR
FT                   PEITVDSLLETILENAETGTLIALIKIHDGDSGENGEVNCRLDGEVPFKIISSSKNSYK
FT                   LVTDRALDRELTPEYNVTITATDRGKPPLSSSTKVTLHVGDVNDNAPLFHQASYLVYIA
FT                   ENNPPGASIAQVSASDLDLGSNGHVSYSIIASDLEPKSLWSYVTVNAQSGVVFAQRAFD
FT                   HEQLRSFQLTLQARDQGSPSLSANVSMRVLVGDRNDNAPRVLYPTLEPDGSALFDMVPR
FT                   AAEPGYLVTKVVAVDADSGHNAWLSYHVLQASDPGLFSLGLRTGEVRTARALGEKDAAR
FT                   QRLLVGVRDGGQPPLSATATLLLVFADSLQEALPDLSDRSLPPDPQAELQFYLVVALAL
FT                   VSVLFLLAVILAIALRLRHSSSPSVWNCFQPGFCSESKPVVFPNYSEGTLPYSYNLYGA
FT                   HAGKTECNFLKCSEPLSSGQGLLCPESSGALFPLCDSSEPTSHPEPLTPQAPPNTDWRF
FT                   SQAQRPGTSGSQNGDETGTWPNNQFDTEMLQAMILASASEAADGSSTLGGGAGTMGLSA
FT                   RYGPQFTLQHVPDYRQNVYIPGSNATLTNAAGKRDGKAPAGGNGNKKKSGKKEKK"
FT   mRNA            join(<437062..439485,535369..535427,543604..543692,
FT                   550253..552222)
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, transcript variant mCT174354"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174354.0
FT                   created on 14-OCT-2002"
FT   CDS             join(437062..439485,535369..535427,543604..543692,
FT                   550253..550479)
FT                   /codon_start=1
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, isoform CRA_x"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174354.0
FT                   protein_id=mCP97253.0 isoform=CRA_x"
FT                   /protein_id="EDL10141.1"
FT                   /translation="MAAAPARRPHCRELVVLCALLGMLWEARAGQIRYSVPEETEKGYI
FT                   VGNISKDLGLEPRELAERGVRIVSKGKTQLFSLSPRSGSLVTAGRIDREELCAQSAPCL
FT                   LSFKVLVEDRVKLYGVEVEVVDINDNAPKFEAKNLVVKISEIAAPGARYPLPEAVDPDV
FT                   GINSLQSYQLSPNHHFSLHLQTGDDGTINPELVLERTLDREEEPTHHLVLTAYDGGNPR
FT                   RSSTALIQVTVLDTNDNAPVFDQPVYRVKVLENVAPGTLLLTVRASDPDEGANGKVTYK
FT                   FRKINEKHSLLFHLHENTGEMTVAKNLDYEECSLYEMEIQAEDGGGLKGRTKVVVMVED
FT                   VNDNRPEVTITSLFSPVREDAPPGTVILLFNAHDQDSGKNGQVVCSIQENPSFKLENSV
FT                   DDYYRLLTAQILDREKASEYNITVTATDRGTPSMSTEVHITLYVADINDNPPAFSQTSY
FT                   SVYLPENNPRGTSIFSVSAHDPDDEENAKVTYSLVENTIQGAPLSSYVSINSDTGVLYA
FT                   LQSFDYEQFQNLQMQVKASDNGHPPLSSNVSLSVFLLDQNDNAPKILYPSLPTDGSTGV
FT                   ELAPRSAEAGYLVTKVVAVDKDSGQNAWLSYRLLKASEPGLFTVGLRSGEIRTARALLE
FT                   RDALKQSLVVAVQDHGQPPLSATITLTVAVADSIPDILADLGSINTPADPDSDITLYLV
FT                   VAVAVVSCIFLLFVLVLLALRLRRWHASHLLQDAMGGSTGVPTSHIVGVHGVQTFLQTY
FT                   SQEFSLTPDSGKSHLIFPQPNYADTLISQESCGKSEPLCSSVEPKFPIDDTPLVPQAPP
FT                   NTDWRFSQAQRPGTSGSQNGDETGTWPNNQFDTEMLQAMILASASEAADGSSTLGGGAG
FT                   TMGLSARYGPQFTLQHVPDYRQNVYIPGSNATLTNAAGKRDGKAPAGGNGNKKKSGKKE
FT                   KK"
FT   mRNA            join(<442183..444600,535369..535427,543604..543692,
FT                   550253..552222)
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, transcript variant mCT174355"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174355.0
FT                   created on 14-OCT-2002"
FT   CDS             join(442183..444600,535369..535427,543604..543692,
FT                   550253..550479)
FT                   /codon_start=1
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, isoform CRA_n"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174355.0
FT                   protein_id=mCP97274.0 isoform=CRA_n"
FT                   /db_xref="GOA:Q91XX4"
FT                   /db_xref="InterPro:IPR002126"
FT                   /db_xref="InterPro:IPR013164"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR020894"
FT                   /db_xref="MGI:MGI:1935197"
FT                   /db_xref="UniProtKB/TrEMBL:Q91XX4"
FT                   /protein_id="EDL10131.1"
FT                   /translation="MGGSSARRKRPDRPQVLFTLLLPLFCPALGQPVRYSIPEELDRGS
FT                   VVGKLAKDLGLSVLEVSSRKLRVSAEKLHFSVDSESGDLLVKDRIDREQICKGRRKCEL
FT                   QLEAVLENPLNIFHVVVGIEDVNDNAPQFEKKETRLEILETVAVGTRIPLEPATDPDIN
FT                   LNSVKDYQISSNPYFSLMVRVNPDGGKTPELSLEKLLDREEQRSHRLILTALDGGDPPR
FT                   SATTQIEISVKDNNDNPPVFSKEEYWVSVSENLSPGSSVLQVTATDEDEGVNAEILYYF
FT                   RSTAQSTRHVFSLDEKTGVIKNNQSLDFEDIERYTMEVEAKDGGGLSTRCKIIIEVLDE
FT                   NDNSPEITITSLSDHILENSPPGVVVVLFKTRDRDFGGNGEVTCDIGKDLPFKIQASSS
FT                   NYYKLVTDGALDREQNPQYNVTITATDKGKPALSSSTTIVLHITDINDNAPAFQKSSYI
FT                   VHVAENNPPGASIAQVSASDPDLGANGHVSYSIIASDLEPKSLWSYVTVNAQSGVVFAQ
FT                   RAFDHEQLRSFQLTLQARDQGKPSLSANVSMRVLVGDRNDNAPRVLYPALEPDGSALFD
FT                   MVPRAAEPGYLVTKVVAVDADSGHNAWLSYHVLQASDPGLFSLGLRTGEVRTARALGEK
FT                   DAARQRLLVGVRDGGQPPLSATATLLLVFADSLQEALPDLSDRSLPPDPQAELQFYLVV
FT                   ALALISVLFLLAVILAIALRLRHSSSPSVWGCFQSGLCSKARPGVSLNYSEGTLPYSYN
FT                   LCVGQTGKAELNFLKCSAPLPSSQEIVSGSSPGALIPLHLGDDLTTHPETLTPQAPPNT
FT                   DWRFSQAQRPGTSGSQNGDETGTWPNNQFDTEMLQAMILASASEAADGSSTLGGGAGTM
FT                   GLSARYGPQFTLQHVPDYRQNVYIPGSNATLTNAAGKRDGKAPAGGNGNKKKSGKKEKK
FT                   "
FT   mRNA            join(<447130..449547,535369..535427,543604..543692,
FT                   550253..552222)
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, transcript variant mCT174356"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174356.0
FT                   created on 14-OCT-2002"
FT   CDS             join(447130..449547,535369..535427,543604..543692,
FT                   550253..550479)
FT                   /codon_start=1
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, isoform CRA_o"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174356.0
FT                   protein_id=mCP97270.0 isoform=CRA_o"
FT                   /protein_id="EDL10132.1"
FT                   /translation="MAAQRNLSERTKLVLLFLWMPWESAARQIRYSVPEELEKGSFVGN
FT                   IAKDLGLEPRQLAERGVRIISRGRSQLFSLNPRGGSLVTAGRIDREELCAQSAPCLVSF
FT                   NILVEDRVKLFGIEIEVTDVNDNAPKFQAETLDVKINENVAPGMRFPLPEATDPDVGVN
FT                   SLQSYQLSSNKHFSLVVQSGAKGVKYPELVLEQALDREEEAIHHLVLVASDGGNPPRSG
FT                   TVLITVTVFDANDNAPVFTSTEYRVNIPENLPVGTQLLKVTATDKDEGANGEVTYAFRK
FT                   SLDTQLSKFQLDKHTGEIKISENLDYEEMSFYEIEIQAEDGGAYLATAKVLITVEDVND
FT                   NSPEVTITSLFSPVTEDSPVGTVIALLNVHDLDSGQNGEVACSISGNLPFKLEKSIDNY
FT                   YRLVTQRALDREQVPAYNITVTATDGGNPPLSTKADFTLQVADINDNPPTFSHPSYFTY
FT                   IPENNPRGASIFSVTALDPDSKENAQIVYSLAEDTIEGAPLSSYISINSDTGILYALWS
FT                   FDYEQFRELQVQVTASDSGKPPLHSNVSLTLFVLDQNDNSPEILYPTMPTDGSTGVELA
FT                   PRSAELGYLVTKVVAVDRDSGQNAWLSYRLLKASEPGLFTVGLHTGEVRTARALMERDA
FT                   LKQSLVVAVQDHGQPPLSATVTLTVAVADSIPDVLADLGNLEPPQDSEASNLTLYLVVA
FT                   VAAVSCVFLAFVIVLLALKLRRWHKSHVLQSSRDGLAGMPASHYVGVDGVRAFLQTYSH
FT                   EVSLTADSRKSHLIFPQPNYADTLISQESCEKKDPLSLLDDSKCPVEDAPLVPQAPPNT
FT                   DWRFSQAQRPGTSGSQNGDETGTWPNNQFDTEMLQAMILASASEAADGSSTLGGGAGTM
FT                   GLSARYGPQFTLQHVPDYRQNVYIPGSNATLTNAAGKRDGKAPAGGNGNKKKSGKKEKK
FT                   "
FT   assembly_gap    450673..450692
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            join(<452580..454994,535369..535427,543604..543692,
FT                   550253..552222)
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, transcript variant mCT174357"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174357.0
FT                   created on 14-OCT-2002"
FT   CDS             join(452580..454994,535369..535427,543604..543692,
FT                   550253..550479)
FT                   /codon_start=1
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, isoform CRA_y"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174357.0
FT                   protein_id=mCP97264.0 isoform=CRA_y"
FT                   /db_xref="GOA:Q91XX3"
FT                   /db_xref="InterPro:IPR002126"
FT                   /db_xref="InterPro:IPR013164"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR020894"
FT                   /db_xref="MGI:MGI:1935199"
FT                   /db_xref="UniProtKB/TrEMBL:Q91XX3"
FT                   /protein_id="EDL10142.1"
FT                   /translation="MGGSSARRKRPGRPQVLFILLLPLFCPALGQPVRYSIPEELDRGS
FT                   VVGKLAKDLGLSVLEVSARKLRVSAEKLHFSVDSESGDLLVKDRIDREQICKGRRKCEL
FT                   QLEAVLENPLNIFHVVVEIEDVNDHAPQFPKDEINLEISESDSPGARTILESAKDLDIG
FT                   MNSLSKYQLSPNDYFLLLVKDNPDGSKYPELELQKMLDREAESTHHLMLTAVDGGDPPR
FT                   TGTTQLRIRVVDANDNRPVFSQDVYRVRLPEDLPPGTTVLRLKAMDQDEGINAEFTYSF
FT                   LGVANKAQFSLDPITGDIVTRQSLDFEEVEQYTIDVEAKDRGSLSSQCKVIIEVLDEND
FT                   NRPEIIITSLSDQISEDSPSGTVVALFKVRDRDSGENAEVMCSLSGNNPFKIHSSSNNY
FT                   YKLVTDSILDREQTPGYNVTITATDRGKPPLSSSTTITLNVADVNDNAPVFQQQAYLIN
FT                   VAENNQPGTSITQVKAWDPDVGSNGLVSYSIIASDLEPKALSSFVSVNQDSGVVYAQRA
FT                   FDHEQIRSFQLTLQARDQGSPALSANVSMRVLVDDRNDNAPRVLYPTLEPDGSALFDMV
FT                   PRAAEPGYLVTKVVAVDADSGHNAWLSYHVLQASDPGLFSLGLRTGEVRTARALSDKDA
FT                   ARQRLLVAVRDGGQPPLSATATLLLVFADSLQEALPDLVDHPIPSDPQSELQFYLVVAL
FT                   ALISVLFLLAVIFAIALRLRQSSSPSSTGCFGSVLGSKSRPVLPPNYSEGTLPYAYNLC
FT                   VPGDQLKPEFNYFSSVGDCPAAQDILNKDSSSALLASILTPGVEADEKTFNQQAPPNTD
FT                   WRFSQAQRPGTSGSQNGDETGTWPNNQFDTEMLQAMILASASEAADGSSTLGGGAGTMG
FT                   LSARYGPQFTLQHVPDYRQNVYIPGSNATLTNAAGKRDGKAPAGGNGNKKKSGKKEKK"
FT   gene            complement(453071..>478777)
FT                   /locus_tag="mCG_145923"
FT                   /note="gene_id=mCG145923.0"
FT   mRNA            complement(join(453071..453699,456170..457917,
FT                   478469..>478777))
FT                   /locus_tag="mCG_145923"
FT                   /product="mCG145923"
FT                   /note="gene_id=mCG145923.0 transcript_id=mCT186031.0
FT                   created on 04-JUL-2003"
FT   CDS             complement(456359..>456754)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145923"
FT                   /product="mCG145923"
FT                   /note="gene_id=mCG145923.0 transcript_id=mCT186031.0
FT                   protein_id=mCP107756.0"
FT                   /protein_id="EDL10144.1"
FT                   /translation="FAMAGCERYSVRVLRRFNFYLFFRVSFCVYEVPGIPHPKHIPKRT
FT                   EVFLLPELRCVSIHPFRLCVLEIPEKYSIALSSRSPIGQQRRLEPNLIIATLIKTRCLL
FT                   RRKLSHSPFPWILTFVKPTTANNSYVM"
FT   mRNA            join(<456747..459173,535369..535427,543604..543692,
FT                   550253..552222)
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, transcript variant mCT174333"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174333.0
FT                   created on 14-OCT-2002"
FT   CDS             join(456747..459173,535369..535427,543604..543692,
FT                   550253..550479)
FT                   /codon_start=1
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, isoform CRA_b"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174333.0
FT                   protein_id=mCP97275.0 isoform=CRA_b"
FT                   /protein_id="EDL10119.1"
FT                   /translation="MANQSQRLDRRALIPLCIFLGTLLTFGTGQIRYSVPEETDKGFFV
FT                   GNISKDLGLEPWEVAERGVRIISRGQSQLFSLNPRGGSLVTAGRIDREELCDTMPSCML
FT                   NLEILVEETLKIYGVEVEVLDINDNAPSFREEEVEIKVSEHTSPGSRFPLPSARDPDAG
FT                   MNSLQSYQLSPSSYFSLQVRGGTDGDKNPELVLEEGLDREKEASHHLLLTALDGGDPVR
FT                   KGTVPIRVVVLDVNDHIPKFTQPVYRVSIPENLSSGTRVLVVNASDPDEGINGEVIYSF
FT                   RKMKSKASEIFQLNSQTGEVLVGKPLDFEKYRFYEMEIQGQDGGGLLSTTTLLITVEDV
FT                   NDNAPEITVTSASNSVSENSPSGTVIALLNVQDQDSGENGQVSCFIPSGLPFKLEKTYG
FT                   NYYKLITNSELDREQVESYNITLIAKDQGSPPLSTETHLLLKVADANDNPPVFSSSSYS
FT                   AYIPENNPRGSSIFSVTAIDRDSRENAQVTYSLAEYTIQGTPLSSYVSINSDTGVLYAL
FT                   QSFDYEQFQTLQLGVTASDNGDPPLSSNISLTLFVLDQNDNTPEILYPSLPTDGSTGVE
FT                   LAPRSAEPGYLVTKVVAVDRDSGQNAWLSYRLLKASEPGLFSVGLHTGEVRTARAMMDK
FT                   DALKQSLVVTVQDHGQPPLSATVKLTVAVADSIPEVLEDLVSLESPANPDESGLTLYLV
FT                   VAITAVSCIFLIFVMVLLALKLRRWHSLRLLQAASGLAGVPPSHFVGVDGMRAFLQTYS
FT                   HEVSLTADSRKSHLIFPQPNYADTLISQESCGKSEPLLITEDSTTVLGKCEPTDIQQAP
FT                   PNTDWRFSQAQRPGTSGSQNGDETGTWPNNQFDTEMLQAMILASASEAADGSSTLGGGA
FT                   GTMGLSARYGPQFTLQHVPDYRQNVYIPGSNATLTNAAGKRDGKAPAGGNGNKKKSGKK
FT                   EKK"
FT   mRNA            join(459099..459116,535369..535427,543604..543692,
FT                   550253..550790)
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, transcript variant mCT174349"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174349.0
FT                   created on 14-OCT-2002"
FT   assembly_gap    461056..462172
FT                   /estimated_length=1117
FT                   /gap_type="unknown"
FT   assembly_gap    463573..463592
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    465123..465142
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            join(<465793..468212,535369..535427,543604..543692,
FT                   550253..552222)
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, transcript variant mCT174334"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174334.0
FT                   created on 14-OCT-2002"
FT   CDS             465793..467271
FT                   /codon_start=1
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, isoform CRA_p"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174334.0
FT                   protein_id=mCP97269.0 isoform=CRA_p"
FT                   /protein_id="EDL10133.1"
FT                   /translation="MERSSVKLGSRTPWRQVLFPFLLPLFCTGLSEQVRYSIPEEMAMG
FT                   SVVGNLAEDLGLPVQDLLTRNLRVIAEKPYLSVNPENGNIVVSDRIDREFLCFQSPLCV
FT                   LPLEIVAENPLNVFHVSVVIEDINDNPPRFLQNSIVLQINELAIPGTRFGLESAIDADV
FT                   GLNSLQSYQLSLNEHFSLVVKDNTEGKDAPELVLEKPLDREKQSSQLLVLTAVDGGEPV
FT                   LTGTAQIQIEVTDANDNPPVFSQSTYKVSLREDMAAGTSVLTVIATDQDEGVNAEVTYS
FT                   FKSLGEDIRDKFILDHQSGEIKSKGPIDFETKRTYTMNIEAKDGGGMASECKVVVEILD
FT                   ENDNAPEVVFTSVSNSITEDAEPGTVVALFKTYDKDSEENGRVSCFVKETVPFRIESSA
FT                   SNYYKLVTDGILDREQTPEYNVTIIATDKGKPPLSSSTSVTLHVGDINDNAPVFHQTSY
FT                   LIQVAENNPPGASIAQVSAFDPDLGSMVSSPTPS"
FT   assembly_gap    470189..476293
FT                   /estimated_length=6105
FT                   /gap_type="unknown"
FT   mRNA            join(476555..479074,535369..535427,543604..543692,
FT                   550253..552225)
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, transcript variant mCT134754"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT134754.0
FT                   created on 14-OCT-2002"
FT   CDS             join(476660..479074,535369..535427,543604..543692,
FT                   550253..550479)
FT                   /codon_start=1
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, isoform CRA_a"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT134754.0
FT                   protein_id=mCP77563.1 isoform=CRA_a"
FT                   /protein_id="EDL10118.1"
FT                   /translation="MQRREDCKGLVFLGVLLGMLWKAGSTQIRYSVPEELEKGSRVGNI
FT                   SKDLGLKPRELAERGVRIVSRGRAQLFALNPRSGSLVTAGRIDREELCMGSIKCQLNLE
FT                   ILMEDIGKIYGVEIEVRDINDNAPYFRESELEIKMSENAAAGMRFPLPHAWDPDIGKNS
FT                   LQSYQLSPNAHFSLEVQNGADGNKYPELVLESSLDREEKAAHLLVLTASDAGDPVRTGT
FT                   ARIRVTVVDANDNAPAFARSEYRVSVRENVAVGTQLLLVNATDRDEGANAEVIYSFRYV
FT                   DDKAAKVFKLDSNLGTISTIGELNHEESGFYEMEVQATDNAGYSARAKVLVTVLDVNDN
FT                   APEVAITSLTNSVPENSPQGTLIALLNVNDQDSGENGQVICSIQENLPFKLEKSYGNYY
FT                   RLVTDAVLDREEVPSYNITVTATDRGSPPLTTETHLALDIADTNDNSPVFLQASYWAYI
FT                   PENNPRGASIASVTAHDPDSDKNAQVTYSLAEDTHQGVPLSSYVSINSDTGVLYALHSF
FT                   DYEQFPDLQLQVMARDSGDPPLSSNVSLSLFVLDQNDNVPEILYPTLPTDGSTGVELAP
FT                   RSAEPGYLVTKVVAVDRDSGQNAWLSYRLLKASEPGLFSVGLHTGEISTARALMDRDAL
FT                   KQNLVVSVQDHGQPPLSATVTLTVAIADSIPDVLADLDNLESPSTSETSGLTLYLVVAV
FT                   AAVSTVFLVFVLVLLALRLRRWHSLRLLRAGGPGLADVAASHFVGVDGVQAFLQTYSHE
FT                   VSLTAGSRKSHLIFPQPNYADTLISQESCEKTEPLLPSGDSVFSKDNHALNQQAPPNTD
FT                   WRFSQAQRPGTSGSQNGDETGTWPNNQFDTEMLQAMILASASEAADGSSTLGGGAGTMG
FT                   LSARYGPQFTLQHVPDYRQNVYIPGSNATLTNAAGKRDGKAPAGGNGNKKKSGKKEKK"
FT   assembly_gap    481576..482694
FT                   /estimated_length=1119
FT                   /gap_type="unknown"
FT   assembly_gap    484023..485005
FT                   /estimated_length=983
FT                   /gap_type="unknown"
FT   assembly_gap    486289..486986
FT                   /estimated_length=698
FT                   /gap_type="unknown"
FT   mRNA            join(<516886..519315,535369..535427,543604..543692,
FT                   550253..552222)
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, transcript variant mCT174336"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174336.0
FT                   created on 14-OCT-2002"
FT   CDS             join(516886..519315,535369..535427,543604..543692,
FT                   550253..550479)
FT                   /codon_start=1
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, isoform CRA_q"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174336.0
FT                   protein_id=mCP97261.0 isoform=CRA_q"
FT                   /protein_id="EDL10134.1"
FT                   /translation="MVAEARSSGLASPWRTVGVLLLLAALTEASTIIHYEILEERERGF
FT                   PVGNVVTDLGLDLGSLSARRLRVVSGASRRFFEVNWETGEMFVNDRLDREELCGTLPSC
FT                   TVTLELVVENPLELFSAEVVVQDINDNNPSFPTGEMKLEISEALAPGTRFPLESAHDPD
FT                   VGSNSLQTYELSHNEYFALRVQTREDGTKYAELVLERALDWEREPSVQLVLTALDGGTP
FT                   ARSATLPIRITVLDANDNAPAFNQSLYRARVREDAPPGTRVAQVLATDLDEGLNGEIVY
FT                   SFGSHNRAGVRELFALDLVTGVLTIKGRLDFEDTKLHEIYIQAKDKGANPEGAHCKVLV
FT                   EVVDVNDNAPEITVTSVYSPVPEDAPLGTVIALLSVTDLDAGENGLVTCEVPPGLPFSL
FT                   TSSLKNYFTLKTSAALDRETMPEYNLSITARDSGIPSLSALTTVKVQVSDINDNPPQSS
FT                   QSSYDVYVEENNLPGVPILNLSVWDPDAPPNARLSFFLLEPGAETGLVSRYFTINRDNG
FT                   VLTTLVPLDYEDQREFQLTAHINDGGTPVLATNISVNVFVTDRNDNAPQVLYPRPGQSS
FT                   VEMLPRGTAAGHVVSRVVGWDADAGHNAWLSYSLLGAPNQSLFAVGLHTGQISTARPIQ
FT                   DTDSPRQILTVLISDSGEPLLSTTATLTVSVTEESPEARAEFPSGSAPREQNKNLTFYL
FT                   LLSLILVSVGFAVTVLGVIIFKVYKWKRSRDLYRAPVSSLYRTPGPSLHADAVRGGLMP
FT                   PHLYHQVYLTTDSRRSDPLLKKPGAASPLASRQNTLRSCDPVFYRQVLGAESAPPGQQA
FT                   PPNTDWRFSQAQRPGTSGSQNGDETGTWPNNQFDTEMLQAMILASASEAADGSSTLGGG
FT                   AGTMGLSARYGPQFTLQHVPDYRQNVYIPGSNATLTNAAGKRDGKAPAGGNGNKKKSGK
FT                   KEKK"
FT   mRNA            join(<525881..528331,535369..535427,543604..543692,
FT                   550253..552222)
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, transcript variant mCT174338"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174338.0
FT                   created on 14-OCT-2002"
FT   CDS             join(525881..528331,535369..535427,543604..543692,
FT                   550253..550479)
FT                   /codon_start=1
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, isoform CRA_r"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174338.0
FT                   protein_id=mCP97259.0 isoform=CRA_r"
FT                   /db_xref="GOA:Q91XX0"
FT                   /db_xref="InterPro:IPR002126"
FT                   /db_xref="InterPro:IPR013164"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR020894"
FT                   /db_xref="MGI:MGI:1935197"
FT                   /db_xref="UniProtKB/TrEMBL:Q91XX0"
FT                   /protein_id="EDL10135.1"
FT                   /translation="MAAMPSTVRSWVEIWWGATLLFLFCHLGYVYGQIRYPVPEESQEG
FT                   TFVGNVAQDFLLDTESLSARRLQVAGEVNQRHFRVDLDSGALLIKNPIDREALCGLSAS
FT                   CIVPLEFVTEGPLEMYRAEVEIVDVNDHAPRFPRQQLDLEIGEAAPPGQRFPLEKAQDA
FT                   DVGSNSISSYRLSSNEHFALDVKKRSDGSLVPELLLEKPLDREKQSDYRLVLTAVDGGN
FT                   PPRSGTAELRVSVLDVNDNAPAFQQSSYRISVLESAPAGMVLIQLNASDPDLGPSGNVT
FT                   FSFSGHTPDRVRNLFSLHPTTGKLTLQGPLDFESENYYEFDVRARDGGSPAMEQHCSLR
FT                   VDLLDVNDNAPHITVTSELGTLPESAEPGTVVALISVQDPDSGSNGDVSLRIPDHLPFA
FT                   LKSAFRNQFSLVTAGPLDREARSSYDIMVTASDAGNPPLSTHRTIFLNISDVNDNPPSF
FT                   FQRSHEVFVPENNRPGDLLCSLAASDPDSGLNALISYSLLEPRNRDVSASSFISLNPQT
FT                   GAVHATRSFDYEQTQTLQFEVQARDRGSPPLSSTVTVRLFVLDLNDNAPAVLRPRARPG
FT                   SLCPQALPPSVGAGHLVTKVTAVDLDSGYNAWVSYQLLEAPDPSLFAVSRYAGEVRTAV
FT                   PIPADLPPQKLVIVVKDSGSPPLSTSVTLLVSLEEDTHPVVPDLRESSAPREGESRLTL
FT                   YLAVSLVAICFVSFGSFVALLSKCLRGAACGVTCFPAGTCACLTRSRRREGLPPSNGIL
FT                   RIQLGSEDPIKFVDVGGHSHGCTPLASAPTRSDSFMMVKSPSAPMAGEPVRPSCPPSDL
FT                   LYGLEQAPPNTDWRFSQAQRPGTSGSQNGDETGTWPNNQFDTEMLQAMILASASEAADG
FT                   SSTLGGGAGTMGLSARYGPQFTLQHVPDYRQNVYIPGSNATLTNAAGKRDGKAPAGGNG
FT                   NKKKSGKKEKK"
FT   mRNA            join(529914..530064,535373..535427,543604..543692,
FT                   550253..552225)
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, transcript variant mCT174348"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174348.0
FT                   created on 14-OCT-2002"
FT   mRNA            join(529999..535427,543604..543692,550253..552225)
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, transcript variant mCT174347"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174347.0
FT                   created on 14-OCT-2002"
FT   mRNA            join(<530023..532482,535369..535427,543604..543692,
FT                   550253..552222)
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, transcript variant mCT174341"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174341.0
FT                   created on 14-OCT-2002"
FT   CDS             join(530023..532482,535369..535427,543604..543692,
FT                   550253..550479)
FT                   /codon_start=1
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, isoform CRA_f"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174341.0
FT                   protein_id=mCP97266.0 isoform=CRA_f"
FT                   /db_xref="GOA:Q91XW9"
FT                   /db_xref="InterPro:IPR002126"
FT                   /db_xref="InterPro:IPR013164"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR020894"
FT                   /db_xref="MGI:MGI:1935197"
FT                   /db_xref="UniProtKB/TrEMBL:Q91XW9"
FT                   /protein_id="EDL10123.1"
FT                   /translation="MRPMASPQVAGKWQVLCMLSLCCCGWVSGQLRYSVVEESEPGTLV
FT                   GNVAQDLGLKGTDLLSRRLRLGSEENGRYFSLSLVSGALAVSQKIDRESLCGASTSCLL
FT                   PVQVVTEHPLELTRVEVEILDLNDNSPSFATPDREMRISESAAPGARFPLDSAQDPDVG
FT                   TNTVSFYTLSPNSHFSLHVKTLKDGKLFPELVLEQQLDRETQARHQLVLTAVDGGTPAR
FT                   SGTSLISVIVLDVNDNAPTFQSSVLRVGLPENTPPGTLLLRLNATDPDEGTNGQLDYSF
FT                   GDHTSETVKNLFGLDPSSGAIHVLGPVDFEESNFYEIHARARDQGQPAMEGHCVIQVDV
FT                   GDANDNPPEVLLASLVNPVLESTPVGTVVGLFNVRDRDSGRNGEVSLKTSPNLPFQIKP
FT                   SENHYSLLTSQPLDREATSHYTIELLASDAGSPPLHTHLTLRLNISDVNDNAPHFTQQL
FT                   YTAYIPENRPPGSLLCTVAASDPDEGDNARLTYSIVGSQIQGAPASSFVYVNPEDGRIF
FT                   AQRTFDYELLQMLQIVVGVRDSGSPRLHANTSLHVFVLDQNDNAPAVLHPRPGREFSAP
FT                   QRLPRSAPPGSLVTKVTAVDADAGHNAWLSYSLLPQSTAPGLFLVSAHTGEVRTARALL
FT                   EDDSDTQQVVVLVRDNGDPSLSSTATVLLVLEDEDAEEMPKSSDFLTHPPERSDLTLYL
FT                   IVALAAVSLLSLVTFTFMSAKCLRRHEDGDRGGGHCCRGQDSPSREFYKQSSPNLQVSS
FT                   DGTLKYMEVTLRPTDSQSHCYRTCFSPASDGSDFTFLRPLSVQQPSALALEPEALRSRS
FT                   STLRERSQQAPPNTDWRFSQAQRPGTSGSQNGDETGTWPNNQFDTEMLQAMILASASEA
FT                   ADGSSTLGGGAGTMGLSARYGPQFTLQHVPDYRQNVYIPGSNATLTNAAGKRDGKAPAG
FT                   GNGNKKKSGKKEKK"
FT   CDS             530023..532638
FT                   /codon_start=1
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, isoform CRA_i"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174347.0
FT                   protein_id=mCP97265.0 isoform=CRA_i"
FT                   /db_xref="GOA:Q8K4A2"
FT                   /db_xref="InterPro:IPR002126"
FT                   /db_xref="InterPro:IPR013164"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR020894"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K4A2"
FT                   /protein_id="EDL10126.1"
FT                   /translation="MRPMASPQVAGKWQVLCMLSLCCCGWVSGQLRYSVVEESEPGTLV
FT                   GNVAQDLGLKGTDLLSRRLRLGSEENGRYFSLSLVSGALAVSQKIDRESLCGASTSCLL
FT                   PVQVVTEHPLELTRVEVEILDLNDNSPSFATPDREMRISESAAPGARFPLDSAQDPDVG
FT                   TNTVSFYTLSPNSHFSLHVKTLKDGKLFPELVLEQQLDRETQARHQLVLTAVDGGTPAR
FT                   SGTSLISVIVLDVNDNAPTFQSSVLRVGLPENTPPGTLLLRLNATDPDEGTNGQLDYSF
FT                   GDHTSETVKNLFGLDPSSGAIHVLGPVDFEESNFYEIHARARDQGQPAMEGHCVIQVDV
FT                   GDANDNPPEVLLASLVNPVLESTPVGTVVGLFNVRDRDSGRNGEVSLKTSPNLPFQIKP
FT                   SENHYSLLTSQPLDREATSHYTIELLASDAGSPPLHTHLTLRLNISDVNDNAPHFTQQL
FT                   YTAYIPENRPPGSLLCTVAASDPDEGDNARLTYSIVGSQIQGAPASSFVYVNPEDGRIF
FT                   AQRTFDYELLQMLQIVVGVRDSGSPRLHANTSLHVFVLDQNDNAPAVLHPRPGREFSAP
FT                   QRLPRSAPPGSLVTKVTAVDADAGHNAWLSYSLLPQSTAPGLFLVSAHTGEVRTARALL
FT                   EDDSDTQQVVVLVRDNGDPSLSSTATVLLVLEDEDAEEMPKSSDFLTHPPERSDLTLYL
FT                   IVALAAVSLLSLVTFTFMSAKCLRRHEDGDRGGGHCCRGQDSPSREFYKQSSPNLQVSS
FT                   DGTLKYMEVTLRPTDSQSHCYRTCFSPASDGSDFTFLRPLSVQQPSALALEPEALRSRS
FT                   STLRERSQVRAGSRHATPGRARWRSCPVHLRGVCSCTLFLFVPSWHTCWMRLKVDNQSG
FT                   "
FT   CDS             join(530058..530064,535373..535427,543604..543692,
FT                   550253..550479)
FT                   /codon_start=1
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, isoform CRA_j"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174348.0
FT                   protein_id=mCP97256.0 isoform=CRA_j"
FT                   /protein_id="EDL10127.1"
FT                   /translation="MATPPNTDWRFSQAQRPGTSGSQNGDETGTWPNNQFDTEMLQAMI
FT                   LASASEAADGSSTLGGGAGTMGLSARYGPQFTLQHVPDYRQNVYIPGSNATLTNAAGKR
FT                   DGKAPAGGNGNKKKSGKKEKK"
FT   CDS             join(543659..543692,550253..550479)
FT                   /codon_start=1
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, isoform CRA_k"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174349.0
FT                   protein_id=mCP97252.0 isoform=CRA_k"
FT                   /protein_id="EDL10128.1"
FT                   /translation="MLQAMILASASEAADGSSTLGGGAGTMGLSARYGPQFTLQHVPDY
FT                   RQNVYIPGSNATLTNAAGKRDGKAPAGGNGNKKKSGKKEKK"
FT   gene            complement(555176..645609)
FT                   /gene="Diap1"
FT                   /locus_tag="mCG_18335"
FT                   /note="gene_id=mCG18335.1"
FT   mRNA            complement(join(555176..555850,561886..561972,
FT                   563638..563773,563879..564041,564813..564939,
FT                   565809..565938,566048..566287,566509..566610,
FT                   566788..566882,570750..570848,600039..600153,
FT                   600818..601510,602134..602313,603690..603754,
FT                   604434..604549,605522..605638,606455..606573,
FT                   606721..606831,607854..607962,610839..610978,
FT                   612287..612350,613266..613352,613529..613659,
FT                   613958..614059,615206..615361,645400..645609))
FT                   /gene="Diap1"
FT                   /locus_tag="mCG_18335"
FT                   /product="diaphanous homolog 1 (Drosophila), transcript
FT                   variant mCT12972"
FT                   /note="gene_id=mCG18335.1 transcript_id=mCT12972.2 created
FT                   on 14-OCT-2002"
FT   mRNA            complement(join(555383..555850,561886..561972,
FT                   563638..563773,563879..564041,564813..564939,
FT                   565809..565938,566048..566482))
FT                   /gene="Diap1"
FT                   /locus_tag="mCG_18335"
FT                   /product="diaphanous homolog 1 (Drosophila), transcript
FT                   variant mCT174389"
FT                   /note="gene_id=mCG18335.1 transcript_id=mCT174389.0 created
FT                   on 14-OCT-2002"
FT   CDS             complement(join(555693..555850,561886..561972,
FT                   563638..563773,563879..564041,564813..564939,
FT                   565809..565938,566048..566287,566509..566610,
FT                   566788..566882,570750..570848,600039..600153,
FT                   600818..601510,602134..602313,603690..603754,
FT                   604434..604549,605522..605638,606455..606573,
FT                   606721..606831,607854..607962,610839..610978,
FT                   612287..612350,613266..613352,613529..613659,
FT                   613958..614059,615206..615361,645400..645516))
FT                   /codon_start=1
FT                   /gene="Diap1"
FT                   /locus_tag="mCG_18335"
FT                   /product="diaphanous homolog 1 (Drosophila), isoform CRA_a"
FT                   /note="gene_id=mCG18335.1 transcript_id=mCT12972.2
FT                   protein_id=mCP8309.2 isoform=CRA_a"
FT                   /protein_id="EDL10115.1"
FT                   /translation="MEPSGGGLGPGRGTRDKKKGRSPDELPATGGDGGKHKKFLERFTS
FT                   MRIKKEKEKPNSAHRNSSASYGDDPTAQSLQDISDEQVLVLFEQMLVDMNLNEEKQQPL
FT                   REKDIVIKREMVSQYLHTSKAGMNQKESSRSAMMYIQELRSGLRDMHLLSCLESLRVSL
FT                   NNNPVSWVQTFGAEGLASLLDILKRLHDEKEETSGNYDSRNQHEIIRCLKAFMNNKFGI
FT                   KTMLETEEGILLLVRAMDPAVPNMMIDAAKLLSALCILPQPEDMNERVLEAMTERAEMD
FT                   EVERFQPLLDGLKSGTSIALKVGCLQLINALITPAEELDFRVHIRSELMRLGLHQVLQE
FT                   LREIENEDMKVQLCVFDEQGDEDFFDLKGRLDDIRMEMDDFGEVFQIILNTVKDSKAEP
FT                   HFLSILQHLLLVRNDYEARPQYYKLIEECVSQIVLHKNGTDPDFKCRHLQIDIERLVDQ
FT                   MIDKTKVEKSEAKATELEKKLDSELTARHELQVEMKKMENDFEQKLQDLQGEKDALDSE
FT                   KQQITAQKQDLEAEVSKLTGEVAKLSKELEDAKNEMASLSAVVVAPSVSSSAAVPPAPP
FT                   LPGDSGTVIPPPPPPPPLPGGVVPPSPPLPPGTCIPPPPPLPGGACIPPPPQLPGSAAI
FT                   PPPPPLPGVASIPPPPPLPGATAIPPPPPLPGATAIPPPPPLPGGTGIPPPPPPLPGSV
FT                   GVPPPPPLPGGPGLPPPPPPFPGAPGIPPPPPGMGVPPPPPFGFGVPAAPVLPFGLTPK
FT                   KVYKPEVQLRRPNWSKFVAEDLSQDCFWTKVKEDRFENNELFAKLTLAFSAQTKTKKDQ
FT                   EGGEEKKSVQKKKVKELKVLDSKTAQNLSIFLGSFRMPYQEIKNVILEVNEAVLTESMI
FT                   QNLIKQMPEPEQLKMLSELKEEYDDLAESEQFGVVMGTVPRLRPRLNAILFKLQFSEQV
FT                   ENIKPEIVSVTAACEELRKSENFSSLLELTLLVGNYMNAGSRNAGAFGFNISFLCKLRD
FT                   TKSADQKMTLLHFLAELCENDHPEVLKFPDELAHVEKASRVSAENLQKSLDQMKKQIAD
FT                   VERDVQNFPAATDEKDKFVEKMTIFVKDAQEQYNKLRMMHSNMETLYKELGDYFVFDPK
FT                   KLSVEEFFMDLHNFRNMFLQAVKENQKRRETEEKMRRAKLAKEKAEKERLEKQQKREQL
FT                   IDMNAEGDETGVMDSLLEALQSGAAFRRKRGPRQVNRKAGCAVTSLLASELTKDDAMAP
FT                   GPVKVPKKSEGVPTILEEAKELVGRAS"
FT   CDS             complement(join(555693..555850,561886..561972,
FT                   563638..563773,563879..564041,564813..564939,
FT                   565809..565938,566048..566287))
FT                   /codon_start=1
FT                   /gene="Diap1"
FT                   /locus_tag="mCG_18335"
FT                   /product="diaphanous homolog 1 (Drosophila), isoform CRA_b"
FT                   /note="gene_id=mCG18335.1 transcript_id=mCT174389.0
FT                   protein_id=mCP97308.0 isoform=CRA_b"
FT                   /protein_id="EDL10116.1"
FT                   /translation="MGTVPRLRPRLNAILFKLQFSEQVENIKPEIVSVTAACEELRKSE
FT                   NFSSLLELTLLVGNYMNAGSRNAGAFGFNISFLCKLRDTKSADQKMTLLHFLAELCEND
FT                   HPEVLKFPDELAHVEKASRVSAENLQKSLDQMKKQIADVERDVQNFPAATDEKDKFVEK
FT                   MTIFVKDAQEQYNKLRMMHSNMETLYKELGDYFVFDPKKLSVEEFFMDLHNFRNMFLQA
FT                   VKENQKRRETEEKMRRAKLAKEKAEKERLEKQQKREQLIDMNAEGDETGVMDSLLEALQ
FT                   SGAAFRRKRGPRQVNRKAGCAVTSLLASELTKDDAMAPGPVKVPKKSEGVPTILEEAKE
FT                   LVGRAS"
FT   mRNA            complement(join(606214..606573,606721..606831,
FT                   607854..608027))
FT                   /gene="Diap1"
FT                   /locus_tag="mCG_18335"
FT                   /product="diaphanous homolog 1 (Drosophila), transcript
FT                   variant mCT174390"
FT                   /note="gene_id=mCG18335.1 transcript_id=mCT174390.0 created
FT                   on 14-OCT-2002"
FT   CDS             complement(join(606430..606573,606721..606831,
FT                   607854..608012))
FT                   /codon_start=1
FT                   /gene="Diap1"
FT                   /locus_tag="mCG_18335"
FT                   /product="diaphanous homolog 1 (Drosophila), isoform CRA_c"
FT                   /note="gene_id=mCG18335.1 transcript_id=mCT174390.0
FT                   protein_id=mCP97309.0 isoform=CRA_c"
FT                   /protein_id="EDL10117.1"
FT                   /translation="MSVSVHLGNSLSVFLGRNERVLEAMTERAEMDEVERFQPLLDGLK
FT                   SGTSIALKVGCLQLINALITPAEELDFRVHIRSELMRLGLHQVLQELREIENEDMKVQL
FT                   CVFDEQGDEDFFDLKGRLDDIRMEMEYPFMTDD"
FT   gene            complement(647176..665162)
FT                   /gene="Hdac3"
FT                   /locus_tag="mCG_128932"
FT                   /note="gene_id=mCG128932.1"
FT   mRNA            complement(join(647176..647880,651151..651308,
FT                   651576..651655,651905..651963,652075..652164,
FT                   653651..653715,653873..653946,654324..654404,
FT                   655083..655216,655531..655586,655702..655758,
FT                   655885..655966,662662..662804,664869..664951,
FT                   665046..665162))
FT                   /gene="Hdac3"
FT                   /locus_tag="mCG_128932"
FT                   /product="histone deacetylase 3, transcript variant
FT                   mCT130237"
FT                   /note="gene_id=mCG128932.1 transcript_id=mCT130237.1
FT                   created on 14-OCT-2002"
FT   mRNA            complement(join(647176..647880,651151..651308,
FT                   651576..651963,652075..652164,653651..653715,
FT                   653873..653946,654324..654404,655083..655216,
FT                   655531..655586,655702..655758,655885..655966,
FT                   662662..662804,664869..664951,665046..665137))
FT                   /gene="Hdac3"
FT                   /locus_tag="mCG_128932"
FT                   /product="histone deacetylase 3, transcript variant
FT                   mCT174331"
FT                   /note="gene_id=mCG128932.1 transcript_id=mCT174331.0
FT                   created on 14-OCT-2002"
FT   mRNA            complement(join(647176..647880,651151..651308,
FT                   651576..651655,651905..651963,652075..652164,
FT                   653651..653703,662739..662804,664869..664951,
FT                   665046..665122))
FT                   /gene="Hdac3"
FT                   /locus_tag="mCG_128932"
FT                   /product="histone deacetylase 3, transcript variant
FT                   mCT174330"
FT                   /note="gene_id=mCG128932.1 transcript_id=mCT174330.0
FT                   created on 14-OCT-2002"
FT   mRNA            complement(join(647276..647880,651151..651308,
FT                   651576..651655,651905..651963,652075..652164,
FT                   653651..653715,653873..653946,654324..654404,
FT                   655083..655216,655531..655586,655702..655758,
FT                   655885..655966,664869..664951,665046..665161))
FT                   /gene="Hdac3"
FT                   /locus_tag="mCG_128932"
FT                   /product="histone deacetylase 3, transcript variant
FT                   mCT174329"
FT                   /note="gene_id=mCG128932.1 transcript_id=mCT174329.0
FT                   created on 14-OCT-2002"
FT   CDS             complement(join(647811..647880,651151..651308,
FT                   651576..651655,651905..651963,652075..652164,
FT                   653651..653703,662739..662804,664869..664951,
FT                   665046..665100))
FT                   /codon_start=1
FT                   /gene="Hdac3"
FT                   /locus_tag="mCG_128932"
FT                   /product="histone deacetylase 3, isoform CRA_b"
FT                   /note="gene_id=mCG128932.1 transcript_id=mCT174330.0
FT                   protein_id=mCP97250.0 isoform=CRA_b"
FT                   /db_xref="GOA:G3X9M4"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR003084"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="MGI:MGI:1343091"
FT                   /db_xref="UniProtKB/TrEMBL:G3X9M4"
FT                   /protein_id="EDL10111.1"
FT                   /translation="MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKM
FT                   IVFKPYQASQHDMCRFHSEDYIDSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGG
FT                   GGYTVRNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQY
FT                   LDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEF
FT                   YDGDHDNDKESDVEI"
FT   CDS             complement(join(647811..647880,651151..651308,
FT                   651576..651655,651905..651963,652075..652164,
FT                   653651..653715,653873..653946,654324..654404,
FT                   655083..655216,655531..655586,655702..655758,
FT                   655885..655966,662662..662804,664869..664951,
FT                   665046..665100))
FT                   /codon_start=1
FT                   /gene="Hdac3"
FT                   /locus_tag="mCG_128932"
FT                   /product="histone deacetylase 3, isoform CRA_a"
FT                   /note="gene_id=mCG128932.1 transcript_id=mCT130237.1
FT                   protein_id=mCP77967.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q3UM33"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR003084"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="MGI:MGI:1343091"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UM33"
FT                   /protein_id="EDL10110.1"
FT                   /translation="MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKM
FT                   IVFKPYQASQHDMCRFHSEDYIDFLQRVSPTNMQGFTKSLNAFNVGDDCPVFPGLFEFC
FT                   SRYTGASLQGATQLNNKICDIAINWAGGLHHAKKFEASGFCYVNDIVIGILELLKYHPR
FT                   VLYIDIDIHHGDGVQEAFYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVP
FT                   LRDGIDDQSYKHLFQPVISQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVE
FT                   YVKSFNIPLLVLGGGGYTVRNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHP
FT                   DVSTRIENQNSRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERG
FT                   PEENYSRPEAPNEFYDGDHDNDKESDVEI"
FT   CDS             complement(join(647811..647880,651151..651308,
FT                   651576..651655,651905..651963,652075..652164,
FT                   653651..653715,653873..653946,654324..654404,
FT                   655083..655131))
FT                   /codon_start=1
FT                   /gene="Hdac3"
FT                   /locus_tag="mCG_128932"
FT                   /product="histone deacetylase 3, isoform CRA_d"
FT                   /note="gene_id=mCG128932.1 transcript_id=mCT174329.0
FT                   protein_id=mCP97251.0 isoform=CRA_d"
FT                   /protein_id="EDL10113.1"
FT                   /translation="MTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSY
FT                   KHLFQPVISQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLL
FT                   VLGGGGYTVRNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQN
FT                   SRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEA
FT                   PNEFYDGDHDNDKESDVEI"
FT   CDS             complement(join(651798..651963,652075..652164,
FT                   653651..653715,653873..653946,654324..654404,
FT                   655083..655216,655531..655586,655702..655758,
FT                   655885..655966,662662..662804,664869..664951,
FT                   665046..665100))
FT                   /codon_start=1
FT                   /gene="Hdac3"
FT                   /locus_tag="mCG_128932"
FT                   /product="histone deacetylase 3, isoform CRA_c"
FT                   /note="gene_id=mCG128932.1 transcript_id=mCT174331.0
FT                   protein_id=mCP97248.0 isoform=CRA_c"
FT                   /protein_id="EDL10112.1"
FT                   /translation="MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKM
FT                   IVFKPYQASQHDMCRFHSEDYIDFLQRVSPTNMQGFTKSLNAFNVGDDCPVFPGLFEFC
FT                   SRYTGASLQGATQLNNKICDIAINWAGGLHHAKKFEASGFCYVNDIVIGILELLKYHPR
FT                   VLYIDIDIHHGDGVQEAFYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVP
FT                   LRDGIDDQSYKHLFQPVISQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVE
FT                   YVKSFNIPLLVLGGGGYTVRNVARCWTYETSLLVEEAISEELPYSGKIHFMMPPQGDTI
FT                   LTSPQNDLVWREIAPSGSSAD"
FT   mRNA            complement(join(651907..651963,652075..652153,
FT                   653641..653715,653873..654404,655083..655216,
FT                   655531..655586,655702..655758,655885..655966,
FT                   662662..662804,664869..664951,665046..665155))
FT                   /gene="Hdac3"
FT                   /locus_tag="mCG_128932"
FT                   /product="histone deacetylase 3, transcript variant
FT                   mCT174332"
FT                   /note="gene_id=mCG128932.1 transcript_id=mCT174332.0
FT                   created on 14-OCT-2002"
FT   CDS             complement(join(654313..654404,655083..655216,
FT                   655531..655586,655702..655758,655885..655966,
FT                   662662..662804,664869..664951,665046..665100))
FT                   /codon_start=1
FT                   /gene="Hdac3"
FT                   /locus_tag="mCG_128932"
FT                   /product="histone deacetylase 3, isoform CRA_e"
FT                   /note="gene_id=mCG128932.1 transcript_id=mCT174332.0
FT                   protein_id=mCP97249.0 isoform=CRA_e"
FT                   /protein_id="EDL10114.1"
FT                   /translation="MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKM
FT                   IVFKPYQASQHDMCRFHSEDYIDFLQRVSPTNMQGFTKSLNAFNVGDDCPVFPGLFEFC
FT                   SRYTGASLQGATQLNNKICDIAINWAGGLHHAKKFEASGFCYVNDIVIGILELLKYHPR
FT                   VLYIDIDIHHGDGVQEAFYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVP
FT                   LRDGIDDQSKF"
FT   gene            665783..669422
FT                   /gene="4631403P03Rik"
FT                   /locus_tag="mCG_18336"
FT                   /note="gene_id=mCG18336.3"
FT   mRNA            join(665783..665862,665934..666166,666585..666824,
FT                   667186..667251,667346..667412,667846..668031,
FT                   668271..668646,668769..668828,669016..669422)
FT                   /gene="4631403P03Rik"
FT                   /locus_tag="mCG_18336"
FT                   /product="RIKEN cDNA 4631403P03, transcript variant
FT                   mCT174391"
FT                   /note="gene_id=mCG18336.3 transcript_id=mCT174391.1 created
FT                   on 13-JUN-2003"
FT   mRNA            join(665783..665862,665934..666166,666585..666824,
FT                   667186..667251,667346..667412,667846..668031,
FT                   668271..669419)
FT                   /gene="4631403P03Rik"
FT                   /locus_tag="mCG_18336"
FT                   /product="RIKEN cDNA 4631403P03, transcript variant
FT                   mCT12934"
FT                   /note="gene_id=mCG18336.3 transcript_id=mCT12934.3 created
FT                   on 13-JUN-2003"
FT   mRNA            join(665783..665862,665934..666166,667186..667251,
FT                   667346..667412,667846..668031,668271..669419)
FT                   /gene="4631403P03Rik"
FT                   /locus_tag="mCG_18336"
FT                   /product="RIKEN cDNA 4631403P03, transcript variant
FT                   mCT174392"
FT                   /note="gene_id=mCG18336.3 transcript_id=mCT174392.1 created
FT                   on 13-JUN-2003"
FT   assembly_gap    665913..665932
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(666641..666824,667186..667251,667346..667412,
FT                   667846..668031,668271..668646,668769..668801)
FT                   /codon_start=1
FT                   /gene="4631403P03Rik"
FT                   /locus_tag="mCG_18336"
FT                   /product="RIKEN cDNA 4631403P03, isoform CRA_a"
FT                   /note="gene_id=mCG18336.3 transcript_id=mCT174391.1
FT                   protein_id=mCP97311.0 isoform=CRA_a"
FT                   /protein_id="EDL10107.1"
FT                   /translation="MSEPQPDLEPPQHGLYMLFLLVLVFFLMGLVGFMICHVLKKKGYR
FT                   CRTSRGSEPDDAQLQPPEDDDVNEDTVERIVRCIIQNEANAEALKEMLGDSEGEGTVQL
FT                   SSVDATSSLQDGAPSHHHTVHLGSAAPCIHCSRSKRPPLVRQGRSKEGKSRPRPGETTV
FT                   FSVGRFRVTHIEKRYGLHEHRDGSPTDRSWGSGGGQEPGGSQAAGGGQPRTGTAAIERL
FT                   LPEPPPSQAAATHSVQNGRLQDASLVPCTLEGTPGTSAELNLGPRGRDPSPGLSSQEAN
FT                   GQPTKLDTSGQQESLPPEAGGM"
FT   CDS             join(666641..666824,667186..667251,667346..667412,
FT                   667846..668031,668271..668652)
FT                   /codon_start=1
FT                   /gene="4631403P03Rik"
FT                   /locus_tag="mCG_18336"
FT                   /product="RIKEN cDNA 4631403P03, isoform CRA_c"
FT                   /note="gene_id=mCG18336.3 transcript_id=mCT12934.3
FT                   protein_id=mCP8358.2 isoform=CRA_c"
FT                   /db_xref="GOA:Q8CFT0"
FT                   /db_xref="InterPro:IPR022248"
FT                   /db_xref="MGI:MGI:1918044"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CFT0"
FT                   /protein_id="EDL10109.1"
FT                   /translation="MSEPQPDLEPPQHGLYMLFLLVLVFFLMGLVGFMICHVLKKKGYR
FT                   CRTSRGSEPDDAQLQPPEDDDVNEDTVERIVRCIIQNEANAEALKEMLGDSEGEGTVQL
FT                   SSVDATSSLQDGAPSHHHTVHLGSAAPCIHCSRSKRPPLVRQGRSKEGKSRPRPGETTV
FT                   FSVGRFRVTHIEKRYGLHEHRDGSPTDRSWGSGGGQEPGGSQAAGGGQPRTGTAAIERL
FT                   LPEPPPSQAAATHSVQNGRLQDASLVPCTLEGTPGTSAELNLGPRGRDPSPGLSSQEAN
FT                   GQPTKLDTSGQQV"
FT   CDS             join(667369..667412,667846..668031,668271..668652)
FT                   /codon_start=1
FT                   /gene="4631403P03Rik"
FT                   /locus_tag="mCG_18336"
FT                   /product="RIKEN cDNA 4631403P03, isoform CRA_b"
FT                   /note="gene_id=mCG18336.3 transcript_id=mCT174392.1
FT                   protein_id=mCP97310.0 isoform=CRA_b"
FT                   /protein_id="EDL10108.1"
FT                   /translation="MLGDSEGEGTVQLSSVDATSSLQDGAPSHHHTVHLGSAAPCIHCS
FT                   RSKRPPLVRQGRSKEGKSRPRPGETTVFSVGRFRVTHIEKRYGLHEHRDGSPTDRSWGS
FT                   GGGQEPGGSQAAGGGQPRTGTAAIERLLPEPPPSQAAATHSVQNGRLQDASLVPCTLEG
FT                   TPGTSAELNLGPRGRDPSPGLSSQEANGQPTKLDTSGQQV"
FT   gene            complement(667689..680025)
FT                   /gene="Fchsd1"
FT                   /locus_tag="mCG_18338"
FT                   /note="gene_id=mCG18338.2"
FT   mRNA            complement(join(667689..669911,670035..670090,
FT                   671502..671589,672828..673048,673175..673292,
FT                   673383..673466,673548..673676,674263..674424,
FT                   674569..674673,675046..675165,675906..676001,
FT                   676154..676276,676696..676824,677618..678008))
FT                   /gene="Fchsd1"
FT                   /locus_tag="mCG_18338"
FT                   /product="FCH and double SH3 domains 1, transcript variant
FT                   mCT174396"
FT                   /note="gene_id=mCG18338.2 transcript_id=mCT174396.0 created
FT                   on 14-OCT-2002"
FT   mRNA            complement(join(667689..669911,670035..670726))
FT                   /gene="Fchsd1"
FT                   /locus_tag="mCG_18338"
FT                   /product="FCH and double SH3 domains 1, transcript variant
FT                   mCT174397"
FT                   /note="gene_id=mCG18338.2 transcript_id=mCT174397.0 created
FT                   on 14-OCT-2002"
FT   mRNA            complement(join(668933..669911,670035..670090,
FT                   671502..671589,672828..673048,673175..673292,
FT                   673383..673466,673548..673676,674263..674424,
FT                   674569..674673,675046..675165,675906..676001,
FT                   676154..676276,676696..676824,677618..677681,
FT                   677793..677929,678015..678156,678469..678536,
FT                   679005..679050,679610..679707,679961..680025))
FT                   /gene="Fchsd1"
FT                   /locus_tag="mCG_18338"
FT                   /product="FCH and double SH3 domains 1, transcript variant
FT                   mCT12416"
FT                   /note="gene_id=mCG18338.2 transcript_id=mCT12416.2 created
FT                   on 14-OCT-2002"
FT   mRNA            complement(join(669382..669911,670035..670090,
FT                   671502..671589,672828..673048,673175..673292,
FT                   673383..673466,673548..673676,674263..674424,
FT                   674569..674673,675046..675165,675906..676001,
FT                   676154..676276,676696..676824,677618..677681,
FT                   677793..677929,678015..678150,678469..678536,
FT                   679005..679050,679610..679707,679961..>680005))
FT                   /gene="Fchsd1"
FT                   /locus_tag="mCG_18338"
FT                   /product="FCH and double SH3 domains 1, transcript variant
FT                   mCT190268"
FT                   /note="gene_id=mCG18338.2 transcript_id=mCT190268.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(669846..669911,670035..670090,
FT                   671502..671589,672828..673048,673175..673292,
FT                   673383..673466,673548..673676,674263..674424,
FT                   674569..674673,675046..675165,675906..676001,
FT                   676154..676276,676696..676824,677618..677681,
FT                   677793..677929,678015..678150,678469..678536,
FT                   679005..679050,679610..679707,679961..>680005))
FT                   /codon_start=1
FT                   /gene="Fchsd1"
FT                   /locus_tag="mCG_18338"
FT                   /product="FCH and double SH3 domains 1, isoform CRA_f"
FT                   /note="gene_id=mCG18338.2 transcript_id=mCT190268.0
FT                   protein_id=mCP111279.0 isoform=CRA_f"
FT                   /protein_id="EDL10106.1"
FT                   /translation="LAAFAGAAMQPPPRKVKPAQEVKLRFLEQLSILQTRQQREADLLE
FT                   DIRSYSKQRAAIEREYGQALQKLAGPFLKREGQRSGEADSRTVFGAWRCLLDATVAGGQ
FT                   TRLQASDRYRDLAGGTGRSAKEQVLRKGTESLQQAQAEVLQSVRELSRSRKLYGQRQRV
FT                   WALAQEKAADVQARLNRSDHGIFHSRTSLQKLSTKLSAQSAQYSQQLRAARNEYLLNLV
FT                   ATNAHLAHYYQEELPALLKVLVSELSEYLRDPLTLLGHTELEAAEMILEHARHGGKATS
FT                   QVNWEQDVKLFLQGPGVFSPTPPQQFQPAGADQVCGLEWGAGGMAGESGLEKEVQRWTS
FT                   RAARDYKIQHHGHRVLQRLEQRRQQAPGREAPGVEQRLQEVRENIRRAQVSQVKGAARL
FT                   ALLQEAGLDVQRWLKPAMTQAQDEVEQERRLSEARLSQRDLSPTAEDAELSDFDECEEA
FT                   GELFEEPAPPALATRPLPCPAHVVFGYQAGREDELTITEGEWLEVIEEGDADEWVKARN
FT                   QHGEAGFVPERYLNFPDLSLPESCHGIDNPSGGEPTAFLARALYSYTGQSEEELSFPEG
FT                   ALIRLLPRAQDGVDDGFWRGEFGGHVGVFPSLLVEELLGPPGPPELSDPEQMLPSPSPP
FT                   SFSPPAPTCALDGSTAPALPSDKVLDCPGPLDMMVPRLRPMRPPPPPPAKAPDPGHPDP
FT                   LT"
FT   CDS             complement(join(669846..669911,670035..670090,
FT                   671502..671589,672828..673048,673175..673292,
FT                   673383..673466,673548..673676,674263..674424,
FT                   674569..674673,675046..675165,675906..676001,
FT                   676154..676276,676696..676824,677618..677681,
FT                   677793..677929,678015..678156,678469..678536,
FT                   679005..679050,679610..679707,679961..679981))
FT                   /codon_start=1
FT                   /gene="Fchsd1"
FT                   /locus_tag="mCG_18338"
FT                   /product="FCH and double SH3 domains 1, isoform CRA_a"
FT                   /note="gene_id=mCG18338.2 transcript_id=mCT12416.2
FT                   protein_id=mCP8376.2 isoform=CRA_a"
FT                   /protein_id="EDL10101.1"
FT                   /translation="MQPPPRKVKPAQEVKLRFLEQLSILQTRQQREADLLEDIRSYSKQ
FT                   RAAIEREYGQALQKLAGPFLKREGQRSGEADSRGRTVFGAWRCLLDATVAGGQTRLQAS
FT                   DRYRDLAGGTGRSAKEQVLRKGTESLQQAQAEVLQSVRELSRSRKLYGQRQRVWALAQE
FT                   KAADVQARLNRSDHGIFHSRTSLQKLSTKLSAQSAQYSQQLRAARNEYLLNLVATNAHL
FT                   AHYYQEELPALLKVLVSELSEYLRDPLTLLGHTELEAAEMILEHARHGGKATSQVNWEQ
FT                   DVKLFLQGPGVFSPTPPQQFQPAGADQVCGLEWGAGGMAGESGLEKEVQRWTSRAARDY
FT                   KIQHHGHRVLQRLEQRRQQAPGREAPGVEQRLQEVRENIRRAQVSQVKGAARLALLQEA
FT                   GLDVQRWLKPAMTQAQDEVEQERRLSEARLSQRDLSPTAEDAELSDFDECEEAGELFEE
FT                   PAPPALATRPLPCPAHVVFGYQAGREDELTITEGEWLEVIEEGDADEWVKARNQHGEAG
FT                   FVPERYLNFPDLSLPESCHGIDNPSGGEPTAFLARALYSYTGQSEEELSFPEGALIRLL
FT                   PRAQDGVDDGFWRGEFGGHVGVFPSLLVEELLGPPGPPELSDPEQMLPSPSPPSFSPPA
FT                   PTCALDGSTAPALPSDKVLDCPGPLDMMVPRLRPMRPPPPPPAKAPDPGHPDPLT"
FT   CDS             complement(join(669846..669911,670035..670090,
FT                   671502..671589,672828..673048,673175..673292,
FT                   673383..673466,673548..673676,674263..674424,
FT                   674569..674673,675046..675165,675906..676001,
FT                   676154..676198))
FT                   /codon_start=1
FT                   /gene="Fchsd1"
FT                   /locus_tag="mCG_18338"
FT                   /product="FCH and double SH3 domains 1, isoform CRA_c"
FT                   /note="gene_id=mCG18338.2 transcript_id=mCT174396.0
FT                   protein_id=mCP97314.0 isoform=CRA_c"
FT                   /protein_id="EDL10103.1"
FT                   /translation="MILEHARHGGKATSQVNWEQDVKLFLQGPGVFSPTPPQQFQPAGA
FT                   DQVCGLEWGAGGMAGESGLEKEVQRWTSRAARDYKIQHHGHRVLQRLEQRRQQAPGREA
FT                   PGVEQRLQEVRENIRRAQVSQVKGAARLALLQEAGLDVQRWLKPAMTQAQDEVEQERRL
FT                   SEARLSQRDLSPTAEDAELSDFDECEEAGELFEEPAPPALATRPLPCPAHVVFGYQAGR
FT                   EDELTITEGEWLEVIEEGDADEWVKARNQHGEAGFVPERYLNFPDLSLPESCHGIDNPS
FT                   GGEPTAFLARALYSYTGQSEEELSFPEGALIRLLPRAQDGVDDGFWRGEFGGHVGVFPS
FT                   LLVEELLGPPGPPELSDPEQMLPSPSPPSFSPPAPTCALDGSTAPALPSDKVLDCPGPL
FT                   DMMVPRLRPMRPPPPPPAKAPDPGHPDPLT"
FT   CDS             complement(join(669846..669911,670035..670145))
FT                   /codon_start=1
FT                   /gene="Fchsd1"
FT                   /locus_tag="mCG_18338"
FT                   /product="FCH and double SH3 domains 1, isoform CRA_d"
FT                   /note="gene_id=mCG18338.2 transcript_id=mCT174397.0
FT                   protein_id=mCP97315.0 isoform=CRA_d"
FT                   /protein_id="EDL10104.1"
FT                   /translation="MQYGADQSLRIDFWFLFLDKVLDCPGPLDMMVPRLRPMRPPPPPP
FT                   AKAPDPGHPDPLT"
FT   mRNA            complement(join(673219..673292,673383..673676,
FT                   674263..674424,674569..674673,675046..675165,
FT                   675906..676001,676154..676276,676696..676824,
FT                   677618..677681,677793..677929,678015..678156,
FT                   678469..678536,679005..679050,679610..679707,
FT                   679961..680025))
FT                   /gene="Fchsd1"
FT                   /locus_tag="mCG_18338"
FT                   /product="FCH and double SH3 domains 1, transcript variant
FT                   mCT174395"
FT                   /note="gene_id=mCG18338.2 transcript_id=mCT174395.0 created
FT                   on 14-OCT-2002"
FT   CDS             complement(join(673542..673676,674263..674424,
FT                   674569..674673,675046..675165,675906..676001,
FT                   676154..676276,676696..676824,677618..677681,
FT                   677793..677929,678015..678156,678469..678536,
FT                   679005..679050,679610..679707,679961..679981))
FT                   /codon_start=1
FT                   /gene="Fchsd1"
FT                   /locus_tag="mCG_18338"
FT                   /product="FCH and double SH3 domains 1, isoform CRA_b"
FT                   /note="gene_id=mCG18338.2 transcript_id=mCT174395.0
FT                   protein_id=mCP97317.0 isoform=CRA_b"
FT                   /protein_id="EDL10102.1"
FT                   /translation="MQPPPRKVKPAQEVKLRFLEQLSILQTRQQREADLLEDIRSYSKQ
FT                   RAAIEREYGQALQKLAGPFLKREGQRSGEADSRGRTVFGAWRCLLDATVAGGQTRLQAS
FT                   DRYRDLAGGTGRSAKEQVLRKGTESLQQAQAEVLQSVRELSRSRKLYGQRQRVWALAQE
FT                   KAADVQARLNRSDHGIFHSRTSLQKLSTKLSAQSAQYSQQLRAARNEYLLNLVATNAHL
FT                   AHYYQEELPALLKVLVSELSEYLRDPLTLLGHTELEAAEMILEHARHGGKATSQVNWEQ
FT                   DVKLFLQGPGVFSPTPPQQFQPAGADQVCGLEWGAGGMAGESGLEKEVQRWTSRAARDY
FT                   KIQHHGHRVLQRLEQRRQQAPGREAPGVEQRLQEVRENIRRAQVSQVKGAARLALLQEA
FT                   GLDVQRWLKPAMTQAQDEVEQERRLSEARLSQRDLSPTAEDAELSDFDECEEAGELFEE
FT                   PAPPALATRPLPCPAHVVFGYQV"
FT   mRNA            complement(join(677895..678156,678469..678536,
FT                   679005..679050,679610..679707,679961..680014))
FT                   /gene="Fchsd1"
FT                   /locus_tag="mCG_18338"
FT                   /product="FCH and double SH3 domains 1, transcript variant
FT                   mCT174398"
FT                   /note="gene_id=mCG18338.2 transcript_id=mCT174398.0 created
FT                   on 14-OCT-2002"
FT   CDS             complement(join(677970..678156,678469..678536,
FT                   679005..679050,679610..679707,679961..679981))
FT                   /codon_start=1
FT                   /gene="Fchsd1"
FT                   /locus_tag="mCG_18338"
FT                   /product="FCH and double SH3 domains 1, isoform CRA_e"
FT                   /note="gene_id=mCG18338.2 transcript_id=mCT174398.0
FT                   protein_id=mCP97316.0 isoform=CRA_e"
FT                   /protein_id="EDL10105.1"
FT                   /translation="MQPPPRKVKPAQEVKLRFLEQLSILQTRQQREADLLEDIRSYSKQ
FT                   RAAIEREYGQALQKLAGPFLKREGQRSGEADSRGRTVFGAWRCLLDATVAGGQTRLQAS
FT                   DRYRDLAGGTGRSAKEQVLRKVCVRGWGRGTSSSD"
FT   gene            complement(682880..>707352)
FT                   /gene="Centd3"
FT                   /locus_tag="mCG_128930"
FT                   /note="gene_id=mCG128930.1"
FT   mRNA            complement(join(682880..683906,684357..684395,
FT                   684620..684757,684873..684936,685642..685677,
FT                   685771..685853,686078..686211,686295..686423,
FT                   688607..688721,688804..688878,690091..690159,
FT                   690441..690588,691568..691673,692220..692432,
FT                   694505..694668,694860..694923,695584..695803,
FT                   697826..697928,698025..698172,698586..698699,
FT                   699330..699465,699634..699816,699957..700042,
FT                   700147..700346,700783..700889,700973..701157,
FT                   701239..701359,701599..701668,701810..702001,
FT                   706446..706557,706656..706717,706823..>707352))
FT                   /gene="Centd3"
FT                   /locus_tag="mCG_128930"
FT                   /product="centaurin, delta 3, transcript variant mCT130235"
FT                   /note="gene_id=mCG128930.1 transcript_id=mCT130235.1
FT                   created on 14-OCT-2002"
FT   CDS             complement(join(683427..683906,684357..684395,
FT                   684620..684757,684873..684936,685642..685677,
FT                   685771..685853,686078..686211,686295..686423,
FT                   688607..688721,688804..688878,690091..690159,
FT                   690441..690588,691568..691673,692220..692432,
FT                   694505..694668,694860..694923,695584..695803,
FT                   697826..697928,698025..698172,698586..698699,
FT                   699330..699465,699634..699816,699957..700042,
FT                   700147..700346,700783..700889,700973..701157,
FT                   701239..701359,701599..701668,701810..702001,
FT                   706446..706557,706656..706717,706823..>707349))
FT                   /codon_start=1
FT                   /gene="Centd3"
FT                   /locus_tag="mCG_128930"
FT                   /product="centaurin, delta 3, isoform CRA_b"
FT                   /note="gene_id=mCG128930.1 transcript_id=mCT130235.1
FT                   protein_id=mCP77625.1 isoform=CRA_b"
FT                   /protein_id="EDL10100.1"
FT                   /translation="KPMAAPQDLDIAVWLALVHLEQYADTFRRHGLATAGAAQHLGHEE
FT                   LRHLGISATGHRKRILRLLRAGSAEGFLDSHLDNTMEPTPSPAPDAQPPKPVPKPRTVF
FT                   GLSNPATAQRPGLSPIFWDPEVSRNSECTQRSSPLLPSSSEQPSVPNTMEMMPNAIYFG
FT                   LDLRGQAQAAQDVTPDSSQATVPTPAFRPTTGTVHIMDPGCLYYGVQPVGIPGASDRRD
FT                   GRGVCQERAEHRQDLETREDAGYASLELPGDSILSLPTQDAETSDDLISPYASFSSTAD
FT                   RPVPLLSGWLDKLSPQGNYVFQRRFVQFNGRSLMYFGSDKDPFPKGVIPLTAIEMTRSS
FT                   KDNKFQVITGQRVFVFRTESEAQRDLWCSTLQSCLKEQRLLGHPRPPHPPRPLRTGTLE
FT                   LRGHKAKVFAALIPGELALYKSEQAFSLGIGICFIELQGCSVRETKSRSFDLLTPHRCF
FT                   SFTAESGGARQSWAAALQEAVTETLSDYEVAEKVWSNPANRHCADCRASRPDWAAVNLG
FT                   VVICKQCAGQHRALGSGISKVQSLKLDTSVWSNEIVQLFIVLGNDRANCFWAGALPPGE
FT                   GLHPDSAPGPRGEFISRKYKLGLFRKPHPRHPDHSQLLQALCAAMAGPNLLKNMAQLLC
FT                   VETSEGEEPLSPSALNGSLLSLLPSDSPGVYNEVVVPATYRGFLYCGSISNKAGAPPLR
FT                   RGRDAPPRLWCVLGAALEMFASESSPEPLSLLQPQDIVCLGVSPPPADPGDLDRFPFSF
FT                   ELILTGGRIQHFATDGADSLEAWISAVGKWFSPLSCHQLLGPGLLRMGRLWLRSPSHAG
FT                   LAPGLWLSGFGLLRGDHLFLCPAPGPGPPAPEDMVHLRRLQEISVVSAADTPDKKEHLV
FT                   LVETGRTLYLQGEGRLDFAAWNTAIGGAAGGGGTGLQEQQMSRGDIPIIVDACISFVTQ
FT                   HGLRLEGVYRKGGARARSLRLLAEFRRDARSVKLRPREHFVEDVTDTLKRFFRELDDPV
FT                   TSARLLPRWREAAELSQKNQRLEKYKEVISCLPRVNRRTLATLIGHLYRVQKCASLNQM
FT                   CTRNLALLFAPSVFQTDGRGEHEVRVLQELIDGYISVFDIDSDQAAQIDLEVSLITTWK
FT                   DVQLSQAGDLIMEVYIEQQLPDNCVTLKVSPTLTAEELTNQVLEMRGAASGTDLWVTFE
FT                   ILEHGELERPLHPKEKVLEQALQWCQLPEPCSASLLLRKVSMAHAGCLFTGVRRESPRV
FT                   GLLRCREEPPRLLGNRFQERFFLVRGRCLLLLKEKKSSKPEREWSLEGAKVYLGIRKKL
FT                   KPPTLWGFTLILEKMHLCLSCMDEEEMWDWTTSILKAQHDDQQSVVLRRRSSSDLARQK
FT                   FGTMPLLPIRGDDSGATLLSANQTLRRLHNRRTLSMFFPMKSPQGSVEEQDELEEPVYE
FT                   EPVYEEVGAFPELTKDTTFSSTWEWSAKSDPSLTSQRSFDQPPLSKASMLGHEERIPDP
FT                   PPGPPSKSSSQARGSLEEQLLQELNNLILRKGEPASCPESSSQPTSPQAPSPTSLPTPT
FT                   PSLPTQPPCTSNPPSSQPLT"
FT   mRNA            complement(join(693067..693428,694505..694668,
FT                   694860..694923,695584..695803,697826..697928,
FT                   698025..698172,698586..698699,699330..699465,
FT                   699634..699816,699957..700042,700147..700346,
FT                   700783..700889,700973..701157,701239..701359,
FT                   701599..701668,701810..702001,706446..706557,
FT                   706656..706717,706823..707352))
FT                   /gene="Centd3"
FT                   /locus_tag="mCG_128930"
FT                   /product="centaurin, delta 3, transcript variant mCT174328"
FT                   /note="gene_id=mCG128930.1 transcript_id=mCT174328.0
FT                   created on 14-OCT-2002"
FT   CDS             complement(join(693409..693428,694505..694668,
FT                   694860..694923,695584..695803,697826..697928,
FT                   698025..698172,698586..698699,699330..699465,
FT                   699634..699816,699957..700042,700147..700346,
FT                   700783..700889,700973..701157,701239..701359,
FT                   701599..701668,701810..702001,706446..706557,
FT                   706656..706717,706823..707343))
FT                   /codon_start=1
FT                   /gene="Centd3"
FT                   /locus_tag="mCG_128930"
FT                   /product="centaurin, delta 3, isoform CRA_a"
FT                   /note="gene_id=mCG128930.1 transcript_id=mCT174328.0
FT                   protein_id=mCP97247.0 isoform=CRA_a"
FT                   /protein_id="EDL10099.1"
FT                   /translation="MAAPQDLDIAVWLALVHLEQYADTFRRHGLATAGAAQHLGHEELR
FT                   HLGISATGHRKRILRLLRAGSAEGFLDSHLDNTMEPTPSPAPDAQPPKPVPKPRTVFGL
FT                   SNPATAQRPGLSPIFWDPEVSRNSECTQRSSPLLPSSSEQPSVPNTMEMMPNAIYFGLD
FT                   LRGQAQAAQDVTPDSSQATVPTPAFRPTTGTVHIMDPGCLYYGVQPVGIPGASDRRDGR
FT                   GVCQERAEHRQDLETREDAGYASLELPGDSILSLPTQDAETSDDLISPYASFSSTADRP
FT                   VPLLSGWLDKLSPQGNYVFQRRFVQFNGRSLMYFGSDKDPFPKGVIPLTAIEMTRSSKD
FT                   NKFQVITGQRVFVFRTESEAQRDLWCSTLQSCLKEQRLLGHPRPPHPPRPLRTGTLELR
FT                   GHKAKVFAALIPGELALYKSEQAFSLGIGICFIELQGCSVRETKSRSFDLLTPHRCFSF
FT                   TAESGGARQSWAAALQEAVTETLSDYEVAEKVWSNPANRHCADCRASRPDWAAVNLGVV
FT                   ICKQCAGQHRALGSGISKVQSLKLDTSVWSNEIVQLFIVLGNDRANCFWAGALPPGEGL
FT                   HPDSAPGPRGEFISRKYKLGLFRKPHPRHPDHSQLLQALCAAMAGPNLLKNMAQLLCVE
FT                   TSEGEEPLSPSALNGSLLSLLPSDSPGVYNEVVVPATYRGFLYCGSISNKAGAPPLRRG
FT                   RDAPPRLWCVLGAALEMFASESSPEPLSLLQPQDIVCLGVSPPPADPGDLDRFPFSFEL
FT                   ILTGGRIQHFATDGADSLEAWISAVGKWFSPLSCHQLLGPGLLRMGRLWLRSPSHAGLA
FT                   PGLWLSGFGLLRGDHLFLCPAPGPGPPAPEDMVHLRRLQEISVVSAADTPDKKEHLVLV
FT                   ETGRTLYLQGEGRLDFAAWNTAIGGAAGGGGTGLQEQQMSRGDIPIIVDACISFVTQHA
FT                   SLAFI"
FT   assembly_gap    703192..703211
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    708883..709223
FT                   /estimated_length=341
FT                   /gap_type="unknown"
FT   assembly_gap    716778..716797
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    727524..727800
FT                   /estimated_length=277
FT                   /gap_type="unknown"
FT   assembly_gap    739549..739568
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    745505..745524
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    747263..747282
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    762843..763154
FT                   /estimated_length=312
FT                   /gap_type="unknown"
FT   assembly_gap    773285..773304
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    788404..788636
FT                   /estimated_length=233
FT                   /gap_type="unknown"
FT   assembly_gap    794232..794251
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    841514..841752
FT                   /estimated_length=239
FT                   /gap_type="unknown"
FT   assembly_gap    848863..850449
FT                   /estimated_length=1587
FT                   /gap_type="unknown"
FT   assembly_gap    852253..852402
FT                   /estimated_length=150
FT                   /gap_type="unknown"
FT   assembly_gap    876925..876987
FT                   /estimated_length=63
FT                   /gap_type="unknown"
FT   assembly_gap    878633..878652
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    886297..886383
FT                   /estimated_length=87
FT                   /gap_type="unknown"
FT   assembly_gap    892775..893488
FT                   /estimated_length=714
FT                   /gap_type="unknown"
FT   assembly_gap    897213..897377
FT                   /estimated_length=165
FT                   /gap_type="unknown"
FT   gene            complement(907823..920891)
FT                   /gene="Pcdh1"
FT                   /locus_tag="mCG_142244"
FT                   /note="gene_id=mCG142244.0"
FT   mRNA            complement(join(907823..910656,913876..914738,
FT                   920688..920891))
FT                   /gene="Pcdh1"
FT                   /locus_tag="mCG_142244"
FT                   /product="protocadherin 1"
FT                   /note="gene_id=mCG142244.0 transcript_id=mCT179463.0
FT                   created on 06-FEB-2003"
FT   CDS             complement(join(908377..910656,913876..914712))
FT                   /codon_start=1
FT                   /gene="Pcdh1"
FT                   /locus_tag="mCG_142244"
FT                   /product="protocadherin 1"
FT                   /note="gene_id=mCG142244.0 transcript_id=mCT179463.0
FT                   protein_id=mCP102385.0 partial"
FT                   /protein_id="EDL10098.1"
FT                   /translation="MGPLRPSPGXXXXXXXSPPLLLALLLLLAPSASHTTQVVYKVPEE
FT                   QPPNTLIGSLAADYGLPDVGHLYKLEVGAPYLRVDGKTGDIFTTETSIDREGLRECQNQ
FT                   IPGNPCILEFEVSITDLVQNGSPRLLEGQIEVQDINDNTPNFASPVITLAIPENTNIGS
FT                   LFPIPLATDRDAGPNGVASYELQAGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWD
FT                   SYDLTIKVQDGGNPPRASSALLRVTVLDTNDNAPKFERPTYEAELSENSPIGHSVIQVK
FT                   ANDSDQGANAEIDYTFHQAPEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDR
FT                   GATPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSD
FT                   RDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVD
FT                   SGNPPLSSTNSLKVQVVDVNDNAPVFTQSITEVAFPENNKPGEVVAEVTASDADSGSNA
FT                   ELVYSLEPEPAAQGLFTISPENGEIRVKTSLDREQRDSYELKVVAADRGSPSLQGTATV
FT                   LVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENARVQLSVEQDNGD
FT                   FVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPFIT
FT                   APSNTSHRLLTPQTRLGETVSQVTAEDIDSGINAELTYSIAGGNPYGLFQIGSHSGAIT
FT                   LEKEIERRHHGLHRLVVKVSDRGKPPRYGTALVHLYVNETLANRTLLETLLVHSLDTPL
FT                   DIDIAGDPEYERSKQRGNILFGVVAGVVAVALLIALAVLVRYCRQREAKSGYQAGKKET
FT                   KDLYAPKPSGKAAKGSKSKGKKSKSPKPVKPVEDEDDTGLQKSLKFNLMSDAPGDSPRI
FT                   HLPLNYPPGSPDLGRHYRSNSPLPSIQLQPQSPSASKKHQVVQDLPPANTFVGTGDTTS
FT                   TGSEQYSDYSYRTNPPKYPSKQVGQPFRLSTPQPPPHPYHGAIWTEVWE"
FT   assembly_gap    914667..914686
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    923162..923313
FT                   /estimated_length=152
FT                   /gap_type="unknown"
FT   assembly_gap    934013..934205
FT                   /estimated_length=193
FT                   /gap_type="unknown"
FT   gene            complement(<950031..>961393)
FT                   /locus_tag="mCG_145146"
FT                   /note="gene_id=mCG145146.0"
FT   mRNA            complement(join(<950031..950162,950546..950724,
FT                   951812..951926,960934..>961393))
FT                   /locus_tag="mCG_145146"
FT                   /product="mCG145146"
FT                   /note="gene_id=mCG145146.0 transcript_id=mCT184570.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(<950031..950162,950546..>950639))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145146"
FT                   /product="mCG145146"
FT                   /note="gene_id=mCG145146.0 transcript_id=mCT184570.0
FT                   protein_id=mCP106250.0"
FT                   /protein_id="EDL10097.1"
FT                   /translation="IQTSGLSTFPTKIPLWSSQRTKCKRATISTAARKRGKATPRIHSK
FT                   RKTKRRRGSSQMLMFCFFDINLRTHMGVFI"
FT   gene            961457..973732
FT                   /gene="0610009O20Rik"
FT                   /locus_tag="mCG_18332"
FT                   /note="gene_id=mCG18332.2"
FT   mRNA            join(961457..961619,962306..962420,962503..962620,
FT                   964039..964183,965122..965283,965494..965582,
FT                   965684..965780,968484..968626,969254..969412,
FT                   969496..969588,971117..971276,972284..972505,
FT                   972986..973732)
FT                   /gene="0610009O20Rik"
FT                   /locus_tag="mCG_18332"
FT                   /product="RIKEN cDNA 0610009O20, transcript variant
FT                   mCT174387"
FT                   /note="gene_id=mCG18332.2 transcript_id=mCT174387.0 created
FT                   on 13-JUN-2003"
FT   mRNA            join(961457..961619,962306..962420,962503..962620,
FT                   964039..964183,965122..965283,965494..965582,
FT                   965684..966776)
FT                   /gene="0610009O20Rik"
FT                   /locus_tag="mCG_18332"
FT                   /product="RIKEN cDNA 0610009O20, transcript variant
FT                   mCT12932"
FT                   /note="gene_id=mCG18332.2 transcript_id=mCT12932.2 created
FT                   on 13-JUN-2003"
FT   mRNA            join(961457..961619,962306..962420,962503..962620,
FT                   964039..964427)
FT                   /gene="0610009O20Rik"
FT                   /locus_tag="mCG_18332"
FT                   /product="RIKEN cDNA 0610009O20, transcript variant
FT                   mCT174388"
FT                   /note="gene_id=mCG18332.2 transcript_id=mCT174388.1 created
FT                   on 13-JUN-2003"
FT   mRNA            join(961457..961619,962306..962420,962503..963070)
FT                   /gene="0610009O20Rik"
FT                   /locus_tag="mCG_18332"
FT                   /product="RIKEN cDNA 0610009O20, transcript variant
FT                   mCT174386"
FT                   /note="gene_id=mCG18332.2 transcript_id=mCT174386.1 created
FT                   on 13-JUN-2003"
FT   CDS             join(961589..961619,962306..962420,962503..962620,
FT                   964039..964183,965122..965283,965494..965582,
FT                   965684..965780,968484..968626,969254..969412,
FT                   969496..969588,971117..971276,972284..972504)
FT                   /codon_start=1
FT                   /gene="0610009O20Rik"
FT                   /locus_tag="mCG_18332"
FT                   /product="RIKEN cDNA 0610009O20, isoform CRA_c"
FT                   /note="gene_id=mCG18332.2 transcript_id=mCT174387.0
FT                   protein_id=mCP97305.0 isoform=CRA_c"
FT                   /protein_id="EDL10095.1"
FT                   /translation="MWRLTGILGRALPRLLGPGFRGITPKPTSSDGSQTTSPTLPLTRL
FT                   SFDRSGSHGSKRSRDPKCCGWKDAFHWMSAHVSPNTLRDAISWGTLAVLALHLARQIHF
FT                   HAPLVAGPQPAERSWHSPLYRFLSSSWWHPHSSLRRHVLPRPDCPAPRNTGLREPRQGQ
FT                   EDHPSAPSQCLPSDSSLRSGLLNLPEEEPSDFDFLHASRDFASQAKAAEAHPPGGKNEQ
FT                   DKAKALPLEEAVTSIQQLFQLSVAITFNFLGTENIKTGDYTAAFSYFQKAADRGYSKAQ
FT                   YNVGLCLEHGRGTPRDLSKAILFYHLAAVQGHSLAQYRYARCLLQSPGSLSDPERERAV
FT                   SLLKQAADSGLTEAQAFLGVLFTKEPHLDEQRAVKYLWLAASNGDSQSRFHLGICYEKG
FT                   LGAQRNLGEAVKCYQQAAAMGNEPARERLRTLFNVEAAGPSHLATTGLKSFSSPSLCSL
FT                   NTLLAGASGLPHASSTGNLGLLCRSGHLGASHGAPSRTIPSLERSLVRLGFG"
FT   CDS             join(961589..961619,962306..962420,962503..962620,
FT                   964039..964183,965122..965283,965494..965582,
FT                   965684..965962)
FT                   /codon_start=1
FT                   /gene="0610009O20Rik"
FT                   /locus_tag="mCG_18332"
FT                   /product="RIKEN cDNA 0610009O20, isoform CRA_a"
FT                   /note="gene_id=mCG18332.2 transcript_id=mCT12932.2
FT                   protein_id=mCP8390.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q99M18"
FT                   /db_xref="MGI:MGI:1914089"
FT                   /db_xref="UniProtKB/TrEMBL:Q99M18"
FT                   /protein_id="EDL10093.1"
FT                   /translation="MWRLTGILGRALPRLLGPGFRGITPKPTSSDGSQTTSPTLPLTRL
FT                   SFDRSGSHGSKRSRDPKCCGWKDAFHWMSAHVSPNTLRDAISWGTLAVLALHLARQIHF
FT                   HAPLVAGPQPAERSWHSPLYRFLSSSWWHPHSSLRRHVLPRPDCPAPRNTGLREPRQGQ
FT                   EDHPSAPSQCLPSDSSLRSGLLNLPEEEPSDFDFLHASRDFASQAKAAEAHPPGGKNEQ
FT                   DKAKALPLEEAVTSIQQLFQLSVAITFNFLGTCFLPRGRGMRIEKGGWDAVRVESGLNE
FT                   RFLFSWVGRPDVAWWFSGVRDPSLLIKVQPI"
FT   CDS             join(961589..961619,962306..962420,962503..962620,
FT                   964039..964419)
FT                   /codon_start=1
FT                   /gene="0610009O20Rik"
FT                   /locus_tag="mCG_18332"
FT                   /product="RIKEN cDNA 0610009O20, isoform CRA_d"
FT                   /note="gene_id=mCG18332.2 transcript_id=mCT174388.1
FT                   protein_id=mCP97306.0 isoform=CRA_d"
FT                   /db_xref="GOA:Q8CBJ7"
FT                   /db_xref="MGI:MGI:1914089"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CBJ7"
FT                   /protein_id="EDL10096.1"
FT                   /translation="MWRLTGILGRALPRLLGPGFRGITPKPTSSDGSQTTSPTLPLTRL
FT                   SFDRSGSHGSKRSRDPKCCGWKDAFHWMSAHVSPNTLRDAISWGTLAVLALHLARQIHF
FT                   HAPLVAGPQPAERSWHSPLYRFLSSSWWHPHSCEFSVLKGQLGQAGSFLWARKYLWLHL
FT                   RKKAISGCLRFLSKVRGREVGKCCPHWVWALPPLSVPQCPSVTSQRGSPKT"
FT   CDS             join(961589..961619,962306..962420,962503..962641)
FT                   /codon_start=1
FT                   /gene="0610009O20Rik"
FT                   /locus_tag="mCG_18332"
FT                   /product="RIKEN cDNA 0610009O20, isoform CRA_b"
FT                   /note="gene_id=mCG18332.2 transcript_id=mCT174386.1
FT                   protein_id=mCP97307.0 isoform=CRA_b"
FT                   /protein_id="EDL10094.1"
FT                   /translation="MWRLTGILGRALPRLLGPGFRGITPKPTSSDGSQTTSPTLPLTRL
FT                   SFDRSGSHGSKRSRDPKCCGWKDAFHWMSAHVSPNTLRDAISWVRLPQA"
FT   assembly_gap    975344..975396
FT                   /estimated_length=53
FT                   /gap_type="unknown"
FT   gene            complement(978288..995311)
FT                   /gene="Pcdh12"
FT                   /locus_tag="mCG_18330"
FT                   /note="gene_id=mCG18330.2"
FT   mRNA            complement(join(978288..980388,986235..986389,
FT                   988739..988839,994987..995311))
FT                   /gene="Pcdh12"
FT                   /locus_tag="mCG_18330"
FT                   /product="protocadherin 12, transcript variant mCT174385"
FT                   /note="gene_id=mCG18330.2 transcript_id=mCT174385.0 created
FT                   on 14-MAR-2003"
FT   mRNA            complement(join(978288..980388,986235..986389,
FT                   988739..988839,992101..995267))
FT                   /gene="Pcdh12"
FT                   /locus_tag="mCG_18330"
FT                   /product="protocadherin 12, transcript variant mCT12931"
FT                   /note="gene_id=mCG18330.2 transcript_id=mCT12931.1 created
FT                   on 14-MAR-2003"
FT   CDS             complement(join(979982..980388,986235..986389,
FT                   988739..988839,992101..994980))
FT                   /codon_start=1
FT                   /gene="Pcdh12"
FT                   /locus_tag="mCG_18330"
FT                   /product="protocadherin 12, isoform CRA_a"
FT                   /note="gene_id=mCG18330.2 transcript_id=mCT12931.1
FT                   protein_id=mCP8380.1 isoform=CRA_a"
FT                   /db_xref="GOA:O55134"
FT                   /db_xref="InterPro:IPR002126"
FT                   /db_xref="InterPro:IPR013164"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR020894"
FT                   /db_xref="MGI:MGI:1855700"
FT                   /protein_id="EDL10091.1"
FT                   /translation="MMLLLPFLLGLLGPGSYLFISGDCQEVATVMVKFQVTEEVPSGTV
FT                   IGKLSQELRVEERRGKAGDAFQILQLPQALPVQMNSEDGLLSTSSRLDREKLCRQEDPC
FT                   LVSFDVLATGASALIHVEIQVLDINDHQPQFPKDEQELEISESASLHTRIPLDRALDQD
FT                   TGPNSLYSYSLSPSEHFALDVIVGPDETKHAELVVVKELDRELHSYFDLVLTAYDNGNP
FT                   PKSGISVVKVNVLDSNDNSPVFAESSLALEIPEDTVPGTLLINLTATDPDQGPNGEVEF
FT                   FFGKHVSPEVMNTFGIDAKTGQIILRQALDYEKNPAYEVDVQARDLGPNSIPGHCKVLI
FT                   KVLDVNDNAPSILITWASQTSLVSEDLPRDSFIALVSANDLDSGNNGLVHCWLNQELGH
FT                   FRLKRTNGNTYMLLTNATLDREQWPIYTLTVFAQDQGPQPLSAEKELQIQVSDVNDNAP
FT                   VFEKSRYEVSTWENNPPSLHLITLKAHDADLGSNGKVSYRIKDSPVSHLVIIDFETGEV
FT                   TAQRSLDYEQMAGFEFQVIAEDRGQPQLASSISVWVSLLDANDNAPEVIQPVLSEGKAT
FT                   LSVLVNASTGHLLLPIENPSGMDPAGTGIPPKATHSPWSFLLLTIVARDADSGANGELF
FT                   YSIQSGNDAHLFFLSPSLGQLFINVTNASSLIGSQWDLGIVVEDQGSPSLQTQVSLKVV
FT                   FVTSVDHLRDSAHEPGVLSTPALALICLAVLLAIFGLLLALFVSICRTERKDNRAYNCR
FT                   EAESSYRHQPKRPQKHIQKADIHLVPVLRAHENETDEVRPSHKDTSKETLMEAGWDSCL
FT                   QAPFHLTPTLYRTLRNQGNQGELAESQEVLQDTFNFLFNHPRQRNASRENLNLPESPPA
FT                   VRQPLLRPLKVPGSPIARATGDQDKEEAPQSPPASSATLRRQRNFNGKVSPRGESGPHQ
FT                   ILRSLVRLSVAAFAERNPVEEPAGDSPPVQQISQLLSLLHQGQFQPKPNHRGNKYLAKP
FT                   GGSSRGTIPDTEGLVGLKPSGQAEPDLEEGPPSPEEDLSVKRLLEEELSSLLDPNTGLA
FT                   LDKLSPPDPAWMARLSLPLTTNYRDNLSSPDATTSEEPRTFQTFGKTVGPGPELSPTGT
FT                   RLASTFVSEMSSLLEMLLGQHTVPVEAASAALRRLSVCGRTLSLDLATSGASASEAQGR
FT                   KKAAESRLGCGRNL"
FT   CDS             complement(979982..980347)
FT                   /codon_start=1
FT                   /gene="Pcdh12"
FT                   /locus_tag="mCG_18330"
FT                   /product="protocadherin 12, isoform CRA_b"
FT                   /note="gene_id=mCG18330.2 transcript_id=mCT174385.0
FT                   protein_id=mCP97304.0 isoform=CRA_b"
FT                   /db_xref="GOA:A0JNZ2"
FT                   /db_xref="MGI:MGI:1855700"
FT                   /db_xref="UniProtKB/TrEMBL:A0JNZ2"
FT                   /protein_id="EDL10092.1"
FT                   /translation="MARLSLPLTTNYRDNLSSPDATTSEEPRTFQTFGKTVGPGPELSP
FT                   TGTRLASTFVSEMSSLLEMLLGQHTVPVEAASAALRRLSVCGRTLSLDLATSGASASEA
FT                   QGRKKAAESRLGCGRNL"
FT   assembly_gap    985674..985693
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1004540..1004713
FT                   /estimated_length=174
FT                   /gap_type="unknown"
FT   gene            1007425..1028648
FT                   /gene="Rnf14"
FT                   /locus_tag="mCG_18329"
FT                   /note="gene_id=mCG18329.2"
FT   mRNA            join(1007425..1007546,1010502..1010674,1011177..1011338,
FT                   1018613..1019143,1020233..1020461,1023961..1024133,
FT                   1025422..1025552,1027274..1028648)
FT                   /gene="Rnf14"
FT                   /locus_tag="mCG_18329"
FT                   /product="ring finger protein 14, transcript variant
FT                   mCT174377"
FT                   /note="gene_id=mCG18329.2 transcript_id=mCT174377.0 created
FT                   on 14-OCT-2002"
FT   mRNA            join(1007425..1007546,1010502..1010674,1011177..1011338,
FT                   1012404..1012555,1014840..1014977)
FT                   /gene="Rnf14"
FT                   /locus_tag="mCG_18329"
FT                   /product="ring finger protein 14, transcript variant
FT                   mCT174379"
FT                   /note="gene_id=mCG18329.2 transcript_id=mCT174379.0 created
FT                   on 14-OCT-2002"
FT   mRNA            join(1007437..1007546,1010502..1010674,1011177..1011232,
FT                   1018613..1019143,1020233..1020461,1023961..1024133,
FT                   1025422..1025552,1027274..1028648)
FT                   /gene="Rnf14"
FT                   /locus_tag="mCG_18329"
FT                   /product="ring finger protein 14, transcript variant
FT                   mCT174383"
FT                   /note="gene_id=mCG18329.2 transcript_id=mCT174383.0 created
FT                   on 14-OCT-2002"
FT   mRNA            join(1007437..1007546,1010502..1010674,1011177..1011338,
FT                   1012404..1012555,1018613..1019143,1020233..1020461,
FT                   1023961..1024133,1025422..1025552,1027274..1028552)
FT                   /gene="Rnf14"
FT                   /locus_tag="mCG_18329"
FT                   /product="ring finger protein 14, transcript variant
FT                   mCT12240"
FT                   /note="gene_id=mCG18329.2 transcript_id=mCT12240.0 created
FT                   on 14-OCT-2002"
FT   mRNA            join(1007458..1007546,1008248..1008323,1010502..1010674,
FT                   1011177..1011338,1012404..1012555,1018613..1019143,
FT                   1020233..1020461,1023961..1024133,1025422..1025552,
FT                   1027274..1027935)
FT                   /gene="Rnf14"
FT                   /locus_tag="mCG_18329"
FT                   /product="ring finger protein 14, transcript variant
FT                   mCT174378"
FT                   /note="gene_id=mCG18329.2 transcript_id=mCT174378.0 created
FT                   on 14-OCT-2002"
FT   mRNA            join(1007474..1007546,1008248..1008323,1009057..1009143,
FT                   1010502..1010674,1011177..1011338,1012404..1012555,
FT                   1018613..1019143,1020233..1020461,1023961..1024133,
FT                   1025422..1025552,1027274..1028590)
FT                   /gene="Rnf14"
FT                   /locus_tag="mCG_18329"
FT                   /product="ring finger protein 14, transcript variant
FT                   mCT174381"
FT                   /note="gene_id=mCG18329.2 transcript_id=mCT174381.0 created
FT                   on 14-OCT-2002"
FT   mRNA            join(1007501..1007546,1010502..1010674,1011177..1011205,
FT                   1018842..1019143,1020233..1020461,1023961..1024133,
FT                   1025422..1025552,1027274..1028648)
FT                   /gene="Rnf14"
FT                   /locus_tag="mCG_18329"
FT                   /product="ring finger protein 14, transcript variant
FT                   mCT174384"
FT                   /note="gene_id=mCG18329.2 transcript_id=mCT174384.0 created
FT                   on 14-OCT-2002"
FT   mRNA            join(<1007553..1007953,1008248..1008323,1010502..1010674,
FT                   1011177..1011338,1012404..1012555,1018613..1019143,
FT                   1020233..1020461,1023961..1024133,1025422..1025552,
FT                   1027274..1028584)
FT                   /gene="Rnf14"
FT                   /locus_tag="mCG_18329"
FT                   /product="ring finger protein 14, transcript variant
FT                   mCT190286"
FT                   /note="gene_id=mCG18329.2 transcript_id=mCT190286.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(1007779..1007963,1008214..1008323,1009057..1009143,
FT                   1010502..1010674,1011177..1011338,1012404..1012555,
FT                   1018613..1019143,1020233..1020461,1023961..1024133,
FT                   1025422..1025552,1027274..1028648)
FT                   /gene="Rnf14"
FT                   /locus_tag="mCG_18329"
FT                   /product="ring finger protein 14, transcript variant
FT                   mCT174380"
FT                   /note="gene_id=mCG18329.2 transcript_id=mCT174380.0 created
FT                   on 14-OCT-2002"
FT   mRNA            join(1008214..1008323,1010502..1010674,1011177..1011338,
FT                   1012404..1012555,1018613..1019143,1020233..1020461,
FT                   1023961..1024133,1025422..1025552,1027274..1027642)
FT                   /gene="Rnf14"
FT                   /locus_tag="mCG_18329"
FT                   /product="ring finger protein 14, transcript variant
FT                   mCT174382"
FT                   /note="gene_id=mCG18329.2 transcript_id=mCT174382.0 created
FT                   on 14-OCT-2002"
FT   CDS             join(<1010623..1010674,1011177..1011338,1012404..1012555,
FT                   1018613..1019143,1020233..1020461,1023961..1024133,
FT                   1025422..1025552,1027274..1027361)
FT                   /codon_start=1
FT                   /gene="Rnf14"
FT                   /locus_tag="mCG_18329"
FT                   /product="ring finger protein 14, isoform CRA_c"
FT                   /note="gene_id=mCG18329.2 transcript_id=mCT190286.0
FT                   protein_id=mCP111277.0 isoform=CRA_c"
FT                   /protein_id="EDL10086.1"
FT                   /translation="NTDCSSINILFSWLLLTASSMSAEDLEAQEDELLALASIYDADEF
FT                   RKAESVQGGETRIYLDLPQNFKIFVSGNSNESLQNSGFEYTICFLPPLVLNFELPPDYP
FT                   SSSPPSFTLSGKWLSPTQLSALCKHLDNLWEEHRGRVVLFAWMQFLKEETLTYLNIVSP
FT                   FELKMGSQKKVQRRATAQASSSTELGVGGAAAADVDQEETVDERAVQDVESLSSLIQEI
FT                   LDFNQARQTKCFNSKLFLCSICFCEKLGSDCMYFLECKHVYCKACLKDYFEIQIKDGQV
FT                   KCLNCPEPQCPSVATPGQVKELVEADLFARYDRLLLQSTLDLMADVVYCPRPCCQLPVM
FT                   QEPGGTMAICSSCNFAFCTLCRLTYHGLSPCKVTAEKLIDLRNEYLQADEATKRFLEQR
FT                   YGKRVIQKALEEMESKDWLEKNSKSCPCCGTPIQKLDGCNKMTCTGCMQYFCWICMGSL
FT                   SRANPYRHFTDSESPCFNRLFHAVDINGDMWEDEIEEDDDDEDDDDD"
FT   CDS             join(1011185..1011338,1012404..1012555,1018613..1019143,
FT                   1020233..1020461,1023961..1024133,1025422..1025552,
FT                   1027274..1027361)
FT                   /codon_start=1
FT                   /gene="Rnf14"
FT                   /locus_tag="mCG_18329"
FT                   /product="ring finger protein 14, isoform CRA_a"
FT                   /note="gene_id=mCG18329.2 transcript_id=mCT174378.0
FT                   protein_id=mCP97298.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q9JI90"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR002867"
FT                   /db_xref="InterPro:IPR006575"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="MGI:MGI:1929668"
FT                   /protein_id="EDL10081.1"
FT                   /translation="MSAEDLEAQEDELLALASIYDADEFRKAESVQGGETRIYLDLPQN
FT                   FKIFVSGNSNESLQNSGFEYTICFLPPLVLNFELPPDYPSSSPPSFTLSGKWLSPTQLS
FT                   ALCKHLDNLWEEHRGRVVLFAWMQFLKEETLTYLNIVSPFELKMGSQKKVQRRATAQAS
FT                   SSTELGVGGAAAADVDQEETVDERAVQDVESLSSLIQEILDFNQARQTKCFNSKLFLCS
FT                   ICFCEKLGSDCMYFLECKHVYCKACLKDYFEIQIKDGQVKCLNCPEPQCPSVATPGQVK
FT                   ELVEADLFARYDRLLLQSTLDLMADVVYCPRPCCQLPVMQEPGGTMAICSSCNFAFCTL
FT                   CRLTYHGLSPCKVTAEKLIDLRNEYLQADEATKRFLEQRYGKRVIQKALEEMESKDWLE
FT                   KNSKSCPCCGTPIQKLDGCNKMTCTGCMQYFCWICMGSLSRANPYRHFTDSESPCFNRL
FT                   FHAVDINGDMWEDEIEEDDDDEDDDDD"
FT   CDS             join(1011185..1011338,1012404..1012555,1018613..1019143,
FT                   1020233..1020461,1023961..1024133,1025422..1025552,
FT                   1027274..1027361)
FT                   /codon_start=1
FT                   /gene="Rnf14"
FT                   /locus_tag="mCG_18329"
FT                   /product="ring finger protein 14, isoform CRA_a"
FT                   /note="gene_id=mCG18329.2 transcript_id=mCT174380.0
FT                   protein_id=mCP97297.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q9JI90"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR002867"
FT                   /db_xref="InterPro:IPR006575"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="MGI:MGI:1929668"
FT                   /protein_id="EDL10082.1"
FT                   /translation="MSAEDLEAQEDELLALASIYDADEFRKAESVQGGETRIYLDLPQN
FT                   FKIFVSGNSNESLQNSGFEYTICFLPPLVLNFELPPDYPSSSPPSFTLSGKWLSPTQLS
FT                   ALCKHLDNLWEEHRGRVVLFAWMQFLKEETLTYLNIVSPFELKMGSQKKVQRRATAQAS
FT                   SSTELGVGGAAAADVDQEETVDERAVQDVESLSSLIQEILDFNQARQTKCFNSKLFLCS
FT                   ICFCEKLGSDCMYFLECKHVYCKACLKDYFEIQIKDGQVKCLNCPEPQCPSVATPGQVK
FT                   ELVEADLFARYDRLLLQSTLDLMADVVYCPRPCCQLPVMQEPGGTMAICSSCNFAFCTL
FT                   CRLTYHGLSPCKVTAEKLIDLRNEYLQADEATKRFLEQRYGKRVIQKALEEMESKDWLE
FT                   KNSKSCPCCGTPIQKLDGCNKMTCTGCMQYFCWICMGSLSRANPYRHFTDSESPCFNRL
FT                   FHAVDINGDMWEDEIEEDDDDEDDDDD"
FT   CDS             join(1011185..1011338,1012404..1012555,1018613..1019143,
FT                   1020233..1020461,1023961..1024133,1025422..1025552,
FT                   1027274..1027361)
FT                   /codon_start=1
FT                   /gene="Rnf14"
FT                   /locus_tag="mCG_18329"
FT                   /product="ring finger protein 14, isoform CRA_a"
FT                   /note="gene_id=mCG18329.2 transcript_id=mCT174381.0
FT                   protein_id=mCP97303.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q9JI90"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR002867"
FT                   /db_xref="InterPro:IPR006575"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="MGI:MGI:1929668"
FT                   /protein_id="EDL10083.1"
FT                   /translation="MSAEDLEAQEDELLALASIYDADEFRKAESVQGGETRIYLDLPQN
FT                   FKIFVSGNSNESLQNSGFEYTICFLPPLVLNFELPPDYPSSSPPSFTLSGKWLSPTQLS
FT                   ALCKHLDNLWEEHRGRVVLFAWMQFLKEETLTYLNIVSPFELKMGSQKKVQRRATAQAS
FT                   SSTELGVGGAAAADVDQEETVDERAVQDVESLSSLIQEILDFNQARQTKCFNSKLFLCS
FT                   ICFCEKLGSDCMYFLECKHVYCKACLKDYFEIQIKDGQVKCLNCPEPQCPSVATPGQVK
FT                   ELVEADLFARYDRLLLQSTLDLMADVVYCPRPCCQLPVMQEPGGTMAICSSCNFAFCTL
FT                   CRLTYHGLSPCKVTAEKLIDLRNEYLQADEATKRFLEQRYGKRVIQKALEEMESKDWLE
FT                   KNSKSCPCCGTPIQKLDGCNKMTCTGCMQYFCWICMGSLSRANPYRHFTDSESPCFNRL
FT                   FHAVDINGDMWEDEIEEDDDDEDDDDD"
FT   CDS             join(1011185..1011338,1012404..1012555,1018613..1019143,
FT                   1020233..1020461,1023961..1024133,1025422..1025552,
FT                   1027274..1027361)
FT                   /codon_start=1
FT                   /gene="Rnf14"
FT                   /locus_tag="mCG_18329"
FT                   /product="ring finger protein 14, isoform CRA_a"
FT                   /note="gene_id=mCG18329.2 transcript_id=mCT174382.0
FT                   protein_id=mCP97300.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q9JI90"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR002867"
FT                   /db_xref="InterPro:IPR006575"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="MGI:MGI:1929668"
FT                   /protein_id="EDL10084.1"
FT                   /translation="MSAEDLEAQEDELLALASIYDADEFRKAESVQGGETRIYLDLPQN
FT                   FKIFVSGNSNESLQNSGFEYTICFLPPLVLNFELPPDYPSSSPPSFTLSGKWLSPTQLS
FT                   ALCKHLDNLWEEHRGRVVLFAWMQFLKEETLTYLNIVSPFELKMGSQKKVQRRATAQAS
FT                   SSTELGVGGAAAADVDQEETVDERAVQDVESLSSLIQEILDFNQARQTKCFNSKLFLCS
FT                   ICFCEKLGSDCMYFLECKHVYCKACLKDYFEIQIKDGQVKCLNCPEPQCPSVATPGQVK
FT                   ELVEADLFARYDRLLLQSTLDLMADVVYCPRPCCQLPVMQEPGGTMAICSSCNFAFCTL
FT                   CRLTYHGLSPCKVTAEKLIDLRNEYLQADEATKRFLEQRYGKRVIQKALEEMESKDWLE
FT                   KNSKSCPCCGTPIQKLDGCNKMTCTGCMQYFCWICMGSLSRANPYRHFTDSESPCFNRL
FT                   FHAVDINGDMWEDEIEEDDDDEDDDDD"
FT   CDS             join(1011185..1011338,1012404..1012555,1018613..1019143,
FT                   1020233..1020461,1023961..1024133,1025422..1025552,
FT                   1027274..1027361)
FT                   /codon_start=1
FT                   /gene="Rnf14"
FT                   /locus_tag="mCG_18329"
FT                   /product="ring finger protein 14, isoform CRA_a"
FT                   /note="gene_id=mCG18329.2 transcript_id=mCT12240.0
FT                   protein_id=mCP8368.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q9JI90"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR002867"
FT                   /db_xref="InterPro:IPR006575"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="MGI:MGI:1929668"
FT                   /protein_id="EDL10087.1"
FT                   /translation="MSAEDLEAQEDELLALASIYDADEFRKAESVQGGETRIYLDLPQN
FT                   FKIFVSGNSNESLQNSGFEYTICFLPPLVLNFELPPDYPSSSPPSFTLSGKWLSPTQLS
FT                   ALCKHLDNLWEEHRGRVVLFAWMQFLKEETLTYLNIVSPFELKMGSQKKVQRRATAQAS
FT                   SSTELGVGGAAAADVDQEETVDERAVQDVESLSSLIQEILDFNQARQTKCFNSKLFLCS
FT                   ICFCEKLGSDCMYFLECKHVYCKACLKDYFEIQIKDGQVKCLNCPEPQCPSVATPGQVK
FT                   ELVEADLFARYDRLLLQSTLDLMADVVYCPRPCCQLPVMQEPGGTMAICSSCNFAFCTL
FT                   CRLTYHGLSPCKVTAEKLIDLRNEYLQADEATKRFLEQRYGKRVIQKALEEMESKDWLE
FT                   KNSKSCPCCGTPIQKLDGCNKMTCTGCMQYFCWICMGSLSRANPYRHFTDSESPCFNRL
FT                   FHAVDINGDMWEDEIEEDDDDEDDDDD"
FT   CDS             join(1011185..1011232,1018613..1019143,1020233..1020461,
FT                   1023961..1024133,1025422..1025552,1027274..1027361)
FT                   /codon_start=1
FT                   /gene="Rnf14"
FT                   /locus_tag="mCG_18329"
FT                   /product="ring finger protein 14, isoform CRA_f"
FT                   /note="gene_id=mCG18329.2 transcript_id=mCT174383.0
FT                   protein_id=mCP97299.0 isoform=CRA_f"
FT                   /protein_id="EDL10090.1"
FT                   /translation="MSAEDLEAQEDELLALLSALCKHLDNLWEEHRGRVVLFAWMQFLK
FT                   EETLTYLNIVSPFELKMGSQKKVQRRATAQASSSTELGVGGAAAADVDQEETVDERAVQ
FT                   DVESLSSLIQEILDFNQARQTKCFNSKLFLCSICFCEKLGSDCMYFLECKHVYCKACLK
FT                   DYFEIQIKDGQVKCLNCPEPQCPSVATPGQVKELVEADLFARYDRLLLQSTLDLMADVV
FT                   YCPRPCCQLPVMQEPGGTMAICSSCNFAFCTLCRLTYHGLSPCKVTAEKLIDLRNEYLQ
FT                   ADEATKRFLEQRYGKRVIQKALEEMESKDWLEKNSKSCPCCGTPIQKLDGCNKMTCTGC
FT                   MQYFCWICMGSLSRANPYRHFTDSESPCFNRLFHAVDINGDMWEDEIEEDDDDEDDDDD
FT                   "
FT   CDS             join(1011185..1011338,1012404..1012555,1014840..1014854)
FT                   /codon_start=1
FT                   /gene="Rnf14"
FT                   /locus_tag="mCG_18329"
FT                   /product="ring finger protein 14, isoform CRA_e"
FT                   /note="gene_id=mCG18329.2 transcript_id=mCT174379.0
FT                   protein_id=mCP97302.0 isoform=CRA_e"
FT                   /protein_id="EDL10089.1"
FT                   /translation="MSAEDLEAQEDELLALASIYDADEFRKAESVQGGETRIYLDLPQN
FT                   FKIFVSGNSNESLQNSGFEYTICFLPPLVLNFELPPDYPSSSPPSFTLSGKWLSPTQGT
FT                   LV"
FT   CDS             join(1018685..1019143,1020233..1020461,1023961..1024133,
FT                   1025422..1025552,1027274..1027361)
FT                   /codon_start=1
FT                   /gene="Rnf14"
FT                   /locus_tag="mCG_18329"
FT                   /product="ring finger protein 14, isoform CRA_d"
FT                   /note="gene_id=mCG18329.2 transcript_id=mCT174377.0
FT                   protein_id=mCP97301.0 isoform=CRA_d"
FT                   /db_xref="GOA:G3XA54"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR002867"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="MGI:MGI:1929668"
FT                   /db_xref="UniProtKB/TrEMBL:G3XA54"
FT                   /protein_id="EDL10088.1"
FT                   /translation="MQFLKEETLTYLNIVSPFELKMGSQKKVQRRATAQASSSTELGVG
FT                   GAAAADVDQEETVDERAVQDVESLSSLIQEILDFNQARQTKCFNSKLFLCSICFCEKLG
FT                   SDCMYFLECKHVYCKACLKDYFEIQIKDGQVKCLNCPEPQCPSVATPGQVKELVEADLF
FT                   ARYDRLLLQSTLDLMADVVYCPRPCCQLPVMQEPGGTMAICSSCNFAFCTLCRLTYHGL
FT                   SPCKVTAEKLIDLRNEYLQADEATKRFLEQRYGKRVIQKALEEMESKDWLEKNSKSCPC
FT                   CGTPIQKLDGCNKMTCTGCMQYFCWICMGSLSRANPYRHFTDSESPCFNRLFHAVDING
FT                   DMWEDEIEEDDDDEDDDDD"
FT   CDS             join(1019006..1019143,1020233..1020461,1023961..1024133,
FT                   1025422..1025552,1027274..1027361)
FT                   /codon_start=1
FT                   /gene="Rnf14"
FT                   /locus_tag="mCG_18329"
FT                   /product="ring finger protein 14, isoform CRA_b"
FT                   /note="gene_id=mCG18329.2 transcript_id=mCT174384.0
FT                   protein_id=mCP97296.0 isoform=CRA_b"
FT                   /protein_id="EDL10085.1"
FT                   /translation="MYFLECKHVYCKACLKDYFEIQIKDGQVKCLNCPEPQCPSVATPG
FT                   QVKELVEADLFARYDRLLLQSTLDLMADVVYCPRPCCQLPVMQEPGGTMAICSSCNFAF
FT                   CTLCRLTYHGLSPCKVTAEKLIDLRNEYLQADEATKRFLEQRYGKRVIQKALEEMESKD
FT                   WLEKNSKSCPCCGTPIQKLDGCNKMTCTGCMQYFCWICMGSLSRANPYRHFTDSESPCF
FT                   NRLFHAVDINGDMWEDEIEEDDDDEDDDDD"
FT   assembly_gap    1035769..1035788
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1037897..1037962
FT                   /estimated_length=66
FT                   /gap_type="unknown"
FT   gene            complement(1038325..1049718)
FT                   /gene="Gnpda1"
FT                   /locus_tag="mCG_18341"
FT                   /note="gene_id=mCG18341.1"
FT   mRNA            complement(join(1038325..1039740,1041253..1041427,
FT                   1042735..1042919,1043921..1044103,1045783..1045884,
FT                   1048858..1048989,1049675..1049718))
FT                   /gene="Gnpda1"
FT                   /locus_tag="mCG_18341"
FT                   /product="glucosamine-6-phosphate deaminase 1, transcript
FT                   variant mCT11744"
FT                   /note="gene_id=mCG18341.1 transcript_id=mCT11744.1 created
FT                   on 14-OCT-2002"
FT   mRNA            complement(join(1039301..1039740,1042735..1042919,
FT                   1043921..1044103,1045783..1045884,1048858..1048989,
FT                   1049675..1049701))
FT                   /gene="Gnpda1"
FT                   /locus_tag="mCG_18341"
FT                   /product="glucosamine-6-phosphate deaminase 1, transcript
FT                   variant mCT174400"
FT                   /note="gene_id=mCG18341.1 transcript_id=mCT174400.0 created
FT                   on 14-OCT-2002"
FT   CDS             complement(join(1039640..1039740,1041253..1041427,
FT                   1042735..1042919,1043921..1044103,1045783..1045884,
FT                   1048858..1048981))
FT                   /codon_start=1
FT                   /gene="Gnpda1"
FT                   /locus_tag="mCG_18341"
FT                   /product="glucosamine-6-phosphate deaminase 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG18341.1 transcript_id=mCT11744.1
FT                   protein_id=mCP8367.1 isoform=CRA_a"
FT                   /db_xref="GOA:O88958"
FT                   /db_xref="InterPro:IPR004547"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="InterPro:IPR018321"
FT                   /db_xref="MGI:MGI:1347054"
FT                   /protein_id="EDL10078.1"
FT                   /translation="MKLIILEHYSQASEWAAKYIRNRIIQFNPGPDKYFTLGLPTGSTP
FT                   LGCYQKLIEYYKNGDLSFQYVKTFNMDEYVGLPRDHPESYHSFMWNNFFKHIDIHPENT
FT                   HILDGNAADLQAECDAFEEKIQAAGGIELFVGGIGPDGHIAFNEPGSSLVSRTRVKTLA
FT                   MDTILANARFFDGDLAKVPTMALTVGVGTVMDAKEVMILITGAHKAFALYKAIEEGVNH
FT                   MWTVSAFQQHPRTVFVCDEDATLELKVKTVKYFKGLMLVHNKLVDPLYSIKEKEIQKSQ
FT                   SAKKPYSD"
FT   CDS             complement(join(1039735..1039740,1042735..1042919,
FT                   1043921..1044103,1045783..1045884,1048858..1048981))
FT                   /codon_start=1
FT                   /gene="Gnpda1"
FT                   /locus_tag="mCG_18341"
FT                   /product="glucosamine-6-phosphate deaminase 1, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG18341.1 transcript_id=mCT174400.0
FT                   protein_id=mCP97319.0 isoform=CRA_c"
FT                   /protein_id="EDL10080.1"
FT                   /translation="MKLIILEHYSQASEWAAKYIRNRIIQFNPGPDKYFTLGLPTGSTP
FT                   LGCYQKLIEYYKNGDLSFQYVKTFNMDEYVGLPRDHPESYHSFMWNNFFKHIDIHPENT
FT                   HILDGNAADLQAECDAFEEKIQAAGGIELFVGGIGPDGHIAFNEPGSSLVSRTRVKTLA
FT                   MDTILANARFFDGDLAKVPTMALTVGVGTVMDAKEV"
FT   mRNA            complement(join(1043806..1044103,1045783..1045884,
FT                   1048858..1048989,1049675..1049701))
FT                   /gene="Gnpda1"
FT                   /locus_tag="mCG_18341"
FT                   /product="glucosamine-6-phosphate deaminase 1, transcript
FT                   variant mCT174399"
FT                   /note="gene_id=mCG18341.1 transcript_id=mCT174399.0 created
FT                   on 14-OCT-2002"
FT   CDS             complement(join(1043871..1044103,1045783..1045884,
FT                   1048858..1048981))
FT                   /codon_start=1
FT                   /gene="Gnpda1"
FT                   /locus_tag="mCG_18341"
FT                   /product="glucosamine-6-phosphate deaminase 1, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG18341.1 transcript_id=mCT174399.0
FT                   protein_id=mCP97318.0 isoform=CRA_b"
FT                   /protein_id="EDL10079.1"
FT                   /translation="MKLIILEHYSQASEWAAKYIRNRIIQFNPGPDKYFTLGLPTGSTP
FT                   LGCYQKLIEYYKNGDLSFQYVKTFNMDEYVGLPRDHPESYHSFMWNNFFKHIDIHPENT
FT                   HILDGNAADLQAECDAFEEKIQAAGGIELFVGGKHGTFHGVYPGPCLE"
FT   assembly_gap    1052892..1052922
FT                   /estimated_length=31
FT                   /gap_type="unknown"
FT   assembly_gap    1064632..1064741
FT                   /estimated_length=110
FT                   /gap_type="unknown"
FT   gene            complement(1070175..1071478)
FT                   /pseudo
FT                   /locus_tag="mCG_50627"
FT                   /note="gene_id=mCG50627.2"
FT   mRNA            complement(1070175..1071478)
FT                   /pseudo
FT                   /locus_tag="mCG_50627"
FT                   /note="gene_id=mCG50627.2 transcript_id=mCT50810.2 created
FT                   on 16-OCT-2002"
FT   assembly_gap    1071479..1071498
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1076228..1076247
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1081594..1081666
FT                   /estimated_length=73
FT                   /gap_type="unknown"
FT   assembly_gap    1128078..1128332
FT                   /estimated_length=255
FT                   /gap_type="unknown"
FT   gene            <1128333..1174473
FT                   /locus_tag="mCG_18343"
FT                   /note="gene_id=mCG18343.2"
FT   mRNA            join(<1128333..1128445,1152186..1152273,1156960..1157090,
FT                   1160824..1160911,1161574..1161698,1165324..1165390,
FT                   1169814..1169919,1173531..1174109)
FT                   /locus_tag="mCG_18343"
FT                   /product="mCG18343, transcript variant mCT190283"
FT                   /note="gene_id=mCG18343.2 transcript_id=mCT190283.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(<1128333..1128445,1152186..1152215,1173634..1173954)
FT                   /locus_tag="mCG_18343"
FT                   /product="mCG18343, transcript variant mCT174401"
FT                   /note="gene_id=mCG18343.2 transcript_id=mCT174401.0 created
FT                   on 10-FEB-2003"
FT   CDS             join(<1128333..1128445,1152186..1152215,1173634..1173652)
FT                   /codon_start=1
FT                   /locus_tag="mCG_18343"
FT                   /product="mCG18343, isoform CRA_b"
FT                   /note="gene_id=mCG18343.2 transcript_id=mCT174401.0
FT                   protein_id=mCP97320.0 isoform=CRA_b"
FT                   /protein_id="EDL10074.1"
FT                   /translation="RPISSLARPPSLRPAAPWPWRWRRWRPWSRPAAAGTSSCRMKRSL
FT                   GNLNSHLL"
FT   mRNA            join(<1128333..1128445,1152186..1152273,1156960..1157090,
FT                   1160824..1160911,1165324..1165399)
FT                   /locus_tag="mCG_18343"
FT                   /product="mCG18343, transcript variant mCT179955"
FT                   /note="gene_id=mCG18343.2 transcript_id=mCT179955.0 created
FT                   on 10-FEB-2003"
FT   mRNA            join(<1128334..1128445,1152186..1152273,1156960..1157090,
FT                   1160824..1160911,1161574..1161698,1165324..1165390,
FT                   1169814..1169919,1173547..1174473)
FT                   /locus_tag="mCG_18343"
FT                   /product="mCG18343, transcript variant mCT12974"
FT                   /note="gene_id=mCG18343.2 transcript_id=mCT12974.2 created
FT                   on 10-FEB-2003"
FT   CDS             join(<1128335..1128445,1152186..1152273,1156960..1157090,
FT                   1160824..1160911,1161574..1161698,1165324..1165390,
FT                   1169814..1169917)
FT                   /codon_start=1
FT                   /locus_tag="mCG_18343"
FT                   /product="mCG18343, isoform CRA_a"
FT                   /note="gene_id=mCG18343.2 transcript_id=mCT12974.2
FT                   protein_id=mCP8384.2 isoform=CRA_a"
FT                   /protein_id="EDL10073.1"
FT                   /translation="PDQLSRSPSFPEARCAMALALAALAAVEPACGSGYQQLQNEEEPG
FT                   EPEQTAGDAPPPYSSITAESAAYFDYKDESGFPKPPSYNVATTLPSYDEAERTKTEATI
FT                   PLVPGRDEDFVGRDDFDDTDQLRIGNDGIFMLTFFMAFLFNWIGFFLSFCLTTSAAGRY
FT                   GAISGFGLSLIKWILIVRFSTYFPGYFDGQYWLWWVFLVLGFLLFLRGFINYAKVRKMP
FT                   ETFSNLPRTRVLFIY"
FT   CDS             join(<1128335..1128445,1152186..1152273,1156960..1157090,
FT                   1160824..1160911,1161574..1161698,1165324..1165390,
FT                   1169814..1169917)
FT                   /codon_start=1
FT                   /locus_tag="mCG_18343"
FT                   /product="mCG18343, isoform CRA_a"
FT                   /note="gene_id=mCG18343.2 transcript_id=mCT190283.0
FT                   protein_id=mCP111280.0 isoform=CRA_a"
FT                   /protein_id="EDL10076.1"
FT                   /translation="PDQLSRSPSFPEARCAMALALAALAAVEPACGSGYQQLQNEEEPG
FT                   EPEQTAGDAPPPYSSITAESAAYFDYKDESGFPKPPSYNVATTLPSYDEAERTKTEATI
FT                   PLVPGRDEDFVGRDDFDDTDQLRIGNDGIFMLTFFMAFLFNWIGFFLSFCLTTSAAGRY
FT                   GAISGFGLSLIKWILIVRFSTYFPGYFDGQYWLWWVFLVLGFLLFLRGFINYAKVRKMP
FT                   ETFSNLPRTRVLFIY"
FT   CDS             join(<1128335..1128445,1152186..1152273,1156960..1157090,
FT                   1160824..1160911,1165324..1165352)
FT                   /codon_start=1
FT                   /locus_tag="mCG_18343"
FT                   /product="mCG18343, isoform CRA_d"
FT                   /note="gene_id=mCG18343.2 transcript_id=mCT179955.0
FT                   protein_id=mCP102877.0 isoform=CRA_d"
FT                   /protein_id="EDL10077.1"
FT                   /translation="PDQLSRSPSFPEARCAMALALAALAAVEPACGSGYQQLQNEEEPG
FT                   EPEQTAGDAPPPYSSITAESAAYFDYKDESGFPKPPSYNVATTLPSYDEAERTKTEATI
FT                   PLVPGRDEDFVGRDDFDDTDQLRIGNDGIFMLTFFIFHLFPWIL"
FT   mRNA            join(<1132361..1132377,1161609..1161698,1165324..1165390,
FT                   1169814..1169919,1173547..1174024)
FT                   /locus_tag="mCG_18343"
FT                   /product="mCG18343, transcript variant mCT174402"
FT                   /note="gene_id=mCG18343.2 transcript_id=mCT174402.0 created
FT                   on 10-FEB-2003"
FT   CDS             join(<1132366..1132377,1161609..1161698,1165324..1165390,
FT                   1169814..1169917)
FT                   /codon_start=1
FT                   /locus_tag="mCG_18343"
FT                   /product="mCG18343, isoform CRA_c"
FT                   /note="gene_id=mCG18343.2 transcript_id=mCT174402.0
FT                   protein_id=mCP97321.0 isoform=CRA_c"
FT                   /protein_id="EDL10075.1"
FT                   /translation="AFFFSFCLTTSAAGRYGAISGFGLSLIKWILIVRFSTYFPGYFDG
FT                   QYWLWWVFLVLGFLLFLRGFINYAKVRKMPETFSNLPRTRVLFIY"
FT   assembly_gap    1182543..1182710
FT                   /estimated_length=168
FT                   /gap_type="unknown"
FT   assembly_gap    1199128..1199443
FT                   /estimated_length=316
FT                   /gap_type="unknown"
FT   assembly_gap    1202686..1202705
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1270104..1270438
FT                   /estimated_length=335
FT                   /gap_type="unknown"
FT   assembly_gap    1272773..1272792
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1291707..1291751
FT                   /estimated_length=45
FT                   /gap_type="unknown"
FT   gene            complement(1295766..1310894)
FT                   /gene="Spry4"
FT                   /locus_tag="mCG_18339"
FT                   /note="gene_id=mCG18339.2"
FT   mRNA            complement(join(1295766..1300241,1310645..1310894))
FT                   /gene="Spry4"
FT                   /locus_tag="mCG_18339"
FT                   /product="sprouty homolog 4 (Drosophila)"
FT                   /note="gene_id=mCG18339.2 transcript_id=mCT12417.1 created
FT                   on 14-OCT-2002"
FT   CDS             complement(1299292..1300194)
FT                   /codon_start=1
FT                   /gene="Spry4"
FT                   /locus_tag="mCG_18339"
FT                   /product="sprouty homolog 4 (Drosophila)"
FT                   /note="gene_id=mCG18339.2 transcript_id=mCT12417.1
FT                   protein_id=mCP8353.1"
FT                   /db_xref="GOA:Q9WTP2"
FT                   /db_xref="InterPro:IPR007875"
FT                   /db_xref="MGI:MGI:1345144"
FT                   /protein_id="EDL10072.1"
FT                   /translation="MEPPVPQSSVPVNPSSVMVQPLLDSRAPHSRLQHPLTILPIDQMK
FT                   TSHVENDYIDNPSLAPATGPKRPRGGPPELAPTPARCDQDITHHWISFSGRPSSVSSSS
FT                   STSSDQRLLDHMAPPPVAEQASPRAVRLQPKVVHCKPLDLKGPTAPPELDKHFLLCEAC
FT                   GKCKCKECASPRTLPSCWVCNQECLCSAQTLVNYGTCMCLVQGIFYHCTNEDDEGSCAD
FT                   HPCSCSGSNCCARWSFMGALSVVLPCLLCYLPATGCVKLAQRGYDRLRRPGCRCKHTNS
FT                   VICKAASGDTKTSRSDKPF"
FT   assembly_gap    1315914..1315951
FT                   /estimated_length=38
FT                   /gap_type="unknown"
FT   assembly_gap    1319099..1319118
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1321864..1321883
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1330430..1330449
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1353906..1354202
FT                   /estimated_length=297
FT                   /gap_type="unknown"
FT   assembly_gap    1371472..1371491
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1373899..1374245
FT                   /estimated_length=347
FT                   /gap_type="unknown"
FT   assembly_gap    1375487..1375506
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1378679..1378698
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1393459..1393541
FT                   /estimated_length=83
FT                   /gap_type="unknown"
FT   assembly_gap    1401684..1401703
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1415590..1415936
FT                   /estimated_length=347
FT                   /gap_type="unknown"
FT   gene            1428977..1509803
FT                   /pseudo
FT                   /locus_tag="mCG_49017"
FT                   /note="gene_id=mCG49017.2"
FT   mRNA            join(1428977..1429416,1509770..1509803)
FT                   /pseudo
FT                   /locus_tag="mCG_49017"
FT                   /note="gene_id=mCG49017.2 transcript_id=mCT49200.1 created
FT                   on 10-MAR-2003"
FT   assembly_gap    1435416..1435616
FT                   /estimated_length=201
FT                   /gap_type="unknown"
FT   assembly_gap    1438646..1438895
FT                   /estimated_length=250
FT                   /gap_type="unknown"
FT   assembly_gap    1472597..1472616
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1478946..1479048
FT                   /estimated_length=103
FT                   /gap_type="unknown"
FT   assembly_gap    1487538..1487597
FT                   /estimated_length=60
FT                   /gap_type="unknown"
FT   assembly_gap    1488355..1488623
FT                   /estimated_length=269
FT                   /gap_type="unknown"
FT   assembly_gap    1510152..1510256
FT                   /estimated_length=105
FT                   /gap_type="unknown"
FT   assembly_gap    1513234..1513310
FT                   /estimated_length=77
FT                   /gap_type="unknown"
FT   assembly_gap    1522364..1522458
FT                   /estimated_length=95
FT                   /gap_type="unknown"
FT   assembly_gap    1529427..1529577
FT                   /estimated_length=151
FT                   /gap_type="unknown"
FT   assembly_gap    1552516..1552535
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1554220..1643466)
FT                   /gene="Fgf1"
FT                   /locus_tag="mCG_18337"
FT                   /note="gene_id=mCG18337.3"
FT   mRNA            complement(join(1554220..1557195,1562121..1562224,
FT                   1569195..1569284,1572787..1572989,1643325..1643466))
FT                   /gene="Fgf1"
FT                   /locus_tag="mCG_18337"
FT                   /product="fibroblast growth factor 1, transcript variant
FT                   mCT181042"
FT                   /note="gene_id=mCG18337.3 transcript_id=mCT181042.1 created
FT                   on 13-JUN-2003"
FT   mRNA            complement(join(1554220..1557195,1562121..1562224,
FT                   1572787..1572989,1632623..1632773,1643165..1643412))
FT                   /gene="Fgf1"
FT                   /locus_tag="mCG_18337"
FT                   /product="fibroblast growth factor 1, transcript variant
FT                   mCT174393"
FT                   /note="gene_id=mCG18337.3 transcript_id=mCT174393.1 created
FT                   on 13-JUN-2003"
FT   mRNA            complement(join(1554220..1557195,1562121..1562224,
FT                   1572787..1572989,1632623..1632849))
FT                   /gene="Fgf1"
FT                   /locus_tag="mCG_18337"
FT                   /product="fibroblast growth factor 1, transcript variant
FT                   mCT12973"
FT                   /note="gene_id=mCG18337.3 transcript_id=mCT12973.3 created
FT                   on 13-JUN-2003"
FT   mRNA            complement(join(1554220..1554546,1554582..1557195,
FT                   1562121..1562224,1572787..1572989,1632623..>1632776))
FT                   /gene="Fgf1"
FT                   /locus_tag="mCG_18337"
FT                   /product="fibroblast growth factor 1, transcript variant
FT                   mCT190265"
FT                   /note="gene_id=mCG18337.3 transcript_id=mCT190265.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(1554220..1557195,1562121..1562224,
FT                   1572787..1572989,1580932..1581063))
FT                   /gene="Fgf1"
FT                   /locus_tag="mCG_18337"
FT                   /product="fibroblast growth factor 1, transcript variant
FT                   mCT181041"
FT                   /note="gene_id=mCG18337.3 transcript_id=mCT181041.1 created
FT                   on 13-JUN-2003"
FT   mRNA            complement(join(1554220..1557195,1562121..1562224,
FT                   1572787..1572989,1580648..1580799))
FT                   /gene="Fgf1"
FT                   /locus_tag="mCG_18337"
FT                   /product="fibroblast growth factor 1, transcript variant
FT                   mCT174394"
FT                   /note="gene_id=mCG18337.3 transcript_id=mCT174394.1 created
FT                   on 13-JUN-2003"
FT   assembly_gap    1554551..1554570
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             complement(join(1557001..1557195,1562121..1562224,
FT                   1572787..1572989,1632623..>1632756))
FT                   /codon_start=1
FT                   /gene="Fgf1"
FT                   /locus_tag="mCG_18337"
FT                   /product="fibroblast growth factor 1, isoform CRA_c"
FT                   /note="gene_id=mCG18337.3 transcript_id=mCT190265.0
FT                   protein_id=mCP111278.0 isoform=CRA_c"
FT                   /protein_id="EDL10070.1"
FT                   /translation="GSESRLERQLQPRHPVTAQRLPSGLHSRLVIKWSEESPPACQFFS
FT                   AEPTTAACCRAMAEGEITTFAALTERFNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDG
FT                   TRDRSDQHIQLQLSAESAGEVYIKGTETGQYLAMDTEGLLYGSQTPNEECLFLERLEEN
FT                   HYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD"
FT   CDS             complement(join(1557001..1557195,1562121..1562224,
FT                   1572787..1572955))
FT                   /codon_start=1
FT                   /gene="Fgf1"
FT                   /locus_tag="mCG_18337"
FT                   /product="fibroblast growth factor 1, isoform CRA_a"
FT                   /note="gene_id=mCG18337.3 transcript_id=mCT12973.3
FT                   protein_id=mCP8351.3 isoform=CRA_a partial"
FT                   /db_xref="GOA:Q6ZWS1"
FT                   /db_xref="InterPro:IPR002209"
FT                   /db_xref="InterPro:IPR008996"
FT                   /db_xref="InterPro:IPR028142"
FT                   /db_xref="InterPro:IPR028210"
FT                   /db_xref="MGI:MGI:95515"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ZWS1"
FT                   /protein_id="EDL10065.1"
FT                   /translation="MAEGEITTFAALTERFNLPLGNYKKPKLLYCSNGGHFLRILPDGT
FT                   VDGTRDRSDQHIQLQLSAESAGEVYIKGTETGQYLAMDTEGLLYGSQTPNEECLFLERL
FT                   EENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD"
FT   CDS             complement(join(1557001..1557195,1562121..1562224,
FT                   1572787..1572955))
FT                   /codon_start=1
FT                   /gene="Fgf1"
FT                   /locus_tag="mCG_18337"
FT                   /product="fibroblast growth factor 1, isoform CRA_a"
FT                   /note="gene_id=mCG18337.3 transcript_id=mCT174393.1
FT                   protein_id=mCP97313.1 isoform=CRA_a partial"
FT                   /db_xref="GOA:Q6ZWS1"
FT                   /db_xref="InterPro:IPR002209"
FT                   /db_xref="InterPro:IPR008996"
FT                   /db_xref="InterPro:IPR028142"
FT                   /db_xref="InterPro:IPR028210"
FT                   /db_xref="MGI:MGI:95515"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ZWS1"
FT                   /protein_id="EDL10066.1"
FT                   /translation="MAEGEITTFAALTERFNLPLGNYKKPKLLYCSNGGHFLRILPDGT
FT                   VDGTRDRSDQHIQLQLSAESAGEVYIKGTETGQYLAMDTEGLLYGSQTPNEECLFLERL
FT                   EENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD"
FT   CDS             complement(join(1557001..1557195,1562121..1562224,
FT                   1572787..1572955))
FT                   /codon_start=1
FT                   /gene="Fgf1"
FT                   /locus_tag="mCG_18337"
FT                   /product="fibroblast growth factor 1, isoform CRA_a"
FT                   /note="gene_id=mCG18337.3 transcript_id=mCT174394.1
FT                   protein_id=mCP97312.1 isoform=CRA_a partial"
FT                   /db_xref="GOA:Q6ZWS1"
FT                   /db_xref="InterPro:IPR002209"
FT                   /db_xref="InterPro:IPR008996"
FT                   /db_xref="InterPro:IPR028142"
FT                   /db_xref="InterPro:IPR028210"
FT                   /db_xref="MGI:MGI:95515"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ZWS1"
FT                   /protein_id="EDL10067.1"
FT                   /translation="MAEGEITTFAALTERFNLPLGNYKKPKLLYCSNGGHFLRILPDGT
FT                   VDGTRDRSDQHIQLQLSAESAGEVYIKGTETGQYLAMDTEGLLYGSQTPNEECLFLERL
FT                   EENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD"
FT   CDS             complement(join(1557001..1557195,1562121..1562224,
FT                   1572787..1572955))
FT                   /codon_start=1
FT                   /gene="Fgf1"
FT                   /locus_tag="mCG_18337"
FT                   /product="fibroblast growth factor 1, isoform CRA_a"
FT                   /note="gene_id=mCG18337.3 transcript_id=mCT181041.1
FT                   protein_id=mCP103965.1 isoform=CRA_a partial"
FT                   /db_xref="GOA:Q6ZWS1"
FT                   /db_xref="InterPro:IPR002209"
FT                   /db_xref="InterPro:IPR008996"
FT                   /db_xref="InterPro:IPR028142"
FT                   /db_xref="InterPro:IPR028210"
FT                   /db_xref="MGI:MGI:95515"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ZWS1"
FT                   /protein_id="EDL10068.1"
FT                   /translation="MAEGEITTFAALTERFNLPLGNYKKPKLLYCSNGGHFLRILPDGT
FT                   VDGTRDRSDQHIQLQLSAESAGEVYIKGTETGQYLAMDTEGLLYGSQTPNEECLFLERL
FT                   EENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD"
FT   mRNA            complement(join(1562121..1562219,1572780..1572989,
FT                   1643165..1643412))
FT                   /gene="Fgf1"
FT                   /locus_tag="mCG_18337"
FT                   /product="fibroblast growth factor 1, transcript variant
FT                   mCT181043"
FT                   /note="gene_id=mCG18337.3 transcript_id=mCT181043.1 created
FT                   on 13-JUN-2003"
FT   CDS             complement(join(1562180..1562219,1572780..1572955))
FT                   /codon_start=1
FT                   /gene="Fgf1"
FT                   /locus_tag="mCG_18337"
FT                   /product="fibroblast growth factor 1, isoform CRA_b"
FT                   /note="gene_id=mCG18337.3 transcript_id=mCT181043.1
FT                   protein_id=mCP103964.1 isoform=CRA_b"
FT                   /protein_id="EDL10069.1"
FT                   /translation="MAEGEITTFAALTERFNLPLGNYKKPKLLYCSNGGHFLRILPDGT
FT                   VDGTRDRSDQHSKHCSSVRKVRAKCI"
FT   assembly_gap    1568437..1568456
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             complement(join(1569217..1569284,1572787..1572955))
FT                   /codon_start=1
FT                   /gene="Fgf1"
FT                   /locus_tag="mCG_18337"
FT                   /product="fibroblast growth factor 1, isoform CRA_d"
FT                   /note="gene_id=mCG18337.3 transcript_id=mCT181042.1
FT                   protein_id=mCP103963.1 isoform=CRA_d"
FT                   /db_xref="GOA:D6RCX9"
FT                   /db_xref="InterPro:IPR002209"
FT                   /db_xref="InterPro:IPR008996"
FT                   /db_xref="InterPro:IPR028210"
FT                   /db_xref="MGI:MGI:95515"
FT                   /db_xref="UniProtKB/TrEMBL:D6RCX9"
FT                   /protein_id="EDL10071.1"
FT                   /translation="MAEGEITTFAALTERFNLPLGNYKKPKLLYCSNGGHFLRILPDGT
FT                   VDGTRDRSDQHRPPEYKDSGSLCSALQLLCPAY"
FT   assembly_gap    1579351..1579392
FT                   /estimated_length=42
FT                   /gap_type="unknown"
FT   assembly_gap    1608107..1608191
FT                   /estimated_length=85
FT                   /gap_type="unknown"
FT   assembly_gap    1617707..1617826
FT                   /estimated_length=120
FT                   /gap_type="unknown"
FT   assembly_gap    1658841..1659420
FT                   /estimated_length=580
FT                   /gap_type="unknown"
FT   assembly_gap    1662339..1662445
FT                   /estimated_length=107
FT                   /gap_type="unknown"
FT   gene            complement(1665854..1666459)
FT                   /locus_tag="mCG_13633"
FT                   /note="gene_id=mCG13633.0"
FT   mRNA            complement(1665854..1666459)
FT                   /locus_tag="mCG_13633"
FT                   /product="mCG13633"
FT                   /note="gene_id=mCG13633.0 transcript_id=mCT16038.0 created
FT                   on 14-OCT-2002"
FT   CDS             complement(1666083..1666391)
FT                   /codon_start=1
FT                   /locus_tag="mCG_13633"
FT                   /product="mCG13633"
FT                   /note="gene_id=mCG13633.0 transcript_id=mCT16038.0
FT                   protein_id=mCP12698.1"
FT                   /protein_id="EDL10064.1"
FT                   /translation="MGSKMASATRVVQVVKPHAPLIKFPSRRDKPKLSASEALGSAVLP
FT                   SHSSAISQHSKGSTSPDLLMHQGPPDTAEIIKSLPQKYRRKPMSQEEMEFIQRGGPE"
FT   assembly_gap    1669460..1669479
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1676537..1676556
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1694339..1694358
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            1709706..2087271
FT                   /gene="Arhgap26"
FT                   /locus_tag="mCG_13636"
FT                   /note="gene_id=mCG13636.2"
FT   mRNA            join(1709706..1710184,1814211..1814306,1816153..1816214,
FT                   1818751..1818822,1827012..1827113,1828358..1828468,
FT                   1836736..1836840,1838391..1838520,1843441..1843541,
FT                   1848657..1848751,1866650..1866728,1922003..1922039,
FT                   1944064..1944129,1946591..1946665,1960240..1960327,
FT                   1961923..1961981,1963459..1963564,2003530..2003689,
FT                   2013806..2013944,2023727..2023877,2077768..2077878,
FT                   2078014..2078043,2083322..2083413,2087082..2087271)
FT                   /gene="Arhgap26"
FT                   /locus_tag="mCG_13636"
FT                   /product="Rho GTPase activating protein 26"
FT                   /note="gene_id=mCG13636.2 transcript_id=mCT16287.2 created
FT                   on 14-OCT-2002"
FT   CDS             join(1710031..1710184,1814211..1814306,1816153..1816214,
FT                   1818751..1818822,1827012..1827113,1828358..1828468,
FT                   1836736..1836840,1838391..1838520,1843441..1843541,
FT                   1848657..1848751,1866650..1866728,1922003..1922039,
FT                   1944064..1944129,1946591..1946665,1960240..1960327,
FT                   1961923..1961981,1963459..1963564,2003530..2003689,
FT                   2013806..2013944,2023727..2023877,2077768..2077878,
FT                   2078014..2078043,2083322..2083413,2087082..2087146)
FT                   /codon_start=1
FT                   /gene="Arhgap26"
FT                   /locus_tag="mCG_13636"
FT                   /product="Rho GTPase activating protein 26"
FT                   /note="gene_id=mCG13636.2 transcript_id=mCT16287.2
FT                   protein_id=mCP12701.1"
FT                   /protein_id="EDL10063.1"
FT                   /translation="MGLPALEFSDCCLDSPHFRETLKSHEAELDKTNKFIKELIKDGKS
FT                   LISALKNLSSAKRKFADSLNEFKFQCIGDAETDDEMCIARSLQEFAAVLRNLEDERSRM
FT                   IENASEVLITPLEKFRKEQIGAAREAKKKYDKETEKYCGTLEKHLNLSSKKKESQLQEA
FT                   DSQVDLVRQHFYEVSLEYVFKVQEVQERKMFEFVEPLLAFLQGLFTFYHHGYELAKDFG
FT                   DFKTQLTISIQNTRNRFEGTRSEVESLMKKMKENPLEHKTISPYTMEGYLYVQEKRHFG
FT                   TSWVKHYCTYQRDSKQITMVPFDQKSGGKGGEDESVTLKSCTRRKTDSIEKRFCFDVEA
FT                   VDRPGVITMQALSEEDRRLWMEAMDGREPVYNSNRDSQSEGTAQLDSIGFSIIRKCIHA
FT                   VETRGINEQGLYRIVGVNSRVQKLLSVLMDPKAASETETDICAEWEIKTVTSALKTYLR
FT                   MLPGPLMMYQFQRSFIKAAKLENQETRVSEIHSLVHRLPEKNRQMLQLLMNHLANVANN
FT                   HKQNLMTVANLGVVFGPTLLRPQEETVAAIMDIKFQNIVIEILIENHEKIFNTVPDVPL
FT                   TNAQLHLSRKKSSDSKPPSCSERPLTLFHAVPSTEKQEQRNSIINSSLESVSSSANSIL
FT                   NSSSSLQPNLNSSDSNLDVVKPSRPSSLPPNPSPTSPLSPSWPMFSAPSSPMPTSSTSS
FT                   DSSPIRPEEAVREDSSTPFRKAKALYACQAEHDSELSFTAGTVFDNDSMGDPVSRNKVE
FT                   SDQGRHQY"
FT   assembly_gap    1749780..1749799
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1834320..1834339
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1891659..1892286
FT                   /estimated_length=628
FT                   /gap_type="unknown"
FT   assembly_gap    1953219..1953238
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1957507..1957526
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1975116..1975135
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2038940..2041805
FT                   /estimated_length=2866
FT                   /gap_type="unknown"
FT   assembly_gap    2107341..2115792
FT                   /estimated_length=8452
FT                   /gap_type="unknown"
FT   gene            complement(2128294..2208330)
FT                   /gene="Nr3c1"
FT                   /locus_tag="mCG_13634"
FT                   /note="gene_id=mCG13634.2"
FT   mRNA            complement(join(2128294..2132367,2133429..2133586,
FT                   2138302..2138432,2139133..2139277,2140214..2140489,
FT                   2142109..2142225,2146326..2146489,2203679..2204899,
FT                   2208222..2208330))
FT                   /gene="Nr3c1"
FT                   /locus_tag="mCG_13634"
FT                   /product="nuclear receptor subfamily 3, group C, member 1,
FT                   transcript variant mCT16039"
FT                   /note="gene_id=mCG13634.2 transcript_id=mCT16039.1 created
FT                   on 14-OCT-2002"
FT   CDS             complement(join(2132215..2132367,2133429..2133586,
FT                   2138302..2138432,2139133..2139277,2140214..2140489,
FT                   2142109..2142225,2146326..2146489,2203679..2204886))
FT                   /codon_start=1
FT                   /gene="Nr3c1"
FT                   /locus_tag="mCG_13634"
FT                   /product="nuclear receptor subfamily 3, group C, member 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG13634.2 transcript_id=mCT16039.1
FT                   protein_id=mCP12699.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q3U2M7"
FT                   /db_xref="InterPro:IPR000536"
FT                   /db_xref="InterPro:IPR001409"
FT                   /db_xref="InterPro:IPR001628"
FT                   /db_xref="InterPro:IPR001723"
FT                   /db_xref="InterPro:IPR008946"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="MGI:MGI:95824"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U2M7"
FT                   /protein_id="EDL10061.1"
FT                   /translation="MDSKESLAPPGRDEVPSSLLGRGRGSVMDLYKTLRGGATVKVSAS
FT                   SPSVAAASQADSKQQRILLDFSKGSASNAQQQQQQQQPQPDLSKAVSLSMGLYMGETET
FT                   KVMGNDLGYPQQGQLGLSSGETDFRLLEESIANLNRSTSRPENPKSSTPAAGCATPTEK
FT                   EFPQTHSDPSSEQQNRKSQPGTNGGSVKLYTTDQSTFDILQDLEFSAGSPGKETNESPW
FT                   RSDLLIDENLLSPLAGEDDPFLLEGDVNEDCKPLILPDTKPKIQDTGDTILSSPSSVAL
FT                   PQVKTEKDDFIELCTPGVIKQEKLGPVYCQASFSGTNIIGNKMSAISVHGVSTSGGQMY
FT                   HYDMNTASLSQQQDQKPVFNVIPPIPVGSENWNRCQGSGEDNLTSLGAMNFAGRSVFSN
FT                   GYSSPGMRPDVSSPPSSSSTATGPPPKLCLVCSDEASGCHYGVLTCGSCKVFFKRAVEG
FT                   QHNYLCAGRNDCIIDKIRRKNCPACRYRKCLQAGMNLEARKTKKKIKGIQQATAGVSQD
FT                   TSENANKTIVPAALPQLTPTLVSLLEVIEPEVLYAGYDSSVPDSAWRIMTTLNMLGGRQ
FT                   VIAAVKWAKAIPGFRNLHLDDQMTLLQYSWMFLMAFALGWRSYRQASGNLLCFAPDLII
FT                   NEQRMTLPCMYDQCKHMLFISTELQRLQVSYEEYLCMKTLLLLSSVPKEGLKSQELFDE
FT                   IRMTYIKELGKAIVKREGNSSQNWQRFYQLTKLLDSMHDVVENLLSYCFQTFLDKSMSI
FT                   EFPEMLAEIITNQIPKYSNGNIKKLLFHQK"
FT   mRNA            complement(join(<2132302..2132367,2133429..2133586,
FT                   2138302..2138432,2139133..2139277,2140214..2140489,
FT                   2142109..2142225,2146323..2146489,2203679..>2204886))
FT                   /gene="Nr3c1"
FT                   /locus_tag="mCG_13634"
FT                   /product="nuclear receptor subfamily 3, group C, member 1,
FT                   transcript variant mCT190276"
FT                   /note="gene_id=mCG13634.2 transcript_id=mCT190276.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(<2132302..2132367,2133429..2133586,
FT                   2138302..2138432,2139133..2139277,2140214..2140489,
FT                   2142109..2142225,2146323..2146489,2203679..2204886))
FT                   /codon_start=1
FT                   /gene="Nr3c1"
FT                   /locus_tag="mCG_13634"
FT                   /product="nuclear receptor subfamily 3, group C, member 1,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG13634.2 transcript_id=mCT190276.0
FT                   protein_id=mCP111266.0 isoform=CRA_b"
FT                   /protein_id="EDL10062.1"
FT                   /translation="MDSKESLAPPGRDEVPSSLLGRGRGSVMDLYKTLRGGATVKVSAS
FT                   SPSVAAASQADSKQQRILLDFSKGSASNAQQQQQQQQPQPDLSKAVSLSMGLYMGETET
FT                   KVMGNDLGYPQQGQLGLSSGETDFRLLEESIANLNRSTSRPENPKSSTPAAGCATPTEK
FT                   EFPQTHSDPSSEQQNRKSQPGTNGGSVKLYTTDQSTFDILQDLEFSAGSPGKETNESPW
FT                   RSDLLIDENLLSPLAGEDDPFLLEGDVNEDCKPLILPDTKPKIQDTGDTILSSPSSVAL
FT                   PQVKTEKDDFIELCTPGVIKQEKLGPVYCQASFSGTNIIGNKMSAISVHGVSTSGGQMY
FT                   HYDMNTASLSQQQDQKPVFNVIPPIPVGSENWNRCQGSGEDNLTSLGAMNFAGRSVFSN
FT                   GYSSPGMRPDVSSPPSSSSTATGPPPKLCLVCSDEASGCHYGVLTCGSCKVFFKRAVEG
FT                   RQHNYLCAGRNDCIIDKIRRKNCPACRYRKCLQAGMNLEARKTKKKIKGIQQATAGVSQ
FT                   DTSENANKTIVPAALPQLTPTLVSLLEVIEPEVLYAGYDSSVPDSAWRIMTTLNMLGGR
FT                   QVIAAVKWAKAIPGFRNLHLDDQMTLLQYSWMFLMAFALGWRSYRQASGNLLCFAPDLI
FT                   INEQRMTLPCMYDQCKHMLFISTELQRLQVSYEEYLCMKTLLLLSSVPKEGLKSQELFD
FT                   EIRMTYIKELGKAIVKREGNSSQNWQRFYQLTKLLDSMHDVVENLLSYCFQTFLDKSMS
FT                   IEF"
FT   assembly_gap    2208357..2208376
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2236376..2236395
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2237769..2237788
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2246568..2246703
FT                   /estimated_length=136
FT                   /gap_type="unknown"
FT   assembly_gap    2267770..2267832
FT                   /estimated_length=63
FT                   /gap_type="unknown"
FT   assembly_gap    2297277..2297296
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2300632..2300651
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2301777..2301796
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2305226..2305245
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2320666..2321412
FT                   /estimated_length=747
FT                   /gap_type="unknown"
FT   assembly_gap    2333389..2333519
FT                   /estimated_length=131
FT                   /gap_type="unknown"
FT   assembly_gap    2337881..2337900
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2349383..2349402
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2439806..2440735
FT                   /estimated_length=930
FT                   /gap_type="unknown"
FT   assembly_gap    2472031..2472050
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2480733..2481031
FT                   /estimated_length=299
FT                   /gap_type="unknown"
FT   gene            2492275..2494412
FT                   /gene="Pabpc2"
FT                   /locus_tag="mCG_13635"
FT                   /note="gene_id=mCG13635.0"
FT   mRNA            2492275..2494412
FT                   /gene="Pabpc2"
FT                   /locus_tag="mCG_13635"
FT                   /product="poly A binding protein, cytoplasmic 2"
FT                   /note="gene_id=mCG13635.0 transcript_id=mCT16040.0 created
FT                   on 14-OCT-2002"
FT   CDS             2492441..2494327
FT                   /codon_start=1
FT                   /gene="Pabpc2"
FT                   /locus_tag="mCG_13635"
FT                   /product="poly A binding protein, cytoplasmic 2"
FT                   /note="gene_id=mCG13635.0 transcript_id=mCT16040.0
FT                   protein_id=mCP12700.1"
FT                   /db_xref="GOA:Q62029"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR002004"
FT                   /db_xref="InterPro:IPR006515"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="MGI:MGI:1349723"
FT                   /db_xref="UniProtKB/TrEMBL:Q62029"
FT                   /protein_id="EDL10060.1"
FT                   /translation="MNSSDPGCPMASLYVGDLHPDVTEAMLYEKFSSAGPILSIRVYRD
FT                   VITRRSLGYASVNFEQPADAERALDTMNFDVIKGKPVRIMWSQRDPSLRRSGVGNVFIK
FT                   NLNKTIDNKALYDTFSAFGNILSCKVVSDENGSKGHGFVHFETEEAAERAIEKMNGMLL
FT                   NDRKVFVGRFKSQKEREAELGTGTKEFTNVYIKNFGDRMDDETLNGLFGRFGQILSVKV
FT                   MTDEGGKSKGFGFVSFERHEDAQKAVDEMNGKELNGKHIYVGRAQKKDDRHTELKHKFE
FT                   QVTQDKSIRYQGINLYVKNLDDGIDDERLQKEFSPFGTITSTKVMTEGGRSKGFGFVCF
FT                   SSPEEATKAVSEMNGRIVATKPLYVALAQRKEERQAHLTNQYIQRMASVRSGPNPVNPY
FT                   QPASSSYSVAAVPQTQNCVPCCPSQIAQPRPSARWIAQGSRPHPFPNVPGAIHPAAPRS
FT                   SLTTVRPSSSHVQVTTAHRITNTSAQITGQRPAPASSATATPVHSIPQYKYAAGVQNSQ
FT                   QHLNAQLAQQPAVCIQGQEPWTASMLVTAPQEPKQMLGERLFPLIQAMHPTLAGKITGM
FT                   LLDIDNSEPLRMLESPVSRCSRAEEAVATLQAHQVKEAAQKAVGSTSGVPTV"
FT   assembly_gap    2583631..2583714
FT                   /estimated_length=84
FT                   /gap_type="unknown"
FT   assembly_gap    2587229..2587248
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2588929..2588948
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2604482..2604501
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2622715..2622734
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2631603..2631656
FT                   /estimated_length=54
FT                   /gap_type="unknown"
FT   assembly_gap    2646594..2646613
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2653325..2653788
FT                   /estimated_length=464
FT                   /gap_type="unknown"
FT   assembly_gap    2668281..2668503
FT                   /estimated_length=223
FT                   /gap_type="unknown"
FT   assembly_gap    2670159..2670226
FT                   /estimated_length=68
FT                   /gap_type="unknown"
FT   assembly_gap    2720262..2720281
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2756121..2756140
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2765170..2765189
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2814521..2814631
FT                   /estimated_length=111
FT                   /gap_type="unknown"
FT   assembly_gap    2816500..2817683
FT                   /estimated_length=1184
FT                   /gap_type="unknown"
FT   assembly_gap    2833745..2834272
FT                   /estimated_length=528
FT                   /gap_type="unknown"
FT   assembly_gap    2837841..2837910
FT                   /estimated_length=70
FT                   /gap_type="unknown"
FT   assembly_gap    2883618..2889625
FT                   /estimated_length=6008
FT                   /gap_type="unknown"
FT   assembly_gap    2895716..2895735
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2904538..2904653
FT                   /estimated_length=116
FT                   /gap_type="unknown"
FT   gene            complement(2923492..2938915)
FT                   /gene="Yipf5"
FT                   /locus_tag="mCG_10357"
FT                   /note="gene_id=mCG10357.2"
FT   mRNA            complement(join(2923492..2925953,2927242..2927423,
FT                   2930303..2930448,2931598..2931770,2938301..2938420,
FT                   2938783..2938915))
FT                   /gene="Yipf5"
FT                   /locus_tag="mCG_10357"
FT                   /product="Yip1 domain family, member 5, transcript variant
FT                   mCT179470"
FT                   /note="gene_id=mCG10357.2 transcript_id=mCT179470.0 created
FT                   on 05-FEB-2003"
FT   mRNA            complement(join(2923492..2925955,2927242..2927423,
FT                   2930303..2930448,2931598..2931766,2938301..2938420,
FT                   2938783..2938890))
FT                   /gene="Yipf5"
FT                   /locus_tag="mCG_10357"
FT                   /product="Yip1 domain family, member 5, transcript variant
FT                   mCT174314"
FT                   /note="gene_id=mCG10357.2 transcript_id=mCT174314.0 created
FT                   on 05-FEB-2003"
FT   mRNA            complement(join(2924420..2925955,2927242..2927423,
FT                   2930303..2930448,2931598..2931770,2938301..2938420,
FT                   2938783..2938915))
FT                   /gene="Yipf5"
FT                   /locus_tag="mCG_10357"
FT                   /product="Yip1 domain family, member 5, transcript variant
FT                   mCT10371"
FT                   /note="gene_id=mCG10357.2 transcript_id=mCT10371.1 created
FT                   on 05-FEB-2003"
FT   mRNA            complement(join(2924420..2925955,2927242..2927423,
FT                   2930303..2930448,2931598..2931770,2938301..2938420,
FT                   2938788..2938900))
FT                   /gene="Yipf5"
FT                   /locus_tag="mCG_10357"
FT                   /product="Yip1 domain family, member 5, transcript variant
FT                   mCT179472"
FT                   /note="gene_id=mCG10357.2 transcript_id=mCT179472.0 created
FT                   on 05-FEB-2003"
FT   mRNA            complement(join(2924420..2925955,2927242..2927423,
FT                   2930303..2930448,2931598..2931770,2938459..2938784))
FT                   /gene="Yipf5"
FT                   /locus_tag="mCG_10357"
FT                   /product="Yip1 domain family, member 5, transcript variant
FT                   mCT179471"
FT                   /note="gene_id=mCG10357.2 transcript_id=mCT179471.0 created
FT                   on 05-FEB-2003"
FT   CDS             complement(join(2925793..2925955,2927242..2927423,
FT                   2930303..2930448,2931598..2931770,2938301..2938410))
FT                   /codon_start=1
FT                   /gene="Yipf5"
FT                   /locus_tag="mCG_10357"
FT                   /product="Yip1 domain family, member 5, isoform CRA_c"
FT                   /note="gene_id=mCG10357.2 transcript_id=mCT10371.1
FT                   protein_id=mCP12703.0 isoform=CRA_c"
FT                   /protein_id="EDL10058.1"
FT                   /translation="MSGFDNLNSGFYQTSYSIDEQSQQSYDYGGSGGPYSKQYAGCDYS
FT                   QQGRFVPPDMMQPQQTYTGQIYQPTQAYPPTTPQPFYGDSFEEEPPLLEELGINFDHIW
FT                   QKTLTVLHPLRAADGSIMNETDLAGPVVFCLAFGATLLLAGKIQFGYVYGISAIGCLGM
FT                   FCLLNLMSMTGVSFGCVASVLGYCLLPMILLSSFAVVFSLQGMVGILLTATIIGWCSFS
FT                   ASKIFISALAMDGQQLLVAYPCALLYGVFALISVF"
FT   CDS             complement(join(2925793..2925955,2927242..2927423,
FT                   2930303..2930448,2931598..2931770,2938301..2938410))
FT                   /codon_start=1
FT                   /gene="Yipf5"
FT                   /locus_tag="mCG_10357"
FT                   /product="Yip1 domain family, member 5, isoform CRA_c"
FT                   /note="gene_id=mCG10357.2 transcript_id=mCT179472.0
FT                   protein_id=mCP102393.0 isoform=CRA_c"
FT                   /protein_id="EDL10059.1"
FT                   /translation="MSGFDNLNSGFYQTSYSIDEQSQQSYDYGGSGGPYSKQYAGCDYS
FT                   QQGRFVPPDMMQPQQTYTGQIYQPTQAYPPTTPQPFYGDSFEEEPPLLEELGINFDHIW
FT                   QKTLTVLHPLRAADGSIMNETDLAGPVVFCLAFGATLLLAGKIQFGYVYGISAIGCLGM
FT                   FCLLNLMSMTGVSFGCVASVLGYCLLPMILLSSFAVVFSLQGMVGILLTATIIGWCSFS
FT                   ASKIFISALAMDGQQLLVAYPCALLYGVFALISVF"
FT   CDS             complement(join(2925793..2925955,2927242..2927423,
FT                   2930303..2930448,2931598..2931718))
FT                   /codon_start=1
FT                   /gene="Yipf5"
FT                   /locus_tag="mCG_10357"
FT                   /product="Yip1 domain family, member 5, isoform CRA_a"
FT                   /note="gene_id=mCG10357.2 transcript_id=mCT174314.0
FT                   protein_id=mCP97233.0 isoform=CRA_a"
FT                   /protein_id="EDL10055.1"
FT                   /translation="MMQPQQTYTGQIYQPTQAYPPTTPQPFYGDSFEEEPPLLEELGIN
FT                   FDHIWQKTLTVLHPLRAADGSIMNETDLAGPVVFCLAFGATLLLAGKIQFGYVYGISAI
FT                   GCLGMFCLLNLMSMTGVSFGCVASVLGYCLLPMILLSSFAVVFSLQGMVGILLTATIIG
FT                   WCSFSASKIFISALAMDGQQLLVAYPCALLYGVFALISVF"
FT   CDS             complement(join(2925793..2925955,2927242..2927423,
FT                   2930303..2930448,2931598..2931718))
FT                   /codon_start=1
FT                   /gene="Yipf5"
FT                   /locus_tag="mCG_10357"
FT                   /product="Yip1 domain family, member 5, isoform CRA_a"
FT                   /note="gene_id=mCG10357.2 transcript_id=mCT179471.0
FT                   protein_id=mCP102392.0 isoform=CRA_a"
FT                   /protein_id="EDL10057.1"
FT                   /translation="MMQPQQTYTGQIYQPTQAYPPTTPQPFYGDSFEEEPPLLEELGIN
FT                   FDHIWQKTLTVLHPLRAADGSIMNETDLAGPVVFCLAFGATLLLAGKIQFGYVYGISAI
FT                   GCLGMFCLLNLMSMTGVSFGCVASVLGYCLLPMILLSSFAVVFSLQGMVGILLTATIIG
FT                   WCSFSASKIFISALAMDGQQLLVAYPCALLYGVFALISVF"
FT   CDS             complement(join(2925908..2925953,2927242..2927423,
FT                   2930303..2930448,2931598..2931770,2938301..2938410))
FT                   /codon_start=1
FT                   /gene="Yipf5"
FT                   /locus_tag="mCG_10357"
FT                   /product="Yip1 domain family, member 5, isoform CRA_b"
FT                   /note="gene_id=mCG10357.2 transcript_id=mCT179470.0
FT                   protein_id=mCP102394.0 isoform=CRA_b"
FT                   /protein_id="EDL10056.1"
FT                   /translation="MSGFDNLNSGFYQTSYSIDEQSQQSYDYGGSGGPYSKQYAGCDYS
FT                   QQGRFVPPDMMQPQQTYTGQIYQPTQAYPPTTPQPFYGDSFEEEPPLLEELGINFDHIW
FT                   QKTLTVLHPLRAADGSIMNETDLAGPVVFCLAFGATLLLAGKIQFGYVYGISAIGCLGM
FT                   FCLLNLMSMTGVSFGCVASVLGYCLLPMILLSSFAVVFSLQNGRNSSHCHNYWMV"
FT   assembly_gap    2951673..2951848
FT                   /estimated_length=176
FT                   /gap_type="unknown"
FT   gene            complement(2962427..>2977866)
FT                   /locus_tag="mCG_146101"
FT                   /note="gene_id=mCG146101.0"
FT   mRNA            complement(join(2962427..2962567,2964888..2965016,
FT                   2976911..2977053,2977650..>2977866))
FT                   /locus_tag="mCG_146101"
FT                   /product="mCG146101"
FT                   /note="gene_id=mCG146101.0 transcript_id=mCT186204.0
FT                   created on 14-JUL-2003"
FT   CDS             complement(join(2962545..2962567,2964888..2965016,
FT                   2976911..>2977010))
FT                   /codon_start=1
FT                   /locus_tag="mCG_146101"
FT                   /product="mCG146101"
FT                   /note="gene_id=mCG146101.0 transcript_id=mCT186204.0
FT                   protein_id=mCP107761.0"
FT                   /protein_id="EDL10053.1"
FT                   /translation="VLETQFLRRNNLFQSNQKPQPHTEPGRLVKSQTAKQWDTMIKGVS
FT                   FEIRQCELHHLPHVSHLCSNSCFYLYCGVRTSSGGARL"
FT   assembly_gap    2974482..2976290
FT                   /estimated_length=1809
FT                   /gap_type="unknown"
FT   gene            2976335..2977059
FT                   /locus_tag="mCG_49005"
FT                   /note="gene_id=mCG49005.2"
FT   mRNA            2976335..2977059
FT                   /locus_tag="mCG_49005"
FT                   /product="mCG49005"
FT                   /note="gene_id=mCG49005.2 transcript_id=mCT49188.2 created
FT                   on 16-OCT-2002"
FT   CDS             2976350..2976784
FT                   /codon_start=1
FT                   /locus_tag="mCG_49005"
FT                   /product="mCG49005"
FT                   /note="gene_id=mCG49005.2 transcript_id=mCT49188.2
FT                   protein_id=mCP34259.2"
FT                   /protein_id="EDL10054.1"
FT                   /translation="MVSCLHCSHNSIRTAPGTVGPLSFGAQAPQASLAFPAAFPSHLAG
FT                   TWASLCPCLQVGWLLQPWGAHLSVALPLGSLNASKSRYLLQLFQVQRIYLFYKVWISFF
FT                   LFFLRKLWLNIYIFFPLLHFFDSASSRFNFFPPRFVLARD"
FT   assembly_gap    2980567..2980586
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3017480..3017499
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3028555..3028755
FT                   /estimated_length=201
FT                   /gap_type="unknown"
FT   assembly_gap    3074948..3074967
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3084656..3084675
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(3089714..3104473)
FT                   /locus_tag="mCG_147316"
FT                   /note="gene_id=mCG147316.0"
FT   mRNA            complement(join(3089714..3090003,3104319..3104473))
FT                   /locus_tag="mCG_147316"
FT                   /product="mCG147316"
FT                   /note="gene_id=mCG147316.0 transcript_id=mCT187579.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(3089815..3089955)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147316"
FT                   /product="mCG147316"
FT                   /note="gene_id=mCG147316.0 transcript_id=mCT187579.0
FT                   protein_id=mCP109704.0"
FT                   /protein_id="EDL10052.1"
FT                   /translation="MATLVYGSSHHPHPKDVTSTSWDDWLGGVEPMTQLRHQRISPANL
FT                   G"
FT   assembly_gap    3098596..3098615
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3102711..3102810
FT                   /estimated_length=100
FT                   /gap_type="unknown"
FT   assembly_gap    3138483..3139056
FT                   /estimated_length=574
FT                   /gap_type="unknown"
FT   assembly_gap    3153562..3153581
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(3155941..>3158875)
FT                   /locus_tag="mCG_145137"
FT                   /note="gene_id=mCG145137.0"
FT   mRNA            complement(join(3155941..3156555,3157041..3157305,
FT                   3158762..>3158875))
FT                   /locus_tag="mCG_145137"
FT                   /product="mCG145137"
FT                   /note="gene_id=mCG145137.0 transcript_id=mCT184561.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(3156351..3156555,3157041..>3157108))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145137"
FT                   /product="mCG145137"
FT                   /note="gene_id=mCG145137.0 transcript_id=mCT184561.0
FT                   protein_id=mCP106247.0"
FT                   /protein_id="EDL10051.1"
FT                   /translation="PTGEKYAHLGYTKVRQNFLATPKYFHMLEDSKSHVYRKSNYGCSL
FT                   KKIIQIGFVVTTMFGSLVYVTVPKIVSCQKPLNIVLGQKLRIINN"
FT   assembly_gap    3184265..3184284
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3213916..3213935
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3216542..3216561
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3218060..3220163
FT                   /estimated_length=2104
FT                   /gap_type="unknown"
FT   assembly_gap    3223368..3223387
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3230848..3230990
FT                   /estimated_length=143
FT                   /gap_type="unknown"
FT   gene            <3235183..3254291
FT                   /locus_tag="mCG_51668"
FT                   /note="gene_id=mCG51668.2"
FT   mRNA            join(3235183..3235354,3241077..3241136,3253046..3254291)
FT                   /locus_tag="mCG_51668"
FT                   /product="mCG51668, transcript variant mCT174422"
FT                   /note="gene_id=mCG51668.2 transcript_id=mCT174422.0 created
FT                   on 06-FEB-2003"
FT   mRNA            join(<3235183..3235350,3253046..3254291)
FT                   /locus_tag="mCG_51668"
FT                   /product="mCG51668, transcript variant mCT179600"
FT                   /note="gene_id=mCG51668.2 transcript_id=mCT179600.0 created
FT                   on 06-FEB-2003"
FT   mRNA            join(3235184..3235354,3253046..3254291)
FT                   /locus_tag="mCG_51668"
FT                   /product="mCG51668, transcript variant mCT51851"
FT                   /note="gene_id=mCG51668.2 transcript_id=mCT51851.2 created
FT                   on 06-FEB-2003"
FT   CDS             join(<3235266..3235350,3253046..3253497)
FT                   /codon_start=1
FT                   /locus_tag="mCG_51668"
FT                   /product="mCG51668, isoform CRA_a"
FT                   /note="gene_id=mCG51668.2 transcript_id=mCT179600.0
FT                   protein_id=mCP102522.0 isoform=CRA_a"
FT                   /protein_id="EDL10048.1"
FT                   /translation="QFIGSLYLAVARLVTLNLQSQSGEVDAGGEPSRWSSSHCDCCCKN
FT                   GKGDKGESGTSCNDLSTSSCDSQSEASSPQETVICGPVTRQSNIQTLDRPIKKGPVQLI
FT                   QQSEMRRKSDLLRTLTSGSRESNISSKKKAAKEKLSIEEELEKCIQDFLKIKIPDRFPE
FT                   RKHPWQSELLRKYHL"
FT   CDS             join(3235342..3235354,3241077..3241136,3253046..3253497)
FT                   /codon_start=1
FT                   /locus_tag="mCG_51668"
FT                   /product="mCG51668, isoform CRA_c"
FT                   /note="gene_id=mCG51668.2 transcript_id=mCT174422.0
FT                   protein_id=mCP97341.0 isoform=CRA_c"
FT                   /protein_id="EDL10050.1"
FT                   /translation="MLEVSHLSNYLKECLSELSKEGMVGEPSRWSSSHCDCCCKNGKGD
FT                   KGESGTSCNDLSTSSCDSQSEASSPQETVICGPVTRQSNIQTLDRPIKKGPVQLIQQSE
FT                   MRRKSDLLRTLTSGSRESNISSKKKAAKEKLSIEEELEKCIQDFLKIKIPDRFPERKHP
FT                   WQSELLRKYHL"
FT   CDS             join(3235342..3235354,3253046..3253497)
FT                   /codon_start=1
FT                   /locus_tag="mCG_51668"
FT                   /product="mCG51668, isoform CRA_b"
FT                   /note="gene_id=mCG51668.2 transcript_id=mCT51851.2
FT                   protein_id=mCP34273.2 isoform=CRA_b"
FT                   /protein_id="EDL10049.1"
FT                   /translation="MLEVCEPSRWSSSHCDCCCKNGKGDKGESGTSCNDLSTSSCDSQS
FT                   EASSPQETVICGPVTRQSNIQTLDRPIKKGPVQLIQQSEMRRKSDLLRTLTSGSRESNI
FT                   SSKKKAAKEKLSIEEELEKCIQDFLKIKIPDRFPERKHPWQSELLRKYHL"
FT   assembly_gap    3239761..3239996
FT                   /estimated_length=236
FT                   /gap_type="unknown"
FT   assembly_gap    3243038..3243366
FT                   /estimated_length=329
FT                   /gap_type="unknown"
FT   assembly_gap    3326865..3328163
FT                   /estimated_length=1299
FT                   /gap_type="unknown"
FT   assembly_gap    3335467..3336061
FT                   /estimated_length=595
FT                   /gap_type="unknown"
FT   assembly_gap    3338083..3338102
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3357052..3357771
FT                   /estimated_length=720
FT                   /gap_type="unknown"
FT   assembly_gap    3375032..3377247
FT                   /estimated_length=2216
FT                   /gap_type="unknown"
FT   assembly_gap    3381577..3381596
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3385368..3385550
FT                   /estimated_length=183
FT                   /gap_type="unknown"
FT   assembly_gap    3409291..3409310
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3436288..3436307
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3448006..3448049
FT                   /estimated_length=44
FT                   /gap_type="unknown"
FT   assembly_gap    3490418..3490463
FT                   /estimated_length=46
FT                   /gap_type="unknown"
FT   assembly_gap    3490864..3490883
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3499672..3499801
FT                   /estimated_length=130
FT                   /gap_type="unknown"
FT   assembly_gap    3513334..3513353
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3521683..3521970
FT                   /estimated_length=288
FT                   /gap_type="unknown"
FT   assembly_gap    3533649..3533741
FT                   /estimated_length=93
FT                   /gap_type="unknown"
FT   assembly_gap    3546998..3547017
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3550528..3550547
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3572957..3573436
FT                   /estimated_length=480
FT                   /gap_type="unknown"
FT   assembly_gap    3574241..3574667
FT                   /estimated_length=427
FT                   /gap_type="unknown"
FT   assembly_gap    3580773..3580869
FT                   /estimated_length=97
FT                   /gap_type="unknown"
FT   assembly_gap    3616227..3616248
FT                   /estimated_length=22
FT                   /gap_type="unknown"
FT   assembly_gap    3627910..3627929
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3808269..3808288
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3813387..3813449
FT                   /estimated_length=63
FT                   /gap_type="unknown"
FT   assembly_gap    3814350..3814369
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3831660..3831750
FT                   /estimated_length=91
FT                   /gap_type="unknown"
FT   assembly_gap    3840465..3840484
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3847299..3853145
FT                   /estimated_length=5847
FT                   /gap_type="unknown"
FT   assembly_gap    3854437..3854800
FT                   /estimated_length=364
FT                   /gap_type="unknown"
FT   assembly_gap    3857758..3858158
FT                   /estimated_length=401
FT                   /gap_type="unknown"
FT   assembly_gap    3933305..3933324
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3952274..3952293
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3958891..3958910
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3976628..3976656
FT                   /estimated_length=29
FT                   /gap_type="unknown"
FT   assembly_gap    3980364..3982403
FT                   /estimated_length=2040
FT                   /gap_type="unknown"
FT   assembly_gap    3983589..3983743
FT                   /estimated_length=155
FT                   /gap_type="unknown"
FT   assembly_gap    3990556..3990575
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3993290..3993309
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4033023..4033042
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4049992..4050011
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4073857..4073876
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4075202..4075221
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4115215..4115234
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4119575..4119594
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4124324..4124491
FT                   /estimated_length=168
FT                   /gap_type="unknown"
FT   assembly_gap    4143998..4144490
FT                   /estimated_length=493
FT                   /gap_type="unknown"
FT   assembly_gap    4152530..4154719
FT                   /estimated_length=2190
FT                   /gap_type="unknown"
FT   assembly_gap    4156756..4156775
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4158356..4158375
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4175537..4175556
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4185185..4185421
FT                   /estimated_length=237
FT                   /gap_type="unknown"
FT   assembly_gap    4199995..4200014
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4204785..4204862
FT                   /estimated_length=78
FT                   /gap_type="unknown"
FT   assembly_gap    4238456..4242118
FT                   /estimated_length=3663
FT                   /gap_type="unknown"
FT   assembly_gap    4270097..4270116
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4280351..4280370
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4309419..4309902
FT                   /estimated_length=484
FT                   /gap_type="unknown"
FT   assembly_gap    4323099..4323123
FT                   /estimated_length=25
FT                   /gap_type="unknown"
FT   assembly_gap    4358004..4358146
FT                   /estimated_length=143
FT                   /gap_type="unknown"
FT   assembly_gap    4364345..4366174
FT                   /estimated_length=1830
FT                   /gap_type="unknown"
FT   assembly_gap    4371673..4371692
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4415319..4415525
FT                   /estimated_length=207
FT                   /gap_type="unknown"
FT   assembly_gap    4416236..4416255
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4419977..4420106
FT                   /estimated_length=130
FT                   /gap_type="unknown"
FT   assembly_gap    4461490..4461565
FT                   /estimated_length=76
FT                   /gap_type="unknown"
FT   assembly_gap    4467621..4467772
FT                   /estimated_length=152
FT                   /gap_type="unknown"
FT   assembly_gap    4469591..4469622
FT                   /estimated_length=32
FT                   /gap_type="unknown"
FT   assembly_gap    4482611..4482783
FT                   /estimated_length=173
FT                   /gap_type="unknown"
FT   assembly_gap    4487402..4487421
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4545190..4547470
FT                   /estimated_length=2281
FT                   /gap_type="unknown"
FT   assembly_gap    4555695..4555765
FT                   /estimated_length=71
FT                   /gap_type="unknown"
FT   assembly_gap    4562102..4562121
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4563609..4568970
FT                   /estimated_length=5362
FT                   /gap_type="unknown"
FT   assembly_gap    4573610..4574325
FT                   /estimated_length=716
FT                   /gap_type="unknown"
FT   assembly_gap    4600589..4601870
FT                   /estimated_length=1282
FT                   /gap_type="unknown"
FT   gene            complement(4605106..4680651)
FT                   /locus_tag="mCG_140804"
FT                   /note="gene_id=mCG140804.0"
FT   mRNA            complement(join(4605106..4605358,4610717..4610789,
FT                   4641825..4641930,4662054..4662214,4664621..4664694,
FT                   4667087..4667144,4680530..4680651))
FT                   /locus_tag="mCG_140804"
FT                   /product="mCG140804"
FT                   /note="gene_id=mCG140804.0 transcript_id=mCT171602.0
FT                   created on 06-AUG-2002"
FT   CDS             complement(join(4610730..4610789,4641825..4641930,
FT                   4662054..4662214,4664621..4664694,4667087..4667144,
FT                   4680530..4680604))
FT                   /codon_start=1
FT                   /locus_tag="mCG_140804"
FT                   /product="mCG140804"
FT                   /note="gene_id=mCG140804.0 transcript_id=mCT171602.0
FT                   protein_id=mCP94521.0"
FT                   /protein_id="EDL10047.1"
FT                   /translation="MGVTVDVHQVFQYPFEQVVACFLRKYPNPMDKNVISVKTVEEKKD
FT                   ESTGLIYRKRIAICQNVVPEILRKVSILKVPDIQLEEESWLSLQKRNMAIRSHCLTWTQ
FT                   YASMREESVFRESVENPNWTEFIQTGRISITGAGFLNCILETFASTFLRQGAQKGIRIM
FT                   EMLLKEQCGSPLVE"
FT   assembly_gap    4623803..4623841
FT                   /estimated_length=39
FT                   /gap_type="unknown"
FT   assembly_gap    4626847..4627208
FT                   /estimated_length=362
FT                   /gap_type="unknown"
FT   assembly_gap    4628643..4628662
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4646200..4646304
FT                   /estimated_length=105
FT                   /gap_type="unknown"
FT   assembly_gap    4649298..4649392
FT                   /estimated_length=95
FT                   /gap_type="unknown"
FT   assembly_gap    4675262..4675494
FT                   /estimated_length=233
FT                   /gap_type="unknown"
FT   assembly_gap    4684867..4685068
FT                   /estimated_length=202
FT                   /gap_type="unknown"
FT   assembly_gap    4698367..4698386
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4702506..4702609
FT                   /estimated_length=104
FT                   /gap_type="unknown"
FT   assembly_gap    4718467..4718486
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4719688..4719707
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4720735..4720754
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4732273..4737840
FT                   /estimated_length=5568
FT                   /gap_type="unknown"
FT   assembly_gap    4740417..4740436
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4742198..4742217
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4745449..4745468
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4746815..4746834
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4757635..4757837
FT                   /estimated_length=203
FT                   /gap_type="unknown"
FT   assembly_gap    4759873..4760539
FT                   /estimated_length=667
FT                   /gap_type="unknown"
FT   assembly_gap    4763882..4763901
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4772140..4772159
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4779624..4779706
FT                   /estimated_length=83
FT                   /gap_type="unknown"
FT   gene            <4782161..4886780
FT                   /gene="Sh3rf2"
FT                   /locus_tag="mCG_13025"
FT                   /note="gene_id=mCG13025.3"
FT   mRNA            join(<4782161..4782690,4829987..4830256,4832517..4832612,
FT                   4839572..4839892,4867792..4867883,4869202..4869372,
FT                   4877866..4878110,4881268..4881626,4884203..4886107)
FT                   /gene="Sh3rf2"
FT                   /locus_tag="mCG_13025"
FT                   /product="SH3 domain containing ring finger 2, transcript
FT                   variant mCT190285"
FT                   /note="gene_id=mCG13025.3 transcript_id=mCT190285.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(4782165..4782690,4829987..4830256,4832517..4832612,
FT                   4839572..4839892,4867792..4867883,4869202..4869384,
FT                   4877866..4878110,4881268..4881626,4884203..4886780)
FT                   /gene="Sh3rf2"
FT                   /locus_tag="mCG_13025"
FT                   /product="SH3 domain containing ring finger 2, transcript
FT                   variant mCT13770"
FT                   /note="gene_id=mCG13025.3 transcript_id=mCT13770.2 created
FT                   on 14-OCT-2002"
FT   mRNA            join(<4782204..4782690,4829987..4830256,4839572..4839892,
FT                   4867792..4867883,4869202..4869372,4877866..4878110,
FT                   4881268..4881626,4884203..4886703)
FT                   /gene="Sh3rf2"
FT                   /locus_tag="mCG_13025"
FT                   /product="SH3 domain containing ring finger 2, transcript
FT                   variant mCT190284"
FT                   /note="gene_id=mCG13025.3 transcript_id=mCT190284.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<4782307..4782690,4829987..4830256,4832517..4832612,
FT                   4839572..4839892,4867792..4867883,4869202..4869372,
FT                   4877866..4878110,4881268..4881626,4884203..4884478)
FT                   /codon_start=1
FT                   /gene="Sh3rf2"
FT                   /locus_tag="mCG_13025"
FT                   /product="SH3 domain containing ring finger 2, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG13025.3 transcript_id=mCT190285.0
FT                   protein_id=mCP111263.0 isoform=CRA_c"
FT                   /protein_id="EDL10046.1"
FT                   /translation="NKMDDLTLLDLLECPVCFEKLDVTAKVLPCQHTFCKPCLQRIFKA
FT                   HKELRCPECRTLVFCSIEALPANLLLVRLLDGVRSGQSSWKGGSFRRPRILTLQDNRKA
FT                   KSSPRSLQASPFRLVPSVRIHMDGVPRAKALCNYRGKNPGDLKFNKGDVILLRRQLDEN
FT                   WYQGEINGVSGIFPASSVEVIKQLPQPPPLCRALYNFDLRDKDKSENQDCLTFLKDDVI
FT                   TVISRVDENWAEGKLGDKVGIFPILFVEPNVSARHLLENKGHQLSRTRHLSLMSSPSRG
FT                   KATNTSSLRKSPGSRRKGSGQFSMTTALNTLNRTVHSPEGHQMVEISTPMLISSNSPSV
FT                   LTQHGDKADFPTSSTGQVSSSQPAPASPGHSTAMVSVPSSQQHLSNNMFVALHTYSAHR
FT                   PEELDLQKGEGIRVLGKYQDGWLKGLSLLTGRTGIFPSDYVIPVFSSTARKTSSFPDSR
FT                   SPTVCTTWALSTSSVSSQGSFAEGDPRQSGPFKSVFVPTAVVNPSRSTPGPGSSGQGSL
FT                   RKVRSSMRKNGSLQRPVQSGIPTFMVGSLRCSPTMVIRPQRFQFYPPQGMTPSPTPIMV
FT                   EMGSKSIYTGEPALTCINRGSKTRIHSAGNSIIMEGKETPIKSEPPPKPPASAPPSILV
FT                   KPENSKNGTEKQVKTVRFQNYSPPPTKHSASSPTSGKHDHPATLKGSQHEAVSSGGEMT
FT                   ILFAHRSGCHSGQQTDLRRKSAFGKTMPLLSTASATQTLFPSK"
FT   CDS             join(<4782307..4782690,4829987..4830256,4839572..4839892,
FT                   4867792..4867883,4869202..4869372,4877866..4878110,
FT                   4881268..4881626,4884203..4884478)
FT                   /codon_start=1
FT                   /gene="Sh3rf2"
FT                   /locus_tag="mCG_13025"
FT                   /product="SH3 domain containing ring finger 2, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG13025.3 transcript_id=mCT190284.0
FT                   protein_id=mCP111262.0 isoform=CRA_b"
FT                   /protein_id="EDL10045.1"
FT                   /translation="NKMDDLTLLDLLECPVCFEKLDVTAKVLPCQHTFCKPCLQRIFKA
FT                   HKELRCPECRTLVFCSIEALPANLLLVRLLDGVRSGQSSWKGGSFRRPRILTLQDNRKA
FT                   KSSPRSLQASPFRLVPSVRIHMDGVPRAKALCNYRGKNPGDLKFNKGDVILLRRQLDEN
FT                   WYQGEINGVSGIFPASSVEVIKQLPQPPPLCRALYNFDLRDKDKSENQDCLTFLKPNVS
FT                   ARHLLENKGHQLSRTRHLSLMSSPSRGKATNTSSLRKSPGSRRKGSGQFSMTTALNTLN
FT                   RTVHSPEGHQMVEISTPMLISSNSPSVLTQHGDKADFPTSSTGQVSSSQPAPASPGHST
FT                   AMVSVPSSQQHLSNNMFVALHTYSAHRPEELDLQKGEGIRVLGKYQDGWLKGLSLLTGR
FT                   TGIFPSDYVIPVFSSTARKTSSFPDSRSPTVCTTWALSTSSVSSQGSFAEGDPRQSGPF
FT                   KSVFVPTAVVNPSRSTPGPGSSGQGSLRKVRSSMRKNGSLQRPVQSGIPTFMVGSLRCS
FT                   PTMVIRPQRFQFYPPQGMTPSPTPIMVEMGSKSIYTGEPALTCINRGSKTRIHSAGNSI
FT                   IMEGKETPIKSEPPPKPPASAPPSILVKPENSKNGTEKQVKTVRFQNYSPPPTKHSASS
FT                   PTSGKHDHPATLKGSQHEAVSSGGEMTILFAHRSGCHSGQQTDLRRKSAFGKTMPLLST
FT                   ASATQTLFPSK"
FT   CDS             join(4782313..4782690,4829987..4830256,4832517..4832612,
FT                   4839572..4839892,4867792..4867883,4869202..4869384,
FT                   4877866..4878110,4881268..4881626,4884203..4884478)
FT                   /codon_start=1
FT                   /gene="Sh3rf2"
FT                   /locus_tag="mCG_13025"
FT                   /product="SH3 domain containing ring finger 2, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG13025.3 transcript_id=mCT13770.2
FT                   protein_id=mCP22540.2 isoform=CRA_a"
FT                   /protein_id="EDL10044.1"
FT                   /translation="MDDLTLLDLLECPVCFEKLDVTAKVLPCQHTFCKPCLQRIFKAHK
FT                   ELRCPECRTLVFCSIEALPANLLLVRLLDGVRSGQSSWKGGSFRRPRILTLQDNRKAKS
FT                   SPRSLQASPFRLVPSVRIHMDGVPRAKALCNYRGKNPGDLKFNKGDVILLRRQLDENWY
FT                   QGEINGVSGIFPASSVEVIKQLPQPPPLCRALYNFDLRDKDKSENQDCLTFLKDDVITV
FT                   ISRVDENWAEGKLGDKVGIFPILFVEPNVSARHLLENKGHQLSRTRHLSLMSSPSRGKA
FT                   TNTSSLRKSPGSRRKGSGQFSMTTALNTLNRTVHSPEGHQMVEISTPMLISSNSPSVLT
FT                   QHGDKADFPTSSTGQVSSSQPAPASPGHSTAMVSVPSSQQHLSNNMFVALHTYSAHRPE
FT                   ELDLQKGEGIRVLGKYQDGWLKGLSLLTGRTGIFPSDYVIPVFRYVSSSTARKTSSFPD
FT                   SRSPTVCTTWALSTSSVSSQGSFAEGDPRQSGPFKSVFVPTAVVNPSRSTPGPGSSGQG
FT                   SLRKVRSSMRKNGSLQRPVQSGIPTFMVGSLRCSPTMVIRPQRFQFYPPQGMTPSPTPI
FT                   MVEMGSKSIYTGEPALTCINRGSKTRIHSAGNSIIMEGKETPIKSEPPPKPPASAPPSI
FT                   LVKPENSKNGTEKQVKTVRFQNYSPPPTKHSASSPTSGKHDHPATLKGSQHEAVSSGGE
FT                   MTILFAHRSGCHSGQQTDLRRKSAFGKTMPLLSTASATQTLFPSK"
FT   assembly_gap    4795842..4795897
FT                   /estimated_length=56
FT                   /gap_type="unknown"
FT   assembly_gap    4844823..4844983
FT                   /estimated_length=161
FT                   /gap_type="unknown"
FT   assembly_gap    4847443..4847534
FT                   /estimated_length=92
FT                   /gap_type="unknown"
FT   assembly_gap    4852392..4852411
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4856117..4856136
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4895938..4895957
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(4906938..>4924918)
FT                   /locus_tag="mCG_144591"
FT                   /note="gene_id=mCG144591.0"
FT   mRNA            complement(join(4906938..4907214,4908530..4908666,
FT                   4920828..4920964,4924737..>4924918))
FT                   /locus_tag="mCG_144591"
FT                   /product="mCG144591"
FT                   /note="gene_id=mCG144591.0 transcript_id=mCT184015.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(4907074..4907214,4908530..4908666,
FT                   4920828..4920964,4924737..>4924882))
FT                   /codon_start=1
FT                   /locus_tag="mCG_144591"
FT                   /product="mCG144591"
FT                   /note="gene_id=mCG144591.0 transcript_id=mCT184015.0
FT                   protein_id=mCP106234.0"
FT                   /protein_id="EDL10042.1"
FT                   /translation="PGGKKTLLTMSWMGHHFSRWCKDISVLSSHLPLFSPMPSEDEHLI
FT                   SNLRSHVPARVVVKQPIRGAIGRTTVAAIVQTGGDWSTGLFSVCRDRKICFWGLLCPMC
FT                   LECDIARHYGECLCWPLLPGSTFALRIGTRERHRIQGTLCEDCVVVHCCWPFSICQVAR
FT                   ELKMRTSQLYEICEVPELKNTLV"
FT   gene            4912250..4914358
FT                   /locus_tag="mCG_63350"
FT                   /note="gene_id=mCG63350.2"
FT   mRNA            join(4912250..4912644,4912845..4914214,4914326..4914358)
FT                   /locus_tag="mCG_63350"
FT                   /product="mCG63350"
FT                   /note="gene_id=mCG63350.2 transcript_id=mCT63533.2 created
FT                   on 16-OCT-2002"
FT   CDS             join(4912601..4912644,4912845..4913169)
FT                   /codon_start=1
FT                   /locus_tag="mCG_63350"
FT                   /product="mCG63350"
FT                   /note="gene_id=mCG63350.2 transcript_id=mCT63533.2
FT                   protein_id=mCP42475.2"
FT                   /protein_id="EDL10043.1"
FT                   /translation="MPPQQPSMGRPSVRSENLTLILTPQMDTQVIEVMVSLPRGIVSIS
FT                   PGDRQDQVLTWARGSVCVFPQDQTEPLWVPERLVRRCKNEAPDPVAPVDVVDGPTNTND
FT                   GAKMGDPFSVPEADTSST"
FT   assembly_gap    4927124..4927294
FT                   /estimated_length=171
FT                   /gap_type="unknown"
FT   gene            4928895..4929689
FT                   /pseudo
FT                   /locus_tag="mCG_49696"
FT                   /note="gene_id=mCG49696.2"
FT   mRNA            4928895..4929689
FT                   /pseudo
FT                   /locus_tag="mCG_49696"
FT                   /note="gene_id=mCG49696.2 transcript_id=mCT49879.2 created
FT                   on 17-OCT-2002"
FT   gene            complement(4930578..4990399)
FT                   /locus_tag="mCG_127948"
FT                   /note="gene_id=mCG127948.0"
FT   mRNA            complement(join(4930578..4930961,4938243..4938375,
FT                   4939386..4939481,4940735..4940839,4943017..4943127,
FT                   4945107..4945217,4945723..4945863,4946759..4946899,
FT                   4948113..4948203,4949732..4949915,4954007..4954070,
FT                   4955489..4955546,4956259..4956471,4956911..4957049,
FT                   4957882..4957964,4958044..4958109,4958195..4958280,
FT                   4962134..4962211,4962915..4963055,4963819..4963872,
FT                   4964917..4964993,4965073..4965160,4970231..4970456,
FT                   4971023..4971090,4971286..4971349,4972096..4972208,
FT                   4973068..4973229,4974265..4974402,4979148..4979228,
FT                   4979612..4979699,4985303..4985427,4990231..4990399))
FT                   /locus_tag="mCG_127948"
FT                   /product="mCG127948"
FT                   /note="gene_id=mCG127948.0 transcript_id=mCT129240.1
FT                   created on 14-OCT-2002"
FT   CDS             complement(join(4930756..4930961,4938243..4938375,
FT                   4939386..4939481,4940735..4940839,4943017..4943127,
FT                   4945107..4945217,4945723..4945863,4946759..4946899,
FT                   4948113..4948203,4949732..4949915,4954007..4954070,
FT                   4955489..4955546,4956259..4956471,4956911..4957049,
FT                   4957882..4957964,4958044..4958109,4958195..4958280,
FT                   4962134..4962211,4962915..4963055,4963819..4963872,
FT                   4964917..4964993,4965073..4965160,4970231..4970456,
FT                   4971023..4971090,4971286..4971349,4972096..4972208,
FT                   4973068..4973229,4974265..4974402,4979148..4979228,
FT                   4979612..4979699,4985303..4985427,4990231..4990236))
FT                   /codon_start=1
FT                   /locus_tag="mCG_127948"
FT                   /product="mCG127948"
FT                   /note="gene_id=mCG127948.0 transcript_id=mCT129240.1
FT                   protein_id=mCP77816.1"
FT                   /db_xref="GOA:Q7TSZ3"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR004493"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="MGI:MGI:1913808"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TSZ3"
FT                   /protein_id="EDL10039.1"
FT                   /translation="MAGRKGTAKVDFLKEIEKEAQQKWEAEKVFEVSASRLEKQKQSSK
FT                   GKYFVTFPYPYMNGRLHLGHTFSLSKCEFAVGYQRLKGKSCLFPFGLHCTGMPIKACAD
FT                   KLKREIELYGCPPDFPEEEEEEEESSAKPGDIVVRDKAKGKKSKAAAKAGSSKYQWDIM
FT                   KSLGLSDDDIVKFSEAEHWLDYFPPLAVQDLKTIGLKVDWRRSFITTDVNPYYDSFVRW
FT                   QFLTLRERNKIKFGKRYTIYSPKDGQPCMDHDRQTGEGVGPQEYTLVKLKVLEPYPSKL
FT                   SGLKGKNIFLVAATLRPETMFGQTNCWVRPDMKYIGFETANGDIFICTQRAARNMSYQG
FT                   FTKHNGVVPVVKELMGEEILGASLSAPLTCYKVVYVLPMLTIKEDKGTGVVTSVPSDSP
FT                   DDLAALRDLKKKQALRTKFGIRDDMVLPFEPVPVLEIPGIGNLPAVTVCDELKIQSQND
FT                   REKLAEAKEKLYLRGFYDGVMLVDGFKGQKIQHVKKTIQKNMIDAGDALIYMEPEKQVM
FT                   SRSADECVVALCDQWYLDYGDENWKKQTFQCLKNMETFCEESRKNFEASLDWLQEHACS
FT                   RTYGLGTRLPWDEQWLIESLSDSTIYMAFYTVAHLLQGGDLNGQAESPLGIRPQQMTKD
FT                   VWDYVFFKDAPFPKTQIPKEKLDQLKQEFEFWYPVDLRASGKDLIPNHLSYYIYNHVAM
FT                   WPEQSDKWPVSVRANGHLLLNSEKMSKSTGNFLTLSQAVDKFSADGMRLALADAGDTVE
FT                   DANFVEAMADAGILRLYTWVEWVKEMLASCSSLRSGPADSFNDRVFASEMNAGIIKTDQ
FT                   NYEKMMFKEALKTGFFEFQAAKDKYRELATEGMHRELVFRFIEVQTILLTPFCPHLCEH
FT                   IWTLLGKPDSIMHASWPVAGPVDESLIRSSQYLMEVAHDLRLRLKNYMMPAKGKKTDKQ
FT                   PAQRPSHCTIYVAKNYPVWQHITLTTLRSHFEANNGKLPDNKVIASELGSLPELKKYMK
FT                   KVMPFVAMIKENMEKKGPRVLDLELEFDEQAVLMENIVYLTNSLELEHIEVKFASEAED
FT                   KVREECCPGKPLNVFRTEPGVPVSLVNPQPSSGHFSTKIDIRQGDSCESIIRRLMKTDR
FT                   GIKDLSKVKLMRFDDPLLGPRRVPVLGREHSEKTLISENAVFHVDLVSKKVHLTENGLR
FT                   TDIGDTMVYLVH"
FT   gene            <4958797..4961523
FT                   /locus_tag="mCG_145134"
FT                   /note="gene_id=mCG145134.0"
FT   mRNA            join(<4958797..4959127,4959169..4959183,4959211..4961523)
FT                   /locus_tag="mCG_145134"
FT                   /product="mCG145134"
FT                   /note="gene_id=mCG145134.0 transcript_id=mCT184558.0
FT                   created on 05-JUN-2003"
FT   CDS             <4960232..4960564
FT                   /codon_start=1
FT                   /locus_tag="mCG_145134"
FT                   /product="mCG145134"
FT                   /note="gene_id=mCG145134.0 transcript_id=mCT184558.0
FT                   protein_id=mCP106244.0"
FT                   /protein_id="EDL10041.1"
FT                   /translation="VGETERSHRIKARRTDLRSREIYNGQEISAPAEQQQPIQRTCCSG
FT                   WECILRCNQSHTETRDKLRKMQGCNFWDDMLRAWQVLILGKNKNWIRKYSLHTTVRLAM
FT                   SQKYKQ"
FT   assembly_gap    4976800..4977793
FT                   /estimated_length=994
FT                   /gap_type="unknown"
FT   gene            4980695..4981190
FT                   /locus_tag="mCG_11587"
FT                   /note="gene_id=mCG11587.0"
FT   mRNA            4980695..4981190
FT                   /locus_tag="mCG_11587"
FT                   /product="mCG11587"
FT                   /note="gene_id=mCG11587.0 transcript_id=mCT11906.0 created
FT                   on 14-OCT-2002"
FT   CDS             4980718..4981155
FT                   /codon_start=1
FT                   /locus_tag="mCG_11587"
FT                   /product="mCG11587"
FT                   /note="gene_id=mCG11587.0 transcript_id=mCT11906.0
FT                   protein_id=mCP22519.1"
FT                   /protein_id="EDL10040.1"
FT                   /translation="MPGVTVKDVNQQEFTRALAAFLKKSGKLKVPEWVDTVKLAKHKEL
FT                   APYDENWFYTRAASTAWHVYLRGGAGVGSMTKIYGGRQRNGVRPSHFSRGSKSVARQVL
FT                   QALEGLKMVEKDQDGGRKLTPQGQRDLDRIAGQVAAANKKH"
FT   assembly_gap    4999470..4999548
FT                   /estimated_length=79
FT                   /gap_type="unknown"
FT   gene            complement(5002732..5003536)
FT                   /locus_tag="mCG_1033463"
FT                   /note="gene_id=mCG1033463.0"
FT   mRNA            complement(join(5002732..5002893,5003300..5003536))
FT                   /locus_tag="mCG_1033463"
FT                   /product="mCG1033463"
FT                   /note="gene_id=mCG1033463.0 transcript_id=mCT151167.0
FT                   created on 10-MAR-2003"
FT   CDS             complement(join(5002806..5002893,5003300..5003346))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1033463"
FT                   /product="mCG1033463"
FT                   /note="gene_id=mCG1033463.0 transcript_id=mCT151167.0
FT                   protein_id=mCP77690.1"
FT                   /protein_id="EDL10038.1"
FT                   /translation="MSRNDSAVVNLQHNVRRNFHQQTSFKRKLMAKMGHWETMGEGGD"
FT   gene            5003736..5068451
FT                   /locus_tag="mCG_11586"
FT                   /note="gene_id=mCG11586.2"
FT   mRNA            join(5003736..5003868,5030251..5030430,5034094..5034228,
FT                   5042391..5042555,5046021..5046170,5048224..5048368,
FT                   5049186..5049339,5050334..5050630,5052477..5052620,
FT                   5054327..5054446,5055586..5055660,5055776..5055940,
FT                   5061126..5061230,5061555..5061743,5065309..5065419,
FT                   5066738..5067363)
FT                   /locus_tag="mCG_11586"
FT                   /product="mCG11586, transcript variant mCT174315"
FT                   /note="gene_id=mCG11586.2 transcript_id=mCT174315.0 created
FT                   on 14-OCT-2002"
FT   assembly_gap    5006896..5007223
FT                   /estimated_length=328
FT                   /gap_type="unknown"
FT   mRNA            join(5027525..5027750,5028664..5028924,5030137..5030430,
FT                   5034094..5034228,5042391..5042555,5046021..5046170,
FT                   5048224..5048368,5049186..5049339,5050334..5050630,
FT                   5052477..5052620,5054327..5054446,5055586..5055660,
FT                   5055776..5055940,5061126..5061230,5061555..5061743,
FT                   5065309..5065419,5066738..5068451)
FT                   /locus_tag="mCG_11586"
FT                   /product="mCG11586, transcript variant mCT11907"
FT                   /note="gene_id=mCG11586.2 transcript_id=mCT11907.2 created
FT                   on 14-OCT-2002"
FT   CDS             join(5027531..5027750,5028664..5028924,5030137..5030430,
FT                   5034094..5034228,5042391..5042555,5046021..5046170,
FT                   5048224..5048368,5049186..5049339,5050334..5050630,
FT                   5052477..5052620,5054327..5054446,5055586..5055660,
FT                   5055776..5055940,5061126..5061230,5061555..5061743,
FT                   5065309..5065419,5066738..5066821)
FT                   /codon_start=1
FT                   /locus_tag="mCG_11586"
FT                   /product="mCG11586, isoform CRA_b"
FT                   /note="gene_id=mCG11586.2 transcript_id=mCT11907.2
FT                   protein_id=mCP22518.2 isoform=CRA_b"
FT                   /protein_id="EDL10037.1"
FT                   /translation="MAFISVYYRTREKKREDGKWRDYERYYERNELYREKYDWRRGRSK
FT                   SRSKSRGLSRSRSRSRGRSKDRDPNRNVEHRERSKFKSERNDLESSYVPVSAPPPSSSE
FT                   QYSSGAQSIPSTVTVIAPAHHSENTTESWSNYYNNHSSSNSFGRNPPPKRRCRDYDERG
FT                   FCVLGDLCQFDHGNDPLVVDEVALPSMIPFPPPPPGLPPPPPPGMLMPPMPGPGPGPGP
FT                   GPGPGPGPGPGPGHSMRLPVPQGHGQPPPSVVLPIPRPPISQSSLINSRDQPGTSAVPN
FT                   LAPVGARLPPPLPQNLLYTVSERQPMYSREHGAAASERLQLGTPPPLLAARLVPPRNLM
FT                   GSSIGYHTSVSSPTPLVPDTYEPDGYNPEAPSITSSGRSQYRQFFSRAQTQRPNLIGLT
FT                   SGDMDANPRAANIVIQTEPPVPVSVNSNVTRVVLEPESRKRAISGLEGPLTKKPWLGKQ
FT                   GNNNQSKPGFLRKNHYTNTKLEVKKIPQELNNITKLNEHFSKFGTIVNIQVAFKGDPEA
FT                   ALIQYLTNEEARKAISSTEAVLNNRFIRVLWHRENNEQPALQSSAQILLQQQHTLSHLS
FT                   QQHHSLPQHLHPQQVMVTQSSPSSVHGGIQKMMGKPQTSGAYVLNKVPVKHRLGHASTN
FT                   QSDTSHLLNQTGGSSGEDCPVFSTPGHPKTIYSSSNLKAPSKLCSGSKSHDVQEVLKKK
FT                   QEAMKLQQDMRKKKQEMLEKQIECQKMLISKLEKNKNMKPEERANIMKTLKELGEKISQ
FT                   LKDELKTSSTVSTPSKVKTKTEAQKELLDTELDLHKRLSSGEDTTELRKKLSQLQVEAA
FT                   RLGILPVGRGKTISSQGRGRGRGRGRGRGSLNHMVVDHRPKALPGGGFIEEEKDELLQH
FT                   FSATNQASKFKDRRLQISWHKPKVPSISTETEEEEVKEEETETSDLFLHDDDDEDEDEY
FT                   ESRSWRR"
FT   CDS             join(5030277..5030430,5034094..5034228,5042391..5042555,
FT                   5046021..5046170,5048224..5048368,5049186..5049339,
FT                   5050334..5050630,5052477..5052620,5054327..5054446,
FT                   5055586..5055660,5055776..5055940,5061126..5061230,
FT                   5061555..5061743,5065309..5065419,5066738..5066821)
FT                   /codon_start=1
FT                   /locus_tag="mCG_11586"
FT                   /product="mCG11586, isoform CRA_a"
FT                   /note="gene_id=mCG11586.2 transcript_id=mCT174315.0
FT                   protein_id=mCP97234.0 isoform=CRA_a"
FT                   /protein_id="EDL10036.1"
FT                   /translation="MLMPPMPGPGPGPGPGPGPGPGPGPGPGHSMRLPVPQGHGQPPPS
FT                   VVLPIPRPPISQSSLINSRDQPGTSAVPNLAPVGARLPPPLPQNLLYTVSERQPMYSRE
FT                   HGAAASERLQLGTPPPLLAARLVPPRNLMGSSIGYHTSVSSPTPLVPDTYEPDGYNPEA
FT                   PSITSSGRSQYRQFFSRAQTQRPNLIGLTSGDMDANPRAANIVIQTEPPVPVSVNSNVT
FT                   RVVLEPESRKRAISGLEGPLTKKPWLGKQGNNNQSKPGFLRKNHYTNTKLEVKKIPQEL
FT                   NNITKLNEHFSKFGTIVNIQVAFKGDPEAALIQYLTNEEARKAISSTEAVLNNRFIRVL
FT                   WHRENNEQPALQSSAQILLQQQHTLSHLSQQHHSLPQHLHPQQVMVTQSSPSSVHGGIQ
FT                   KMMGKPQTSGAYVLNKVPVKHRLGHASTNQSDTSHLLNQTGGSSGEDCPVFSTPGHPKT
FT                   IYSSSNLKAPSKLCSGSKSHDVQEVLKKKQEAMKLQQDMRKKKQEMLEKQIECQKMLIS
FT                   KLEKNKNMKPEERANIMKTLKELGEKISQLKDELKTSSTVSTPSKVKTKTEAQKELLDT
FT                   ELDLHKRLSSGEDTTELRKKLSQLQVEAARLGILPVGRGKTISSQGRGRGRGRGRGRGS
FT                   LNHMVVDHRPKALPGGGFIEEEKDELLQHFSATNQASKFKDRRLQISWHKPKVPSISTE
FT                   TEEEEVKEEETETSDLFLHDDDDEDEDEYESRSWRR"
FT   assembly_gap    5060235..5060254
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5084250..5084272
FT                   /estimated_length=23
FT                   /gap_type="unknown"
FT   assembly_gap    5105732..5105874
FT                   /estimated_length=143
FT                   /gap_type="unknown"
FT   gene            <5123014..5125613
FT                   /gene="Pou4f3"
FT                   /locus_tag="mCG_142213"
FT                   /note="gene_id=mCG142213.0"
FT   mRNA            join(<5123014..5123133,5123477..5125613)
FT                   /gene="Pou4f3"
FT                   /locus_tag="mCG_142213"
FT                   /product="POU domain, class 4, transcription factor 3"
FT                   /note="gene_id=mCG142213.0 transcript_id=mCT179419.0
FT                   created on 06-FEB-2003"
FT   CDS             join(5123014..5123133,5123477..5124373)
FT                   /codon_start=1
FT                   /gene="Pou4f3"
FT                   /locus_tag="mCG_142213"
FT                   /product="POU domain, class 4, transcription factor 3"
FT                   /note="gene_id=mCG142213.0 transcript_id=mCT179419.0
FT                   protein_id=mCP102341.0"
FT                   /db_xref="GOA:Q63955"
FT                   /db_xref="InterPro:IPR000327"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR013847"
FT                   /db_xref="InterPro:IPR017970"
FT                   /db_xref="MGI:MGI:102523"
FT                   /protein_id="EDL10035.1"
FT                   /translation="MMAMNAKQPFGMHPVLQEPKFSSLHSGSEAMRRVCLPAPQLQGNI
FT                   FGSFDESLLARAEALAAVDIVSHGKNHPFKPDATYHTMSSVPCTSTSPTVPISHPAALT
FT                   SHPHHAVHQGLEGDLLEHISPTLSVSGLGAPEHSVMPAQIHPHHLGAMGHLHQAMGMSH
FT                   PHAVAPHSAMPACLSDVESDPRELEAFAERFKQRRIKLGVTQADVGAALANLKIPGVGS
FT                   LSQSTICRFESLTLSHNNMIALKPVLQAWLEEAEAAYREKNSKPELFNGSERKRKRTSI
FT                   AAPEKRSLEAYFAIQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKYSAVH"
FT   assembly_gap    5130433..5130536
FT                   /estimated_length=104
FT                   /gap_type="unknown"
FT   assembly_gap    5132596..5132667
FT                   /estimated_length=72
FT                   /gap_type="unknown"
FT   assembly_gap    5133874..5138015
FT                   /estimated_length=4142
FT                   /gap_type="unknown"
FT   assembly_gap    5154324..5154637
FT                   /estimated_length=314
FT                   /gap_type="unknown"
FT   gene            5170941..5171514
FT                   /locus_tag="mCG_11578"
FT                   /note="gene_id=mCG11578.1"
FT   mRNA            5170941..5171514
FT                   /locus_tag="mCG_11578"
FT                   /product="mCG11578"
FT                   /note="gene_id=mCG11578.1 transcript_id=mCT11898.1 created
FT                   on 14-OCT-2002"
FT   CDS             5170976..5171464
FT                   /codon_start=1
FT                   /locus_tag="mCG_11578"
FT                   /product="mCG11578"
FT                   /note="gene_id=mCG11578.1 transcript_id=mCT11898.1
FT                   protein_id=mCP22523.1"
FT                   /protein_id="EDL10034.1"
FT                   /translation="MTNTKGKQRGTRYMFSRLFRKHGVVPLATYMRIYKKGDIVDIKGM
FT                   GMGTVQKGMPHKCYHGKTGRVYNVTQHAMGIIVNKQVKGKILAKRINVRIEHIKHSKSR
FT                   DSFLKRVKENDQKKKEAKEKGTWVQLKRQPVPPREAHFVRTNGKEPELLEPIPYEFMA"
FT   assembly_gap    5180951..5180970
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5186018..5186037
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5196884..5196903
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5198557..5198576
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5199957..5199976
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5202569..5202767
FT                   /estimated_length=199
FT                   /gap_type="unknown"
FT   assembly_gap    5212365..5212384
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5216104..5216123
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5231896..5231972
FT                   /estimated_length=77
FT                   /gap_type="unknown"
FT   assembly_gap    5241244..5241391
FT                   /estimated_length=148
FT                   /gap_type="unknown"
FT   gene            5246126..5312044
FT                   /locus_tag="mCG_127945"
FT                   /note="gene_id=mCG127945.1"
FT   mRNA            join(5246126..5246208,5253645..5253870,5257209..5257361,
FT                   5258188..5258647,5264988..5265230,5269429..5269491,
FT                   5270522..5270722,5271206..5271318,5272312..5272400,
FT                   5285359..5285519,5286800..5286856,5287004..5287070,
FT                   5289452..5289587,5290368..5290457,5297192..5297310,
FT                   5300339..5300489,5304128..5304292,5304685..5304867,
FT                   5307272..5307451,5308081..5308164,5309517..5309617,
FT                   5310417..5310510,5310775..5311101)
FT                   /locus_tag="mCG_127945"
FT                   /product="mCG127945, transcript variant mCT129237"
FT                   /note="gene_id=mCG127945.1 transcript_id=mCT129237.1
FT                   created on 14-OCT-2002"
FT   mRNA            join(5246126..5246208,5253645..5253870,5257209..5257361,
FT                   5258188..5258647,5264988..5265230,5269429..5269491,
FT                   5270522..5270722,5271206..5271318,5272312..5272400,
FT                   5285359..5285519,5286800..5286856,5287004..5287070,
FT                   5289452..5289587,5290368..5290457,5297192..5297310,
FT                   5300339..5300489,5304128..5304292,5304685..5304867,
FT                   5307272..5307451,5308081..5308164,5309517..5309617,
FT                   5310775..5311101)
FT                   /locus_tag="mCG_127945"
FT                   /product="mCG127945, transcript variant mCT174100"
FT                   /note="gene_id=mCG127945.1 transcript_id=mCT174100.0
FT                   created on 14-OCT-2002"
FT   mRNA            join(5246126..5246208,5253645..5253870,5257209..5257361,
FT                   5258188..5258647,5264988..5265230,5269429..5269491,
FT                   5270522..5270722,5271206..5271318,5272312..5272400,
FT                   5285359..5285519,5286800..5286856,5287004..5287070,
FT                   5289452..5290457)
FT                   /locus_tag="mCG_127945"
FT                   /product="mCG127945, transcript variant mCT174101"
FT                   /note="gene_id=mCG127945.1 transcript_id=mCT174101.0
FT                   created on 14-OCT-2002"
FT   mRNA            join(<5246147..5246208,5253645..5253870,5257209..5257361,
FT                   5258188..5258647,5264988..5265230,5270522..5270722,
FT                   5271206..5271318,5272312..5272400,5285359..5285519,
FT                   5286800..5286856,5287004..5287070,5289452..5289587,
FT                   5290368..5290457,5297192..5297310,5300339..5300489,
FT                   5304128..5304292,5304685..5304867,5307272..5307451,
FT                   5308081..5308164,5309517..5309617,5310775..5311810)
FT                   /locus_tag="mCG_127945"
FT                   /product="mCG127945, transcript variant mCT190275"
FT                   /note="gene_id=mCG127945.1 transcript_id=mCT190275.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<5246147..5246208,5253645..5253870,5257209..5257361,
FT                   5258188..5258647,5264988..5265230,5270522..5270722,
FT                   5271206..5271318,5272312..5272400,5285359..5285519,
FT                   5286800..5286856,5287004..5287070,5289452..5289587,
FT                   5290368..5290457,5297192..5297310,5300339..5300489,
FT                   5304128..5304292,5304685..5304867,5307272..5307451,
FT                   5308081..5308164,5309517..5309617,5310775..5310976)
FT                   /codon_start=1
FT                   /locus_tag="mCG_127945"
FT                   /product="mCG127945, isoform CRA_b"
FT                   /note="gene_id=mCG127945.1 transcript_id=mCT190275.0
FT                   protein_id=mCP111261.0 isoform=CRA_b"
FT                   /protein_id="EDL10030.1"
FT                   /translation="VMAERGGDGGEGERFNPGELRMAQQQALRFRGPAPPPNAVMRGPP
FT                   PLMRPPPPFGMMRGPPPPPRPPFGRPPFDPNMPPMPPPGGIPPPMGPPHLQRPPFMPPP
FT                   MGAMPPPPGMMFPPGMPPGTAPGAPALPPTEEIWVENKTPDGKVYYYNARTRESAWTKP
FT                   DGVKVIQQSELTPMLAAQAQVQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQA
FT                   QAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQVQAQAVGAPTPTTSSPAPAVSTSTPTST
FT                   PSSTTATTTTATSVAQTVSTPTTQDQTPSSAVSVATPTVSVSAPAPTATPVQTVPQPHP
FT                   QTLPPAVPHSVPQPAAAIPAFPPVMVPPFRVPLPGMPIPLPGVLPGMAPPIVPMIHPQV
FT                   AIAASPATLAGATAVSEWTEYKTADGKTYYYNNRTLESTWEKPQELKEKEKLDEKIKEP
FT                   IKEASEEPLPMETEEEDPKEEPVKEIKEEPKEEEMTEEEKAAQKAKPVATTPIPGTPWC
FT                   VVWTGDERVFFYNPTTRLSMWDRPDDLIGRADVDKIIQEPPHKKGLEDMKKLRHPAPTM
FT                   LSIQKWQFSMSAIKEEQELMEEMNEDEPIKAKKRKRDDNKDIDSEKEAAMEAEIKAARE
FT                   RAIVPLEARMKQFKDMLLERGVSAFSTWEKELHKIVFDPRYLLLNPKERKQVFDQYVKT
FT                   RAEEERREKKNKIMQAKEDFKKMMEEAKFNPRATFSEFAAKHAKDSRFKAIEKMKDREA
FT                   LFNEFVAAARKKEKEDSKTRGEKIKSDFFELLSNHHLDSQSRWSKVKDKVESDPRYKAV
FT                   DSSSMREDLFKQYIEKIAKNLDSEKEKELERQARIEASLREREREVQKARSEQTKEIDR
FT                   EREQHKREEAIQNFKALLSDMVRSSDVSWSDTRRTLRKDHRWESGSLLEREEKEKLFNE
FT                   HIEALTKKKREHFRQLLDETSAITLTSTWKEVKKIIKEDPRCIKFSSSDRKKQREFEEY
FT                   IRDKYITAKADFRTLLKETKFITYRSKKLIQESDQHLKDVEKILQNDKRYLVLDCVPEE
FT                   RRKLIVAYVDDLDRRGPPPPPTASEPTRRSTK"
FT   CDS             join(5246150..5246208,5253645..5253870,5257209..5257361,
FT                   5258188..5258647,5264988..5265230,5269429..5269491,
FT                   5270522..5270722,5271206..5271318,5272312..5272400,
FT                   5285359..5285519,5286800..5286856,5287004..5287070,
FT                   5289452..5289587,5290368..5290457,5297192..5297310,
FT                   5300339..5300489,5304128..5304292,5304685..5304867,
FT                   5307272..5307451,5308081..5308164,5309517..5309617,
FT                   5310775..5310976)
FT                   /codon_start=1
FT                   /locus_tag="mCG_127945"
FT                   /product="mCG127945, isoform CRA_a"
FT                   /note="gene_id=mCG127945.1 transcript_id=mCT174100.0
FT                   protein_id=mCP97020.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q3TH57"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="InterPro:IPR002713"
FT                   /db_xref="MGI:MGI:1926421"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TH57"
FT                   /protein_id="EDL10029.1"
FT                   /translation="MAERGGDGGEGERFNPGELRMAQQQALRFRGPAPPPNAVMRGPPP
FT                   LMRPPPPFGMMRGPPPPPRPPFGRPPFDPNMPPMPPPGGIPPPMGPPHLQRPPFMPPPM
FT                   GAMPPPPGMMFPPGMPPGTAPGAPALPPTEEIWVENKTPDGKVYYYNARTRESAWTKPD
FT                   GVKVIQQSELTPMLAAQAQVQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQ
FT                   AQAQAQAQAQAQAQAQAQAQAQAQAQAQAQVQAQAVGAPTPTTSSPAPAVSTSTPTSTP
FT                   SSTTATTTTATSVAQTVSTPTTQDQTPSSAVSVATPTVSVSAPAPTATPVQTVPQPHPQ
FT                   TLPPAVPHSVPQPAAAIPAFPPVMVPPFRVPLPGMPIPLPGVAMMQIVSCPYVKTVATT
FT                   KTGVLPGMAPPIVPMIHPQVAIAASPATLAGATAVSEWTEYKTADGKTYYYNNRTLEST
FT                   WEKPQELKEKEKLDEKIKEPIKEASEEPLPMETEEEDPKEEPVKEIKEEPKEEEMTEEE
FT                   KAAQKAKPVATTPIPGTPWCVVWTGDERVFFYNPTTRLSMWDRPDDLIGRADVDKIIQE
FT                   PPHKKGLEDMKKLRHPAPTMLSIQKWQFSMSAIKEEQELMEEMNEDEPIKAKKRKRDDN
FT                   KDIDSEKEAAMEAEIKAARERAIVPLEARMKQFKDMLLERGVSAFSTWEKELHKIVFDP
FT                   RYLLLNPKERKQVFDQYVKTRAEEERREKKNKIMQAKEDFKKMMEEAKFNPRATFSEFA
FT                   AKHAKDSRFKAIEKMKDREALFNEFVAAARKKEKEDSKTRGEKIKSDFFELLSNHHLDS
FT                   QSRWSKVKDKVESDPRYKAVDSSSMREDLFKQYIEKIAKNLDSEKEKELERQARIEASL
FT                   REREREVQKARSEQTKEIDREREQHKREEAIQNFKALLSDMVRSSDVSWSDTRRTLRKD
FT                   HRWESGSLLEREEKEKLFNEHIEALTKKKREHFRQLLDETSAITLTSTWKEVKKIIKED
FT                   PRCIKFSSSDRKKQREFEEYIRDKYITAKADFRTLLKETKFITYRSKKLIQESDQHLKD
FT                   VEKILQNDKRYLVLDCVPEERRKLIVAYVDDLDRRGPPPPPTASEPTRRSTK"
FT   CDS             join(5246150..5246208,5253645..5253870,5257209..5257361,
FT                   5258188..5258647,5264988..5265230,5269429..5269491,
FT                   5270522..5270722,5271206..5271318,5272312..5272400,
FT                   5285359..5285519,5286800..5286856,5287004..5287070,
FT                   5289452..5289587,5290368..5290457,5297192..5297310,
FT                   5300339..5300489,5304128..5304292,5304685..5304867,
FT                   5307272..5307451,5308081..5308164,5309517..5309617,
FT                   5310417..5310420)
FT                   /codon_start=1
FT                   /locus_tag="mCG_127945"
FT                   /product="mCG127945, isoform CRA_c"
FT                   /note="gene_id=mCG127945.1 transcript_id=mCT129237.1
FT                   protein_id=mCP77670.1 isoform=CRA_c"
FT                   /protein_id="EDL10031.1"
FT                   /translation="MAERGGDGGEGERFNPGELRMAQQQALRFRGPAPPPNAVMRGPPP
FT                   LMRPPPPFGMMRGPPPPPRPPFGRPPFDPNMPPMPPPGGIPPPMGPPHLQRPPFMPPPM
FT                   GAMPPPPGMMFPPGMPPGTAPGAPALPPTEEIWVENKTPDGKVYYYNARTRESAWTKPD
FT                   GVKVIQQSELTPMLAAQAQVQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQ
FT                   AQAQAQAQAQAQAQAQAQAQAQAQAQAQAQVQAQAVGAPTPTTSSPAPAVSTSTPTSTP
FT                   SSTTATTTTATSVAQTVSTPTTQDQTPSSAVSVATPTVSVSAPAPTATPVQTVPQPHPQ
FT                   TLPPAVPHSVPQPAAAIPAFPPVMVPPFRVPLPGMPIPLPGVAMMQIVSCPYVKTVATT
FT                   KTGVLPGMAPPIVPMIHPQVAIAASPATLAGATAVSEWTEYKTADGKTYYYNNRTLEST
FT                   WEKPQELKEKEKLDEKIKEPIKEASEEPLPMETEEEDPKEEPVKEIKEEPKEEEMTEEE
FT                   KAAQKAKPVATTPIPGTPWCVVWTGDERVFFYNPTTRLSMWDRPDDLIGRADVDKIIQE
FT                   PPHKKGLEDMKKLRHPAPTMLSIQKWQFSMSAIKEEQELMEEMNEDEPIKAKKRKRDDN
FT                   KDIDSEKEAAMEAEIKAARERAIVPLEARMKQFKDMLLERGVSAFSTWEKELHKIVFDP
FT                   RYLLLNPKERKQVFDQYVKTRAEEERREKKNKIMQAKEDFKKMMEEAKFNPRATFSEFA
FT                   AKHAKDSRFKAIEKMKDREALFNEFVAAARKKEKEDSKTRGEKIKSDFFELLSNHHLDS
FT                   QSRWSKVKDKVESDPRYKAVDSSSMREDLFKQYIEKIAKNLDSEKEKELERQARIEASL
FT                   REREREVQKARSEQTKEIDREREQHKREEAIQNFKALLSDMVRSSDVSWSDTRRTLRKD
FT                   HRWESGSLLEREEKEKLFNEHIEALTKKKREHFRQLLDETSAITLTSTWKEVKKIIKED
FT                   PRCIKFSSSDRKKQREFEEYIRDKYITAKADFRTLLKETKFITYS"
FT   CDS             join(5246150..5246208,5253645..5253870,5257209..5257361,
FT                   5258188..5258647,5264988..5265230,5269429..5269491,
FT                   5270522..5270722,5271206..5271318,5272312..5272400,
FT                   5285359..5285519,5286800..5286856,5287004..5287070,
FT                   5289452..5289653)
FT                   /codon_start=1
FT                   /locus_tag="mCG_127945"
FT                   /product="mCG127945, isoform CRA_e"
FT                   /note="gene_id=mCG127945.1 transcript_id=mCT174101.0
FT                   protein_id=mCP97019.0 isoform=CRA_e"
FT                   /protein_id="EDL10033.1"
FT                   /translation="MAERGGDGGEGERFNPGELRMAQQQALRFRGPAPPPNAVMRGPPP
FT                   LMRPPPPFGMMRGPPPPPRPPFGRPPFDPNMPPMPPPGGIPPPMGPPHLQRPPFMPPPM
FT                   GAMPPPPGMMFPPGMPPGTAPGAPALPPTEEIWVENKTPDGKVYYYNARTRESAWTKPD
FT                   GVKVIQQSELTPMLAAQAQVQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQ
FT                   AQAQAQAQAQAQAQAQAQAQAQAQAQAQAQVQAQAVGAPTPTTSSPAPAVSTSTPTSTP
FT                   SSTTATTTTATSVAQTVSTPTTQDQTPSSAVSVATPTVSVSAPAPTATPVQTVPQPHPQ
FT                   TLPPAVPHSVPQPAAAIPAFPPVMVPPFRVPLPGMPIPLPGVAMMQIVSCPYVKTVATT
FT                   KTGVLPGMAPPIVPMIHPQVAIAASPATLAGATAVSEWTEYKTADGKTYYYNNRTLEST
FT                   WEKPQELKEKEKLDEKIKEPIKEASEEPLPMETEEEDPKEEPVKEIKEEPKEEEMTEEE
FT                   KAAQKAKPVATTPIPGTPWCVVWTGDERVFFYNPTTRLSMWDRPDDLIGRADVDKIIQE
FT                   PPHKKGLEDMKKLRHPAPTMLSIQKWQFSMSAIKEEQELMEEMNEDEPIKAKKRKRDDN
FT                   KDIDSEKEAAMEAEIKAARERAIVPLEARMKQFKDMLLERGVRKQSLGEIFLFYISNIN
FT                   MSC"
FT   assembly_gap    5246521..5246564
FT                   /estimated_length=44
FT                   /gap_type="unknown"
FT   assembly_gap    5252012..5252568
FT                   /estimated_length=557
FT                   /gap_type="unknown"
FT   assembly_gap    5264682..5264934
FT                   /estimated_length=253
FT                   /gap_type="unknown"
FT   mRNA            join(5289802..5290457,5297192..5297310,5300339..5300489,
FT                   5304128..5304292,5304685..5304867,5307272..5307451,
FT                   5308081..5308164,5309517..5309617,5310775..5312044)
FT                   /locus_tag="mCG_127945"
FT                   /product="mCG127945, transcript variant mCT174102"
FT                   /note="gene_id=mCG127945.1 transcript_id=mCT174102.0
FT                   created on 14-OCT-2002"
FT   CDS             join(5290308..5290457,5297192..5297310,5300339..5300489,
FT                   5304128..5304292,5304685..5304867,5307272..5307451,
FT                   5308081..5308164,5309517..5309617,5310775..5310976)
FT                   /codon_start=1
FT                   /locus_tag="mCG_127945"
FT                   /product="mCG127945, isoform CRA_d"
FT                   /note="gene_id=mCG127945.1 transcript_id=mCT174102.0
FT                   protein_id=mCP97021.0 isoform=CRA_d"
FT                   /protein_id="EDL10032.1"
FT                   /translation="MTFLELSILIMRQCFLFILKVSAFSTWEKELHKIVFDPRYLLLNP
FT                   KERKQVFDQYVKTRAEEERREKKNKIMQAKEDFKKMMEEAKFNPRATFSEFAAKHAKDS
FT                   RFKAIEKMKDREALFNEFVAAARKKEKEDSKTRGEKIKSDFFELLSNHHLDSQSRWSKV
FT                   KDKVESDPRYKAVDSSSMREDLFKQYIEKIAKNLDSEKEKELERQARIEASLREREREV
FT                   QKARSEQTKEIDREREQHKREEAIQNFKALLSDMVRSSDVSWSDTRRTLRKDHRWESGS
FT                   LLEREEKEKLFNEHIEALTKKKREHFRQLLDETSAITLTSTWKEVKKIIKEDPRCIKFS
FT                   SSDRKKQREFEEYIRDKYITAKADFRTLLKETKFITYRSKKLIQESDQHLKDVEKILQN
FT                   DKRYLVLDCVPEERRKLIVAYVDDLDRRGPPPPPTASEPTRRSTK"
FT   gene            complement(5314140..5315896)
FT                   /gene="Gpr151"
FT                   /locus_tag="mCG_142727"
FT                   /note="gene_id=mCG142727.0"
FT   mRNA            complement(5314140..5315896)
FT                   /gene="Gpr151"
FT                   /locus_tag="mCG_142727"
FT                   /product="G protein-coupled receptor 151"
FT                   /note="gene_id=mCG142727.0 transcript_id=mCT181969.0
FT                   created on 17-APR-2003"
FT   CDS             complement(5314602..5315870)
FT                   /codon_start=1
FT                   /gene="Gpr151"
FT                   /locus_tag="mCG_142727"
FT                   /product="G protein-coupled receptor 151"
FT                   /note="gene_id=mCG142727.0 transcript_id=mCT181969.0
FT                   protein_id=mCP104891.0"
FT                   /protein_id="EDL10028.1"
FT                   /translation="MGKAMLRAGFADTNSSNMNESFARLHFAGGYLPSDSKDWRTIIPS
FT                   LLMAVCLVGLVGNLCVIGILLHGVWKRKPSTIHSLILNLSLADFSLLLFSAPVRAAAYS
FT                   KGVWDLGWFICKSSDWFTHVCMAAKSLTFVVVAKACFAYASDPAKQESIHSRTIWSVLA
FT                   GIWVVASLLPLPEWLFSTTRRHAGVEMCLVDVPAVAEEFMSMFGKLYPLLVFCLPLLLA
FT                   GVYFWRAYDQCKTRCTKTRNLRDQMRSKQLTVMLLSTAIISALLWLPEWIAWLWVWHVK
FT                   AGGPMPPQGFIALSQVLMFFTSTANPLIFLVMSEEFKAGLKGLWKWMITRKPAVTSEVQ
FT                   EAPAGNTEALPGKAPSPETQTCILDTDGRGSPDDSKEKSGKVVAPILPDVEQFWHERDA
FT                   VPSAQDNDPIPWEHEGQETEGCN"
FT   assembly_gap    5321936..5322089
FT                   /estimated_length=154
FT                   /gap_type="unknown"
FT   assembly_gap    5324271..5324350
FT                   /estimated_length=80
FT                   /gap_type="unknown"
FT   assembly_gap    5329183..5329210
FT                   /estimated_length=28
FT                   /gap_type="unknown"
FT   assembly_gap    5348423..5348473
FT                   /estimated_length=51
FT                   /gap_type="unknown"
FT   gene            complement(5351522..5353812)
FT                   /locus_tag="mCG_147293"
FT                   /note="gene_id=mCG147293.0"
FT   mRNA            complement(join(5351522..5351828,5353093..5353812))
FT                   /locus_tag="mCG_147293"
FT                   /product="mCG147293"
FT                   /note="gene_id=mCG147293.0 transcript_id=mCT187556.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(join(5351823..5351828,5353093..5353209))
FT                   /codon_start=1
FT                   /locus_tag="mCG_147293"
FT                   /product="mCG147293"
FT                   /note="gene_id=mCG147293.0 transcript_id=mCT187556.0
FT                   protein_id=mCP109680.0"
FT                   /protein_id="EDL10027.1"
FT                   /translation="MKKGEILWHESYKQLDNGRSRRNRLPWGRGPNPEVVYIQE"
FT   gene            complement(5373354..5797608)
FT                   /gene="Ppp2r2b"
FT                   /locus_tag="mCG_5620"
FT                   /note="gene_id=mCG5620.2"
FT   mRNA            complement(join(5373354..5373849,5384449..5384540,
FT                   5398882..5399051,5424292..5424456,5437505..5437682,
FT                   5467801..5467913,5473919..5474084,5477117..5477214,
FT                   5634621..5634865))
FT                   /gene="Ppp2r2b"
FT                   /locus_tag="mCG_5620"
FT                   /product="protein phosphatase 2 (formerly 2A), regulatory
FT                   subunit B (PR 52), beta isoform, transcript variant
FT                   mCT174148"
FT                   /note="gene_id=mCG5620.2 transcript_id=mCT174148.0 created
FT                   on 14-OCT-2002"
FT   CDS             complement(join(5373561..5373849,5384449..5384540,
FT                   5398882..5399051,5424292..5424456,5437505..5437682,
FT                   5467801..5467913,5473919..5474084,5477117..5477214,
FT                   5634621..5634690))
FT                   /codon_start=1
FT                   /gene="Ppp2r2b"
FT                   /locus_tag="mCG_5620"
FT                   /product="protein phosphatase 2 (formerly 2A), regulatory
FT                   subunit B (PR 52), beta isoform, isoform CRA_a"
FT                   /note="gene_id=mCG5620.2 transcript_id=mCT174148.0
FT                   protein_id=mCP97067.0 isoform=CRA_a"
FT                   /protein_id="EDL10023.1"
FT                   /translation="MEEDIDTRKINNSFLRDHSYATEADIISTVEFNHTGELLATGDKG
FT                   GRVVIFQREQESKNQVHRRGEYNVYSTFQSHEPEFDYLKSLEIEEKINKIRWLPQQNAA
FT                   YFLLSTNDKTVKLWKVSERDKRPEGYNLKDEEGRLRDPATITTLRVPVLRPMDLMVEAT
FT                   PRRVFANAHTYHINSISVNSDYETYMSADDLRINLWNFEITNQSFNIVDIKPANMEELT
FT                   EVITAAEFHPHHCNTFVYSSSKGTIRLCDMRASALCDRHTKFFEEPEDPSNRSFFSEII
FT                   SSISDVKFSHSGRYIMTRDYLTVKVWDLNMENRPIETYQVHDYLRSKLCSLYENDCIFD
FT                   KFECVWNGSDRQGLITSHVTAVGDKMAWNAKMSAFIGDWTDVPEIACPPQKKKVYFQET
FT                   LTFLSTEIMPPLQGWNSISASLLPAPRGLNHSITLMCPRRDSGDPPA"
FT   mRNA            complement(join(5381001..5381782,5384449..5384540,
FT                   5398882..5399051,5424292..5424456,5433462..5433467,
FT                   5437505..5437682,5467801..5467913,5473919..5474084,
FT                   5477117..5477214,5634621..5634865))
FT                   /gene="Ppp2r2b"
FT                   /locus_tag="mCG_5620"
FT                   /product="protein phosphatase 2 (formerly 2A), regulatory
FT                   subunit B (PR 52), beta isoform, transcript variant
FT                   mCT4818"
FT                   /note="gene_id=mCG5620.2 transcript_id=mCT4818.2 created on
FT                   14-OCT-2002"
FT   mRNA            complement(join(5381198..5381782,5384449..5384540,
FT                   5398882..5399051,5424292..5424456,5437505..5437682,
FT                   5467801..5467913,5473919..5474084,5477117..5477214,
FT                   5797323..5797608))
FT                   /gene="Ppp2r2b"
FT                   /locus_tag="mCG_5620"
FT                   /product="protein phosphatase 2 (formerly 2A), regulatory
FT                   subunit B (PR 52), beta isoform, transcript variant
FT                   mCT174147"
FT                   /note="gene_id=mCG5620.2 transcript_id=mCT174147.0 created
FT                   on 14-OCT-2002"
FT   CDS             complement(join(5381503..5381782,5384449..5384540,
FT                   5398882..5399051,5424292..5424456,5437505..5437682,
FT                   5467801..5467913,5473919..5474084,5477117..5477214,
FT                   5797323..5797401))
FT                   /codon_start=1
FT                   /gene="Ppp2r2b"
FT                   /locus_tag="mCG_5620"
FT                   /product="protein phosphatase 2 (formerly 2A), regulatory
FT                   subunit B (PR 52), beta isoform, isoform CRA_c"
FT                   /note="gene_id=mCG5620.2 transcript_id=mCT174147.0
FT                   protein_id=mCP97066.0 isoform=CRA_c"
FT                   /db_xref="GOA:Q6ZWR4"
FT                   /db_xref="InterPro:IPR000009"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR018067"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="MGI:MGI:1920180"
FT                   /protein_id="EDL10025.1"
FT                   /translation="MKCFSRYLPYIFRPPNTILSSSCHTEADIISTVEFNHTGELLATG
FT                   DKGGRVVIFQREQESKNQVHRRGEYNVYSTFQSHEPEFDYLKSLEIEEKINKIRWLPQQ
FT                   NAAYFLLSTNDKTVKLWKVSERDKRPEGYNLKDEEGRLRDPATITTLRVPVLRPMDLMV
FT                   EATPRRVFANAHTYHINSISVNSDYETYMSADDLRINLWNFEITNQSFNIVDIKPANME
FT                   ELTEVITAAEFHPHHCNTFVYSSSKGTIRLCDMRASALCDRHTKFFEEPEDPSNRSFFS
FT                   EIISSISDVKFSHSGRYIMTRDYLTVKVWDLNMENRPIETYQVHDYLRSKLCSLYENDC
FT                   IFDKFECVWNGSDSVIMTGSYNNFFRMFDRNTKRDVTLEASRENSKPRAILKPRKVCVG
FT                   GKRRKDEISVDSLDFSKKILHTAWHPSENIIAVAATNNLYIFQDKVN"
FT   CDS             complement(join(5381503..5381782,5384449..5384540,
FT                   5398882..5399051,5424292..5424456,5433462..5433467,
FT                   5437505..5437682,5467801..5467913,5473919..5474084,
FT                   5477117..5477214,5634621..5634690))
FT                   /codon_start=1
FT                   /gene="Ppp2r2b"
FT                   /locus_tag="mCG_5620"
FT                   /product="protein phosphatase 2 (formerly 2A), regulatory
FT                   subunit B (PR 52), beta isoform, isoform CRA_b"
FT                   /note="gene_id=mCG5620.2 transcript_id=mCT4818.2
FT                   protein_id=mCP13143.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q6ZWR4"
FT                   /db_xref="InterPro:IPR000009"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR018067"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="MGI:MGI:1920180"
FT                   /protein_id="EDL10024.1"
FT                   /translation="MEEDIDTRKINNSFLRDHSYATEADIISTVEFNHTGELLATGDKG
FT                   GRVVIFQREQESKNQVHRRGEYNVYSTFQSHEPEFDYLKSLEIEEKINKIRWLPQQNAA
FT                   YFLLSTNDKTVKLWKVSERDKRPEGYNLKDEEGRLRDPATITTLRVPVLRPMDLMVEAT
FT                   PRRVFANAHTYHINSISVNSDYETYMSADDLRINLWNFEITNQSFMPDIVDIKPANMEE
FT                   LTEVITAAEFHPHHCNTFVYSSSKGTIRLCDMRASALCDRHTKFFEEPEDPSNRSFFSE
FT                   IISSISDVKFSHSGRYIMTRDYLTVKVWDLNMENRPIETYQVHDYLRSKLCSLYENDCI
FT                   FDKFECVWNGSDSVIMTGSYNNFFRMFDRNTKRDVTLEASRENSKPRAILKPRKVCVGG
FT                   KRRKDEISVDSLDFSKKILHTAWHPSENIIAVAATNNLYIFQDKVN"
FT   assembly_gap    5399526..5399919
FT                   /estimated_length=394
FT                   /gap_type="unknown"
FT   assembly_gap    5412618..5412637
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5425039..5425118
FT                   /estimated_length=80
FT                   /gap_type="unknown"
FT   assembly_gap    5431761..5431780
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5438347..5438400
FT                   /estimated_length=54
FT                   /gap_type="unknown"
FT   assembly_gap    5454581..5454600
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5532818..5532888
FT                   /estimated_length=71
FT                   /gap_type="unknown"
FT   assembly_gap    5543316..5543683
FT                   /estimated_length=368
FT                   /gap_type="unknown"
FT   assembly_gap    5547170..5547637
FT                   /estimated_length=468
FT                   /gap_type="unknown"
FT   assembly_gap    5625444..5625649
FT                   /estimated_length=206
FT                   /gap_type="unknown"
FT   assembly_gap    5642119..5642138
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5653022..5653293
FT                   /estimated_length=272
FT                   /gap_type="unknown"
FT   assembly_gap    5657983..5658396
FT                   /estimated_length=414
FT                   /gap_type="unknown"
FT   assembly_gap    5662695..5662836
FT                   /estimated_length=142
FT                   /gap_type="unknown"
FT   gene            5671298..5674724
FT                   /locus_tag="mCG_147295"
FT                   /note="gene_id=mCG147295.0"
FT   mRNA            join(5671298..5671490,5673615..5674724)
FT                   /locus_tag="mCG_147295"
FT                   /product="mCG147295"
FT                   /note="gene_id=mCG147295.0 transcript_id=mCT187558.0
FT                   created on 13-JAN-2004"
FT   CDS             5673749..5673988
FT                   /codon_start=1
FT                   /locus_tag="mCG_147295"
FT                   /product="mCG147295"
FT                   /note="gene_id=mCG147295.0 transcript_id=mCT187558.0
FT                   protein_id=mCP109683.0"
FT                   /protein_id="EDL10026.1"
FT                   /translation="MAKEVADIGKSCTLICSFCLCVRSSHDVKGYHLHREDWFSKSVWE
FT                   SSSYLFVILVNINISPGLSISVRMIFTIGLFYPL"
FT   assembly_gap    5675262..5675328
FT                   /estimated_length=67
FT                   /gap_type="unknown"
FT   assembly_gap    5707143..5707162
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5711221..5721535
FT                   /estimated_length=10315
FT                   /gap_type="unknown"
FT   assembly_gap    5730896..5730915
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5756742..5756761
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(5776667..5912425)
FT                   /locus_tag="mCG_62349"
FT                   /note="gene_id=mCG62349.2"
FT   mRNA            complement(join(5776667..5776738,5806842..5807029,
FT                   5812815..5812898,5820927..5821001,5825705..5825860,
FT                   5827275..5827618,5828513..5828610,5829053..5829179,
FT                   5837049..5837089,5912286..5912425))
FT                   /locus_tag="mCG_62349"
FT                   /product="mCG62349"
FT                   /note="gene_id=mCG62349.2 transcript_id=mCT62532.2 created
FT                   on 14-OCT-2002"
FT   assembly_gap    5789936..5790653
FT                   /estimated_length=718
FT                   /gap_type="unknown"
FT   assembly_gap    5809457..5810519
FT                   /estimated_length=1063
FT                   /gap_type="unknown"
FT   CDS             complement(join(5827583..5827618,5828513..5828610,
FT                   5829053..5829179,5837049..5837051))
FT                   /codon_start=1
FT                   /locus_tag="mCG_62349"
FT                   /product="mCG62349"
FT                   /note="gene_id=mCG62349.2 transcript_id=mCT62532.2
FT                   protein_id=mCP34683.2"
FT                   /protein_id="EDL10022.1"
FT                   /translation="MVLYKPEELALQMGESRKKREASHRHLEIGDKGEKEGGLESKKEP
FT                   EVELSATSPAPCLPACHHASLPGNNGLNLRNRETSLAADPRK"
FT   assembly_gap    5855271..5856648
FT                   /estimated_length=1378
FT                   /gap_type="unknown"
FT   assembly_gap    5859452..5859471
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5860549..5860847
FT                   /estimated_length=299
FT                   /gap_type="unknown"
FT   assembly_gap    5882441..5882460
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <5912294..5915870
FT                   /locus_tag="mCG_126946"
FT                   /note="gene_id=mCG126946.1"
FT   mRNA            join(<5912294..5912423,5912710..5913361,5913395..5913490,
FT                   5913726..5915870)
FT                   /locus_tag="mCG_126946"
FT                   /product="mCG126946"
FT                   /note="gene_id=mCG126946.1 transcript_id=mCT128222.1
FT                   created on 30-OCT-2002"
FT   assembly_gap    5912426..5912706
FT                   /estimated_length=281
FT                   /gap_type="unknown"
FT   CDS             <5912742..5913029
FT                   /codon_start=1
FT                   /locus_tag="mCG_126946"
FT                   /product="mCG126946"
FT                   /note="gene_id=mCG126946.1 transcript_id=mCT128222.1
FT                   protein_id=mCP77327.1"
FT                   /protein_id="EDL10021.1"
FT                   /translation="KPNIYTQKQEPPKKVMMTKRTKDMGKFSSVTVSTIDEEEEEIEAR
FT                   EVADSYAQNAKVIEKQLERKGLSKRRLQELAELEAKKAKMKGTLIDNQFK"
FT   assembly_gap    5913503..5913720
FT                   /estimated_length=218
FT                   /gap_type="unknown"
FT   assembly_gap    5932310..5932477
FT                   /estimated_length=168
FT                   /gap_type="unknown"
FT   assembly_gap    5944964..5945368
FT                   /estimated_length=405
FT                   /gap_type="unknown"
FT   assembly_gap    5946465..5946776
FT                   /estimated_length=312
FT                   /gap_type="unknown"
FT   gene            5949056..6067766
FT                   /gene="Stk32a"
FT                   /locus_tag="mCG_126942"
FT                   /note="gene_id=mCG126942.2"
FT   mRNA            join(5949056..5949313,5953297..5953445,5983514..5983569,
FT                   5984511..5984662,6002935..6003108,6005272..6005357)
FT                   /gene="Stk32a"
FT                   /locus_tag="mCG_126942"
FT                   /product="serine/threonine kinase 32A, transcript variant
FT                   mCT174099"
FT                   /note="gene_id=mCG126942.2 transcript_id=mCT174099.0
FT                   created on 16-JUN-2003"
FT   mRNA            join(5949168..5949313,5953297..5953445,5983514..5983569,
FT                   5984511..5984662,6002935..6003108,6031730..6031767,
FT                   6039192..6039281,6047463..6047560,6060257..6060373,
FT                   6061757..6061882,6063348..6063476,6063970..6064034,
FT                   6065215..6065764,6065929..6067766)
FT                   /gene="Stk32a"
FT                   /locus_tag="mCG_126942"
FT                   /product="serine/threonine kinase 32A, transcript variant
FT                   mCT128218"
FT                   /note="gene_id=mCG126942.2 transcript_id=mCT128218.2
FT                   created on 16-JUN-2003"
FT   assembly_gap    5950711..5950730
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(5953394..5953445,5983514..5983569,5984511..5984662,
FT                   6002935..6003108,6031730..6031767,6039192..6039281,
FT                   6047463..6047560,6060257..6060373,6061757..6061882,
FT                   6063348..6063476,6063970..6064034,6065215..6065314)
FT                   /codon_start=1
FT                   /gene="Stk32a"
FT                   /locus_tag="mCG_126942"
FT                   /product="serine/threonine kinase 32A, isoform CRA_a"
FT                   /note="gene_id=mCG126942.2 transcript_id=mCT128218.2
FT                   protein_id=mCP77759.2 isoform=CRA_a"
FT                   /protein_id="EDL10019.1"
FT                   /translation="MGANTSSKAPVFDENEDVNFDHFEILRAIGKGSFGKVCIVRKNDT
FT                   KKMYAMKYMNKQKCVERNEVRNVFKELQIMQGLEHPFLVNLWYSFQDEEDMFMVVDLLL
FT                   GGDLRYHLQQNVHFQEDTVKLFICELAMALDYLQSQRIIHRDMKPDNILLDEHGHVHIT
FT                   DFNIAAMLPKETRITTVAGTKPYMAPEMFTSRKETGYSFAVDWWSLGVTAYELLRGRRP
FT                   YHIRSSTSSKEIVNMFETAIVTYPSAWSQEMVSLLKKLLEPNPDQRFSHLTDIQNFPYM
FT                   SDMNWDAVLQKRLIPGFIPTKGRLNCDPTFELEEMILESKPLHKKKKRLAKREKEMKKS
FT                   DSSQTCLLQEHLDAVQKEFIIFNREKVKSDFNQRQANLALEQTKNNTEEEEDGQNNNL"
FT   CDS             join(5953394..5953445,5983514..5983569,5984511..5984662,
FT                   6002935..6003108,6005272..6005335)
FT                   /codon_start=1
FT                   /gene="Stk32a"
FT                   /locus_tag="mCG_126942"
FT                   /product="serine/threonine kinase 32A, isoform CRA_b"
FT                   /note="gene_id=mCG126942.2 transcript_id=mCT174099.0
FT                   protein_id=mCP97018.0 isoform=CRA_b"
FT                   /protein_id="EDL10020.1"
FT                   /translation="MGANTSSKAPVFDENEDVNFDHFEILRAIGKGSFGKVCIVRKNDT
FT                   KKMYAMKYMNKQKCVERNEVRNVFKELQIMQGLEHPFLVNLWYSFQDEEDMFMVVDLLL
FT                   GGDLRYHLQQNVHFQEDTVKLFICELAMALDYLQSQRIIHRSKAMAASLPFASPLLVRK
FT                   MK"
FT   assembly_gap    5956358..5956449
FT                   /estimated_length=92
FT                   /gap_type="unknown"
FT   assembly_gap    5968206..5968441
FT                   /estimated_length=236
FT                   /gap_type="unknown"
FT   assembly_gap    5996526..5996829
FT                   /estimated_length=304
FT                   /gap_type="unknown"
FT   assembly_gap    6042072..6042431
FT                   /estimated_length=360
FT                   /gap_type="unknown"
FT   assembly_gap    6043697..6043716
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6053025..6056968
FT                   /estimated_length=3944
FT                   /gap_type="unknown"
FT   assembly_gap    6058616..6058635
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6060082..6060101
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6062158..6062276
FT                   /estimated_length=119
FT                   /gap_type="unknown"
FT   assembly_gap    6064271..6064587
FT                   /estimated_length=317
FT                   /gap_type="unknown"
FT   assembly_gap    6065765..6065928
FT                   /estimated_length=164
FT                   /gap_type="unknown"
FT   assembly_gap    6068890..6068909
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6070177..6070196
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(6075023..6185894)
FT                   /gene="Dpysl3"
FT                   /locus_tag="mCG_5618"
FT                   /note="gene_id=mCG5618.2"
FT   mRNA            complement(join(6075023..6076478,6077783..6077945,
FT                   6080305..6080484,6081671..6081841,6084852..6084993,
FT                   6085861..6086017,6093722..6093842,6096586..6096639,
FT                   6101321..6101401,6102182..6102243,6105692..6105856,
FT                   6108417..6108601,6110970..6111058,6140443..6140784))
FT                   /gene="Dpysl3"
FT                   /locus_tag="mCG_5618"
FT                   /product="dihydropyrimidinase-like 3, transcript variant
FT                   mCT4817"
FT                   /note="gene_id=mCG5618.2 transcript_id=mCT4817.2 created on
FT                   11-OCT-2002"
FT   mRNA            complement(join(6075710..6076478,6077783..6077945,
FT                   6080305..6080484,6081671..6081841,6084852..6084993,
FT                   6085861..6086017,6093722..6093842,6096586..6096639,
FT                   6101321..6101401,6102182..6102243,6105692..6105856,
FT                   6108417..6108601,6110970..6111058,6185459..6185894))
FT                   /gene="Dpysl3"
FT                   /locus_tag="mCG_5618"
FT                   /product="dihydropyrimidinase-like 3, transcript variant
FT                   mCT174145"
FT                   /note="gene_id=mCG5618.2 transcript_id=mCT174145.0 created
FT                   on 11-OCT-2002"
FT   mRNA            complement(join(6075946..6076478,6077783..6077945,
FT                   6080305..6080484,6081671..6081841,6084852..6084993,
FT                   6085861..6086017,6093722..6093842,6096586..6096639,
FT                   6101321..6101401,6102182..6102243,6105692..6105856,
FT                   6108417..6108601,6110970..6111058,6120517..6120710))
FT                   /gene="Dpysl3"
FT                   /locus_tag="mCG_5618"
FT                   /product="dihydropyrimidinase-like 3, transcript variant
FT                   mCT174146"
FT                   /note="gene_id=mCG5618.2 transcript_id=mCT174146.0 created
FT                   on 11-OCT-2002"
FT   CDS             complement(join(6076390..6076478,6077783..6077945,
FT                   6080305..6080484,6081671..6081841,6084852..6084993,
FT                   6085861..6086017,6093722..6093842,6096586..6096639,
FT                   6101321..6101401,6102182..6102243,6105692..6105856,
FT                   6108417..6108601,6110970..6111058,6185459..6185836))
FT                   /codon_start=1
FT                   /gene="Dpysl3"
FT                   /locus_tag="mCG_5618"
FT                   /product="dihydropyrimidinase-like 3, isoform CRA_a"
FT                   /note="gene_id=mCG5618.2 transcript_id=mCT174145.0
FT                   protein_id=mCP97064.0 isoform=CRA_a"
FT                   /protein_id="EDL10016.1"
FT                   /translation="MASGRRGWDSSHEDDLPVYLARPGTTDQVPRQKYGGMFCNVEGAF
FT                   ESKTLDFDALSVGQRGAKTPRSSQGSGRGAGNRPGMEVDARRGPGREESREPAPESPKP
FT                   AGVEIRSATGKEVLQNLGPKDKSDRLLIKGGRIVNDDQSFYADIYMEDGLIKQIGDNLI
FT                   VPGGVKTIEANGKMVIPGGIDVHTHFQMPYKGMTTVDDFFQGTKAALAGGTTMIIDHVV
FT                   PEPESSLTEAYEKWREWADGKSCCDYALHVDITHWNDSVKQEVQSLSKEKGVNSFMVYM
FT                   AYKDLYQVSNTELYEIFTCLGELGAIAQVHAENGDIIAQAGNGDNRPRRPVLSRPEELE
FT                   AEAVFRAITVASQTNCPLYVTKVMSKSAADLISQARKKGNVVFGEPITASLGIDGTHYW
FT                   SKNWAKAAAFVTSPPLSPDPTTPDYINSLLASGDLQLSGSAHCTFSTAQKAIGKDNFTA
FT                   IPEGTNGVEERMSVIWDKAVATGKMDENQFVAVTSTNAAKIFNLYPRKGRIAVGSDSDL
FT                   VIWDPDALKIVSAKNHQSVAEYNIFEGMELRGAPLVVICQGKIMLEDGNLHVTQGAGRF
FT                   IPCSPFSDYVYKRIKARRKMADLHAVPRGMYDGPVFDLTTTPKGGTPAGSTRGSPTRPN
FT                   PPVRNLHQSGFSLSGTQVDEGVRSASKRIVAPPGGRSNITSLS"
FT   CDS             complement(join(6076390..6076478,6077783..6077945,
FT                   6080305..6080484,6081671..6081841,6084852..6084993,
FT                   6085861..6086017,6093722..6093842,6096586..6096639,
FT                   6101321..6101401,6102182..6102243,6105692..6105856,
FT                   6108417..6108601,6110970..6111058,6140443..6140481))
FT                   /codon_start=1
FT                   /gene="Dpysl3"
FT                   /locus_tag="mCG_5618"
FT                   /product="dihydropyrimidinase-like 3, isoform CRA_c"
FT                   /note="gene_id=mCG5618.2 transcript_id=mCT4817.2
FT                   protein_id=mCP13146.2 isoform=CRA_c"
FT                   /protein_id="EDL10018.1"
FT                   /translation="MSYQGKKNIPRITSDRLLIKGGRIVNDDQSFYADIYMEDGLIKQI
FT                   GDNLIVPGGVKTIEANGKMVIPGGIDVHTHFQMPYKGMTTVDDFFQGTKAALAGGTTMI
FT                   IDHVVPEPESSLTEAYEKWREWADGKSCCDYALHVDITHWNDSVKQEVQSLSKEKGVNS
FT                   FMVYMAYKDLYQVSNTELYEIFTCLGELGAIAQVHAENGDIIAQAGNGDNRPRRPVLSR
FT                   PEELEAEAVFRAITVASQTNCPLYVTKVMSKSAADLISQARKKGNVVFGEPITASLGID
FT                   GTHYWSKNWAKAAAFVTSPPLSPDPTTPDYINSLLASGDLQLSGSAHCTFSTAQKAIGK
FT                   DNFTAIPEGTNGVEERMSVIWDKAVATGKMDENQFVAVTSTNAAKIFNLYPRKGRIAVG
FT                   SDSDLVIWDPDALKIVSAKNHQSVAEYNIFEGMELRGAPLVVICQGKIMLEDGNLHVTQ
FT                   GAGRFIPCSPFSDYVYKRIKARRKMADLHAVPRGMYDGPVFDLTTTPKGGTPAGSTRGS
FT                   PTRPNPPVRNLHQSGFSLSGTQVDEGVRSASKRIVAPPGGRSNITSLS"
FT   CDS             complement(join(6076390..6076478,6077783..6077945,
FT                   6080305..6080484,6081671..6081841,6084852..6084993,
FT                   6085861..6086017,6093722..6093842,6096586..6096639,
FT                   6101321..6101401,6102182..6102243,6105692..6105856,
FT                   6108417..6108601,6110970..6111058,6120517..6120549))
FT                   /codon_start=1
FT                   /gene="Dpysl3"
FT                   /locus_tag="mCG_5618"
FT                   /product="dihydropyrimidinase-like 3, isoform CRA_b"
FT                   /note="gene_id=mCG5618.2 transcript_id=mCT174146.0
FT                   protein_id=mCP97065.0 isoform=CRA_b"
FT                   /protein_id="EDL10017.1"
FT                   /translation="MYSPSRNKIRQSDRLLIKGGRIVNDDQSFYADIYMEDGLIKQIGD
FT                   NLIVPGGVKTIEANGKMVIPGGIDVHTHFQMPYKGMTTVDDFFQGTKAALAGGTTMIID
FT                   HVVPEPESSLTEAYEKWREWADGKSCCDYALHVDITHWNDSVKQEVQSLSKEKGVNSFM
FT                   VYMAYKDLYQVSNTELYEIFTCLGELGAIAQVHAENGDIIAQAGNGDNRPRRPVLSRPE
FT                   ELEAEAVFRAITVASQTNCPLYVTKVMSKSAADLISQARKKGNVVFGEPITASLGIDGT
FT                   HYWSKNWAKAAAFVTSPPLSPDPTTPDYINSLLASGDLQLSGSAHCTFSTAQKAIGKDN
FT                   FTAIPEGTNGVEERMSVIWDKAVATGKMDENQFVAVTSTNAAKIFNLYPRKGRIAVGSD
FT                   SDLVIWDPDALKIVSAKNHQSVAEYNIFEGMELRGAPLVVICQGKIMLEDGNLHVTQGA
FT                   GRFIPCSPFSDYVYKRIKARRKMADLHAVPRGMYDGPVFDLTTTPKGGTPAGSTRGSPT
FT                   RPNPPVRNLHQSGFSLSGTQVDEGVRSASKRIVAPPGGRSNITSLS"
FT   assembly_gap    6079568..6079661
FT                   /estimated_length=94
FT                   /gap_type="unknown"
FT   assembly_gap    6089428..6089447
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6096643..6096662
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6097769..6097788
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6100393..6100412
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6128264..6128324
FT                   /estimated_length=61
FT                   /gap_type="unknown"
FT   assembly_gap    6163415..6163517
FT                   /estimated_length=103
FT                   /gap_type="unknown"
FT   assembly_gap    6171747..6171975
FT                   /estimated_length=229
FT                   /gap_type="unknown"
FT   assembly_gap    6182718..6182737
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6200699..6207103
FT                   /estimated_length=6405
FT                   /gap_type="unknown"
FT   assembly_gap    6211572..6211591
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6212861..6212962
FT                   /estimated_length=102
FT                   /gap_type="unknown"
FT   assembly_gap    6216405..6218709
FT                   /estimated_length=2305
FT                   /gap_type="unknown"
FT   gene            complement(6221457..6428406)
FT                   /locus_tag="mCG_4624"
FT                   /note="gene_id=mCG4624.2"
FT   mRNA            complement(join(6221457..6222194,6287975..6288178,
FT                   6290657..6290734,6293199..6293267,6297522..6297587,
FT                   6298371..6298424,6299181..6299279,6300135..6300233,
FT                   6303574..6303636,6304312..6304395,6306912..6307040,
FT                   6308140..6308259,6309117..6309173,6312102..6312242,
FT                   6312890..6313036,6316499..6316597,6318338..6318547,
FT                   6322867..6323364,6331583..6331861,6428272..6428316))
FT                   /locus_tag="mCG_4624"
FT                   /product="mCG4624, transcript variant mCT174142"
FT                   /note="gene_id=mCG4624.2 transcript_id=mCT174142.0 created
FT                   on 11-OCT-2002"
FT   mRNA            complement(join(6221457..6222194,6281621..6281686,
FT                   6287975..6288178,6290657..6290734,6293199..6293267,
FT                   6297522..6297587,6298371..6298424,6299181..6299279,
FT                   6300135..6300233,6303574..6303636,6304312..6304395,
FT                   6306912..6307040,6308140..6308259,6309117..6309173,
FT                   6312102..6312242,6312890..6313036,6316499..6316597,
FT                   6318338..6318547,6322867..6323364,6331583..6331861,
FT                   6428272..6428316))
FT                   /locus_tag="mCG_4624"
FT                   /product="mCG4624, transcript variant mCT174141"
FT                   /note="gene_id=mCG4624.2 transcript_id=mCT174141.0 created
FT                   on 11-OCT-2002"
FT   CDS             complement(join(6222147..6222194,6287975..6288178,
FT                   6290657..6290734,6293199..6293267,6297522..6297587,
FT                   6298371..6298424,6299181..6299279,6300135..6300233,
FT                   6303574..6303636,6304312..6304395,6306912..6307040,
FT                   6308140..6308259,6309117..6309173,6312102..6312242,
FT                   6312890..6313036,6316499..6316597,6318338..6318547,
FT                   6322867..6323364,6331583..6331711))
FT                   /codon_start=1
FT                   /locus_tag="mCG_4624"
FT                   /product="mCG4624, isoform CRA_b"
FT                   /note="gene_id=mCG4624.2 transcript_id=mCT174142.0
FT                   protein_id=mCP97061.0 isoform=CRA_b"
FT                   /protein_id="EDL10014.1"
FT                   /translation="MSKKGRNKGEKPEALIVALQAANEDLRTKLTDIQIELHQEKSKVS
FT                   KLEREKTQEAKRIRELEQRKHTVLVTELKAKLHEEKMKELQAVRENLIKQHEQEMSRTV
FT                   KVRDGEIQRLKSALCALRDGSSDKVRTALTIEAREEARKQFDAERLKLLQEITDLKTAK
FT                   KQVDEALSNMIQADKIKAGDLRSEHQSHQEAISKIKWESERDIRRLMDEIKAKDRIIFS
FT                   LEKELETQTGYVQKLQLQKEALDEQLFLVKEAECNMSSPKREIPGRAGDGSEHCSSPDL
FT                   RRNQKRIAELNATIRKLEDRNTLLGDERNELLKRVRETEKQCKPLLERNKCLAKRNDEL
FT                   MVSLQRMEEKLKAVTKENSEMREKITSHPPLKKLKSLNDLDQANEEQETEFLKLQVIEQ
FT                   QNIIDELTRDREKLIRRRKHRRSSKPIKRPVLDPFIGYDEDSMDSETSSMTSFRTDRTP
FT                   ATPDDDLDESLAAEESELRFRQLTKEYQALQRAYALLQEQTGGIIDAEREAKAQEQLQA
FT                   EVLRYRAKIEDLEATLAQKGQDSHWVEDKQLFIKRNQELLEKIEKQEAENHRLQQELQD
FT                   ARDQNELLEFRNLELEERERRSPPFNLQIHPFSDGVSALQIYCMKEGVKDVNIPDLIKQ
FT                   LDILGDNGNLRNEEQVAIIQASTVLSLAEKWIQQIEGAEAALHQKMMELESDMEQFCKI
FT                   KGYLEEELDYRKQALDQAYMRIQELEATLYNALQQETVIKFGELLSDKQQEELRTAVEK
FT                   LRRQMLRKSREYDCQILQERMELLQQAHQSRPSSCQVPCSHSCP"
FT   CDS             complement(join(6222147..6222194,6281621..6281686,
FT                   6287975..6288178,6290657..6290734,6293199..6293267,
FT                   6297522..6297587,6298371..6298424,6299181..6299279,
FT                   6300135..6300233,6303574..6303636,6304312..6304395,
FT                   6306912..6307040,6308140..6308259,6309117..6309173,
FT                   6312102..6312242,6312890..6313036,6316499..6316597,
FT                   6318338..6318547,6322867..6323364,6331583..6331711))
FT                   /codon_start=1
FT                   /locus_tag="mCG_4624"
FT                   /product="mCG4624, isoform CRA_a"
FT                   /note="gene_id=mCG4624.2 transcript_id=mCT174141.0
FT                   protein_id=mCP97060.0 isoform=CRA_a"
FT                   /protein_id="EDL10013.1"
FT                   /translation="MSKKGRNKGEKPEALIVALQAANEDLRTKLTDIQIELHQEKSKVS
FT                   KLEREKTQEAKRIRELEQRKHTVLVTELKAKLHEEKMKELQAVRENLIKQHEQEMSRTV
FT                   KVRDGEIQRLKSALCALRDGSSDKVRTALTIEAREEARKQFDAERLKLLQEITDLKTAK
FT                   KQVDEALSNMIQADKIKAGDLRSEHQSHQEAISKIKWESERDIRRLMDEIKAKDRIIFS
FT                   LEKELETQTGYVQKLQLQKEALDEQLFLVKEAECNMSSPKREIPGRAGDGSEHCSSPDL
FT                   RRNQKRIAELNATIRKLEDRNTLLGDERNELLKRVRETEKQCKPLLERNKCLAKRNDEL
FT                   MVSLQRMEEKLKAVTKENSEMREKITSHPPLKKLKSLNDLDQANEEQETEFLKLQVIEQ
FT                   QNIIDELTRDREKLIRRRKHRRSSKPIKRPVLDPFIGYDEDSMDSETSSMTSFRTDRTP
FT                   ATPDDDLDESLAAEESELRFRQLTKEYQALQRAYALLQEQTGGIIDAEREAKAQEQLQA
FT                   EVLRYRAKIEDLEATLAQKGQDSHWVEDKQLFIKRNQELLEKIEKQEAENHRLQQELQD
FT                   ARDQNELLEFRNLELEERERRSPPFNLQIHPFSDGVSALQIYCMKEGVKDVNIPDLIKQ
FT                   LDILGDNGNLRNEEQVAIIQASTVLSLAEKWIQQIEGAEAALHQKMMELESDMEQFCKI
FT                   KGYLEEELDYRKQALDQAYMRIQELEATLYNALQQETVIKFGELLSDKQQEELRTAVEK
FT                   LRRQMLRKSREYDCQILQERMELLQQAHQRIRDLEDKTDIQKRQIKDLEEKSRPSSCQV
FT                   PCSHSCP"
FT   assembly_gap    6248332..6248727
FT                   /estimated_length=396
FT                   /gap_type="unknown"
FT   mRNA            complement(join(6272444..6272999,6278691..6278761,
FT                   6281621..6281686,6287975..6288178,6290657..6290734,
FT                   6293199..6293267,6297522..6297587,6298371..6298424,
FT                   6299181..6299279,6300135..6300233,6303574..6303636,
FT                   6304312..6304395,6306912..6307040,6308140..6308259,
FT                   6309117..6309173,6312102..6312242,6312890..6313036,
FT                   6316499..6316597,6318338..6318547,6322867..6323364,
FT                   6331583..6331861,6428272..6428406))
FT                   /locus_tag="mCG_4624"
FT                   /product="mCG4624, transcript variant mCT4015"
FT                   /note="gene_id=mCG4624.2 transcript_id=mCT4015.2 created on
FT                   11-OCT-2002"
FT   CDS             complement(join(6278711..6278761,6281621..6281686,
FT                   6287975..6288178,6290657..6290734,6293199..6293267,
FT                   6297522..6297587,6298371..6298424,6299181..6299279,
FT                   6300135..6300233,6303574..6303636,6304312..6304395,
FT                   6306912..6307040,6308140..6308259,6309117..6309173,
FT                   6312102..6312242,6312890..6313036,6316499..6316597,
FT                   6318338..6318547,6322867..6323364,6331583..6331711))
FT                   /codon_start=1
FT                   /locus_tag="mCG_4624"
FT                   /product="mCG4624, isoform CRA_c"
FT                   /note="gene_id=mCG4624.2 transcript_id=mCT4015.2
FT                   protein_id=mCP13142.2 isoform=CRA_c"
FT                   /db_xref="GOA:D3YXK0"
FT                   /db_xref="InterPro:IPR024836"
FT                   /db_xref="MGI:MGI:1923467"
FT                   /db_xref="UniProtKB/TrEMBL:D3YXK0"
FT                   /protein_id="EDL10015.1"
FT                   /translation="MSKKGRNKGEKPEALIVALQAANEDLRTKLTDIQIELHQEKSKVS
FT                   KLEREKTQEAKRIRELEQRKHTVLVTELKAKLHEEKMKELQAVRENLIKQHEQEMSRTV
FT                   KVRDGEIQRLKSALCALRDGSSDKVRTALTIEAREEARKQFDAERLKLLQEITDLKTAK
FT                   KQVDEALSNMIQADKIKAGDLRSEHQSHQEAISKIKWESERDIRRLMDEIKAKDRIIFS
FT                   LEKELETQTGYVQKLQLQKEALDEQLFLVKEAECNMSSPKREIPGRAGDGSEHCSSPDL
FT                   RRNQKRIAELNATIRKLEDRNTLLGDERNELLKRVRETEKQCKPLLERNKCLAKRNDEL
FT                   MVSLQRMEEKLKAVTKENSEMREKITSHPPLKKLKSLNDLDQANEEQETEFLKLQVIEQ
FT                   QNIIDELTRDREKLIRRRKHRRSSKPIKRPVLDPFIGYDEDSMDSETSSMTSFRTDRTP
FT                   ATPDDDLDESLAAEESELRFRQLTKEYQALQRAYALLQEQTGGIIDAEREAKAQEQLQA
FT                   EVLRYRAKIEDLEATLAQKGQDSHWVEDKQLFIKRNQELLEKIEKQEAENHRLQQELQD
FT                   ARDQNELLEFRNLELEERERRSPPFNLQIHPFSDGVSALQIYCMKEGVKDVNIPDLIKQ
FT                   LDILGDNGNLRNEEQVAIIQASTVLSLAEKWIQQIEGAEAALHQKMMELESDMEQFCKI
FT                   KGYLEEELDYRKQALDQAYMRIQELEATLYNALQQETVIKFGELLSDKQQEELRTAVEK
FT                   LRRQMLRKSREYDCQILQERMELLQQAHQRIRDLEDKTDIQKRQIKDLEEKFLFLFLFF
FT                   SLAFILWP"
FT   assembly_gap    6335894..6336495
FT                   /estimated_length=602
FT                   /gap_type="unknown"
FT   assembly_gap    6363384..6363783
FT                   /estimated_length=400
FT                   /gap_type="unknown"
FT   assembly_gap    6365787..6365843
FT                   /estimated_length=57
FT                   /gap_type="unknown"
FT   assembly_gap    6377450..6377549
FT                   /estimated_length=100
FT                   /gap_type="unknown"
FT   assembly_gap    6397708..6397727
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6438960..6439081
FT                   /estimated_length=122
FT                   /gap_type="unknown"
FT   assembly_gap    6442560..6442693
FT                   /estimated_length=134
FT                   /gap_type="unknown"
FT   assembly_gap    6462365..6462384
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(6463053..6478395)
FT                   /gene="Spink3"
FT                   /locus_tag="mCG_4621"
FT                   /note="gene_id=mCG4621.1"
FT   mRNA            complement(join(6463053..6463175,6474687..6474793,
FT                   6476365..6476399,6478296..6478395))
FT                   /gene="Spink3"
FT                   /locus_tag="mCG_4621"
FT                   /product="serine peptidase inhibitor, Kazal type 3"
FT                   /note="gene_id=mCG4621.1 transcript_id=mCT4017.1 created on
FT                   11-OCT-2002"
FT   CDS             complement(join(6463130..6463175,6474687..6474793,
FT                   6476365..6476399,6478296..6478350))
FT                   /codon_start=1
FT                   /gene="Spink3"
FT                   /locus_tag="mCG_4621"
FT                   /product="serine peptidase inhibitor, Kazal type 3"
FT                   /note="gene_id=mCG4621.1 transcript_id=mCT4017.1
FT                   protein_id=mCP13134.2"
FT                   /protein_id="EDL10012.1"
FT                   /translation="MKVAVIFLLSALALLSLAGNTFSAKVTGKEASCHDAVAGCPRIYD
FT                   PVCGTDGITYANECVLCFENRKRIEPVLIRKGGPC"
FT   assembly_gap    6465515..6470419
FT                   /estimated_length=4905
FT                   /gap_type="unknown"
FT   assembly_gap    6472925..6472944
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6479818..6479837
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6489354..6489373
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6490389..6490408
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6493793..6497947
FT                   /estimated_length=4155
FT                   /gap_type="unknown"
FT   assembly_gap    6505792..6505811
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            6511432..6514508
FT                   /gene="Scgb3a2"
FT                   /locus_tag="mCG_4629"
FT                   /note="gene_id=mCG4629.2"
FT   mRNA            join(6511432..6511581,6513814..6514010,6514341..6514496)
FT                   /gene="Scgb3a2"
FT                   /locus_tag="mCG_4629"
FT                   /product="secretoglobin, family 3A, member 2, transcript
FT                   variant mCT4014"
FT                   /note="gene_id=mCG4629.2 transcript_id=mCT4014.1 created on
FT                   11-OCT-2002"
FT   mRNA            join(6511436..6511581,6513814..6514508)
FT                   /gene="Scgb3a2"
FT                   /locus_tag="mCG_4629"
FT                   /product="secretoglobin, family 3A, member 2, transcript
FT                   variant mCT174144"
FT                   /note="gene_id=mCG4629.2 transcript_id=mCT174144.0 created
FT                   on 11-OCT-2002"
FT   mRNA            join(6511436..6511581,6513814..6514076,6514341..6514508)
FT                   /gene="Scgb3a2"
FT                   /locus_tag="mCG_4629"
FT                   /product="secretoglobin, family 3A, member 2, transcript
FT                   variant mCT174143"
FT                   /note="gene_id=mCG4629.2 transcript_id=mCT174143.0 created
FT                   on 11-OCT-2002"
FT   CDS             join(6511527..6511581,6513814..6514076,6514341..6514364)
FT                   /codon_start=1
FT                   /gene="Scgb3a2"
FT                   /locus_tag="mCG_4629"
FT                   /product="secretoglobin, family 3A, member 2, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG4629.2 transcript_id=mCT174143.0
FT                   protein_id=mCP97063.0 isoform=CRA_a"
FT                   /protein_id="EDL10009.1"
FT                   /translation="MKLVSIFLLVTIGICGYSATALLINRLPVVDKLPVPLDDIIPSFD
FT                   PLKMLLKTLGISVEHLVTGLKKCVDELGPEASEAVKKLLVIIICSYFPGRSLCYVNNLP
FT                   SFEALSHLV"
FT   CDS             join(6511527..6511581,6513814..6514010,6514341..6514364)
FT                   /codon_start=1
FT                   /gene="Scgb3a2"
FT                   /locus_tag="mCG_4629"
FT                   /product="secretoglobin, family 3A, member 2, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG4629.2 transcript_id=mCT4014.1
FT                   protein_id=mCP13150.1 isoform=CRA_c"
FT                   /db_xref="GOA:Q5D060"
FT                   /db_xref="InterPro:IPR016126"
FT                   /db_xref="MGI:MGI:2153470"
FT                   /db_xref="UniProtKB/TrEMBL:Q5D060"
FT                   /protein_id="EDL10011.1"
FT                   /translation="MKLVSIFLLVTIGICGYSATALLINRLPVVDKLPVPLDDIIPSFD
FT                   PLKMLLKTLGISVEHLVTGLKKCVDELGPEASEAVKKLLEALSHLV"
FT   CDS             join(6511527..6511581,6513814..6514178)
FT                   /codon_start=1
FT                   /gene="Scgb3a2"
FT                   /locus_tag="mCG_4629"
FT                   /product="secretoglobin, family 3A, member 2, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG4629.2 transcript_id=mCT174144.0
FT                   protein_id=mCP97062.0 isoform=CRA_b"
FT                   /protein_id="EDL10010.1"
FT                   /translation="MKLVSIFLLVTIGICGYSATALLINRLPVVDKLPVPLDDIIPSFD
FT                   PLKMLLKTLGISVEHLVTGLKKCVDELGPEASEAVKKLLVIIICSYFPGRSLCYVNNLP
FT                   SFVSVLFLPMICAYPRDSKKQTFAFIERVFEQSKL"
FT   gene            complement(6524808..6541525)
FT                   /locus_tag="mCG_4626"
FT                   /note="gene_id=mCG4626.2"
FT   mRNA            complement(join(6524808..6525214,6528800..6528858,
FT                   6532167..6532320,6541371..6541525))
FT                   /locus_tag="mCG_4626"
FT                   /product="mCG4626"
FT                   /note="gene_id=mCG4626.2 transcript_id=mCT4020.2 created on
FT                   11-OCT-2002"
FT   CDS             complement(join(6528801..6528858,6532167..6532320,
FT                   6541371..6541440))
FT                   /codon_start=1
FT                   /locus_tag="mCG_4626"
FT                   /product="mCG4626"
FT                   /note="gene_id=mCG4626.2 transcript_id=mCT4020.2
FT                   protein_id=mCP13147.2"
FT                   /db_xref="GOA:B2RV94"
FT                   /db_xref="InterPro:IPR027950"
FT                   /db_xref="MGI:MGI:2684940"
FT                   /db_xref="UniProtKB/TrEMBL:B2RV94"
FT                   /protein_id="EDL10008.1"
FT                   /translation="MAVSVLRLMVVLGLSALILTCRADDNPNENDNPDSKPDDSSKNPE
FT                   PGFPKFLSILGSEIIENAVDFILRSMSRGSSFMELEGDPGQQPSKVTS"
FT   assembly_gap    6534395..6534414
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6536667..6536686
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6561191..6561416
FT                   /estimated_length=226
FT                   /gap_type="unknown"
FT   assembly_gap    6563328..6563512
FT                   /estimated_length=185
FT                   /gap_type="unknown"
FT   assembly_gap    6567434..6567453
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6569882..6570045
FT                   /estimated_length=164
FT                   /gap_type="unknown"
FT   assembly_gap    6571564..6583633
FT                   /estimated_length=12070
FT                   /gap_type="unknown"
FT   assembly_gap    6585688..6585707
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6590466..6590485
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6595814..6595879
FT                   /estimated_length=66
FT                   /gap_type="unknown"
FT   assembly_gap    6614453..6614507
FT                   /estimated_length=55
FT                   /gap_type="unknown"
FT   assembly_gap    6618994..6619370
FT                   /estimated_length=377
FT                   /gap_type="unknown"
FT   assembly_gap    6640209..6641304
FT                   /estimated_length=1096
FT                   /gap_type="unknown"
FT   assembly_gap    6646171..6646277
FT                   /estimated_length=107
FT                   /gap_type="unknown"
FT   assembly_gap    6648973..6648992
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6663678..6663697
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6676094..6676256
FT                   /estimated_length=163
FT                   /gap_type="unknown"
FT   assembly_gap    6684439..6684929
FT                   /estimated_length=491
FT                   /gap_type="unknown"
FT   assembly_gap    6685923..6686517
FT                   /estimated_length=595
FT                   /gap_type="unknown"
FT   gene            6706287..6765498
FT                   /locus_tag="mCG_127182"
FT                   /note="gene_id=mCG127182.0"
FT   mRNA            join(6706287..6706406,6707475..6707500,6710031..6710158,
FT                   6712322..6712397,6720663..6720790,6724141..6724204,
FT                   6725189..6725316,6726555..6726621,6729303..6729430,
FT                   6730788..6730875,6732365..6732492,6733661..6733739,
FT                   6735159..6735286,6735876..6735924,6739618..6739745,
FT                   6741785..6741866,6742808..6742932,6743515..6743575,
FT                   6746199..6746326,6749387..6749480,6750645..6750772,
FT                   6752198..6752270,6752925..6753052,6753216..6753294,
FT                   6755852..6755979,6756933..6757002,6757698..6757787,
FT                   6757894..6758021,6758599..6758695,6759378..6759508,
FT                   6761711..6761844,6763834..6765498)
FT                   /locus_tag="mCG_127182"
FT                   /product="mCG127182"
FT                   /note="gene_id=mCG127182.0 transcript_id=mCT128464.1
FT                   created on 11-OCT-2002"
FT   CDS             join(6706352..6706406,6707475..6707500,6710031..6710158,
FT                   6712322..6712397,6720663..6720790,6724141..6724204,
FT                   6725189..6725316,6726555..6726621,6729303..6729430,
FT                   6730788..6730875,6732365..6732492,6733661..6733739,
FT                   6735159..6735286,6735876..6735924,6739618..6739745,
FT                   6741785..6741866,6742808..6742932,6743515..6743575,
FT                   6746199..6746326,6749387..6749480,6750645..6750772,
FT                   6752198..6752270,6752925..6753052,6753216..6753294,
FT                   6755852..6755979,6756933..6757002,6757698..6757787,
FT                   6757894..6758021,6758599..6758695,6759378..6759508,
FT                   6761711..6761844,6763834..6763952)
FT                   /codon_start=1
FT                   /locus_tag="mCG_127182"
FT                   /product="mCG127182"
FT                   /note="gene_id=mCG127182.0 transcript_id=mCT128464.1
FT                   protein_id=mCP77912.1"
FT                   /protein_id="EDL10007.1"
FT                   /translation="MKTATVPMLLTLAFYLTQDAAGEKGNQDPCMKFQAQMKNGTLTCP
FT                   KGNNSSQSLNDIIFQSECILCKRALEQGAPTKIMNVKVLSRANRATDPAKLNCESFKQR
FT                   RKDGDFICPSDTSSVCGTDGKTYRSRCELCAENAKSQNHVDVKSEGECGSSHLETDMCS
FT                   DFRAYVQDGRLGCTRESDPILGPDGRTHGNRCAMCAELFLKEAKENATRNRESRIRRDA
FT                   EKELCKEFENQVRNGRLFCTRESDPIRGPDGKMHGNKCALCAEIFMRQFTEEKGKAEKN
FT                   QKDAEERAKAKMEIQKRCSEFQDRARNGTLFCTRENDPIRGLDGKTHGNLCSMCQAFFK
FT                   TEAEEKKAEAGSRNRRGSEESETYAKLCDEYRKARKNGQLYCTRENAPIRGPDGKIHGN
FT                   TCSMCQAFFIQEDKARAKVKREAAKEMCSEFRNQARNGMLMCTRENDPVVGPDGKRHSN
FT                   KCAMCASVFLLEEEEKKKDDKTEKVDAGKAKKEAVQLCRKYHTQLRNGPLRCTRRNNPI
FT                   EGLDGKMYKNACFMCWAFFQQEAKKSGAGFRPKVKREVKVDCSEYLALSKRGEIFCTRE
FT                   NDPVRGPDGKTHGNKCAMCKAVFKKENEERKRKEGENQRITSGESSSGGNPKAKDECAQ
FT                   YRESMKHGQLSCTRESDPVRGVDGEHYNNKCVMCKELLQKEMEETNKNSASRSNGTGSA
FT                   TGKDVCDQFRSQMKNGKLLCTRESDPTRGPDGAMHGNKCAMCKERLEKEAAEKKKKEDE
FT                   EKRNTETNKSDKEDKCHEYRSMQLDGRLICTRENDPVRDADGKMHVNKCAMCQMMFERE
FT                   ANERKMREENSRSQPTNEAKDQCGEVHNSVEDAKPRPARSSLPSIRGISKDECSEFQNL
FT                   MKNEKLTCPETDDPVRGADGTFYQNKCHMCRDVLKNEAMKRSGLQEKSSDIRSTKEGDP
FT                   EFSSSSRDSDMCKNYRILPRMGYLCPKNLNPVCGDDGQTYSNPCMLCHENLMRQTNTRI
FT                   HKQGACEESSNLKTVSTGTPASVSALAFGVKVVVVEGKNDAMIGEITEKKLSLDSELPA
FT                   FTICVYKEFFKLIFLL"
FT   gene            6771701..6775183
FT                   /locus_tag="mCG_1033458"
FT                   /note="gene_id=mCG1033458.0"
FT   mRNA            join(6771701..6771829,6772552..6772595,6773848..6773984,
FT                   6774838..6774883,6774998..6775183)
FT                   /locus_tag="mCG_1033458"
FT                   /product="mCG1033458"
FT                   /note="gene_id=mCG1033458.0 transcript_id=mCT151162.0
FT                   created on 10-MAR-2003"
FT   CDS             join(6771766..6771829,6772552..6772595,6773848..6773984,
FT                   6774838..6774883)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1033458"
FT                   /product="mCG1033458"
FT                   /note="gene_id=mCG1033458.0 transcript_id=mCT151162.0
FT                   protein_id=mCP77316.1"
FT                   /db_xref="GOA:B9EJP9"
FT                   /db_xref="InterPro:IPR002350"
FT                   /db_xref="MGI:MGI:3646952"
FT                   /db_xref="UniProtKB/TrEMBL:B9EJP9"
FT                   /protein_id="EDL10006.1"
FT                   /translation="MVKYFQCSVLFSIMLHLVILAAPGARVWWPTHGLIKIKCPYKKVN
FT                   LSWFNKTVDPCPDLKQPICGTNFVTYDNPCILCVESLKSGGRIRYYYNGRC"
FT   assembly_gap    6776108..6776127
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6778179..6778198
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6790684..6797012
FT                   /estimated_length=6329
FT                   /gap_type="unknown"
FT   assembly_gap    6798086..6798105
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6800218..6800750
FT                   /estimated_length=533
FT                   /gap_type="unknown"
FT   assembly_gap    6803388..6803998
FT                   /estimated_length=611
FT                   /gap_type="unknown"
FT   gene            6811974..6812709
FT                   /pseudo
FT                   /locus_tag="mCG_4622"
FT                   /note="gene_id=mCG4622.2"
FT   mRNA            6811974..6812709
FT                   /pseudo
FT                   /locus_tag="mCG_4622"
FT                   /note="gene_id=mCG4622.2 transcript_id=mCT4018.2 created on
FT                   17-OCT-2002"
FT   assembly_gap    6819900..6819919
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            6821904..6834113
FT                   /locus_tag="mCG_58554"
FT                   /note="gene_id=mCG58554.1"
FT   mRNA            join(6821904..6822036,6824913..6824935,6830623..6830697,
FT                   6832758..6832873,6833875..6834113)
FT                   /locus_tag="mCG_58554"
FT                   /product="mCG58554, transcript variant mCT58737"
FT                   /note="gene_id=mCG58554.1 transcript_id=mCT58737.1 created
FT                   on 11-OCT-2002"
FT   CDS             join(6821979..6822036,6824913..6824935,6830623..6830697,
FT                   6832758..6832873,6833875..6833920)
FT                   /codon_start=1
FT                   /locus_tag="mCG_58554"
FT                   /product="mCG58554, isoform CRA_b"
FT                   /note="gene_id=mCG58554.1 transcript_id=mCT58737.1
FT                   protein_id=mCP34668.2 isoform=CRA_b"
FT                   /protein_id="EDL10005.1"
FT                   /translation="MKVAGVFLLLSLALLCFFSGAFSQGGQDKRGWITRSEGRFPGKGV
FT                   LRHRLFQINCGEFRDPKVFCTRESDPLCGSDGQTYGNKCAFCKALEKSSGKINLKHRGK
FT                   C"
FT   mRNA            join(6824361..6824466,6824913..6824935,6832758..6832873,
FT                   6833875..6834111)
FT                   /locus_tag="mCG_58554"
FT                   /product="mCG58554, transcript variant mCT174149"
FT                   /note="gene_id=mCG58554.1 transcript_id=mCT174149.0 created
FT                   on 11-OCT-2002"
FT   CDS             join(6824367..6824466,6824913..6824935,6832758..6832873,
FT                   6833875..6833920)
FT                   /codon_start=1
FT                   /locus_tag="mCG_58554"
FT                   /product="mCG58554, isoform CRA_a"
FT                   /note="gene_id=mCG58554.1 transcript_id=mCT174149.0
FT                   protein_id=mCP97068.0 isoform=CRA_a"
FT                   /protein_id="EDL10004.1"
FT                   /translation="MRRELHKKPSSGIQRNREGTKNEGSERGGNQSLSAFSQGGQINCG
FT                   EFRDPKVFCTRESDPLCGSDGQTYGNKCAFCKALEKSSGKINLKHRGKC"
FT   assembly_gap    6842124..6842598
FT                   /estimated_length=475
FT                   /gap_type="unknown"
FT   gene            6855072..6859188
FT                   /gene="9230117E20Rik"
FT                   /locus_tag="mCG_4966"
FT                   /note="gene_id=mCG4966.1"
FT   mRNA            join(6855072..6855435,6857178..6857203,6858336..6858463,
FT                   6858702..6859188)
FT                   /gene="9230117E20Rik"
FT                   /locus_tag="mCG_4966"
FT                   /product="RIKEN cDNA 9230117E20"
FT                   /note="gene_id=mCG4966.1 transcript_id=mCT4024.1 created on
FT                   11-OCT-2002"
FT   CDS             join(6855321..6855435,6857178..6857203,6858336..6858463,
FT                   6858702..6858750)
FT                   /codon_start=1
FT                   /gene="9230117E20Rik"
FT                   /locus_tag="mCG_4966"
FT                   /product="RIKEN cDNA 9230117E20"
FT                   /note="gene_id=mCG4966.1 transcript_id=mCT4024.1
FT                   protein_id=mCP13145.1"
FT                   /protein_id="EDL10003.1"
FT                   /translation="MFNAPNISVFSDLKILSAMKPAGAFLLLISLACLFLSVDAVSQGG
FT                   FQAFCSNYEKTLAPDGKSCPKTHKPVCGTDGKTYQNRCAFCQTAMERSLGKLGFKHEGK
FT                   C"
FT   assembly_gap    6864231..6864250
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6890616..6890635
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(6913902..>6922600)
FT                   /gene="9530002K18Rik"
FT                   /locus_tag="mCG_144595"
FT                   /note="gene_id=mCG144595.0"
FT   mRNA            complement(join(6913902..6914216,6915590..6915705,
FT                   6916659..6916705,6922058..6922128,6922556..>6922600))
FT                   /gene="9530002K18Rik"
FT                   /locus_tag="mCG_144595"
FT                   /product="RIKEN cDNA 9530002K18"
FT                   /note="gene_id=mCG144595.0 transcript_id=mCT184019.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(6914168..6914216,6915590..6915705,
FT                   6916659..6916705,6922058..6922128,6922556..>6922563))
FT                   /codon_start=1
FT                   /gene="9530002K18Rik"
FT                   /locus_tag="mCG_144595"
FT                   /product="RIKEN cDNA 9530002K18"
FT                   /note="gene_id=mCG144595.0 transcript_id=mCT184019.0
FT                   protein_id=mCP106237.0"
FT                   /protein_id="EDL10002.1"
FT                   /translation="AQRFDKMSSTWIKFLFILTLVLLPYSVFSVNIFAGPENVIKEPNC
FT                   TMYKSKSECSNIAENPVCADDRNTYYNECYFCIEKVVEKLKYRYHGICIYK"
FT   assembly_gap    6923542..6923717
FT                   /estimated_length=176
FT                   /gap_type="unknown"
FT   assembly_gap    6936857..6936915
FT                   /estimated_length=59
FT                   /gap_type="unknown"
FT   assembly_gap    6966906..6966925
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6976261..6979895
FT                   /estimated_length=3635
FT                   /gap_type="unknown"
FT   assembly_gap    6990747..6991078
FT                   /estimated_length=332
FT                   /gap_type="unknown"
FT   assembly_gap    6992161..6994514
FT                   /estimated_length=2354
FT                   /gap_type="unknown"
FT   gene            7016765..7024339
FT                   /gene="Npy6r"
FT                   /locus_tag="mCG_4623"
FT                   /note="gene_id=mCG4623.2"
FT   mRNA            join(7016765..7016973,7021981..7024339)
FT                   /gene="Npy6r"
FT                   /locus_tag="mCG_4623"
FT                   /product="neuropeptide Y receptor Y6"
FT                   /note="gene_id=mCG4623.2 transcript_id=mCT4019.2 created on
FT                   12-JUN-2003"
FT   CDS             7022153..7023268
FT                   /codon_start=1
FT                   /gene="Npy6r"
FT                   /locus_tag="mCG_4623"
FT                   /product="neuropeptide Y receptor Y6"
FT                   /note="gene_id=mCG4623.2 transcript_id=mCT4019.2
FT                   protein_id=mCP13135.0"
FT                   /protein_id="EDL10001.1"
FT                   /translation="MEVLTNQPTPNKTSGKSNNSAFFYFESCQPPFLAILLLLIAYTVI
FT                   LIMGIFGNLSLIIIIFKKQREAQNVTNILIANLSLSDILVCVMCIPFTVIYTLMDHWVF
FT                   GNTMCKLTSYVQSVSVSVSIFSLVLIAIERYQLIVNPRGWKPRVAHAYWGIILIWLISL
FT                   TLSIPLFLSYHLTNEPFHNLSLPTDIYTHQVACVEIWPSKLNQLLFSTSLFMLQYFVPL
FT                   GFILICYLKIVLCLRKRTRQVDRRKENKSRLNENKRVNVMLISIVVTFGACWLPLNIFN
FT                   VIFDWYHEMLMSCHHDLVFVVCHLIAMVSTCINPLFYGFLNKNFQKDLMMLIHHCWCGE
FT                   PQESYENIAMSTMHTDESKGSLKLAHIPTGI"
FT   assembly_gap    7027204..7027223
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7033227..7033420
FT                   /estimated_length=194
FT                   /gap_type="unknown"
FT   assembly_gap    7037320..7041848
FT                   /estimated_length=4529
FT                   /gap_type="unknown"
FT   assembly_gap    7048867..7049336
FT                   /estimated_length=470
FT                   /gap_type="unknown"
FT   assembly_gap    7055856..7055875
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7056885..7057450
FT                   /estimated_length=566
FT                   /gap_type="unknown"
FT   assembly_gap    7067134..7067153
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            7080653..7102287
FT                   /locus_tag="mCG_4625"
FT                   /note="gene_id=mCG4625.1"
FT   mRNA            join(7080653..7080735,7083346..7083889,7087882..7088056,
FT                   7088921..7089022,7091023..7091069,7091593..7091725,
FT                   7092579..7092786,7100681..7100846,7101367..7101500,
FT                   7101673..7102287)
FT                   /locus_tag="mCG_4625"
FT                   /product="mCG4625"
FT                   /note="gene_id=mCG4625.1 transcript_id=mCT4012.1 created on
FT                   11-OCT-2002"
FT   CDS             join(7083537..7083889,7087882..7088056,7088921..7089022,
FT                   7091023..7091069,7091593..7091725,7092579..7092786,
FT                   7100681..7100846,7101367..7101500,7101673..7101845)
FT                   /codon_start=1
FT                   /locus_tag="mCG_4625"
FT                   /product="mCG4625"
FT                   /note="gene_id=mCG4625.1 transcript_id=mCT4012.1
FT                   protein_id=mCP13137.2"
FT                   /db_xref="GOA:A0A509"
FT                   /db_xref="InterPro:IPR003598"
FT                   /db_xref="InterPro:IPR003599"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013098"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="MGI:MGI:1889800"
FT                   /db_xref="UniProtKB/TrEMBL:A0A509"
FT                   /protein_id="EDL10000.1"
FT                   /translation="MFNYERPKHFIQPQNPCGSRLQPPGPEVSGFPSQTKQSSIVIQPR
FT                   QCTEQRFSASSTVSSHITVSSSAYPAPQQLAGPNPGQKVTATYNQSPASFLSSILPSQP
FT                   DYCNSKIPSTVDSNYQQSSVNQPVNAMSSQAANARPTPKTPDHEIQGSKEALIQDLERK
FT                   LKCKDTLLHNGNQRLTYEEKMARRLLGPQNAAAVFQAQNSDVQDSPQHNPEQARLHVPT
FT                   SQVRSRSSSRAEANDQDAIQEKFYPPRFIQVPENMSIEEGRFCRMDFKVSGLPAPDVSW
FT                   YLNGRPVQSDELHKMIVSEKGFHSLIFEVVRASDAGPYACVARNRAGEATFTVQLDVLA
FT                   KEHKRAPMFIFKPQSKKVFEGETVKLECQISAIPPPKLFWKRNNEMVQFNTDRISLYHD
FT                   NAGRVTLLIKDVNKKDAGWYTVSAVNEAGVTTCNTRLDVTARPIQTLPAPKQLRVRPTF
FT                   SKYLALNGRGLDVKQAFNPEGEFQRLAAQSGLYESEEL"
FT   assembly_gap    7103480..7103499
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7104645..7105337
FT                   /estimated_length=693
FT                   /gap_type="unknown"
FT   assembly_gap    7109366..7109385
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7110605..7110624
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7111801..7111820
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7119597..7123410
FT                   /estimated_length=3814
FT                   /gap_type="unknown"
FT   assembly_gap    7124960..7124979
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            7128296..7168139
FT                   /locus_tag="mCG_4968"
FT                   /note="gene_id=mCG4968.2"
FT   mRNA            join(7128296..7128479,7145248..7145399,7148999..7149126,
FT                   7149696..7149794,7154585..7154737,7154832..7154944,
FT                   7155028..7155135,7159494..7159629,7161911..7162021,
FT                   7164770..7164821,7166952..7168139)
FT                   /locus_tag="mCG_4968"
FT                   /product="mCG4968, transcript variant mCT4021"
FT                   /note="gene_id=mCG4968.2 transcript_id=mCT4021.2 created on
FT                   06-FEB-2003"
FT   mRNA            join(7128301..7128479,7145248..7145395,7148993..7149126,
FT                   7149696..7149794,7154585..7154737,7154832..7154944,
FT                   7155028..7155135,7159494..7159629,7161911..7162021,
FT                   7164770..7164821,7166952..7167336)
FT                   /locus_tag="mCG_4968"
FT                   /product="mCG4968, transcript variant mCT179597"
FT                   /note="gene_id=mCG4968.2 transcript_id=mCT179597.0 created
FT                   on 06-FEB-2003"
FT   assembly_gap    7131701..7131732
FT                   /estimated_length=32
FT                   /gap_type="unknown"
FT   assembly_gap    7141381..7141400
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7142500..7142519
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(7149076..7149126,7149696..7149794,7154585..7154737,
FT                   7154832..7154944,7155028..7155135,7159494..7159629,
FT                   7161911..7162021,7164770..7164821,7166952..7167115)
FT                   /codon_start=1
FT                   /locus_tag="mCG_4968"
FT                   /product="mCG4968, isoform CRA_a"
FT                   /note="gene_id=mCG4968.2 transcript_id=mCT4021.2
FT                   protein_id=mCP13129.2 isoform=CRA_a"
FT                   /protein_id="EDL09998.1"
FT                   /translation="MGVPTYGAIILDETLENVLLVQGYLAKSGWGFPKGKVNKEEAPHD
FT                   CAAREVFEETGFDIKDYICKDDYIELRINDQLARLYIIPGVPKDTKFNPKTRREIRNIE
FT                   WFSIEKLPCHRNDMTPKSKLGLAPNKFFMAIPFIRPLRDWLSRRFGDSSDSDNGFSSAG
FT                   STPARPTVEKLSRTKFRHSQQLFPEGSPSDQWVKHRQPLQQKPHSNHGEVSDLLKAKNQ
FT                   NMRGNGRKQYQDSPNQKKRANGVHGQPAKQQNPLVKCEKKLHPRKLQDNFETDATCDLP
FT                   CSGEEPSVEHAEGHSVACNGHCKFPFSSRAFLSFKFDQNAIMKILDL"
FT   CDS             join(7149076..7149126,7149696..7149794,7154585..7154737,
FT                   7154832..7154944,7155028..7155135,7159494..7159629,
FT                   7161911..7162021,7164770..7164821,7166952..7167115)
FT                   /codon_start=1
FT                   /locus_tag="mCG_4968"
FT                   /product="mCG4968, isoform CRA_a"
FT                   /note="gene_id=mCG4968.2 transcript_id=mCT179597.0
FT                   protein_id=mCP102519.0 isoform=CRA_a"
FT                   /protein_id="EDL09999.1"
FT                   /translation="MGVPTYGAIILDETLENVLLVQGYLAKSGWGFPKGKVNKEEAPHD
FT                   CAAREVFEETGFDIKDYICKDDYIELRINDQLARLYIIPGVPKDTKFNPKTRREIRNIE
FT                   WFSIEKLPCHRNDMTPKSKLGLAPNKFFMAIPFIRPLRDWLSRRFGDSSDSDNGFSSAG
FT                   STPARPTVEKLSRTKFRHSQQLFPEGSPSDQWVKHRQPLQQKPHSNHGEVSDLLKAKNQ
FT                   NMRGNGRKQYQDSPNQKKRANGVHGQPAKQQNPLVKCEKKLHPRKLQDNFETDATCDLP
FT                   CSGEEPSVEHAEGHSVACNGHCKFPFSSRAFLSFKFDQNAIMKILDL"
FT   gene            complement(7178932..7411175)
FT                   /locus_tag="mCG_4620"
FT                   /note="gene_id=mCG4620.3"
FT   mRNA            complement(join(7178932..7179386,7180654..7180776,
FT                   7192209..7192306,7195042..7195248,7198474..7198708,
FT                   7209013..7209196,7213051..7213154,7217689..7217829,
FT                   7222929..7223077,7224440..7224529,7225544..7225690,
FT                   7239859..7240065,7242114..7242277,7258901..7259043,
FT                   7268302..7268444,7282952..7283065,7410572..7411175))
FT                   /locus_tag="mCG_4620"
FT                   /product="mCG4620, transcript variant mCT4016"
FT                   /note="gene_id=mCG4620.3 transcript_id=mCT4016.2 created on
FT                   19-JUN-2003"
FT   mRNA            complement(join(7178932..7179386,7180654..7180776,
FT                   7192209..7192306,7195042..7195248,7198474..7198708,
FT                   7209013..7209196,7213051..7213154,7217689..7217829,
FT                   7222929..7223077,7224440..7224529,7225544..7225690,
FT                   7239859..7240065,7242114..7242277,7258901..7259043,
FT                   7268302..7268444,7282952..7283065,7323341..7323444))
FT                   /locus_tag="mCG_4620"
FT                   /product="mCG4620, transcript variant mCT174140"
FT                   /note="gene_id=mCG4620.3 transcript_id=mCT174140.0 created
FT                   on 19-JUN-2003"
FT   CDS             complement(join(7179206..7179386,7180654..7180776,
FT                   7192209..7192306,7195042..7195248,7198474..7198708,
FT                   7209013..7209196,7213051..7213154,7217689..7217829,
FT                   7222929..7223077,7224440..7224529,7225544..7225690,
FT                   7239859..7240065,7242114..7242277,7258901..7259043,
FT                   7268302..7268444,7282952..7283065,7410572..7410628))
FT                   /codon_start=1
FT                   /locus_tag="mCG_4620"
FT                   /product="mCG4620, isoform CRA_b"
FT                   /note="gene_id=mCG4620.3 transcript_id=mCT4016.2
FT                   protein_id=mCP13132.2 isoform=CRA_b"
FT                   /db_xref="InterPro:IPR019536"
FT                   /db_xref="MGI:MGI:96930"
FT                   /db_xref="UniProtKB/TrEMBL:G3UW40"
FT                   /protein_id="EDL09997.1"
FT                   /translation="MNSGVAVKYGNDSSAELSELHLAALASLKGDIVELNKRLQQTERE
FT                   RDLLEKKLAKAQCEQSHLMREHEDVQERTTLRYEERITELHSIIAELNKKIDRLQGTTI
FT                   REEDEYSELRSELSQSQQEVNEDSRSVDQDQTSVSIPENQSTMVTADMDNCSDLNSELQ
FT                   RVLTGLESVVCGRKKSSCSLSVADVDRHIEQLTTASEHCDLAIKTVEEIEGVLGRDLYP
FT                   NLAEERSRWEKELAGLREENESLTAMLCSKEEELNRTKATMNAIREERDRLRRRVRELQ
FT                   TRLQSVQATGPSSPGRLTPANRPINPSTGELSTSSSSNDIPIAKIAERVKLSKTRSESS
FT                   SSDRPVLGSEISSIGVSSSVAEHLAHSLQDCSNIQEIFQTLYSHGSAISESKIREFEVE
FT                   TERLNSRIEHLKSQNDLLTITLEECKSNAERMSMLVGKYESNATALRLALQYSEQCIEA
FT                   YELLLALAESEQSLILGQFRAAGVGSSPGDQSGDENITQMLKRAHDCRKTAENAAKALL
FT                   MKLDGSCGGAFAVAGCSVQPWESLSSNSHTSTTSSTASSCDTEFTKEDEQRLKDYIQQL
FT                   KNDRAAVKLTMLELESIHIDPLSYDVKPRGDSQRLDLENAVLMQELMAMKEEMAELKAQ
FT                   LYLLEKEKKALELKLSTREAQEQAYLVHIEHLKSEVEEQKEQRTRSLSSTSSSGKEKPG
FT                   KECADAASPALSLAELRTNSDSELATEFANAIRREKKLKARVQELVSALERLTKSSEIR
FT                   HQQSAEFVNDLKRANSNLVAAYEKAKKKHQNKLKKLESQMMAMVERHETQVRMLKQRIA
FT                   LLEEENSRPHTNETSL"
FT   CDS             complement(join(7179206..7179386,7180654..7180776,
FT                   7192209..7192306,7195042..7195248,7198474..7198708,
FT                   7209013..7209196,7213051..7213154,7217689..7217829,
FT                   7222929..7223077,7224440..7224529,7225544..7225690,
FT                   7239859..7240065,7242114..7242277,7258901..7259043,
FT                   7268302..7268426))
FT                   /codon_start=1
FT                   /locus_tag="mCG_4620"
FT                   /product="mCG4620, isoform CRA_a"
FT                   /note="gene_id=mCG4620.3 transcript_id=mCT174140.0
FT                   protein_id=mCP97059.0 isoform=CRA_a"
FT                   /protein_id="EDL09996.1"
FT                   /translation="MREHEDVQERTTLRYEERITELHSIIAELNKKIDRLQGTTIREED
FT                   EYSELRSELSQSQQEVNEDSRSVDQDQTSVSIPENQSTMVTADMDNCSDLNSELQRVLT
FT                   GLESVVCGRKKSSCSLSVADVDRHIEQLTTASEHCDLAIKTVEEIEGVLGRDLYPNLAE
FT                   ERSRWEKELAGLREENESLTAMLCSKEEELNRTKATMNAIREERDRLRRRVRELQTRLQ
FT                   SVQATGPSSPGRLTPANRPINPSTGELSTSSSSNDIPIAKIAERVKLSKTRSESSSSDR
FT                   PVLGSEISSIGVSSSVAEHLAHSLQDCSNIQEIFQTLYSHGSAISESKIREFEVETERL
FT                   NSRIEHLKSQNDLLTITLEECKSNAERMSMLVGKYESNATALRLALQYSEQCIEAYELL
FT                   LALAESEQSLILGQFRAAGVGSSPGDQSGDENITQMLKRAHDCRKTAENAAKALLMKLD
FT                   GSCGGAFAVAGCSVQPWESLSSNSHTSTTSSTASSCDTEFTKEDEQRLKDYIQQLKNDR
FT                   AAVKLTMLELESIHIDPLSYDVKPRGDSQRLDLENAVLMQELMAMKEEMAELKAQLYLL
FT                   EKEKKALELKLSTREAQEQAYLVHIEHLKSEVEEQKEQRTRSLSSTSSSGKEKPGKECA
FT                   DAASPALSLAELRTNSDSELATEFANAIRREKKLKARVQELVSALERLTKSSEIRHQQS
FT                   AEFVNDLKRANSNLVAAYEKAKKKHQNKLKKLESQMMAMVERHETQVRMLKQRIALLEE
FT                   ENSRPHTNETSL"
FT   assembly_gap    7230168..7230194
FT                   /estimated_length=27
FT                   /gap_type="unknown"
FT   assembly_gap    7234548..7234567
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7245811..7245830
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7249231..7249250
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7299502..7299667
FT                   /estimated_length=166
FT                   /gap_type="unknown"
FT   assembly_gap    7312527..7312716
FT                   /estimated_length=190
FT                   /gap_type="unknown"
FT   assembly_gap    7328851..7329916
FT                   /estimated_length=1066
FT                   /gap_type="unknown"
FT   assembly_gap    7342510..7342677
FT                   /estimated_length=168
FT                   /gap_type="unknown"
FT   assembly_gap    7385030..7385049
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7387950..7388582
FT                   /estimated_length=633
FT                   /gap_type="unknown"
FT   assembly_gap    7400608..7400686
FT                   /estimated_length=79
FT                   /gap_type="unknown"
FT   assembly_gap    7409841..7409860
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <7410536..7425084
FT                   /locus_tag="mCG_145926"
FT                   /note="gene_id=mCG145926.0"
FT   mRNA            join(<7410536..7411156,7417640..7417735,7421078..7421218,
FT                   7421826..7422438,7424189..7425084)
FT                   /locus_tag="mCG_145926"
FT                   /product="mCG145926"
FT                   /note="gene_id=mCG145926.0 transcript_id=mCT186034.0
FT                   created on 04-JUL-2003"
FT   CDS             join(<7410537..7411156,7417640..7417649)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145926"
FT                   /product="mCG145926"
FT                   /note="gene_id=mCG145926.0 transcript_id=mCT186034.0
FT                   protein_id=mCP107758.0"
FT                   /protein_id="EDL09995.1"
FT                   /translation="RNPSSGPQQFLTSLSSAEESLPYFTATPEFMPALFRAGLVPRPRS
FT                   VGAGLRLDSLGLLPAGTFQSRQPFSPRTAARPERMEKLDTVSQAGISPASHSCRRLGRG
FT                   LRSQQLQRPSRRRDPPARPPRSPGVMPPSAPPRPSYGTTQIPITRQAGSSRRRPAELGY
FT                   PPGEAWAPVRERYVPPVPGRKELERAGAEQHFTPKFPPLNRLELVL"
FT   assembly_gap    7449317..7452291
FT                   /estimated_length=2975
FT                   /gap_type="unknown"
FT   assembly_gap    7453862..7453881
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7455174..7455193
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7456685..7456704
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7460329..7465530
FT                   /estimated_length=5202
FT                   /gap_type="unknown"
FT   assembly_gap    7483058..7483382
FT                   /estimated_length=325
FT                   /gap_type="unknown"
FT   assembly_gap    7486029..7486477
FT                   /estimated_length=449
FT                   /gap_type="unknown"
FT   assembly_gap    7490427..7491148
FT                   /estimated_length=722
FT                   /gap_type="unknown"
FT   assembly_gap    7506165..7506184
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7507596..7507615
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7509184..7509203
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7510876..7510895
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7533173..7533206
FT                   /estimated_length=34
FT                   /gap_type="unknown"
FT   assembly_gap    7534189..7535243
FT                   /estimated_length=1055
FT                   /gap_type="unknown"
FT   assembly_gap    7537611..7537630
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            7588786..7642252
FT                   /locus_tag="mCG_11938"
FT                   /note="gene_id=mCG11938.2"
FT   mRNA            join(7588786..7588985,7591668..7591834,7594515..7594617,
FT                   7595593..7595745,7609279..7609408,7609619..7609715,
FT                   7609798..7609885,7609971..7610051,7611623..7611708,
FT                   7612804..7612909,7614504..7614623,7614908..7615180,
FT                   7617134..7617260,7618794..7618999,7619390..7619585,
FT                   7625971..7626080,7627362..7627654,7632139..7632316,
FT                   7639589..7639792,7640706..7640888,7642074..7642252)
FT                   /locus_tag="mCG_11938"
FT                   /product="mCG11938"
FT                   /note="gene_id=mCG11938.2 transcript_id=mCT12219.2 created
FT                   on 11-OCT-2002"
FT   CDS             join(7588797..7588985,7591668..7591834,7594515..7594617,
FT                   7595593..7595745,7609279..7609408,7609619..7609715,
FT                   7609798..7609885,7609971..7610051,7611623..7611708,
FT                   7612804..7612909,7614504..7614623,7614908..7615180,
FT                   7617134..7617260,7618794..7618999,7619390..7619585,
FT                   7625971..7626080,7627362..7627654,7632139..7632316,
FT                   7639589..7639792,7640706..7640888,7642074..7642154)
FT                   /codon_start=1
FT                   /locus_tag="mCG_11938"
FT                   /product="mCG11938"
FT                   /note="gene_id=mCG11938.2 transcript_id=mCT12219.2
FT                   protein_id=mCP13131.2"
FT                   /protein_id="EDL09994.1"
FT                   /translation="MSKTSGRLNNGIPQVPVKRGESEFDSFRQSLPVFEKQEEIVKIIK
FT                   ENKVVLIVGETGSGKTTQIPQFLLDDCFKNGIPCRIFCTQPRRLAAIAVAERVAAERRE
FT                   RIGQTIGYQIRLESRVSPKTLLTFCTNGVLLRTLMAGDSTLSTVTHVIVDEVHERDRFS
FT                   DFLLTKLRDLLQKHPTLKLILSSAALDVNLFIRYFGSCPVINGNDLSAEDRELLKAYHH
FT                   SFDDEKVDLDLIMHLLYNICHSCDAGAILIFLPGYDEIVGLRDRILFDDKRFADNTHRY
FT                   QVFMLHSNMQTSDQKKVLKNPPAGVRKIILSTNIAETSITVNDVVFVIDSGKVKEQKSF
FT                   DALNFVTMLKMVWISKASAIQRKGRAGRCRPGICFRLFSRLRFQNMLEFQTPELLRMPL
FT                   QELCLHTKLLAPVNCTIADFLMKAPEPPPALIVRNAVQMLKTIDAMDAWEDLTELGYHL
FT                   ADLPVEPHLGKMVLCAVVLKCLDPILTIACTLAYRDPFVLPTQASQKRAAMLCRKRFTA
FT                   GTFSDHMALLRAFQAWQKARSDGWERAFCEKNFLSQATMEIIIGMRTQLLGQLRASGFV
FT                   RARGGGDIRDVNTNSENWAVVKAALVAGMYPNLVHVDRENVILTGPKEKKVRFHPTSVL
FT                   SQPQYKKIPPANGQAAAIQALPTDWLIYDEMTRAHRIANIRCCSAVTPVTVLVFCGPAR
FT                   LASNALQEPSSFRADGIPNDSSDSEMEDRTTANLAALKLDEWLNFKLEPEAASLLLQLR
FT                   QKWHSLFLRRMRAPSKPWSQVDEATIRAIIAVLSTEEQSAGLQQPSGIGQRPRPMSSEE
FT                   LPLASSWRSNNSRKSTADTEFADGSTTGERVLMKSPSPALHPPQKYKDRGILHPKRSTD
FT                   DRSDQSSVKSTDSSSYPSPCASPSPPSSGKGSKSPSPRPNMPIRYFIMKSSNLRNLEIS
FT                   QQKGIWSTTPSNERKLNRAFWESSMVYLVFSVQGSGHFQGFSRMSSEIGREKSQDWGSA
FT                   GLGGVFKVEWIRKESLPFQFAHHLLNPWNDNKKVQISRDGQELEPQVGEQLLQLWERLP
FT                   LGEKTTSD"
FT   assembly_gap    7607859..7608261
FT                   /estimated_length=403
FT                   /gap_type="unknown"
FT   assembly_gap    7639235..7639349
FT                   /estimated_length=115
FT                   /gap_type="unknown"
FT   assembly_gap    7648577..7648638
FT                   /estimated_length=62
FT                   /gap_type="unknown"
FT   assembly_gap    7657113..7657585
FT                   /estimated_length=473
FT                   /gap_type="unknown"
FT   assembly_gap    7661093..7661112
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7662246..7670717
FT                   /estimated_length=8472
FT                   /gap_type="unknown"
FT   assembly_gap    7672425..7672444
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7673871..7673890
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7675153..7675172
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7676369..7677460
FT                   /estimated_length=1092
FT                   /gap_type="unknown"
FT   assembly_gap    7678999..7679018
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7683318..7683337
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7699247..7699467
FT                   /estimated_length=221
FT                   /gap_type="unknown"
FT   assembly_gap    7716430..7716449
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7717746..7717765
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7725348..7725367
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7738187..7738513
FT                   /estimated_length=327
FT                   /gap_type="unknown"
FT   assembly_gap    7740150..7740169
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7741176..7741195
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7742711..7742730
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7744040..7744059
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7763917..7763936
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7765194..7765213
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7770428..7770447
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7772766..7774801
FT                   /estimated_length=2036
FT                   /gap_type="unknown"
FT   assembly_gap    7775971..7775990
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7777508..7777527
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7791249..7791268
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7792642..7792661
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7796260..7796279
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7798002..7801317
FT                   /estimated_length=3316
FT                   /gap_type="unknown"
FT   gene            complement(7807815..7809521)
FT                   /pseudo
FT                   /locus_tag="mCG_3420"
FT                   /note="gene_id=mCG3420.1"
FT   mRNA            complement(7807815..7809521)
FT                   /pseudo
FT                   /locus_tag="mCG_3420"
FT                   /note="gene_id=mCG3420.1 transcript_id=mCT2530.1 created on
FT                   17-APR-2003"
FT   assembly_gap    7809835..7809950
FT                   /estimated_length=116
FT                   /gap_type="unknown"
FT   assembly_gap    7811884..7811903
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7818743..7818762
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7821489..7821508
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7822845..7822864
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7864303..7864381
FT                   /estimated_length=79
FT                   /gap_type="unknown"
FT   assembly_gap    7874946..7875025
FT                   /estimated_length=80
FT                   /gap_type="unknown"
FT   gene            complement(7888293..7889431)
FT                   /pseudo
FT                   /locus_tag="mCG_3421"
FT                   /note="gene_id=mCG3421.2"
FT   mRNA            complement(join(7888293..7888777,7888835..7889431))
FT                   /pseudo
FT                   /locus_tag="mCG_3421"
FT                   /note="gene_id=mCG3421.2 transcript_id=mCT2531.2 created on
FT                   11-OCT-2002"
FT   assembly_gap    7916513..7916532
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8009714..8009762
FT                   /estimated_length=49
FT                   /gap_type="unknown"
FT   assembly_gap    8011092..8011290
FT                   /estimated_length=199
FT                   /gap_type="unknown"
FT   gene            8012005..>8032879
FT                   /locus_tag="mCG_147299"
FT                   /note="gene_id=mCG147299.0"
FT   mRNA            join(8012005..8012562,8031092..>8032879)
FT                   /locus_tag="mCG_147299"
FT                   /product="mCG147299"
FT                   /note="gene_id=mCG147299.0 transcript_id=mCT187562.0
FT                   created on 13-JAN-2004"
FT   gene            complement(8028313..8029289)
FT                   /pseudo
FT                   /locus_tag="mCG_56293"
FT                   /note="gene_id=mCG56293.2"
FT   mRNA            complement(8028313..8029289)
FT                   /pseudo
FT                   /locus_tag="mCG_56293"
FT                   /note="gene_id=mCG56293.2 transcript_id=mCT56476.2 created
FT                   on 17-OCT-2002"
FT   CDS             8032675..>8032879
FT                   /codon_start=1
FT                   /locus_tag="mCG_147299"
FT                   /product="mCG147299"
FT                   /note="gene_id=mCG147299.0 transcript_id=mCT187562.0
FT                   protein_id=mCP109687.0"
FT                   /protein_id="EDL09993.1"
FT                   /translation="MDSKLGHSLDHLSLSLFSSFVPAVLLDRNNSGSEFLTVEWQAQRV
FT                   GRLGGEEEFWEGSSGRGNDWIVK"
FT   assembly_gap    8034624..8034981
FT                   /estimated_length=358
FT                   /gap_type="unknown"
FT   assembly_gap    8049459..8050044
FT                   /estimated_length=586
FT                   /gap_type="unknown"
FT   assembly_gap    8074820..8074867
FT                   /estimated_length=48
FT                   /gap_type="unknown"
FT   assembly_gap    8086086..8086105
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8088346..8088365
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8132565..8133950
FT                   /estimated_length=1386
FT                   /gap_type="unknown"
FT   assembly_gap    8140725..8140744
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8159328..8159427
FT                   /estimated_length=100
FT                   /gap_type="unknown"
FT   assembly_gap    8201728..8202194
FT                   /estimated_length=467
FT                   /gap_type="unknown"
FT   assembly_gap    8213867..8213895
FT                   /estimated_length=29
FT                   /gap_type="unknown"
FT   assembly_gap    8243199..8243852
FT                   /estimated_length=654
FT                   /gap_type="unknown"
FT   assembly_gap    8249661..8251840
FT                   /estimated_length=2180
FT                   /gap_type="unknown"
FT   assembly_gap    8265192..8265307
FT                   /estimated_length=116
FT                   /gap_type="unknown"
FT   gene            <8298647..8424459
FT                   /gene="Kcnn2"
FT                   /locus_tag="mCG_3422"
FT                   /note="gene_id=mCG3422.3"
FT   mRNA            join(<8298647..8299803,8300400..8300495,8331161..8331579,
FT                   8393611..8393752,8408652..8409685)
FT                   /gene="Kcnn2"
FT                   /locus_tag="mCG_3422"
FT                   /product="potassium intermediate/small conductance
FT                   calcium-activated channel, subfamily N, member 2,
FT                   transcript variant mCT190310"
FT                   /note="gene_id=mCG3422.3 transcript_id=mCT190310.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<8298649..8299803,8300400..8300495,8331161..8331579,
FT                   8393611..8393752,8408652..8408846)
FT                   /codon_start=1
FT                   /gene="Kcnn2"
FT                   /locus_tag="mCG_3422"
FT                   /product="potassium intermediate/small conductance
FT                   calcium-activated channel, subfamily N, member 2, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG3422.3 transcript_id=mCT190310.0
FT                   protein_id=mCP111283.0 isoform=CRA_b"
FT                   /protein_id="EDL09991.1"
FT                   /translation="THCAGCTTAWSPCSFNSSDMETPLQFQRGFFPEQPPPPPRSSHLH
FT                   CQQQQQSQDKPCAPFAPLPHPHHHPHLAHQQPGSGGSSPCLRCNSCASSGAPAAGAGAG
FT                   DNLSLLLRTSSPGGAFRTRTSSPLSGSSCCCCCSSRRGSQLNVSELTPSSHASALRQQY
FT                   AQQPASASQYHQCHSLQPATSPTGSLGSLGSGPPLSHHHHHPHPAHHQHHQPQARRESN
FT                   PFTEIAMSSCRYNGGVMRPLSNLSSSRRNLQEMDSEAQPLQPPASVVGGGGGASSPSAA
FT                   AAASSSAPEIVVSKPEHNNSNNLALYGTGGGGSTGGGGGGSGHGSSSGTKSSKKKNQNI
FT                   GYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSWGAYDKASLYSLALKCLISL
FT                   STIILLGLIIVYHAREIQLFMVDNGADDWRIAMTYERIFFICLEILVCAIHPIPGNYTF
FT                   TWTARLAFSYAPSTTTADVDIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKI
FT                   NFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRACERYHDQQDVTSNFLGAMWLIS
FT                   ITFLSIGYGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMD
FT                   TQLTKRVSRPPHIVQDDVTVHCDIPTLRNMGFH"
FT   mRNA            join(8299077..8299803,8300400..8300495,8331161..8331579,
FT                   8393611..8393752,8408652..8408762,8415373..8415500,
FT                   8421505..8421574,8423709..8424459)
FT                   /gene="Kcnn2"
FT                   /locus_tag="mCG_3422"
FT                   /product="potassium intermediate/small conductance
FT                   calcium-activated channel, subfamily N, member 2,
FT                   transcript variant mCT2532"
FT                   /note="gene_id=mCG3422.3 transcript_id=mCT2532.2 created on
FT                   11-OCT-2002"
FT   CDS             join(8299333..8299803,8300400..8300495,8331161..8331579,
FT                   8393611..8393752,8408652..8408762,8415373..8415500,
FT                   8421505..8421574,8423709..8423996)
FT                   /codon_start=1
FT                   /gene="Kcnn2"
FT                   /locus_tag="mCG_3422"
FT                   /product="potassium intermediate/small conductance
FT                   calcium-activated channel, subfamily N, member 2, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG3422.3 transcript_id=mCT2532.2
FT                   protein_id=mCP12539.2 isoform=CRA_c"
FT                   /db_xref="GOA:P58390"
FT                   /db_xref="InterPro:IPR004178"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="InterPro:IPR015449"
FT                   /db_xref="MGI:MGI:2153182"
FT                   /protein_id="EDL09992.1"
FT                   /translation="MSSCRYNGGVMRPLSNLSSSRRNLQEMDSEAQPLQPPASVVGGGG
FT                   GASSPSAAAAASSSAPEIVVSKPEHNNSNNLALYGTGGGGSTGGGGGGSGHGSSSGTKS
FT                   SKKKNQNIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSWGAYDKASLYSL
FT                   ALKCLISLSTIILLGLIIVYHAREIQLFMVDNGADDWRIAMTYERIFFICLEILVCAIH
FT                   PIPGNYTFTWTARLAFSYAPSTTTADVDIILSIPMFLRLYLIARVMLLHSKLFTDASSR
FT                   SIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRACERYHDQQDVTSNF
FT                   LGAMWLISITFLSIGYGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEK
FT                   HVHNFMMDTQLTKRVKNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLR
FT                   SVKMEQRKLNDQANTLVDLAKTQNIMYDMISDLNERSEDFEKRIVTLETKLETLIGSIH
FT                   ALPGLISQTIRQQQRDFIETQMENYDKHVSYNAERSRSSSRRRRSSSTAPPTSSESS"
FT   mRNA            join(<8299333..8299803,8300400..8300495,8331161..8331579,
FT                   8393611..8393752,8408652..8408762,8413691..8413798)
FT                   /gene="Kcnn2"
FT                   /locus_tag="mCG_3422"
FT                   /product="potassium intermediate/small conductance
FT                   calcium-activated channel, subfamily N, member 2,
FT                   transcript variant mCT190309"
FT                   /note="gene_id=mCG3422.3 transcript_id=mCT190309.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(8299333..8299803,8300400..8300495,8331161..8331579,
FT                   8393611..8393752,8408652..8408762,8413691..8413750)
FT                   /codon_start=1
FT                   /gene="Kcnn2"
FT                   /locus_tag="mCG_3422"
FT                   /product="potassium intermediate/small conductance
FT                   calcium-activated channel, subfamily N, member 2, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG3422.3 transcript_id=mCT190309.0
FT                   protein_id=mCP111282.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q80X11"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="InterPro:IPR015449"
FT                   /db_xref="MGI:MGI:2153182"
FT                   /db_xref="UniProtKB/TrEMBL:Q80X11"
FT                   /protein_id="EDL09990.1"
FT                   /translation="MSSCRYNGGVMRPLSNLSSSRRNLQEMDSEAQPLQPPASVVGGGG
FT                   GASSPSAAAAASSSAPEIVVSKPEHNNSNNLALYGTGGGGSTGGGGGGSGHGSSSGTKS
FT                   SKKKNQNIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSWGAYDKASLYSL
FT                   ALKCLISLSTIILLGLIIVYHAREIQLFMVDNGADDWRIAMTYERIFFICLEILVCAIH
FT                   PIPGNYTFTWTARLAFSYAPSTTTADVDIILSIPMFLRLYLIARVMLLHSKLFTDASSR
FT                   SIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRACERYHDQQDVTSNF
FT                   LGAMWLISITFLSIGYGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEK
FT                   HVHNFMMDTQLTKRTGICTKSVAMFNARVMAQH"
FT   assembly_gap    8342111..8342242
FT                   /estimated_length=132
FT                   /gap_type="unknown"
FT   assembly_gap    8359770..8359823
FT                   /estimated_length=54
FT                   /gap_type="unknown"
FT   assembly_gap    8384347..8384698
FT                   /estimated_length=352
FT                   /gap_type="unknown"
FT   assembly_gap    8385901..8385920
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(8421921..>8627233)
FT                   /locus_tag="mCG_146103"
FT                   /note="gene_id=mCG146103.0"
FT   mRNA            complement(join(8421921..8423992,8440314..8440368,
FT                   8575886..8575991,8627140..>8627233))
FT                   /locus_tag="mCG_146103"
FT                   /product="mCG146103"
FT                   /note="gene_id=mCG146103.0 transcript_id=mCT186206.0
FT                   created on 14-JUL-2003"
FT   CDS             complement(8422546..>8422776)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146103"
FT                   /product="mCG146103"
FT                   /note="gene_id=mCG146103.0 transcript_id=mCT186206.0
FT                   protein_id=mCP107763.0"
FT                   /protein_id="EDL09989.1"
FT                   /translation="GDGEICSTQSTATFSKSQTPWAARTSCLSCSLSASQLFKDNKGTH
FT                   RSSHSEPRHFLLFEPQTQGALILALLHSWEN"
FT   assembly_gap    8454319..8454443
FT                   /estimated_length=125
FT                   /gap_type="unknown"
FT   assembly_gap    8461842..8462079
FT                   /estimated_length=238
FT                   /gap_type="unknown"
FT   assembly_gap    8504003..8504022
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8552372..8552391
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8591503..8591522
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8650149..8650396
FT                   /estimated_length=248
FT                   /gap_type="unknown"
FT   assembly_gap    8651419..8651438
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8652481..8652500
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8657045..8657064
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8667917..8667936
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8675647..8675688
FT                   /estimated_length=42
FT                   /gap_type="unknown"
FT   assembly_gap    8709554..8709573
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8741562..8741890
FT                   /estimated_length=329
FT                   /gap_type="unknown"
FT   assembly_gap    8745318..8745409
FT                   /estimated_length=92
FT                   /gap_type="unknown"
FT   assembly_gap    8757695..8763623
FT                   /estimated_length=5929
FT                   /gap_type="unknown"
FT   assembly_gap    8766128..8766343
FT                   /estimated_length=216
FT                   /gap_type="unknown"
FT   assembly_gap    8770154..8770173
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8772151..8773248
FT                   /estimated_length=1098
FT                   /gap_type="unknown"
FT   assembly_gap    8820843..8820862
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8825954..8826464
FT                   /estimated_length=511
FT                   /gap_type="unknown"
FT   assembly_gap    8827762..8828388
FT                   /estimated_length=627
FT                   /gap_type="unknown"
FT   assembly_gap    8877665..8877684
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8882730..8882749
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(8893756..>8939216)
FT                   /gene="Trim36"
FT                   /locus_tag="mCG_3456"
FT                   /note="gene_id=mCG3456.1"
FT   mRNA            complement(join(8893756..8894530,8895912..8896209,
FT                   8899198..8899488,8902372..8902496,8902695..8902948,
FT                   8905227..8905322,8912946..8913092,8915215..8915540,
FT                   8922904..8923138,8939154..>8939216))
FT                   /gene="Trim36"
FT                   /locus_tag="mCG_3456"
FT                   /product="tripartite motif-containing 36"
FT                   /note="gene_id=mCG3456.1 transcript_id=mCT2429.2 created on
FT                   11-OCT-2002"
FT   CDS             complement(join(8894176..8894530,8895912..8896209,
FT                   8899198..8899488,8902372..8902496,8902695..8902948,
FT                   8905227..8905322,8912946..8913092,8915215..8915540,
FT                   8922904..8923138,8939154..8939216))
FT                   /codon_start=1
FT                   /gene="Trim36"
FT                   /locus_tag="mCG_3456"
FT                   /product="tripartite motif-containing 36"
FT                   /note="gene_id=mCG3456.1 transcript_id=mCT2429.2
FT                   protein_id=mCP12526.1"
FT                   /protein_id="EDL09987.1"
FT                   /translation="MSESEEISEFGYIMELLAKGKVTIKNIEKELICPACKELFTHPLI
FT                   LPCQHSVCHKCVKELLLSLDDSFNDVASDSSNQSSPRLRLTSPSMDKIDKINRPGWKRN
FT                   SLTPRPTTFPCPGCEHDVDLGERGVSGLFRNFTLETIVERYRQAARAATAIMCDLCKPP
FT                   PQESTKSCMDCSASYCNECFKIYHPWGTVKAQHEYVGPTTNFRPKVLMCPEHETERINM
FT                   YCELCRRPVCHLCKLGGNHSNHRVTTMSSAYKTLKEKLSKDIDFLIGKESQVKSQISEL
FT                   NLLMKETECNGERAKEEALAHFEKLFEILEDRKSSVLKAIDASKKLRLDKFHTQMEEYQ
FT                   GLLENNGLVGYAQEVLKETDQSCFVQTAKQLHLRIQKATESLKSFRPAAQASFEDYVVN
FT                   ISKQTEVLGELSFFSSGIDIPEINEEQSKVYNNALIDWHHPEKDKADSYVLEYRKINRD
FT                   EEMISWNEIEVHGTSKVVSNLESNSPYAFRVRAYRGSICSPCSRELILHTPPAPVFSFL
FT                   FDEKCGYNTEHLLLNLKRDRVESRAGFNVLLAAERIQVGHYTSLDYIIGDVGVTKGKHF
FT                   WACRVEPYSYLVKVGVASSDKLQEWLRSPRDAASPRYEQDSGHDSGSEDACFDSSQPFT
FT                   LVTIGMKKFFIPKSPTSSNEPENRVLPMPTSIGIFLDCDKGKVSFYDMDHMKCLYERQV
FT                   DCSHTMYPAFALMGSGGIQLEEAITAKYLEYEEDV"
FT   assembly_gap    8898913..8898994
FT                   /estimated_length=82
FT                   /gap_type="unknown"
FT   gene            8925852..8926564
FT                   /locus_tag="mCG_147291"
FT                   /note="gene_id=mCG147291.0"
FT   mRNA            8925852..8926564
FT                   /locus_tag="mCG_147291"
FT                   /product="mCG147291"
FT                   /note="gene_id=mCG147291.0 transcript_id=mCT187554.0
FT                   created on 13-JAN-2004"
FT   CDS             8926209..8926544
FT                   /codon_start=1
FT                   /locus_tag="mCG_147291"
FT                   /product="mCG147291"
FT                   /note="gene_id=mCG147291.0 transcript_id=mCT187554.0
FT                   protein_id=mCP109673.0"
FT                   /protein_id="EDL09988.1"
FT                   /translation="MFRFLLNPGLAPHATQEPGVTGTAGGSRDCIPGCWPRIGIKILRQ
FT                   SPRPSPAHSHLVVPHLKSVDRGSEMPRQPHQACTGQGSRWAHFACFLRTGRTEQGSLLL
FT                   SGANITR"
FT   assembly_gap    8928322..8928385
FT                   /estimated_length=64
FT                   /gap_type="unknown"
FT   assembly_gap    8933235..8933327
FT                   /estimated_length=93
FT                   /gap_type="unknown"
FT   assembly_gap    8937674..8937733
FT                   /estimated_length=60
FT                   /gap_type="unknown"
FT   gene            complement(8964340..9013067)
FT                   /gene="Pggt1b"
FT                   /locus_tag="mCG_3458"
FT                   /note="gene_id=mCG3458.1"
FT   mRNA            complement(join(8964340..8968535,8973396..8973504,
FT                   8975705..8975889,8981135..8981180,8984973..8985105,
FT                   8986492..8986643,8989785..8989852,9002695..9002813,
FT                   9012749..9013067))
FT                   /gene="Pggt1b"
FT                   /locus_tag="mCG_3458"
FT                   /product="protein geranylgeranyltransferase type I, beta
FT                   subunit"
FT                   /note="gene_id=mCG3458.1 transcript_id=mCT2431.1 created on
FT                   11-OCT-2002"
FT   CDS             complement(join(8968354..8968535,8973396..8973504,
FT                   8975705..8975889,8981135..8981180,8984973..8985105,
FT                   8986492..8986643,8989785..8989852,9002695..9002813,
FT                   9012749..9012888))
FT                   /codon_start=1
FT                   /gene="Pggt1b"
FT                   /locus_tag="mCG_3458"
FT                   /product="protein geranylgeranyltransferase type I, beta
FT                   subunit"
FT                   /note="gene_id=mCG3458.1 transcript_id=mCT2431.1
FT                   protein_id=mCP12527.2"
FT                   /protein_id="EDL09986.1"
FT                   /translation="MATTEDDRLAGSGEGERLDFLRDRHVRFFQRCLQVLPERYSSLET
FT                   SRLTIAFFALSGLDMLDSLDVVNKDDIIEWIYSLQVLPTEDRSNLSRCGFRGSSYLGIP
FT                   FNPSKNPGAAHPYDSGHIAMTYTGLSCLIILGDDLGRVDKEACLAGLRALQLEDGSFCA
FT                   VPEGSENDMRFVYCASCICYMLNNWSGMDMKKAISYIRRSMSYDNGLAQGAGLESHGGS
FT                   TFCGIASLCLMGKLEEVFSEKELNRIKRWCIMRQQNGYHGRPNKPVDTCYSFWVGATLK
FT                   LLKIFQYTNFEKNRNYILSTQDRLVGGFAKWPDSHPDALHAYFGICGLSLMEESGICKV
FT                   HPALNVSTRTSERLRDLHQSWKTKDSKQCSDNVHIAT"
FT   assembly_gap    8983110..8983129
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8991897..8991916
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8998707..8998726
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9006009..9006028
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9007952..9007971
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9009081..9009691
FT                   /estimated_length=611
FT                   /gap_type="unknown"
FT   gene            complement(9015120..9044006)
FT                   /locus_tag="mCG_3462"
FT                   /note="gene_id=mCG3462.2"
FT   mRNA            complement(join(9015120..9015360,9015751..9015869,
FT                   9017728..9017823,9019465..9019878,9022867..9023257,
FT                   9023639..9023714,9025520..9025609,9028380..9028501,
FT                   9031385..9031506,9043806..9044006))
FT                   /locus_tag="mCG_3462"
FT                   /product="mCG3462, transcript variant mCT2423"
FT                   /note="gene_id=mCG3462.2 transcript_id=mCT2423.2 created on
FT                   11-OCT-2002"
FT   CDS             complement(join(9015330..9015360,9015751..9015869,
FT                   9017728..9017823,9019465..9019878,9022867..9023257,
FT                   9023639..9023714,9025520..9025609,9028380..9028501,
FT                   9031385..9031506,9043806..9043922))
FT                   /codon_start=1
FT                   /locus_tag="mCG_3462"
FT                   /product="mCG3462, isoform CRA_b"
FT                   /note="gene_id=mCG3462.2 transcript_id=mCT2423.2
FT                   protein_id=mCP12530.2 isoform=CRA_b"
FT                   /db_xref="GOA:D3Z1J2"
FT                   /db_xref="MGI:MGI:1918800"
FT                   /db_xref="UniProtKB/TrEMBL:D3Z1J2"
FT                   /protein_id="EDL09985.1"
FT                   /translation="MAALTTVVVAAAATAVAGAVAGAGAAAGTGVGAAPTPQQSDGGCS
FT                   ASGGIRSFQLQNWKQKVSRTKKAEFIRTAEKFKNQVIVIEKDKHSHFYNQRGDFRTEYN
FT                   MLEELENKLINSRKTERAKIQQQLAKIHNNVKKLQNQLKDVKPTPDFVEKLREMMEEIE
FT                   NAINTFKEEQRLIYEELIQEEKTTNNELSAVSRRIESWALGNSETEKAFRAISSKVPVD
FT                   RVTQRTLPEQVVEFEKFLQQTGGRQGGWDALDHQNFVKVRNKHKGKPTFMKEVVEHLPG
FT                   RTLDEVQQHEKWYQKFLTLEEKKKESIQNWKTKKQQKKEEILKLKEKVDTVPLPSQSKA
FT                   EDSPKQREEQRKKQKLAVEAWKKRKSLEMSAKLASQLREEEEKERKQQRERQRQSKLKL
FT                   LLESYTQQRREQEEFLRLEQEIKEKAEKAEKRKTAADELARFQERDLHKLELKILDRQA
FT                   KEEEKAEKQRRLTKLKEKVENNVSRDPSRLYKPTKGWEERTKKIGPSGSGPLLHIPHRA
FT                   IPTWRQGI"
FT   mRNA            complement(join(9041053..9041410,9043806..9044005))
FT                   /locus_tag="mCG_3462"
FT                   /product="mCG3462, transcript variant mCT174132"
FT                   /note="gene_id=mCG3462.2 transcript_id=mCT174132.0 created
FT                   on 11-OCT-2002"
FT   CDS             complement(9041187..9041408)
FT                   /codon_start=1
FT                   /locus_tag="mCG_3462"
FT                   /product="mCG3462, isoform CRA_a"
FT                   /note="gene_id=mCG3462.2 transcript_id=mCT174132.0
FT                   protein_id=mCP97051.0 isoform=CRA_a"
FT                   /protein_id="EDL09984.1"
FT                   /translation="MGWMAHMLRALVLQEDLGLISSTHILTHKHLYLQFQEIQSSHLAF
FT                   TDNSTYMMHRHTYKQNTRTHKMNLKINK"
FT   assembly_gap    9081179..9081198
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(9090193..9159828)
FT                   /locus_tag="mCG_147321"
FT                   /note="gene_id=mCG147321.0"
FT   mRNA            complement(join(9090193..9090390,9159638..9159828))
FT                   /locus_tag="mCG_147321"
FT                   /product="mCG147321"
FT                   /note="gene_id=mCG147321.0 transcript_id=mCT187584.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(join(9090343..9090390,9159638..9159796))
FT                   /codon_start=1
FT                   /locus_tag="mCG_147321"
FT                   /product="mCG147321"
FT                   /note="gene_id=mCG147321.0 transcript_id=mCT187584.0
FT                   protein_id=mCP109709.0"
FT                   /protein_id="EDL09983.1"
FT                   /translation="MSVIMSVCSEGYFRKMWGLVFYICSEAWRQPAEGLRRGVRIAQEA
FT                   GRVQTGFQKEDGKFGIKWEQANW"
FT   assembly_gap    9129443..9129462
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9173412..9173431
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9177795..9178127
FT                   /estimated_length=333
FT                   /gap_type="unknown"
FT   assembly_gap    9178835..9178864
FT                   /estimated_length=30
FT                   /gap_type="unknown"
FT   assembly_gap    9181884..9182013
FT                   /estimated_length=130
FT                   /gap_type="unknown"
FT   gene            complement(9192120..9192943)
FT                   /locus_tag="mCG_56291"
FT                   /note="gene_id=mCG56291.2"
FT   mRNA            complement(9192120..9192943)
FT                   /locus_tag="mCG_56291"
FT                   /product="mCG56291"
FT                   /note="gene_id=mCG56291.2 transcript_id=mCT56474.2 created
FT                   on 18-OCT-2002"
FT   CDS             complement(9192341..9192916)
FT                   /codon_start=1
FT                   /locus_tag="mCG_56291"
FT                   /product="mCG56291"
FT                   /note="gene_id=mCG56291.2 transcript_id=mCT56474.2
FT                   protein_id=mCP34139.1"
FT                   /db_xref="GOA:Q9D8A4"
FT                   /db_xref="InterPro:IPR000535"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="MGI:MGI:1919326"
FT                   /db_xref="UniProtKB/TrEMBL:Q9D8A4"
FT                   /protein_id="EDL09982.1"
FT                   /translation="MASTSRAPAKPQQVLVLDPPTDLKFKGPFTGLLTAHLKLRNPSAR
FT                   KVCFKVKSTSPRRYCVRPNNGVIDPGCTVTVAATMQPSCCGPSKEVKHKFMVQTVFAPP
FT                   DISDLEAVWREAHPGELMDSKLRCVFEPPTESDKLEDGLRLRKATHPDKPRPSSSTSLK
FT                   PARSTPLPVVLLVIGAVFFGFFLGKFVL"
FT   assembly_gap    9195308..9195327
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9213302..9213337
FT                   /estimated_length=36
FT                   /gap_type="unknown"
FT   gene            complement(9228891..9252906)
FT                   /gene="Fem1c"
FT                   /locus_tag="mCG_3467"
FT                   /note="gene_id=mCG3467.1"
FT   mRNA            complement(join(9228891..9233530,9251281..9252008,
FT                   9252797..9252906))
FT                   /gene="Fem1c"
FT                   /locus_tag="mCG_3467"
FT                   /product="fem-1 homolog c (C.elegans)"
FT                   /note="gene_id=mCG3467.1 transcript_id=mCT2417.1 created on
FT                   11-OCT-2002"
FT   CDS             complement(join(9232221..9233530,9251281..9251824))
FT                   /codon_start=1
FT                   /gene="Fem1c"
FT                   /locus_tag="mCG_3467"
FT                   /product="fem-1 homolog c (C.elegans)"
FT                   /note="gene_id=mCG3467.1 transcript_id=mCT2417.1
FT                   protein_id=mCP12545.0"
FT                   /db_xref="GOA:B2RRW5"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="MGI:MGI:2444737"
FT                   /db_xref="UniProtKB/TrEMBL:B2RRW5"
FT                   /protein_id="EDL09981.1"
FT                   /translation="MDLKTAVFNAARDGKLRLLTKLLASKSKAEVSSLISEKTNGATPL
FT                   LMAARYGHLDMVEFLLEQCSASIEVGGSVNFDGETIEGAPPLWAASAAGHLKVVQSLLN
FT                   HGASVNNTTLTNSTPLRAACFDGHLEIVKYLVEHKADLEVSNRHGHTCLMISCYKGHKE
FT                   IAQYLLEKGADVNRKSVKGNTALHDCAESGSLDIMKMLLMYCAKMEKDGYGMTPLLSAS
FT                   VTGHTNIVDFLTHHAQTSKTERINALELLGATFVDKKRDLLGALKYWKKAMNMRYSDRT
FT                   NIISKPVPQTLIMAYDYAKEVNSAEELEGLIADPDEMRMQALLIRERILGPSHPDTSYY
FT                   IRYRGAVYADSGNFKRCINLWKYALDMQQSNLDPLSPMTASSLLSFAELFSFMLQDRAK
FT                   GLLGTTVTFDDLMGILCKSVLEIERAIKQTQCPADPLQLNKALSIILHLICLLEKVPCT
FT                   VEQDHFKKQTIYRFLKLHPRGKNNFSPLHLAVDKNTTCVGRYPVCKFPSLQVTAILIEC
FT                   GADVNVRDSDDNSPLHIAALNNHPDIMNLLIKSGAHFDATNLHKQTASDLLDEKEIAKN
FT                   LIQPINHTTLQCLAARVIVNHRIYYKGNIPEKLETFVSLHR"
FT   assembly_gap    9238902..9238921
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9243293..9243312
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9259355..9259374
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9261426..9261465
FT                   /estimated_length=40
FT                   /gap_type="unknown"
FT   assembly_gap    9283489..9283508
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(9284812..9300956)
FT                   /gene="Ticam2"
FT                   /locus_tag="mCG_1033370"
FT                   /note="gene_id=mCG1033370.1"
FT   mRNA            complement(join(9284812..9287653,9299301..9299403,
FT                   9300715..9300956))
FT                   /gene="Ticam2"
FT                   /locus_tag="mCG_1033370"
FT                   /product="toll-like receptor adaptor molecule 2"
FT                   /note="gene_id=mCG1033370.1 transcript_id=mCT151074.1
FT                   created on 10-MAR-2003"
FT   CDS             complement(9286901..9287599)
FT                   /codon_start=1
FT                   /gene="Ticam2"
FT                   /locus_tag="mCG_1033370"
FT                   /product="toll-like receptor adaptor molecule 2"
FT                   /note="gene_id=mCG1033370.1 transcript_id=mCT151074.1
FT                   protein_id=mCP78085.1"
FT                   /protein_id="EDL09980.1"
FT                   /translation="MGVGKSKLDKCPLSWHKKDSVDADQDGHESDSKNSEEACLRGFVE
FT                   QSSGSEPPTGEQDQPEAKGAGPEEQDEEEFLKFVILHAEDDTDEALRVQDLLQNDFGIR
FT                   PGIVFAEMPCGRLHLQNLDDAVNGSAWTILLLTENFLRDTWCNFQFYTSLMNSVSRQHK
FT                   YNSVIPMRPLNSPLPRERTPLALQTINALEEESQGFSTQVERIFRESVFERQQSIWKET
FT                   RSVSQKQFIA"
FT   assembly_gap    9297543..9297562
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            9298375..9342842
FT                   /gene="Eif1a"
FT                   /locus_tag="mCG_3464"
FT                   /note="gene_id=mCG3464.2"
FT   mRNA            join(9298375..9298409,9324216..9324283,9325125..9325184,
FT                   9333898..9336613)
FT                   /gene="Eif1a"
FT                   /locus_tag="mCG_3464"
FT                   /product="eukaryotic translation initiation factor 1A,
FT                   transcript variant mCT174133"
FT                   /note="gene_id=mCG3464.2 transcript_id=mCT174133.0 created
FT                   on 11-OCT-2002"
FT   gene            complement(9312459..9324033)
FT                   /locus_tag="mCG_3463"
FT                   /note="gene_id=mCG3463.2"
FT   mRNA            complement(join(9312459..9315189,9319750..9319995,
FT                   9323589..9324033))
FT                   /locus_tag="mCG_3463"
FT                   /product="mCG3463"
FT                   /note="gene_id=mCG3463.2 transcript_id=mCT2424.2 created on
FT                   11-OCT-2002"
FT   CDS             complement(join(9314953..9315189,9319750..9319923))
FT                   /codon_start=1
FT                   /locus_tag="mCG_3463"
FT                   /product="mCG3463"
FT                   /note="gene_id=mCG3463.2 transcript_id=mCT2424.2
FT                   protein_id=mCP12540.2"
FT                   /protein_id="EDL09979.1"
FT                   /translation="MKKQYDSFTFTASRNGTYKFCFSNEFSTFTHKTVYFDFQVGEDPP
FT                   LFPSENRVSALTQMESACVSIHEALKSVIDYQTHFRLREAQGRSRAEDLNTRVAYWSVG
FT                   EALILLVVSVGQVFLLKSFFSDKRTTTTRVGS"
FT   assembly_gap    9324056..9324075
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            join(9324208..9325184,9333898..9335567)
FT                   /gene="Eif1a"
FT                   /locus_tag="mCG_3464"
FT                   /product="eukaryotic translation initiation factor 1A,
FT                   transcript variant mCT174135"
FT                   /note="gene_id=mCG3464.2 transcript_id=mCT174135.0 created
FT                   on 11-OCT-2002"
FT   mRNA            join(9324225..9324283,9325125..9325184,9333958..9336613)
FT                   /gene="Eif1a"
FT                   /locus_tag="mCG_3464"
FT                   /product="eukaryotic translation initiation factor 1A,
FT                   transcript variant mCT2420"
FT                   /note="gene_id=mCG3464.2 transcript_id=mCT2420.2 created on
FT                   11-OCT-2002"
FT   mRNA            join(9324355..9324640,9325125..9325184,9333898..9334136,
FT                   9342195..9342329,9342663..9342842)
FT                   /gene="Eif1a"
FT                   /locus_tag="mCG_3464"
FT                   /product="eukaryotic translation initiation factor 1A,
FT                   transcript variant mCT174134"
FT                   /note="gene_id=mCG3464.2 transcript_id=mCT174134.0 created
FT                   on 11-OCT-2002"
FT   CDS             join(9324567..9324640,9325125..9325184,9333898..9334136,
FT                   9342195..9342329,9342663..9342736)
FT                   /codon_start=1
FT                   /gene="Eif1a"
FT                   /locus_tag="mCG_3464"
FT                   /product="eukaryotic translation initiation factor 1A,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG3464.2 transcript_id=mCT174134.0
FT                   protein_id=mCP97053.0 isoform=CRA_a"
FT                   /protein_id="EDL09975.1"
FT                   /translation="MRIITRFSVGKRQLGESGWHVVSTRLRRRPHLPENQARTEVLFCS
FT                   SQKPGLCNTVCCLWIFYIHSVPVASDLPLLDTSATHPKSIVVLGKESQLLSAGVPHSTP
FT                   VVALSIMPKNKGKGGKNRRRGRISVSLWAVAVFSSVSHLFPVILPEHRIPISTFAPANR
FT                   STLRPPGGTHGDRRTAVSGASSLLPSSGFH"
FT   assembly_gap    9326487..9326506
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9330136..9330155
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             9334094..9334528
FT                   /codon_start=1
FT                   /gene="Eif1a"
FT                   /locus_tag="mCG_3464"
FT                   /product="eukaryotic translation initiation factor 1A,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG3464.2 transcript_id=mCT174135.0
FT                   protein_id=mCP97054.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q4FJR7"
FT                   /db_xref="InterPro:IPR001253"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018104"
FT                   /db_xref="MGI:MGI:95298"
FT                   /db_xref="UniProtKB/TrEMBL:Q4FJR7"
FT                   /protein_id="EDL09976.1"
FT                   /translation="MPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNG
FT                   RLEAMCFDGVRRLCHIRGKLRKKVWINTSDIILIGLRDYQDNKADVILKYNADEARSLK
FT                   AYGELPEHAKINETDTFGPGDDDEIQFDDIGDDDEDIDDI"
FT   CDS             9334094..9334528
FT                   /codon_start=1
FT                   /gene="Eif1a"
FT                   /locus_tag="mCG_3464"
FT                   /product="eukaryotic translation initiation factor 1A,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG3464.2 transcript_id=mCT2420.2
FT                   protein_id=mCP12542.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q4FJR7"
FT                   /db_xref="InterPro:IPR001253"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018104"
FT                   /db_xref="MGI:MGI:95298"
FT                   /db_xref="UniProtKB/TrEMBL:Q4FJR7"
FT                   /protein_id="EDL09977.1"
FT                   /translation="MPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNG
FT                   RLEAMCFDGVRRLCHIRGKLRKKVWINTSDIILIGLRDYQDNKADVILKYNADEARSLK
FT                   AYGELPEHAKINETDTFGPGDDDEIQFDDIGDDDEDIDDI"
FT   CDS             9334094..9334528
FT                   /codon_start=1
FT                   /gene="Eif1a"
FT                   /locus_tag="mCG_3464"
FT                   /product="eukaryotic translation initiation factor 1A,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG3464.2 transcript_id=mCT174133.0
FT                   protein_id=mCP97052.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q4FJR7"
FT                   /db_xref="InterPro:IPR001253"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018104"
FT                   /db_xref="MGI:MGI:95298"
FT                   /db_xref="UniProtKB/TrEMBL:Q4FJR7"
FT                   /protein_id="EDL09978.1"
FT                   /translation="MPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNG
FT                   RLEAMCFDGVRRLCHIRGKLRKKVWINTSDIILIGLRDYQDNKADVILKYNADEARSLK
FT                   AYGELPEHAKINETDTFGPGDDDEIQFDDIGDDDEDIDDI"
FT   assembly_gap    9345908..9346388
FT                   /estimated_length=481
FT                   /gap_type="unknown"
FT   assembly_gap    9347330..9347349
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9369481..9369500
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9393095..9393223
FT                   /estimated_length=129
FT                   /gap_type="unknown"
FT   assembly_gap    9412846..9415638
FT                   /estimated_length=2793
FT                   /gap_type="unknown"
FT   assembly_gap    9420238..9421868
FT                   /estimated_length=1631
FT                   /gap_type="unknown"
FT   gene            complement(9439323..9454475)
FT                   /gene="Cdo1"
FT                   /locus_tag="mCG_3466"
FT                   /note="gene_id=mCG3466.3"
FT   mRNA            complement(join(9439323..9440017,9446479..9446560,
FT                   9449437..9449514,9454092..9454452))
FT                   /gene="Cdo1"
FT                   /locus_tag="mCG_3466"
FT                   /product="cysteine dioxygenase 1, cytosolic, transcript
FT                   variant mCT179596"
FT                   /note="gene_id=mCG3466.3 transcript_id=mCT179596.0 created
FT                   on 05-FEB-2003"
FT   mRNA            complement(join(9439324..9440079,9441715..9441884,
FT                   9446406..9446560,9449437..9449514,9454092..9454475))
FT                   /gene="Cdo1"
FT                   /locus_tag="mCG_3466"
FT                   /product="cysteine dioxygenase 1, cytosolic, transcript
FT                   variant mCT2419"
FT                   /note="gene_id=mCG3466.3 transcript_id=mCT2419.2 created on
FT                   05-FEB-2003"
FT   mRNA            complement(join(9439324..9440079,9441715..9441933,
FT                   9446406..9446560,9449437..9449514,9454092..9454462))
FT                   /gene="Cdo1"
FT                   /locus_tag="mCG_3466"
FT                   /product="cysteine dioxygenase 1, cytosolic, transcript
FT                   variant mCT179595"
FT                   /note="gene_id=mCG3466.3 transcript_id=mCT179595.0 created
FT                   on 05-FEB-2003"
FT   mRNA            complement(join(9439325..9440079,9441715..9441884,
FT                   9446406..9446557,9449437..9449514,9454092..9454475))
FT                   /gene="Cdo1"
FT                   /locus_tag="mCG_3466"
FT                   /product="cysteine dioxygenase 1, cytosolic, transcript
FT                   variant mCT179594"
FT                   /note="gene_id=mCG3466.3 transcript_id=mCT179594.0 created
FT                   on 05-FEB-2003"
FT   mRNA            complement(join(9439797..9439872,9446406..9446560,
FT                   9449437..9449514,9454092..9454221,9454377..9454438))
FT                   /gene="Cdo1"
FT                   /locus_tag="mCG_3466"
FT                   /product="cysteine dioxygenase 1, cytosolic, transcript
FT                   variant mCT174136"
FT                   /note="gene_id=mCG3466.3 transcript_id=mCT174136.0 created
FT                   on 05-FEB-2003"
FT   CDS             complement(join(9439847..9439872,9446406..9446560,
FT                   9449437..9449468))
FT                   /codon_start=1
FT                   /gene="Cdo1"
FT                   /locus_tag="mCG_3466"
FT                   /product="cysteine dioxygenase 1, cytosolic, isoform CRA_a"
FT                   /note="gene_id=mCG3466.3 transcript_id=mCT174136.0
FT                   protein_id=mCP97055.0 isoform=CRA_a"
FT                   /protein_id="EDL09968.1"
FT                   /translation="MILCWGEGHGSSIHDHTDSHCFLKLLQGNLKETLFDWPDKKSNEM
FT                   IKKSERTLRENQCAYINDPTKEKVT"
FT   CDS             complement(join(9439889..9440017,9446479..9446560,
FT                   9449437..9449514,9454092..9454261))
FT                   /codon_start=1
FT                   /gene="Cdo1"
FT                   /locus_tag="mCG_3466"
FT                   /product="cysteine dioxygenase 1, cytosolic, isoform CRA_d"
FT                   /note="gene_id=mCG3466.3 transcript_id=mCT179596.0
FT                   protein_id=mCP102518.0 isoform=CRA_d"
FT                   /protein_id="EDL09971.1"
FT                   /translation="MERTELLKPRTLADLIRILHELFAGDEVNVEEVQAVLEAYESNPA
FT                   EWALYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTDSHCFLKLLQGNLKE
FT                   TLFDWPDPLNVFPWTERPPTICCPVTQLNKGYAQFYCKGCVLRKQTIP"
FT   mRNA            complement(join(9440036..9440079,9441715..9441884,
FT                   9446406..9446560,9449437..9449477,9454393..9454473))
FT                   /gene="Cdo1"
FT                   /locus_tag="mCG_3466"
FT                   /product="cysteine dioxygenase 1, cytosolic, transcript
FT                   variant mCT174137"
FT                   /note="gene_id=mCG3466.3 transcript_id=mCT174137.0 created
FT                   on 05-FEB-2003"
FT   CDS             complement(join(9440050..9440079,9441715..9441884,
FT                   9446406..9446557,9449437..9449514,9454092..9454261))
FT                   /codon_start=1
FT                   /gene="Cdo1"
FT                   /locus_tag="mCG_3466"
FT                   /product="cysteine dioxygenase 1, cytosolic, isoform CRA_f"
FT                   /note="gene_id=mCG3466.3 transcript_id=mCT179594.0
FT                   protein_id=mCP102516.0 isoform=CRA_f"
FT                   /protein_id="EDL09973.1"
FT                   /translation="MERTELLKPRTLADLIRILHELFAGDEVNVEEVQAVLEAYESNPA
FT                   EWALYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSIHDHTDSHCFLKLLQGNLKET
FT                   LFDWPDKKSNEMIKKSERTLRENQCAYINDSIGLHRVENVSHTEPAVSLHLYSPPFDTC
FT                   HAFDQRTGHKNKVTMTFHSKFGIRTPFTTSGSLENN"
FT   CDS             complement(join(9440050..9440079,9441715..9441884,
FT                   9446406..9446560,9449437..9449514,9454092..9454261))
FT                   /codon_start=1
FT                   /gene="Cdo1"
FT                   /locus_tag="mCG_3466"
FT                   /product="cysteine dioxygenase 1, cytosolic, isoform CRA_g"
FT                   /note="gene_id=mCG3466.3 transcript_id=mCT2419.2
FT                   protein_id=mCP12547.1 isoform=CRA_g"
FT                   /protein_id="EDL09974.1"
FT                   /translation="MERTELLKPRTLADLIRILHELFAGDEVNVEEVQAVLEAYESNPA
FT                   EWALYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTDSHCFLKLLQGNLKE
FT                   TLFDWPDKKSNEMIKKSERTLRENQCAYINDSIGLHRVENVSHTEPAVSLHLYSPPFDT
FT                   CHAFDQRTGHKNKVTMTFHSKFGIRTPFTTSGSLENN"
FT   CDS             complement(join(9440050..9440079,9441715..9441884,
FT                   9446406..9446560,9449437..9449468))
FT                   /codon_start=1
FT                   /gene="Cdo1"
FT                   /locus_tag="mCG_3466"
FT                   /product="cysteine dioxygenase 1, cytosolic, isoform CRA_e"
FT                   /note="gene_id=mCG3466.3 transcript_id=mCT174137.0
FT                   protein_id=mCP97057.0 isoform=CRA_e"
FT                   /protein_id="EDL09972.1"
FT                   /translation="MILCWGEGHGSSIHDHTDSHCFLKLLQGNLKETLFDWPDKKSNEM
FT                   IKKSERTLRENQCAYINDSIGLHRVENVSHTEPAVSLHLYSPPFDTCHAFDQRTGHKNK
FT                   VTMTFHSKFGIRTPFTTSGSLENN"
FT   mRNA            complement(join(9441844..9441884,9446406..9446465,
FT                   9449497..9449514,9454092..9454467))
FT                   /gene="Cdo1"
FT                   /locus_tag="mCG_3466"
FT                   /product="cysteine dioxygenase 1, cytosolic, transcript
FT                   variant mCT174138"
FT                   /note="gene_id=mCG3466.3 transcript_id=mCT174138.0 created
FT                   on 05-FEB-2003"
FT   CDS             complement(join(9441887..9441933,9446406..9446560,
FT                   9449437..9449514,9454092..9454261))
FT                   /codon_start=1
FT                   /gene="Cdo1"
FT                   /locus_tag="mCG_3466"
FT                   /product="cysteine dioxygenase 1, cytosolic, isoform CRA_c"
FT                   /note="gene_id=mCG3466.3 transcript_id=mCT179595.0
FT                   protein_id=mCP102517.0 isoform=CRA_c"
FT                   /protein_id="EDL09970.1"
FT                   /translation="MERTELLKPRTLADLIRILHELFAGDEVNVEEVQAVLEAYESNPA
FT                   EWALYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTDSHCFLKLLQGNLKE
FT                   TLFDWPDKKSNEMIKKSERTLRENQCAYINATVLIPSLFSVLFGL"
FT   CDS             complement(join(9446444..9446465,9449497..9449514,
FT                   9454092..9454261))
FT                   /codon_start=1
FT                   /gene="Cdo1"
FT                   /locus_tag="mCG_3466"
FT                   /product="cysteine dioxygenase 1, cytosolic, isoform CRA_b"
FT                   /note="gene_id=mCG3466.3 transcript_id=mCT174138.0
FT                   protein_id=mCP97056.0 isoform=CRA_b"
FT                   /protein_id="EDL09969.1"
FT                   /translation="MERTELLKPRTLADLIRILHELFAGDEVNVEEVQAVLEAYESNPA
FT                   EWALYAKFDQYRYTRNLVRDDQEV"
FT   gene            complement(9458546..9467683)
FT                   /gene="Atg12"
FT                   /locus_tag="mCG_3468"
FT                   /note="gene_id=mCG3468.1"
FT   mRNA            complement(join(9458546..9460628,9461374..9461436,
FT                   9463512..9463648,9467500..9467677))
FT                   /gene="Atg12"
FT                   /locus_tag="mCG_3468"
FT                   /product="autophagy-related 12 (yeast), transcript variant
FT                   mCT2413"
FT                   /note="gene_id=mCG3468.1 transcript_id=mCT2413.0 created on
FT                   11-OCT-2002"
FT   CDS             complement(join(9460569..9460628,9461374..9461436,
FT                   9463512..9463648,9467500..9467665))
FT                   /codon_start=1
FT                   /gene="Atg12"
FT                   /locus_tag="mCG_3468"
FT                   /product="autophagy-related 12 (yeast), isoform CRA_b"
FT                   /note="gene_id=mCG3468.1 transcript_id=mCT2413.0
FT                   protein_id=mCP12528.1 isoform=CRA_b"
FT                   /protein_id="EDL09967.1"
FT                   /translation="MSEDSEVVLQLPSAPVGAGGESLPELSPETATPEPPSSAAVSPGT
FT                   EEPPGDTKKKIDILLKAVGDTPIMKTKKWAVERTRTIQGLIDFIKKFLKLVASEQLFIY
FT                   VNQSFAPSPDQEVGTLYECFGSDGKLVLHYCKSQAWG"
FT   mRNA            complement(join(9463199..9463648,9467500..9467683))
FT                   /gene="Atg12"
FT                   /locus_tag="mCG_3468"
FT                   /product="autophagy-related 12 (yeast), transcript variant
FT                   mCT174139"
FT                   /note="gene_id=mCG3468.1 transcript_id=mCT174139.0 created
FT                   on 11-OCT-2002"
FT   CDS             complement(join(9463506..9463648,9467500..9467665))
FT                   /codon_start=1
FT                   /gene="Atg12"
FT                   /locus_tag="mCG_3468"
FT                   /product="autophagy-related 12 (yeast), isoform CRA_a"
FT                   /note="gene_id=mCG3468.1 transcript_id=mCT174139.0
FT                   protein_id=mCP97058.0 isoform=CRA_a"
FT                   /protein_id="EDL09966.1"
FT                   /translation="MSEDSEVVLQLPSAPVGAGGESLPELSPETATPEPPSSAAVSPGT
FT                   EEPPGDTKKKIDILLKAVGDTPIMKTKKWAVERTRTIQGLIDFIKKFLKLVASEQLV"
FT   assembly_gap    9468020..9468086
FT                   /estimated_length=67
FT                   /gap_type="unknown"
FT   gene            9468087..9516823
FT                   /locus_tag="mCG_3457"
FT                   /note="gene_id=mCG3457.2"
FT   mRNA            join(9468087..9468219,9480552..9480643,9484184..9484295,
FT                   9505402..9505473,9506875..9506982,9516103..9516823)
FT                   /locus_tag="mCG_3457"
FT                   /product="mCG3457, transcript variant mCT2430"
FT                   /note="gene_id=mCG3457.2 transcript_id=mCT2430.2 created on
FT                   11-OCT-2002"
FT   mRNA            join(9468087..9468219,9480552..9480643,9483563..9483616,
FT                   9484184..9484295,9505402..9505420)
FT                   /locus_tag="mCG_3457"
FT                   /product="mCG3457, transcript variant mCT174418"
FT                   /note="gene_id=mCG3457.2 transcript_id=mCT174418.0 created
FT                   on 14-OCT-2002"
FT   CDS             join(9468151..9468219,9480552..9480643,9484184..9484295,
FT                   9505402..9505473,9506875..9506982,9516103..9516231)
FT                   /codon_start=1
FT                   /locus_tag="mCG_3457"
FT                   /product="mCG3457, isoform CRA_b"
FT                   /note="gene_id=mCG3457.2 transcript_id=mCT2430.2
FT                   protein_id=mCP12531.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q3U8S0"
FT                   /db_xref="InterPro:IPR000804"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="InterPro:IPR016635"
FT                   /db_xref="InterPro:IPR022775"
FT                   /db_xref="MGI:MGI:1337062"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U8S0"
FT                   /protein_id="EDL09965.1"
FT                   /translation="MIKAILIFNNHGKPRLSKFYQPYSEDTQQQIIRETFHLVSKRDEN
FT                   VCNFLEGGLLIGGSDNKLIYRHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENV
FT                   CELDLIFHVDKVHNILAEMVMGGMVLETNMNEIVTQIDAQNKLEKSEAGLAGAPARAVS
FT                   AVKNMNLPEIPRNINIGDISIKVPNLPSFK"
FT   CDS             join(9468151..9468219,9480552..9480643,9483563..9483566)
FT                   /codon_start=1
FT                   /locus_tag="mCG_3457"
FT                   /product="mCG3457, isoform CRA_a"
FT                   /note="gene_id=mCG3457.2 transcript_id=mCT174418.0
FT                   protein_id=mCP97337.0 isoform=CRA_a"
FT                   /protein_id="EDL09964.1"
FT                   /translation="MIKAILIFNNHGKPRLSKFYQPYSEDTQQQIIRETFHLVSKRDEN
FT                   VCNFLEGGF"
FT   assembly_gap    9470110..9470198
FT                   /estimated_length=89
FT                   /gap_type="unknown"
FT   assembly_gap    9475961..9475980
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9518407..9518564
FT                   /estimated_length=158
FT                   /gap_type="unknown"
FT   assembly_gap    9523016..9523035
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9526934..9526958
FT                   /estimated_length=25
FT                   /gap_type="unknown"
FT   assembly_gap    9556219..9558182
FT                   /estimated_length=1964
FT                   /gap_type="unknown"
FT   gene            9574734..9608248
FT                   /locus_tag="mCG_3461"
FT                   /note="gene_id=mCG3461.2"
FT   mRNA            join(9574734..9575572,9589397..9589539,9591119..9591258,
FT                   9600624..9600750,9603397..9603551,9604743..9604856,
FT                   9607130..9607273,9607770..9607835,9607924..9608248)
FT                   /locus_tag="mCG_3461"
FT                   /product="mCG3461"
FT                   /note="gene_id=mCG3461.2 transcript_id=mCT2422.2 created on
FT                   11-OCT-2002"
FT   CDS             join(9574887..9575572,9589397..9589539,9591119..9591258,
FT                   9600624..9600750,9603397..9603551,9604743..9604856,
FT                   9607130..9607273,9607770..9607835,9607924..9608028)
FT                   /codon_start=1
FT                   /locus_tag="mCG_3461"
FT                   /product="mCG3461"
FT                   /note="gene_id=mCG3461.2 transcript_id=mCT2422.2
FT                   protein_id=mCP12538.2"
FT                   /protein_id="EDL09963.1"
FT                   /translation="MSRPFSSGVYVSRGVALLLAALTAVLLLVLVALASLYGSCAHVQP
FT                   SEQGNSRVKNTSLWPPGGQEWALPTPAQEPTVGTSQDLGPPSGPWDHLRLPPWLVPLHY
FT                   DLELWPWLQPDKLSPPNLTFTGRVNITVRCTVASSRLLLHSFLLNYKQVEVWGPLAQDT
FT                   RNATVGRVQVEKVWFAPDMQFVVLDLGQSLEPGSRYELSFHFSGQVLQVGLEGLFLNLY
FT                   HDEDELRALVATQMEPTFARHVFPCFDEPALKATFNITVIHHPGYAALSNMPQLGQSER
FT                   IDVNGSRWTVTTFHTTPRMPTYLVALVVCDLDHISRTERGKEIRVWARKDDIASGYLDF
FT                   AANITGPIFSFLEDLFNISYRLPKTDIVALPIFASGAMENWGLLIFDESSLLLEPEDEL
FT                   TEKRAMILSIIAHEVGHQWFGNLVTMSWWNNIWLNEGFASYFELELTNYFYPKVPMNMI
FT                   FFFTVLHGILGEDHALESRAVSTAVENFTETSEINRLFDLYTYKKGACMAWMLASFLSP
FT                   HLFINALKSYLETFSYSNAEQDDLWRHIQMVIVPFRHFLAEH"
FT   gene            9595534..9596004
FT                   /pseudo
FT                   /locus_tag="mCG_127875"
FT                   /note="gene_id=mCG127875.1"
FT   mRNA            9595534..9596004
FT                   /pseudo
FT                   /locus_tag="mCG_127875"
FT                   /note="gene_id=mCG127875.1 transcript_id=mCT129166.1
FT                   created on 11-OCT-2002"
FT   assembly_gap    9597353..9597372
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9601378..9601397
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            9620003..9633771
FT                   /locus_tag="mCG_141257"
FT                   /note="gene_id=mCG141257.0"
FT   mRNA            join(9620003..9620026,9620805..9620981,9621156..9621293,
FT                   9626724..9626799,9633541..9633771)
FT                   /locus_tag="mCG_141257"
FT                   /product="mCG141257"
FT                   /note="gene_id=mCG141257.0 transcript_id=mCT174174.0
FT                   created on 11-OCT-2002"
FT   assembly_gap    9620410..9620429
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(9620947..9620981,9621156..9621293,9626724..9626799,
FT                   9633541..9633681)
FT                   /codon_start=1
FT                   /locus_tag="mCG_141257"
FT                   /product="mCG141257"
FT                   /note="gene_id=mCG141257.0 transcript_id=mCT174174.0
FT                   protein_id=mCP97093.0"
FT                   /protein_id="EDL09962.1"
FT                   /translation="MSCSKDPWILNRFMEYAITAVSSNFSETNIIVVVATSEVGRYIAK
FT                   DFLMDNWVAVTERYGMDWLDALVPVLGRTVSTDQQVTELQHFFSTVLEEHQRVVVQAKL
FT                   QAMKTKNLQNKKRIARVVEWLRKNT"
FT   assembly_gap    9631443..9631462
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9631683..9631702
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9644544..9644651
FT                   /estimated_length=108
FT                   /gap_type="unknown"
FT   assembly_gap    9661022..9661053
FT                   /estimated_length=32
FT                   /gap_type="unknown"
FT   assembly_gap    9666899..9667058
FT                   /estimated_length=160
FT                   /gap_type="unknown"
FT   gene            complement(9669959..9670551)
FT                   /pseudo
FT                   /locus_tag="mCG_126149"
FT                   /note="gene_id=mCG126149.1"
FT   mRNA            complement(9669959..9670551)
FT                   /pseudo
FT                   /locus_tag="mCG_126149"
FT                   /note="gene_id=mCG126149.1 transcript_id=mCT127416.1
FT                   created on 11-OCT-2002"
FT   assembly_gap    9672005..9672121
FT                   /estimated_length=117
FT                   /gap_type="unknown"
FT   assembly_gap    9673278..9675880
FT                   /estimated_length=2603
FT                   /gap_type="unknown"
FT   gene            9687436..9817453
FT                   /gene="Commd10"
FT                   /locus_tag="mCG_3460"
FT                   /note="gene_id=mCG3460.1"
FT   mRNA            join(9687436..9687495,9688983..9689073,9692227..9692337,
FT                   9696307..9696462,9719105..9719215,9815709..9815768,
FT                   9816485..9817453)
FT                   /gene="Commd10"
FT                   /locus_tag="mCG_3460"
FT                   /product="COMM domain containing 10, transcript variant
FT                   mCT2421"
FT                   /note="gene_id=mCG3460.1 transcript_id=mCT2421.1 created on
FT                   11-OCT-2002"
FT   mRNA            join(9687444..9687495,9688983..9689073,9692227..9692337,
FT                   9719105..9719215,9815709..9815768,9816485..9816611)
FT                   /gene="Commd10"
FT                   /locus_tag="mCG_3460"
FT                   /product="COMM domain containing 10, transcript variant
FT                   mCT174130"
FT                   /note="gene_id=mCG3460.1 transcript_id=mCT174130.0 created
FT                   on 11-OCT-2002"
FT   mRNA            join(9687445..9687495,9688983..9689073,9719105..9719215,
FT                   9815709..9815768,9816485..9816665)
FT                   /gene="Commd10"
FT                   /locus_tag="mCG_3460"
FT                   /product="COMM domain containing 10, transcript variant
FT                   mCT174131"
FT                   /note="gene_id=mCG3460.1 transcript_id=mCT174131.0 created
FT                   on 11-OCT-2002"
FT   CDS             join(9687455..9687495,9688983..9689073,9692227..9692337,
FT                   9696307..9696462,9719105..9719215,9815709..9815768,
FT                   9816485..9816523)
FT                   /codon_start=1
FT                   /gene="Commd10"
FT                   /locus_tag="mCG_3460"
FT                   /product="COMM domain containing 10, isoform CRA_c"
FT                   /note="gene_id=mCG3460.1 transcript_id=mCT2421.1
FT                   protein_id=mCP12529.2 isoform=CRA_c"
FT                   /db_xref="GOA:Q3TKN7"
FT                   /db_xref="InterPro:IPR009886"
FT                   /db_xref="InterPro:IPR017920"
FT                   /db_xref="MGI:MGI:1916706"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TKN7"
FT                   /protein_id="EDL09961.1"
FT                   /translation="MAASAALILPESPSMKKAVPLINAIDTGRFPRLLSRILQKLHLKA
FT                   ESSFSEEEEEKLQAAFSLEKQELHLVLETISFVLEQAVYHNVKPAALQQQLEMIHLRKD
FT                   KAEAFASAWSAMGQETVEKFRQRILGPHKLETVGWQLNLQMAHSAQAKLQSPQAVLQLG
FT                   VSKEDAKNVEKVLVEFNHKELFDFYNKLETIQAQLDSLT"
FT   CDS             join(9687455..9687495,9688983..9689073,9692227..9692337,
FT                   9719105..9719215,9815709..9815768,9816485..9816523)
FT                   /codon_start=1
FT                   /gene="Commd10"
FT                   /locus_tag="mCG_3460"
FT                   /product="COMM domain containing 10, isoform CRA_a"
FT                   /note="gene_id=mCG3460.1 transcript_id=mCT174130.0
FT                   protein_id=mCP97049.0 isoform=CRA_a"
FT                   /protein_id="EDL09959.1"
FT                   /translation="MAASAALILPESPSMKKAVPLINAIDTGRFPRLLSRILQKLHLKA
FT                   ESSFSEEEEEKLQAAFSLEKQELHLVLETISFVLEQLETVGWQLNLQMAHSAQAKLQSP
FT                   QAVLQLGVSKEDAKNVEKVLVEFNHKELFDFYNKLETIQAQLDSLT"
FT   CDS             join(9687455..9687495,9688983..9689073,9719105..9719215,
FT                   9815709..9815768,9816485..9816523)
FT                   /codon_start=1
FT                   /gene="Commd10"
FT                   /locus_tag="mCG_3460"
FT                   /product="COMM domain containing 10, isoform CRA_b"
FT                   /note="gene_id=mCG3460.1 transcript_id=mCT174131.0
FT                   protein_id=mCP97050.0 isoform=CRA_b"
FT                   /protein_id="EDL09960.1"
FT                   /translation="MAASAALILPESPSMKKAVPLINAIDTGRFPRLLSRILQKLHLKL
FT                   ETVGWQLNLQMAHSAQAKLQSPQAVLQLGVSKEDAKNVEKVLVEFNHKELFDFYNKLET
FT                   IQAQLDSLT"
FT   assembly_gap    9689481..9689628
FT                   /estimated_length=148
FT                   /gap_type="unknown"
FT   assembly_gap    9709535..9709554
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9711708..9711727
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9718612..9718631
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9730427..9730934
FT                   /estimated_length=508
FT                   /gap_type="unknown"
FT   assembly_gap    9758494..9758531
FT                   /estimated_length=38
FT                   /gap_type="unknown"
FT   assembly_gap    9765895..9765914
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9779274..9779293
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9801141..9801160
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            9836347..9838800
FT                   /locus_tag="mCG_147308"
FT                   /note="gene_id=mCG147308.0"
FT   mRNA            9836347..9838800
FT                   /locus_tag="mCG_147308"
FT                   /product="mCG147308"
FT                   /note="gene_id=mCG147308.0 transcript_id=mCT187571.0
FT                   created on 13-JAN-2004"
FT   CDS             9837239..9837502
FT                   /codon_start=1
FT                   /locus_tag="mCG_147308"
FT                   /product="mCG147308"
FT                   /note="gene_id=mCG147308.0 transcript_id=mCT187571.0
FT                   protein_id=mCP109696.0"
FT                   /protein_id="EDL09958.1"
FT                   /translation="MCLGVFVCLCAAYVPDAGAGGGQKRVLHPLKLKLWTVVDYHVDAG
FT                   IEHGSEKAANTLFFLLLFWFLFCFCFFETGFLCIALAVLELT"
FT   gene            9841572..9841995
FT                   /locus_tag="mCG_8024"
FT                   /note="gene_id=mCG8024.0"
FT   mRNA            9841572..9841995
FT                   /locus_tag="mCG_8024"
FT                   /product="mCG8024"
FT                   /note="gene_id=mCG8024.0 transcript_id=mCT7171.0 created on
FT                   11-OCT-2002"
FT   CDS             9841612..9841920
FT                   /codon_start=1
FT                   /locus_tag="mCG_8024"
FT                   /product="mCG8024"
FT                   /note="gene_id=mCG8024.0 transcript_id=mCT7171.0
FT                   protein_id=mCP12544.1"
FT                   /db_xref="GOA:Q9JI95"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="UniProtKB/TrEMBL:Q9JI95"
FT                   /protein_id="EDL09957.1"
FT                   /translation="MAGQAFRKFLLLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQAT
FT                   VVAVGSGGKGKSGEIEPVSVKVGDKVLLPEYGGTKVVLDDKDYFLFRDSDILGKYVN"
FT   gene            9845986..9846808
FT                   /pseudo
FT                   /locus_tag="mCG_51938"
FT                   /note="gene_id=mCG51938.2"
FT   mRNA            9845986..9846808
FT                   /pseudo
FT                   /locus_tag="mCG_51938"
FT                   /note="gene_id=mCG51938.2 transcript_id=mCT52121.2 created
FT                   on 10-MAR-2003"
FT   assembly_gap    9864715..9864734
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9869090..9869290
FT                   /estimated_length=201
FT                   /gap_type="unknown"
FT   assembly_gap    9876939..9876958
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9912387..9912406
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9917748..9917767
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9920562..9920635
FT                   /estimated_length=74
FT                   /gap_type="unknown"
FT   assembly_gap    9947149..9947355
FT                   /estimated_length=207
FT                   /gap_type="unknown"
FT   assembly_gap    9965656..9965675
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<9972441..10092547)
FT                   /gene="Sema6a"
FT                   /locus_tag="mCG_8025"
FT                   /note="gene_id=mCG8025.2"
FT   mRNA            complement(join(<9972441..9973642,9994805..9994969,
FT                   10000778..10000798,10003308..10003366,10005312..10005392,
FT                   10005484..10005624,10005987..10006012,10006091..10006163,
FT                   10007501..10007656,10011615..10011746,10014166..10014383,
FT                   10015286..10015374,10016078..10016197,10018210..10018300,
FT                   10022376..10022477,10023267..10023329,10024274..10024334,
FT                   10028294..10028411,10030546..10030683,10092513..10092547))
FT                   /gene="Sema6a"
FT                   /locus_tag="mCG_8025"
FT                   /product="sema domain, transmembrane domain (TM), and
FT                   cytoplasmic domain, (semaphorin) 6A, transcript variant
FT                   mCT174467"
FT                   /note="gene_id=mCG8025.2 transcript_id=mCT174467.0 created
FT                   on 08-NOV-2002"
FT   mRNA            complement(join(<9972441..9973642,9994805..9994969,
FT                   10000778..10000798,10003308..10003366,10005312..10005392,
FT                   10005484..10005624,10005987..10006163,10007501..10007656,
FT                   10011615..10011746,10014166..10014383,10015286..10015374,
FT                   10016078..10016197,10018210..10018300,10022376..10022477,
FT                   10023267..10023329,10024274..10024334,10028294..10028411,
FT                   10030546..10030683,10092513..10092547))
FT                   /gene="Sema6a"
FT                   /locus_tag="mCG_8025"
FT                   /product="sema domain, transmembrane domain (TM), and
FT                   cytoplasmic domain, (semaphorin) 6A, transcript variant
FT                   mCT7168"
FT                   /note="gene_id=mCG8025.2 transcript_id=mCT7168.2 created on
FT                   08-NOV-2002"
FT   CDS             complement(join(9972441..9973642,9994805..9994969,
FT                   10000778..10000798,10003308..10003366,10005312..10005392,
FT                   10005484..10005624,10005987..10006012,10006091..10006163,
FT                   10007501..10007656,10011615..10011746,10014166..10014383,
FT                   10015286..10015374,10016078..10016197,10018210..10018300,
FT                   10022376..10022477,10023267..10023329,10024274..10024334,
FT                   10028294..10028411,10030546..10030645))
FT                   /codon_start=1
FT                   /gene="Sema6a"
FT                   /locus_tag="mCG_8025"
FT                   /product="sema domain, transmembrane domain (TM), and
FT                   cytoplasmic domain, (semaphorin) 6A, isoform CRA_a"
FT                   /note="gene_id=mCG8025.2 transcript_id=mCT174467.0
FT                   protein_id=mCP97386.0 isoform=CRA_a"
FT                   /protein_id="EDL09954.1"
FT                   /translation="MRPAALLLCLTLLHCAGAGFPEDSEPISISHGNYTKQYPVFVGHK
FT                   PGRNTTQRHRLDIQMIMIMNRTLYVAARDHIYTVDIDTSHTEEIYCSKKLTWKSRQADV
FT                   DTCRMKGKHKDECHNFIKVLLKKNDDTLFVCGTNAFNPSCRNYRVDTLETFGDEFSGMA
FT                   RCPYDAKHANIALFADGKLYSATVTDFLAIDAVIYRSLGDSPTLRTVKHDSKWLKEPYF
FT                   VQAVDYGDYIYFFFREIAVEYNTMGKVVFPRVAQVCKNDMGGSQRVLEKQWTSFLKARL
FT                   NCSVPGDSHFYFNILQAVTDVIRINGRDVVLATFSTPYNSIPGSAVCAYDMLDIANVFT
FT                   GRFKEQKSPDSTWTPVPDERVPKPRPGCCAGSSSLEKYATSNEFPDDTLNFIKTHPLMD
FT                   EAVPSIINRPWFLRTMVRYRLTKIAVDNAAGPYQNHTVVFLGEMNVYNPEKCSYDGVED
FT                   KRIMGMQLDRASGSLYVAFSTCVIKVPLGRCERHGKCKKTCIASRDPYCGWVRESGSCA
FT                   HLSPLSRLTFEQDIERGNTDGLGDCHNSFVALNGHASSLYPSTTTSDSASRDGYESRGG
FT                   MLDWNDLLEAPGSTDPLGAVSSHNHQDKKGVIRESYLKSNDQLVPVTLLAIAVILAFVM
FT                   GAVFSGIIVYCVCDHRRKDVAVVQRKEKELTHSRRGSMSSVTKLSGLFGDTQSKDPKPE
FT                   AILTPLMHNGKLATPSNTAKMLIKADQHHLDLTALPTPESTPTLQQKRKPNRGSREWER
FT                   NQNIINACTKDMPPMGSPVIPTDLPLRASPSHIPSVVVLPITQQGYQHEYVDQPKMSEV
FT                   VAQMALEDQAATLEYKTIKEHLSSKSPNHGVNLVENLDSLPPKVPQREASLGPPGTSLS
FT                   QTGLSKRLEMQHSSSYGLEYKRSYPTNSLTRSHQTTTLKRNNTNSSNSSHLSRNQSFGR
FT                   GDNPPPAPQRVDSIQVHSSQPSGQAVTVSRQPSLNAYNSLTRSGLKRTPSLKPDVPPKP
FT                   SFAPLSTSMKPNDACT"
FT   CDS             complement(join(9972441..9973642,9994805..9994969,
FT                   10000778..10000798,10003308..10003366,10005312..10005392,
FT                   10005484..10005624,10005987..10006163,10007501..10007656,
FT                   10011615..10011746,10014166..10014383,10015286..10015374,
FT                   10016078..10016197,10018210..10018300,10022376..10022477,
FT                   10023267..10023329,10024274..10024334,10028294..10028411,
FT                   10030546..10030645))
FT                   /codon_start=1
FT                   /gene="Sema6a"
FT                   /locus_tag="mCG_8025"
FT                   /product="sema domain, transmembrane domain (TM), and
FT                   cytoplasmic domain, (semaphorin) 6A, isoform CRA_c"
FT                   /note="gene_id=mCG8025.2 transcript_id=mCT7168.2
FT                   protein_id=mCP12546.2 isoform=CRA_c"
FT                   /protein_id="EDL09956.1"
FT                   /translation="MRPAALLLCLTLLHCAGAGFPEDSEPISISHGNYTKQYPVFVGHK
FT                   PGRNTTQRHRLDIQMIMIMNRTLYVAARDHIYTVDIDTSHTEEIYCSKKLTWKSRQADV
FT                   DTCRMKGKHKDECHNFIKVLLKKNDDTLFVCGTNAFNPSCRNYRVDTLETFGDEFSGMA
FT                   RCPYDAKHANIALFADGKLYSATVTDFLAIDAVIYRSLGDSPTLRTVKHDSKWLKEPYF
FT                   VQAVDYGDYIYFFFREIAVEYNTMGKVVFPRVAQVCKNDMGGSQRVLEKQWTSFLKARL
FT                   NCSVPGDSHFYFNILQAVTDVIRINGRDVVLATFSTPYNSIPGSAVCAYDMLDIANVFT
FT                   GRFKEQKSPDSTWTPVPDERVPKPRPGCCAGSSSLEKYATSNEFPDDTLNFIKTHPLMD
FT                   EAVPSIINRPWFLRTMVRYRLTKIAVDNAAGPYQNHTVVFLGSEKGIILKFLARIGSSG
FT                   FLNGSLFLEEMNVYNPEKCSYDGVEDKRIMGMQLDRASGSLYVAFSTCVIKVPLGRCER
FT                   HGKCKKTCIASRDPYCGWVRESGSCAHLSPLSRLTFEQDIERGNTDGLGDCHNSFVALN
FT                   GHASSLYPSTTTSDSASRDGYESRGGMLDWNDLLEAPGSTDPLGAVSSHNHQDKKGVIR
FT                   ESYLKSNDQLVPVTLLAIAVILAFVMGAVFSGIIVYCVCDHRRKDVAVVQRKEKELTHS
FT                   RRGSMSSVTKLSGLFGDTQSKDPKPEAILTPLMHNGKLATPSNTAKMLIKADQHHLDLT
FT                   ALPTPESTPTLQQKRKPNRGSREWERNQNIINACTKDMPPMGSPVIPTDLPLRASPSHI
FT                   PSVVVLPITQQGYQHEYVDQPKMSEVVAQMALEDQAATLEYKTIKEHLSSKSPNHGVNL
FT                   VENLDSLPPKVPQREASLGPPGTSLSQTGLSKRLEMQHSSSYGLEYKRSYPTNSLTRSH
FT                   QTTTLKRNNTNSSNSSHLSRNQSFGRGDNPPPAPQRVDSIQVHSSQPSGQAVTVSRQPS
FT                   LNAYNSLTRSGLKRTPSLKPDVPPKPSFAPLSTSMKPNDACT"
FT   assembly_gap    9987932..9987951
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            complement(join(10027864..10028411,10030546..10030683,
FT                   10092513..10092543))
FT                   /gene="Sema6a"
FT                   /locus_tag="mCG_8025"
FT                   /product="sema domain, transmembrane domain (TM), and
FT                   cytoplasmic domain, (semaphorin) 6A, transcript variant
FT                   mCT175453"
FT                   /note="gene_id=mCG8025.2 transcript_id=mCT175453.0 created
FT                   on 08-NOV-2002"
FT   CDS             complement(join(10028290..10028411,10030546..10030645))
FT                   /codon_start=1
FT                   /gene="Sema6a"
FT                   /locus_tag="mCG_8025"
FT                   /product="sema domain, transmembrane domain (TM), and
FT                   cytoplasmic domain, (semaphorin) 6A, isoform CRA_b"
FT                   /note="gene_id=mCG8025.2 transcript_id=mCT175453.0
FT                   protein_id=mCP98372.0 isoform=CRA_b"
FT                   /protein_id="EDL09955.1"
FT                   /translation="MRPAALLLCLTLLHCAGAGFPEDSEPISISHGNYTKQYPVFVGHK
FT                   PGRNTTQRHRLDIQMIMIMNRTLYVAAR"
FT   assembly_gap    10043845..10043991
FT                   /estimated_length=147
FT                   /gap_type="unknown"
FT   assembly_gap    10058852..10058871
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10091833..10091982
FT                   /estimated_length=150
FT                   /gap_type="unknown"
FT   assembly_gap    10096155..10096174
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10098023..10098376
FT                   /estimated_length=354
FT                   /gap_type="unknown"
FT   assembly_gap    10103368..10103387
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10112155..10112174
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10118235..10119845
FT                   /estimated_length=1611
FT                   /gap_type="unknown"
FT   gene            complement(10139153..10140031)
FT                   /pseudo
FT                   /locus_tag="mCG_8028"
FT                   /note="gene_id=mCG8028.2"
FT   mRNA            complement(10139153..10140031)
FT                   /pseudo
FT                   /locus_tag="mCG_8028"
FT                   /note="gene_id=mCG8028.2 transcript_id=mCT7163.2 created on
FT                   11-OCT-2002"
FT   assembly_gap    10154978..10154997
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10170976..10171070
FT                   /estimated_length=95
FT                   /gap_type="unknown"
FT   gene            10177664..10201246
FT                   /locus_tag="mCG_8027"
FT                   /note="gene_id=mCG8027.2"
FT   mRNA            join(10177664..10177782,10179078..10179178,
FT                   10181398..10181535,10195562..10195881)
FT                   /locus_tag="mCG_8027"
FT                   /product="mCG8027, transcript variant mCT7162"
FT                   /note="gene_id=mCG8027.2 transcript_id=mCT7162.1 created on
FT                   11-OCT-2002"
FT   mRNA            join(10177692..10177782,10179078..10179178,
FT                   10181398..10181535,10199300..10199416,10200878..10201246)
FT                   /locus_tag="mCG_8027"
FT                   /product="mCG8027, transcript variant mCT174168"
FT                   /note="gene_id=mCG8027.2 transcript_id=mCT174168.0 created
FT                   on 11-OCT-2002"
FT   CDS             join(10179131..10179178,10181398..10181535,
FT                   10199300..10199416)
FT                   /codon_start=1
FT                   /locus_tag="mCG_8027"
FT                   /product="mCG8027, isoform CRA_a"
FT                   /note="gene_id=mCG8027.2 transcript_id=mCT174168.0
FT                   protein_id=mCP97087.0 isoform=CRA_a"
FT                   /protein_id="EDL09952.1"
FT                   /translation="MPELLQLCVEAVQLAKQDSKQLFEAAGFKKPGSHVIARGGLTGYG
FT                   ELNNVITFMECHLLILKFCIFRLPWQGFLIHPGGRFGQKSDLLLCRTPDWTWKEE"
FT   CDS             join(10179131..10179178,10181398..10181535,
FT                   10195562..10195573)
FT                   /codon_start=1
FT                   /locus_tag="mCG_8027"
FT                   /product="mCG8027, isoform CRA_b"
FT                   /note="gene_id=mCG8027.2 transcript_id=mCT7162.1
FT                   protein_id=mCP12534.2 isoform=CRA_b"
FT                   /protein_id="EDL09953.1"
FT                   /translation="MPELLQLCVEAVQLAKQDSKQLFEAAGFKKPGSHVIARGGLTGYG
FT                   ELNNVITFMECHLLILKLCV"
FT   gene            10202519..10223983
FT                   /locus_tag="mCG_147331"
FT                   /note="gene_id=mCG147331.0"
FT   mRNA            join(10202519..10202604,10222228..10223983)
FT                   /locus_tag="mCG_147331"
FT                   /product="mCG147331"
FT                   /note="gene_id=mCG147331.0 transcript_id=mCT187594.0
FT                   created on 13-JAN-2004"
FT   assembly_gap    10202869..10206562
FT                   /estimated_length=3694
FT                   /gap_type="unknown"
FT   assembly_gap    10207607..10207626
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10211282..10211301
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             10223267..10223449
FT                   /codon_start=1
FT                   /locus_tag="mCG_147331"
FT                   /product="mCG147331"
FT                   /note="gene_id=mCG147331.0 transcript_id=mCT187594.0
FT                   protein_id=mCP109719.0"
FT                   /protein_id="EDL09951.1"
FT                   /translation="MVILKPLSSSHCAALCAVDLTTAAKGEPGKASGVGSPPNLTGFWG
FT                   SNSGSQYHIPGRRFF"
FT   assembly_gap    10229316..10229335
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10252200..10252447
FT                   /estimated_length=248
FT                   /gap_type="unknown"
FT   gene            <10267410..10446278
FT                   /locus_tag="mCG_145928"
FT                   /note="gene_id=mCG145928.0"
FT   mRNA            join(<10267410..10268487,10430571..10430671,
FT                   10443344..10443474,10443732..10443801,10446046..10446144,
FT                   10446234..10446278)
FT                   /locus_tag="mCG_145928"
FT                   /product="mCG145928"
FT                   /note="gene_id=mCG145928.0 transcript_id=mCT186036.0
FT                   created on 04-JUL-2003"
FT   CDS             join(<10268347..10268487,10430571..10430671,
FT                   10443344..10443474,10443732..10443751)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145928"
FT                   /product="mCG145928"
FT                   /note="gene_id=mCG145928.0 transcript_id=mCT186036.0
FT                   protein_id=mCP107760.0"
FT                   /protein_id="EDL09950.1"
FT                   /translation="NGEKQINVPGLGSEMEHCIMITSAVNQHRKEGCWCRRTAYPAGEL
FT                   DKIGSSLTHKTSQHVTSEAVWTNILLDASWAQQLQRMICSSGIWQSRTEKPFCLLFSDS
FT                   LIQQSVQKLTISEDGDLKASGGGFGL"
FT   assembly_gap    10278542..10278561
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10308698..10308833
FT                   /estimated_length=136
FT                   /gap_type="unknown"
FT   assembly_gap    10339277..10339375
FT                   /estimated_length=99
FT                   /gap_type="unknown"
FT   assembly_gap    10341032..10341438
FT                   /estimated_length=407
FT                   /gap_type="unknown"
FT   assembly_gap    10348599..10348889
FT                   /estimated_length=291
FT                   /gap_type="unknown"
FT   assembly_gap    10357892..10357911
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10361903..10361922
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10393356..10393375
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10398412..10398467
FT                   /estimated_length=56
FT                   /gap_type="unknown"
FT   gene            10413602..10414269
FT                   /pseudo
FT                   /locus_tag="mCG_1033311"
FT                   /note="gene_id=mCG1033311.1"
FT   mRNA            10413602..10414269
FT                   /pseudo
FT                   /locus_tag="mCG_1033311"
FT                   /note="gene_id=mCG1033311.1 transcript_id=mCT151015.1
FT                   created on 17-OCT-2002"
FT   assembly_gap    10452310..10452329
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10459394..10459413
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10465661..10465680
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10471017..10471331
FT                   /estimated_length=315
FT                   /gap_type="unknown"
FT   gene            complement(10483097..10504506)
FT                   /locus_tag="mCG_1050964"
FT                   /note="gene_id=mCG1050964.0"
FT   mRNA            complement(join(10483097..10483514,10483615..10483687,
FT                   10504304..10504506))
FT                   /locus_tag="mCG_1050964"
FT                   /product="mCG1050964"
FT                   /note="gene_id=mCG1050964.0 transcript_id=mCT194753.0
FT                   created on 27-JAN-2005"
FT   CDS             complement(join(10483499..10483514,10483615..10483687,
FT                   10504304..10504325))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1050964"
FT                   /product="mCG1050964"
FT                   /note="gene_id=mCG1050964.0 transcript_id=mCT194753.0
FT                   protein_id=mCP115784.0"
FT                   /protein_id="EDL09949.1"
FT                   /translation="MFQNIINDLSQAKMNLLDFYRSDKKLSSNGSWKEIP"
FT   gene            complement(10515596..10516848)
FT                   /pseudo
FT                   /locus_tag="mCG_48619"
FT                   /note="gene_id=mCG48619.1"
FT   mRNA            complement(10515596..10516848)
FT                   /pseudo
FT                   /locus_tag="mCG_48619"
FT                   /note="gene_id=mCG48619.1 transcript_id=mCT48802.1 created
FT                   on 11-OCT-2002"
FT   assembly_gap    10516284..10516303
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10526821..10527409
FT                   /estimated_length=589
FT                   /gap_type="unknown"
FT   assembly_gap    10540655..10540674
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10543260..10544150
FT                   /estimated_length=891
FT                   /gap_type="unknown"
FT   assembly_gap    10551557..10551576
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10553120..10554796
FT                   /estimated_length=1677
FT                   /gap_type="unknown"
FT   assembly_gap    10615136..10615307
FT                   /estimated_length=172
FT                   /gap_type="unknown"
FT   assembly_gap    10625196..10625222
FT                   /estimated_length=27
FT                   /gap_type="unknown"
FT   gene            <10638547..10818117
FT                   /locus_tag="mCG_145143"
FT                   /note="gene_id=mCG145143.0"
FT   mRNA            join(<10638547..10638807,10651481..10651640,
FT                   10773978..10774069,10817284..10818117)
FT                   /locus_tag="mCG_145143"
FT                   /product="mCG145143"
FT                   /note="gene_id=mCG145143.0 transcript_id=mCT184567.0
FT                   created on 05-JUN-2003"
FT   assembly_gap    10644688..10645040
FT                   /estimated_length=353
FT                   /gap_type="unknown"
FT   assembly_gap    10739653..10739672
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10748709..10749646
FT                   /estimated_length=938
FT                   /gap_type="unknown"
FT   assembly_gap    10762255..10762642
FT                   /estimated_length=388
FT                   /gap_type="unknown"
FT   gene            complement(10782929..10784166)
FT                   /locus_tag="mCG_8026"
FT                   /note="gene_id=mCG8026.2"
FT   mRNA            complement(10782929..10784166)
FT                   /locus_tag="mCG_8026"
FT                   /product="mCG8026"
FT                   /note="gene_id=mCG8026.2 transcript_id=mCT7172.2 created on
FT                   11-OCT-2002"
FT   CDS             complement(10783214..10783618)
FT                   /codon_start=1
FT                   /locus_tag="mCG_8026"
FT                   /product="mCG8026"
FT                   /note="gene_id=mCG8026.2 transcript_id=mCT7172.2
FT                   protein_id=mCP12532.2"
FT                   /protein_id="EDL09948.1"
FT                   /translation="MRIGAEVYHNLKNVIKEKYRKDATNVGDEGGFASNILENKEALLL
FT                   LKTAISKAGITDQVVIGMDVAASEFYRSGKYDLDFKSLDDTSRYITHDQLADLYKSFIQ
FT                   TTQWYPSKPPLTRTTGMLGRSSLLVRASRW"
FT   assembly_gap    10787156..10787175
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             <10817638..10817928
FT                   /codon_start=1
FT                   /locus_tag="mCG_145143"
FT                   /product="mCG145143"
FT                   /note="gene_id=mCG145143.0 transcript_id=mCT184567.0
FT                   protein_id=mCP106254.0"
FT                   /protein_id="EDL09947.1"
FT                   /translation="YTLLPFKIKDDDFLVRRRSAFDFKTFAFGKIPLFVNLWFLISFFC
FT                   LFYKALEKFRNIVQNSKYYFIKKQEILLYLELGQSRNLTISTHNFLHCPGV"
FT   assembly_gap    10837618..10837637
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10845677..10845696
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10848241..10848764
FT                   /estimated_length=524
FT                   /gap_type="unknown"
FT   assembly_gap    10851246..10851265
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10853052..10853523
FT                   /estimated_length=472
FT                   /gap_type="unknown"
FT   assembly_gap    10867685..10868602
FT                   /estimated_length=918
FT                   /gap_type="unknown"
FT   assembly_gap    10882266..10882312
FT                   /estimated_length=47
FT                   /gap_type="unknown"
FT   assembly_gap    10893565..10893584
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10899966..10899985
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10909808..10909827
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10920747..10920766
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10968077..10968122
FT                   /estimated_length=46
FT                   /gap_type="unknown"
FT   assembly_gap    10983444..10984141
FT                   /estimated_length=698
FT                   /gap_type="unknown"
FT   assembly_gap    11003441..11003528
FT                   /estimated_length=88
FT                   /gap_type="unknown"
FT   assembly_gap    11105961..11105980
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11135856..11136103
FT                   /estimated_length=248
FT                   /gap_type="unknown"
FT   assembly_gap    11170974..11172020
FT                   /estimated_length=1047
FT                   /gap_type="unknown"
FT   assembly_gap    11172750..11172769
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11174347..11174366
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11184159..11184433
FT                   /estimated_length=275
FT                   /gap_type="unknown"
FT   assembly_gap    11198318..11198337
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11199538..11199557
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11208292..11209815
FT                   /estimated_length=1524
FT                   /gap_type="unknown"
FT   assembly_gap    11217192..11217680
FT                   /estimated_length=489
FT                   /gap_type="unknown"
FT   assembly_gap    11234663..11239908
FT                   /estimated_length=5246
FT                   /gap_type="unknown"
FT   assembly_gap    11319860..11319879
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            11324477..11325477
FT                   /pseudo
FT                   /locus_tag="mCG_50946"
FT                   /note="gene_id=mCG50946.2"
FT   mRNA            11324477..11325477
FT                   /pseudo
FT                   /locus_tag="mCG_50946"
FT                   /note="gene_id=mCG50946.2 transcript_id=mCT51129.2 created
FT                   on 10-MAR-2003"
FT   assembly_gap    11347919..11347938
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11358287..11359262
FT                   /estimated_length=976
FT                   /gap_type="unknown"
FT   assembly_gap    11376051..11376981
FT                   /estimated_length=931
FT                   /gap_type="unknown"
FT   assembly_gap    11388997..11389016
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11407944..11410552
FT                   /estimated_length=2609
FT                   /gap_type="unknown"
FT   assembly_gap    11431451..11431470
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11436230..11436249
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11437308..11437327
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11438575..11438918
FT                   /estimated_length=344
FT                   /gap_type="unknown"
FT   assembly_gap    11440740..11440990
FT                   /estimated_length=251
FT                   /gap_type="unknown"
FT   assembly_gap    11459325..11460158
FT                   /estimated_length=834
FT                   /gap_type="unknown"
FT   assembly_gap    11463095..11463615
FT                   /estimated_length=521
FT                   /gap_type="unknown"
FT   assembly_gap    11516296..11517818
FT                   /estimated_length=1523
FT                   /gap_type="unknown"
FT   assembly_gap    11533388..11533602
FT                   /estimated_length=215
FT                   /gap_type="unknown"
FT   assembly_gap    11541015..11541143
FT                   /estimated_length=129
FT                   /gap_type="unknown"
FT   assembly_gap    11598733..11598752
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11634402..11634446
FT                   /estimated_length=45
FT                   /gap_type="unknown"
FT   assembly_gap    11658717..11658805
FT                   /estimated_length=89
FT                   /gap_type="unknown"
FT   assembly_gap    11692189..11692253
FT                   /estimated_length=65
FT                   /gap_type="unknown"
FT   assembly_gap    11741691..11743608
FT                   /estimated_length=1918
FT                   /gap_type="unknown"
FT   assembly_gap    11752898..11752917
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11764498..11764517
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11767788..11767821
FT                   /estimated_length=34
FT                   /gap_type="unknown"
FT   assembly_gap    11769915..11770153
FT                   /estimated_length=239
FT                   /gap_type="unknown"
FT   assembly_gap    11819064..11819083
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11825226..11825245
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11856250..11856269
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11865167..11865186
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11868964..11868983
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11871438..11871457
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11875039..11875058
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11877148..11877451
FT                   /estimated_length=304
FT                   /gap_type="unknown"
FT   assembly_gap    11885889..11885908
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11887703..11887722
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11896848..11896867
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11916733..11916752
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11947407..11947475
FT                   /estimated_length=69
FT                   /gap_type="unknown"
FT   assembly_gap    12002979..12002998
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12010298..12010516
FT                   /estimated_length=219
FT                   /gap_type="unknown"
FT   assembly_gap    12013823..12013842
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12044432..12044451
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12050784..12051028
FT                   /estimated_length=245
FT                   /gap_type="unknown"
FT   assembly_gap    12057019..12057911
FT                   /estimated_length=893
FT                   /gap_type="unknown"
FT   assembly_gap    12086503..12086522
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12087857..12088149
FT                   /estimated_length=293
FT                   /gap_type="unknown"
FT   assembly_gap    12089539..12089558
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12091951..12092565
FT                   /estimated_length=615
FT                   /gap_type="unknown"
FT   assembly_gap    12144138..12144369
FT                   /estimated_length=232
FT                   /gap_type="unknown"
FT   assembly_gap    12202065..12202487
FT                   /estimated_length=423
FT                   /gap_type="unknown"
FT   gene            12217503..12218650
FT                   /locus_tag="mCG_147315"
FT                   /note="gene_id=mCG147315.0"
FT   mRNA            join(12217503..12217572,12218348..12218650)
FT                   /locus_tag="mCG_147315"
FT                   /product="mCG147315"
FT                   /note="gene_id=mCG147315.0 transcript_id=mCT187578.0
FT                   created on 13-JAN-2004"
FT   CDS             12218366..12218584
FT                   /codon_start=1
FT                   /locus_tag="mCG_147315"
FT                   /product="mCG147315"
FT                   /note="gene_id=mCG147315.0 transcript_id=mCT187578.0
FT                   protein_id=mCP109702.0"
FT                   /protein_id="EDL09946.1"
FT                   /translation="MRSLKRIECRLPHQIRRSEKPVFSSQWTKRKGGKKQGRKAVLPFS
FT                   LIPYFSVNTTLLTSLVNSKTCFLDSSM"
FT   assembly_gap    12261394..12261413
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12293038..12293057
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12295460..12295479
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12321955..12321974
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12341668..12341725
FT                   /estimated_length=58
FT                   /gap_type="unknown"
FT   assembly_gap    12359490..12359509
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12362979..12366129
FT                   /estimated_length=3151
FT                   /gap_type="unknown"
FT   assembly_gap    12388340..12388359
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(12390637..12448679)
FT                   /locus_tag="mCG_15519"
FT                   /note="gene_id=mCG15519.2"
FT   mRNA            complement(join(12390637..12391663,12393422..12393550,
FT                   12416704..12416896,12417195..12417289,12421451..12421541,
FT                   12448403..12448660))
FT                   /locus_tag="mCG_15519"
FT                   /product="mCG15519, transcript variant mCT17721"
FT                   /note="gene_id=mCG15519.2 transcript_id=mCT17721.2 created
FT                   on 11-OCT-2002"
FT   mRNA            complement(join(12390638..12391663,12393422..12393550,
FT                   12421451..12421541,12448403..12448679))
FT                   /locus_tag="mCG_15519"
FT                   /product="mCG15519, transcript variant mCT174106"
FT                   /note="gene_id=mCG15519.2 transcript_id=mCT174106.0 created
FT                   on 11-OCT-2002"
FT   CDS             complement(join(12391493..12391663,12393422..12393550,
FT                   12421451..12421541,12448403..12448620))
FT                   /codon_start=1
FT                   /locus_tag="mCG_15519"
FT                   /product="mCG15519, isoform CRA_b"
FT                   /note="gene_id=mCG15519.2 transcript_id=mCT174106.0
FT                   protein_id=mCP97025.0 isoform=CRA_b"
FT                   /db_xref="GOA:B7ZP35"
FT                   /db_xref="InterPro:IPR005636"
FT                   /db_xref="MGI:MGI:1916107"
FT                   /db_xref="UniProtKB/TrEMBL:B7ZP35"
FT                   /protein_id="EDL09945.1"
FT                   /translation="MEPQAEERTLGEPAPPPSGALASPTPDEEERTEGGAPPTATPAGA
FT                   SGDSTSADGLWGLPVEHAERRPECGRCSRPQKVCLCPYLPVRPLQISTHLYIIQHPAEV
FT                   QLKTSVCSQYVIRMQPTNRCLSTLECAAVALSILEKNNCIQETLLRPLQALCSFQLQHG
FT                   AQIRLSKEYLLRNGLYPKPMPKNKRKLRKMELLMNSVKI"
FT   CDS             complement(join(12391493..12391663,12393422..12393550,
FT                   12416704..12416896,12417195..12417289,12421451..12421541,
FT                   12448403..12448620))
FT                   /codon_start=1
FT                   /locus_tag="mCG_15519"
FT                   /product="mCG15519, isoform CRA_a"
FT                   /note="gene_id=mCG15519.2 transcript_id=mCT17721.2
FT                   protein_id=mCP20947.2 isoform=CRA_a"
FT                   /db_xref="GOA:B2RTH8"
FT                   /db_xref="InterPro:IPR005636"
FT                   /db_xref="MGI:MGI:1916107"
FT                   /db_xref="UniProtKB/TrEMBL:B2RTH8"
FT                   /protein_id="EDL09944.1"
FT                   /translation="MEPQAEERTLGEPAPPPSGALASPTPDEEERTEGGAPPTATPAGA
FT                   SGDSTSADGLWGLPVEHAERRPECGRCSRPQKVCLCPYLPVRPLQISTHLYIIQHPAEE
FT                   SRVLRTVPLLAACLPPDRCTVKIGRRFSEERDVELATVCRDSGTLILYPGAEATNLEEF
FT                   ILDSPVYPSTIILIDGTWSQAKDIFYKNSLFRLPKQVQLKTSVCSQYVIRMQPTNRCLS
FT                   TLECAAVALSILEKNNCIQETLLRPLQALCSFQLQHGAQIRLSKEYLLRNGLYPKPMPK
FT                   NKRKLRKMELLMNSVKI"
FT   assembly_gap    12403158..12403177
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12441354..12441373
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12446943..12446962
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12451778..12451797
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12453506..12453525
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12457789..12457808
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12458884..12459289
FT                   /estimated_length=406
FT                   /gap_type="unknown"
FT   assembly_gap    12460806..12460858
FT                   /estimated_length=53
FT                   /gap_type="unknown"
FT   assembly_gap    12462742..12462761
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12483624..12483643
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12486456..12487604
FT                   /estimated_length=1149
FT                   /gap_type="unknown"
FT   assembly_gap    12490764..12490783
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(12496545..>12511191)
FT                   /locus_tag="mCG_145149"
FT                   /note="gene_id=mCG145149.0"
FT   mRNA            complement(join(12496545..12496740,12498990..12499087,
FT                   12500386..12500565,12501541..12501628,12511048..>12511191))
FT                   /locus_tag="mCG_145149"
FT                   /product="mCG145149"
FT                   /note="gene_id=mCG145149.0 transcript_id=mCT184573.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(12499067..12499087,12500386..12500565,
FT                   12501541..>12501546))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145149"
FT                   /product="mCG145149"
FT                   /note="gene_id=mCG145149.0 transcript_id=mCT184573.0
FT                   protein_id=mCP106259.0"
FT                   /protein_id="EDL09943.1"
FT                   /translation="AQRGPRGPRTAQAIATAVGCPLELYGKNLLMRITCALGKGHRKMK
FT                   LQLNFCLQERHHRKRQKGEIFLT"
FT   assembly_gap    12507638..12508093
FT                   /estimated_length=456
FT                   /gap_type="unknown"
FT   assembly_gap    12519166..12519344
FT                   /estimated_length=179
FT                   /gap_type="unknown"
FT   gene            12526238..12657916
FT                   /locus_tag="mCG_140807"
FT                   /note="gene_id=mCG140807.0"
FT   mRNA            join(12526238..12526402,12533613..12533738,
FT                   12537012..12537083,12539811..12539889,12541894..12542020,
FT                   12544656..12544722,12545472..12545650,12550460..12550649,
FT                   12552343..12552511,12556132..12556344,12557175..12557428,
FT                   12557537..12558221,12558310..12558431,12561032..12561121,
FT                   12561202..12561304,12564036..12564155,12564733..12564954,
FT                   12570849..12572531,12573901..12574008,12581887..12582056,
FT                   12582634..12582731,12583788..12583953,12584563..12584824,
FT                   12586391..12587469,12588154..12588345,12591872..12591948,
FT                   12595429..12595556,12595948..12596196,12605812..12605966,
FT                   12610748..12610890,12613057..12613142,12613999..12614200,
FT                   12615767..12615884,12625081..12625167,12627756..12627877,
FT                   12628364..12628505,12632723..12632783,12644376..12644503,
FT                   12649283..12649375,12650768..12650859,12651889..12651941,
FT                   12654550..12654767,12655664..12657916)
FT                   /locus_tag="mCG_140807"
FT                   /product="mCG140807"
FT                   /note="gene_id=mCG140807.0 transcript_id=mCT171609.0
FT                   created on 06-AUG-2002"
FT   CDS             join(12526316..12526402,12533613..12533738,
FT                   12537012..12537083,12539811..12539889,12541894..12542020,
FT                   12544656..12544722,12545472..12545650,12550460..12550649,
FT                   12552343..12552511,12556132..12556344,12557175..12557428,
FT                   12557537..12558221,12558310..12558431,12561032..12561121,
FT                   12561202..12561304,12564036..12564155,12564733..12564954,
FT                   12570849..12572531,12573901..12574008,12581887..12582056,
FT                   12582634..12582731,12583788..12583953,12584563..12584824,
FT                   12586391..12587469,12588154..12588345,12591872..12591948,
FT                   12595429..12595556,12595948..12596196,12605812..12605966,
FT                   12610748..12610890,12613057..12613142,12613999..12614200,
FT                   12615767..12615884,12625081..12625167,12627756..12627877,
FT                   12628364..12628505,12632723..12632783,12644376..12644503,
FT                   12649283..12649375,12650768..12650859,12651889..12651941,
FT                   12654550..12654767,12655664..12655888)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140807"
FT                   /product="mCG140807"
FT                   /note="gene_id=mCG140807.0 transcript_id=mCT171609.0
FT                   protein_id=mCP94528.0"
FT                   /protein_id="EDL09942.1"
FT                   /translation="MNLHQVLTGAVNPGDHCFAVGSVGEQRFTAYASGCDIVILGSNFE
FT                   RLQIIPGAKHGNIQVGCVDCSMQQGKIAASYGNVISVFEPVSLPKKRKNLEFYSQWQKS
FT                   GQFFLDSIAHNITWDPAGNRLLTGSSCLQLWCNSRKQTEDENPDKTDLNFGNWMCIWHC
FT                   KTASQVHLMKFSPDGEFFATAGKDDCLLKVWYNVENWRPAVTSPDKNSEKQSQGEIDFS
FT                   FVYLAHPRAVNGFSWRKTSKYMPRASVCNVLLTCCKDNVCRLWVETFLPNDCFLYGSDC
FT                   NHWCEPVSLTNNLKRNASSKDRVQSALEVNLRPFRRGRSRSLALVAHTGYLPHQQDPHH
FT                   AHRNTPLHANALCHFHIAASINPATDIPLLPSITSLSLNENEEKCGPFVVHWLNNKELH
FT                   FTLSMEVFLQQLRKSFEQPSSEASVEDSIQADLKSDEELDDGVDDLKINHEKKELDEDK
FT                   MLPSSSFTPLSSAAVDHQIEVLLSEWSKNADMLFSIHPMDGSLLVWHVDWLDEYQPGMF
FT                   RQVQVSFVSRIPVAFPTGDANSLCKSIVMYACTKNVDLAIQQGKQRPTGLTRSTSMLIS
FT                   SAHSKSSNNLKLSIFTPNVMMISKHADGSLNQWLVSFAEESAFSTVLSISHKSRYCGHR
FT                   FHLNDLACHSVLPLLLTTSHHNALRTPNVGNQKQAHDAVNTEECSLAQQNKSNVDMAFQ
FT                   DPNAIYSELILWRVDPVGPLSFSGGVSELARINSLHVSAFSNVAWLPTLIPSYCLGAYC
FT                   NSPSACFVASDGQYLRLYEAVIDAKKLLYELSNPEISKYVGEVFNIVSQQSTARPGCII
FT                   ALDSITKLHGRKTQLLHVFQEDFILNNLEKKRLGVDNILLDSDSSCNGFSEKFYLVVIE
FT                   CTEDNRSLLRMWDLHLRSTPVSLDERIDTKISEASWLPEEHYSSSPEKILSPFSQKFQA
FT                   CRANLQSTSKLSLFSEMVYSKELDLPEGVEIISVKPSAGHLSSSSIYPVCSAPYLLATS
FT                   CSDDKVRFWRCRVTNGESATSKNGKLDVVYVWEEWPLLIEDGLENNSSVTVPGRPVEVS
FT                   CAHTSRLAVAYKQPTGNSRSQEFVMHVSIFECESTGGSCWILEQTIHLDELSTVLDSGI
FT                   SIDSNLVAYNKQETYLVSKESITSNTKHLVHLDWMSREDGSHILTVGIGSKLFMYGPMA
FT                   GKVQDQTGKENQAFPLWDSTKIVPLSKFVLLRSVDLVSSVEGAPPFPVSLSWVRDGILV
FT                   VGMDCEMHVYSQWQPSNKQEPVISESYNGSTPSILSLIKQSNSSSSGLHPPKKTLTRSM
FT                   TSLAQKICGKKSIFDPSVDMEDSGLFEAAHVLSPTLPQYHPLQLLELMDLGKVRRAKAI
FT                   LSHLVKCIAGEVVALNEAESNHERRLRSLTISASGSTTRDPQAFNKADSRDYTEIDSVP
FT                   PLPLYALLAADDDSYCSSLEKTGSESSLKKSKQLSKESYDELFQTSVLMSDNHMLETDE
FT                   ENTQPRVIDLSQYSPTYFGPEHAQVLSGHLLHSSLPGLTRMEQMSLMALADTIATTSTD
FT                   IGESRDRNQGGETLDECGLKFLLAVRLHTFLTTSLPAYRAQLLHQGLSTGHFAWAFHSV
FT                   AEEELLNMLPAMQKDDPTWSELRAMGVGWWVRNARILRRCIEKVAKAAFHRNNDPLDAA
FT                   IFYLAMKKKAVIWGLYRSQKDTKMTQFFGHNFEEERWRKAALKNAFSLLGKQRFEHSAA
FT                   FFLLGGCLKDAIEVCLEKLNDIQLALVIARLFESEFDKSATYKSILRKKVLGIGSPASE
FT                   LSSSSINAHHDPFLRSMAHWILEDYSAALETLIKQPVTEDEDQVMMSACNPIVFNFYNY
FT                   LRTHPLLLRRHFGSSSETFSTHMTLAGKSGLAGTINLSERRLFFTTASAHLKAGCPMLA
FT                   LEVLSKMPKVSKKAKPCCRGSSFLTSKDSSLKLDVREDKCCAADWSPSLTNGLESSSEG
FT                   SSERHSHSTLSFDWSQPSVVFQDDSLELKWDSDNDEENEDPPISMKEIRPLQRKTVKEI
FT                   DELSSYTDSLSTLDENDILNPSEDIIAVQLKFRACLKILTVELRTLSTGYEIDGGKLRY
FT                   QLYHWLEKEVVALQRTCDFCSDADQLQTTFSQSADESGSTEDADDLHHQTKVKQLRESF
FT                   QEKRQWLLKYQSLLRMFLSYCVLHGSHGGGLASVRMELILLLQESQQETAEPIFSNPLS
FT                   EQTSVPLLFACTASAKTVVANPLLHLSNLTHDILHAIINFDSPPHPDSQTNKVYVMHTL
FT                   AASLSACIYQCLCGSHNYSSFQTNQFTGMVYQTVLLAHRHSLRTGSLDESVTPNTSPAQ
FT                   WPGINFLIQLLNSSGEEAQSGLTVLLCEILTAVYLSLFIHGLATHSSNELFRIVAHPLN
FT                   EKMWSAVFGGGAHVPSKGQANSKALSVEGEKQNRHISPSKVSARESPVSSSSGNQEPPA
FT                   VKEKFVPPELSIWDYFIAKPFLPPSQSRAEYDSEESLESDDEEEEDDDDALPSGLQLHE
FT                   HSNSNSFSWSLMRLAMVQLVLNNLKTFYPFAGHDLAELPVSSPLCHAVLKTLQCWEQVL
FT                   LRRLEIHGGPPQNYISSHTSEENVSAGPAILRHKALLEPTNTPFKSKNHLALSVKRLWQ
FT                   YLVKQEEIQETFIRNIFTKKRCLNEIEADLGYPGGKARIIHKESDIITAFAVNRANRNC
FT                   IAIASSHDVQELDVSAILATQIYTWVDDDTETETKGSEDFLVIHARDDLSAVQGSTPYT
FT                   HSNPGTPINMPWLGSTQTGRGASVMLKKAINNVRRMTSHPTLPYYLTGAQDGSVRMFEW
FT                   GHSQQITCFRSGGNSRITRMRFNYQGNKFGIVDADGYLSLYQTNWKCCPVTGSMPKPYL
FT                   AWQCHNKTANDFVFVSSSSLIATAGLSSDNRNICLWDTLVAPANSLVHAFTCHDSGATV
FT                   LAYAPKHQLLISGGRKGFTCIFDLRQRQQRQLFQSHDSPVKAIAIDPTEEYFVTGSAEG
FT                   NIKIWSLSSFSLLHTFINEHARQSIFRNIGTGVMQIETGPANHIFSCGADGTMKMRILP
FT                   DQFSPLNEVLKNDVKFML"
FT   assembly_gap    12563476..12563497
FT                   /estimated_length=22
FT                   /gap_type="unknown"
FT   assembly_gap    12566829..12566970
FT                   /estimated_length=142
FT                   /gap_type="unknown"
FT   assembly_gap    12671925..12672097
FT                   /estimated_length=173
FT                   /gap_type="unknown"
FT   assembly_gap    12684404..12684594
FT                   /estimated_length=191
FT                   /gap_type="unknown"
FT   gene            complement(12707489..12710698)
FT                   /locus_tag="mCG_147282"
FT                   /note="gene_id=mCG147282.0"
FT   mRNA            complement(join(12707489..12708080,12710075..12710698))
FT                   /locus_tag="mCG_147282"
FT                   /product="mCG147282"
FT                   /note="gene_id=mCG147282.0 transcript_id=mCT187545.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(12707671..12707931)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147282"
FT                   /product="mCG147282"
FT                   /note="gene_id=mCG147282.0 transcript_id=mCT187545.0
FT                   protein_id=mCP109670.0"
FT                   /protein_id="EDL09941.1"
FT                   /translation="MSPCNLWFTAGTSCEDCATRSDDGSAPGQSARKRLRIPRGSPRNV
FT                   RPPASCSCRSSLPRPLSWRWDKTLRILLPVAGETEPAGVES"
FT   assembly_gap    12718210..12718399
FT                   /estimated_length=190
FT                   /gap_type="unknown"
FT   gene            complement(<12740081..>12747681)
FT                   /locus_tag="mCG_145924"
FT                   /note="gene_id=mCG145924.0"
FT   mRNA            complement(join(<12740081..12740553,12740797..12741012,
FT                   12741207..12741325,12745531..12746356,12746533..12746652,
FT                   12747354..>12747681))
FT                   /locus_tag="mCG_145924"
FT                   /product="mCG145924"
FT                   /note="gene_id=mCG145924.0 transcript_id=mCT186032.0
FT                   created on 04-JUL-2003"
FT   CDS             complement(<12740081..>12740402)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145924"
FT                   /product="mCG145924"
FT                   /note="gene_id=mCG145924.0 transcript_id=mCT186032.0
FT                   protein_id=mCP107757.0"
FT                   /protein_id="EDL09940.1"
FT                   /translation="CRTYPNRVQVKRTGSFSAVAQEVFHLNRSGSETGLFGQSLERGYR
FT                   DMCQLPLRGWGARSDNPPHLSRVQSTECDIKPMNFVGKKKGKKIINFLNLNSISTDFFF
FT                   FNY"
FT   gene            12745567..12788334
FT                   /gene="Tnfaip8"
FT                   /locus_tag="mCG_15520"
FT                   /note="gene_id=mCG15520.1"
FT   mRNA            join(12745567..12745686,12746542..12746603,
FT                   12747133..12747455,12786750..12788334)
FT                   /gene="Tnfaip8"
FT                   /locus_tag="mCG_15520"
FT                   /product="tumor necrosis factor, alpha-induced protein 8,
FT                   transcript variant mCT17722"
FT                   /note="gene_id=mCG15520.1 transcript_id=mCT17722.1 created
FT                   on 05-FEB-2003"
FT   mRNA            join(12745571..12745686,12786750..12788327)
FT                   /gene="Tnfaip8"
FT                   /locus_tag="mCG_15520"
FT                   /product="tumor necrosis factor, alpha-induced protein 8,
FT                   transcript variant mCT179561"
FT                   /note="gene_id=mCG15520.1 transcript_id=mCT179561.0 created
FT                   on 05-FEB-2003"
FT   CDS             join(12745677..12745686,12786750..12787315)
FT                   /codon_start=1
FT                   /gene="Tnfaip8"
FT                   /locus_tag="mCG_15520"
FT                   /product="tumor necrosis factor, alpha-induced protein 8,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG15520.1 transcript_id=mCT179561.0
FT                   protein_id=mCP102483.0 isoform=CRA_a"
FT                   /protein_id="EDL09937.1"
FT                   /translation="MLSVATDVFNSKNLAVQAQKKILGKMVSKSIATTLIDDTSSEVLD
FT                   ELYRVTKEYTQNKKEAERVIKNLIKTVIKLAVLHRNNQFNQDELALMEKFKKKVHQLAM
FT                   TVVSFHQVEYTFDRNVLSRLLNECRELLHEIIQRHLTAKSHGRVNNVFDHFSDCDFLAA
FT                   LYNPFGKFKPHLQKLCDGINKMLDEENI"
FT   assembly_gap    12746778..12747027
FT                   /estimated_length=250
FT                   /gap_type="unknown"
FT   CDS             join(12747425..12747455,12786750..12787315)
FT                   /codon_start=1
FT                   /gene="Tnfaip8"
FT                   /locus_tag="mCG_15520"
FT                   /product="tumor necrosis factor, alpha-induced protein 8,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG15520.1 transcript_id=mCT17722.1
FT                   protein_id=mCP20948.1 isoform=CRA_b"
FT                   /protein_id="EDL09938.1"
FT                   /translation="MLSEAEEPREVATDVFNSKNLAVQAQKKILGKMVSKSIATTLIDD
FT                   TSSEVLDELYRVTKEYTQNKKEAERVIKNLIKTVIKLAVLHRNNQFNQDELALMEKFKK
FT                   KVHQLAMTVVSFHQVEYTFDRNVLSRLLNECRELLHEIIQRHLTAKSHGRVNNVFDHFS
FT                   DCDFLAALYNPFGKFKPHLQKLCDGINKMLDEENI"
FT   gene            12759640..12765359
FT                   /locus_tag="mCG_146102"
FT                   /note="gene_id=mCG146102.0"
FT   mRNA            join(12759640..12760446,12763180..12765359)
FT                   /locus_tag="mCG_146102"
FT                   /product="mCG146102"
FT                   /note="gene_id=mCG146102.0 transcript_id=mCT186205.1
FT                   created on 19-MAR-2004"
FT   assembly_gap    12762100..12762382
FT                   /estimated_length=283
FT                   /gap_type="unknown"
FT   CDS             12763607..12763738
FT                   /codon_start=1
FT                   /locus_tag="mCG_146102"
FT                   /product="mCG146102"
FT                   /note="gene_id=mCG146102.0 transcript_id=mCT186205.1
FT                   protein_id=mCP107762.1"
FT                   /protein_id="EDL09939.1"
FT                   /translation="MDATSVRQDCLHFLLCIPDSVLCAGHLSYHLSAKYTAMQGKEI"
FT   assembly_gap    12766500..12766519
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12781443..12781816
FT                   /estimated_length=374
FT                   /gap_type="unknown"
FT   assembly_gap    12790276..12790358
FT                   /estimated_length=83
FT                   /gap_type="unknown"
FT   gene            12793811..12895561
FT                   /gene="Hsd17b4"
FT                   /locus_tag="mCG_15516"
FT                   /note="gene_id=mCG15516.2"
FT   mRNA            join(12793811..12793831,12877205..12877311,
FT                   12878345..12878431,12881230..12881316,12882457..12882595,
FT                   12891010..12891137,12895153..12895482)
FT                   /gene="Hsd17b4"
FT                   /locus_tag="mCG_15516"
FT                   /product="hydroxysteroid (17-beta) dehydrogenase 4,
FT                   transcript variant mCT174105"
FT                   /note="gene_id=mCG15516.2 transcript_id=mCT174105.0 created
FT                   on 11-OCT-2002"
FT   assembly_gap    12794509..12795072
FT                   /estimated_length=564
FT                   /gap_type="unknown"
FT   assembly_gap    12796532..12796551
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12797582..12797601
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12799087..12799106
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12800212..12800231
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12804368..12804387
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12818864..12819048
FT                   /estimated_length=185
FT                   /gap_type="unknown"
FT   assembly_gap    12821727..12822305
FT                   /estimated_length=579
FT                   /gap_type="unknown"
FT   mRNA            join(12827390..12827509,12829226..12829279,
FT                   12838742..12838849,12839634..12839693,12841769..12841790,
FT                   12841892..12841938,12844040..12844124,12845689..12845876,
FT                   12854417..12854508,12857675..12857699,12859427..12859555,
FT                   12894916..12895030)
FT                   /gene="Hsd17b4"
FT                   /locus_tag="mCG_15516"
FT                   /product="hydroxysteroid (17-beta) dehydrogenase 4,
FT                   transcript variant mCT174103"
FT                   /note="gene_id=mCG15516.2 transcript_id=mCT174103.0 created
FT                   on 11-OCT-2002"
FT   mRNA            join(12827440..12827509,12829226..12829279,
FT                   12838742..12838849,12839634..12839693,12841769..12841790,
FT                   12841892..12841938,12844040..12844124,12845689..12845876,
FT                   12854417..12854508,12857675..12857699,12859427..12859555,
FT                   12861391..12861491,12863915..12864151,12866184..12866235,
FT                   12870020..12870091,12871328..12871431,12872960..12873025,
FT                   12876468..12876537,12877205..12877311,12878345..12878431,
FT                   12881230..12881316,12882457..12882595,12891010..12891137,
FT                   12895153..12895487)
FT                   /gene="Hsd17b4"
FT                   /locus_tag="mCG_15516"
FT                   /product="hydroxysteroid (17-beta) dehydrogenase 4,
FT                   transcript variant mCT17716"
FT                   /note="gene_id=mCG15516.2 transcript_id=mCT17716.1 created
FT                   on 11-OCT-2002"
FT   mRNA            join(12827450..12827509,12829226..12829279,
FT                   12838742..12838849,12839634..12839698,12841881..12841938,
FT                   12844040..12844124,12845689..12845876,12854417..12854508,
FT                   12857675..12857699,12859427..12859555,12861391..12861491,
FT                   12863915..12864151,12866184..12866235,12870020..12870091,
FT                   12871328..12871431,12872960..12873025,12876468..12876537,
FT                   12877205..12877311,12878345..12878431,12881230..12881316,
FT                   12882457..12882595,12891010..12891137,12895153..12895561)
FT                   /gene="Hsd17b4"
FT                   /locus_tag="mCG_15516"
FT                   /product="hydroxysteroid (17-beta) dehydrogenase 4,
FT                   transcript variant mCT174104"
FT                   /note="gene_id=mCG15516.2 transcript_id=mCT174104.0 created
FT                   on 11-OCT-2002"
FT   CDS             join(12827452..12827509,12829226..12829279,
FT                   12838742..12838849,12839634..12839698,12841881..12841938,
FT                   12844040..12844124,12845689..12845876,12854417..12854508,
FT                   12857675..12857699,12859427..12859555,12861391..12861491,
FT                   12863915..12864151,12866184..12866235,12870020..12870091,
FT                   12871328..12871431,12872960..12873025,12876468..12876537,
FT                   12877205..12877311,12878345..12878431,12881230..12881316,
FT                   12882457..12882595,12891010..12891137,12895153..12895242)
FT                   /codon_start=1
FT                   /gene="Hsd17b4"
FT                   /locus_tag="mCG_15516"
FT                   /product="hydroxysteroid (17-beta) dehydrogenase 4, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG15516.2 transcript_id=mCT174104.0
FT                   protein_id=mCP97022.0 isoform=CRA_b"
FT                   /protein_id="EDL09934.1"
FT                   /translation="MASPLRFDGRVVLVTGAGGGLGRAYALAFAERGALVIVNDLGGDF
FT                   KGIGKGSSAADKVVAEIRRKGGKAVANYDSVEAGEKLVKTALDTFGRIGDQYFRILRDR
FT                   SFSRISDEDWDIIHRVHLRGSFQVTRAAWDHMKKQNYGRILMTSSASGIYGNFGQANYS
FT                   AAKLGILGLCNTLAIEGRKNNIHCNTIAPNAGSRMTETVLPEDLVEALKPEYVAPLVLW
FT                   LCHESCEENGGLFEVGAGWIGKLRWERTLGAIVRKRNQPMTPEAVRDNWEKICDFSNAS
FT                   KPQTIQESTGGIVEVLHKVDSEGISPNRTSHAAPAATSGFVGAVGHKLPSFSSSYTELQ
FT                   SIMYALGVGASVKNPKDLKFVYEGSADFSCLPTFGVIVAQKSMMNGGLAEVPGLSFNFA
FT                   KALHGEQYLELYKPLPRSGELKCEAVIADILDKGSGVVIVMDVYSYSGKELICYNQFSV
FT                   FVVGSGGFGGKRTSEKLKAAVAVPNRPPDAVLRDATSLNQAALYRLSGDWNPLHIDPDF
FT                   ASVAGFEKPILHGLCTFGFSARHVLQQFADNDVSRFKAIKVRFAKPVYPGQTLQTEMWK
FT                   EGNRIHFQTKVHETGDVVISNAYVDLVPASGVSTQTPSEGGELQSALVFGEIGRRLKSV
FT                   GREVVKKANAVFEWHITKGGTVAAKWTIDLKSGSGEVYQGPAKGSADVTIIISDEDFME
FT                   VVFGKLDPQKAFFSGRLKARGNIMLSQKLQMILKDYAKL"
FT   CDS             join(12827452..12827509,12829226..12829279,
FT                   12838742..12838849,12839634..12839693,12841769..12841790,
FT                   12841892..12841938,12844040..12844124,12845689..12845876,
FT                   12854417..12854508,12857675..12857699,12859427..12859555,
FT                   12861391..12861491,12863915..12864151,12866184..12866235,
FT                   12870020..12870091,12871328..12871431,12872960..12873025,
FT                   12876468..12876537,12877205..12877311,12878345..12878431,
FT                   12881230..12881316,12882457..12882595,12891010..12891137,
FT                   12895153..12895242)
FT                   /codon_start=1
FT                   /gene="Hsd17b4"
FT                   /locus_tag="mCG_15516"
FT                   /product="hydroxysteroid (17-beta) dehydrogenase 4, isoform
FT                   CRA_d"
FT                   /note="gene_id=mCG15516.2 transcript_id=mCT17716.1
FT                   protein_id=mCP20951.2 isoform=CRA_d"
FT                   /protein_id="EDL09936.1"
FT                   /translation="MASPLRFDGRVVLVTGAGGGLGRAYALAFAERGALVIVNDLGGDF
FT                   KGIGKGSSAADKVVAEIRRKGGKAVANYDSVEAGEKLVKTALDTFGRIDVVVNNAGILR
FT                   DRSFSRISDEDWDIIHRVHLRGSFQVTRAAWDHMKKQNYGRILMTSSASGIYGNFGQAN
FT                   YSAAKLGILGLCNTLAIEGRKNNIHCNTIAPNAGSRMTETVLPEDLVEALKPEYVAPLV
FT                   LWLCHESCEENGGLFEVGAGWIGKLRWERTLGAIVRKRNQPMTPEAVRDNWEKICDFSN
FT                   ASKPQTIQESTGGIVEVLHKVDSEGISPNRTSHAAPAATSGFVGAVGHKLPSFSSSYTE
FT                   LQSIMYALGVGASVKNPKDLKFVYEGSADFSCLPTFGVIVAQKSMMNGGLAEVPGLSFN
FT                   FAKALHGEQYLELYKPLPRSGELKCEAVIADILDKGSGVVIVMDVYSYSGKELICYNQF
FT                   SVFVVGSGGFGGKRTSEKLKAAVAVPNRPPDAVLRDATSLNQAALYRLSGDWNPLHIDP
FT                   DFASVAGFEKPILHGLCTFGFSARHVLQQFADNDVSRFKAIKVRFAKPVYPGQTLQTEM
FT                   WKEGNRIHFQTKVHETGDVVISNAYVDLVPASGVSTQTPSEGGELQSALVFGEIGRRLK
FT                   SVGREVVKKANAVFEWHITKGGTVAAKWTIDLKSGSGEVYQGPAKGSADVTIIISDEDF
FT                   MEVVFGKLDPQKAFFSGRLKARGNIMLSQKLQMILKDYAKL"
FT   CDS             join(12827452..12827509,12829226..12829279,
FT                   12838742..12838849,12839634..12839693,12841769..12841790,
FT                   12841892..12841938,12844040..12844124,12845689..12845876,
FT                   12854417..12854508,12857675..12857699,12859427..12859555,
FT                   12894916..12894950)
FT                   /codon_start=1
FT                   /gene="Hsd17b4"
FT                   /locus_tag="mCG_15516"
FT                   /product="hydroxysteroid (17-beta) dehydrogenase 4, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG15516.2 transcript_id=mCT174103.0
FT                   protein_id=mCP97023.0 isoform=CRA_a"
FT                   /protein_id="EDL09933.1"
FT                   /translation="MASPLRFDGRVVLVTGAGGGLGRAYALAFAERGALVIVNDLGGDF
FT                   KGIGKGSSAADKVVAEIRRKGGKAVANYDSVEAGEKLVKTALDTFGRIDVVVNNAGILR
FT                   DRSFSRISDEDWDIIHRVHLRGSFQVTRAAWDHMKKQNYGRILMTSSASGIYGNFGQAN
FT                   YSAAKLGILGLCNTLAIEGRKNNIHCNTIAPNAGSRMTETVLPEDLVEALKPEYVAPLV
FT                   LWLCHESCEENGGLFEVGAGWIGKLRWERTLGAIVRKRNQPMTPEAVRDNWEKICDFSN
FT                   ASKPQTIQESPSLSSQITL"
FT   gene            12833828..12834892
FT                   /pseudo
FT                   /locus_tag="mCG_125639"
FT                   /note="gene_id=mCG125639.2"
FT   mRNA            join(12833828..12834139,12834356..12834892)
FT                   /pseudo
FT                   /locus_tag="mCG_125639"
FT                   /note="gene_id=mCG125639.2 transcript_id=mCT126902.2
FT                   created on 16-MAY-2003"
FT   CDS             join(12878393..12878431,12881230..12881316,
FT                   12882457..12882595,12891010..12891137,12895153..12895242)
FT                   /codon_start=1
FT                   /gene="Hsd17b4"
FT                   /locus_tag="mCG_15516"
FT                   /product="hydroxysteroid (17-beta) dehydrogenase 4, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG15516.2 transcript_id=mCT174105.0
FT                   protein_id=mCP97024.0 isoform=CRA_c"
FT                   /protein_id="EDL09935.1"
FT                   /translation="MWKEGNRIHFQTKVHETGDVVISNAYVDLVPASGVSTQTPSEGGE
FT                   LQSALVFGEIGRRLKSVGREVVKKANAVFEWHITKGGTVAAKWTIDLKSGSGEVYQGPA
FT                   KGSADVTIIISDEDFMEVVFGKLDPQKAFFSGRLKARGNIMLSQKLQMILKDYAKL"
FT   assembly_gap    12905704..12906127
FT                   /estimated_length=424
FT                   /gap_type="unknown"
FT   assembly_gap    12907705..12908069
FT                   /estimated_length=365
FT                   /gap_type="unknown"
FT   gene            complement(12919616..12920434)
FT                   /pseudo
FT                   /locus_tag="mCG_15523"
FT                   /note="gene_id=mCG15523.2"
FT   mRNA            complement(12919616..12920434)
FT                   /pseudo
FT                   /locus_tag="mCG_15523"
FT                   /note="gene_id=mCG15523.2 transcript_id=mCT17723.2 created
FT                   on 10-OCT-2002"
FT   assembly_gap    12922648..12922667
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12923748..12924253
FT                   /estimated_length=506
FT                   /gap_type="unknown"
FT   assembly_gap    12938789..12938808
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12954660..12958602
FT                   /estimated_length=3943
FT                   /gap_type="unknown"
FT   assembly_gap    12961937..12961956
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <12974653..12976022
FT                   /gene="Gm93"
FT                   /locus_tag="mCG_15517"
FT                   /note="gene_id=mCG15517.1"
FT   mRNA            join(<12974653..12975253,12975526..12975584,
FT                   12975898..12976022)
FT                   /gene="Gm93"
FT                   /locus_tag="mCG_15517"
FT                   /product="gene model 93, (NCBI), transcript variant
FT                   mCT17717"
FT                   /note="gene_id=mCG15517.1 transcript_id=mCT17717.1 created
FT                   on 17-APR-2003"
FT   mRNA            join(<12974653..12975253,12975898..12976015)
FT                   /gene="Gm93"
FT                   /locus_tag="mCG_15517"
FT                   /product="gene model 93, (NCBI), transcript variant
FT                   mCT181918"
FT                   /note="gene_id=mCG15517.1 transcript_id=mCT181918.0 created
FT                   on 17-APR-2003"
FT   CDS             join(12974653..12975253,12975526..12975584,
FT                   12975898..12975987)
FT                   /codon_start=1
FT                   /gene="Gm93"
FT                   /locus_tag="mCG_15517"
FT                   /product="gene model 93, (NCBI), isoform CRA_b"
FT                   /note="gene_id=mCG15517.1 transcript_id=mCT17717.1
FT                   protein_id=mCP20946.1 isoform=CRA_b"
FT                   /protein_id="EDL09932.1"
FT                   /translation="MKIYYMQVQMKKGVAISWDTKETSESLEKQPRMEEATLPEGVWVG
FT                   TPPSDVSTRNLLSDSEPIGEEKEHEEKPESDSPPGSPAVEERPRAKTPDWLVTMENGFR
FT                   CMACCRVFATMESLQEHVQYGIREGFSCHVFHLTMAQLIGSMESESTQEEEEDHTEETE
FT                   KPKEEKAEEQQPTEEDVGMKKPWSQCPGCVFDSPKDRTTEIPGSEEHARWGGPFLGEEE
FT                   ERTIATTAAADNASSTKEDENNTPSDT"
FT   CDS             join(12974653..12975253,12975898..12975935)
FT                   /codon_start=1
FT                   /gene="Gm93"
FT                   /locus_tag="mCG_15517"
FT                   /product="gene model 93, (NCBI), isoform CRA_a"
FT                   /note="gene_id=mCG15517.1 transcript_id=mCT181918.0
FT                   protein_id=mCP104840.0 isoform=CRA_a"
FT                   /protein_id="EDL09931.1"
FT                   /translation="MKIYYMQVQMKKGVAISWDTKETSESLEKQPRMEEATLPEGVWVG
FT                   TPPSDVSTRNLLSDSEPIGEEKEHEEKPESDSPPGSPAVEERPRAKTPDWLVTMENGFR
FT                   CMACCRVFATMESLQEHVQYGIREGFSCHVFHLTMAQLIGSMESESTQEEEEDHTEETE
FT                   KPKEEKAEEQQPTEEDVGMKKPWSQCPGCVFDSPKDRRRRKDHCDNSGS"
FT   assembly_gap    12984565..12984584
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12985736..12985755
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12987482..12989847
FT                   /estimated_length=2366
FT                   /gap_type="unknown"
FT   assembly_gap    13006171..13006190
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13015427..13015530
FT                   /estimated_length=104
FT                   /gap_type="unknown"
FT   assembly_gap    13017097..13017231
FT                   /estimated_length=135
FT                   /gap_type="unknown"
FT   assembly_gap    13020783..13020802
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13042918..13043002
FT                   /estimated_length=85
FT                   /gap_type="unknown"
FT   assembly_gap    13073456..13073912
FT                   /estimated_length=457
FT                   /gap_type="unknown"
FT   assembly_gap    13103754..13103773
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13130547..13130566
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13150514..13150972
FT                   /estimated_length=459
FT                   /gap_type="unknown"
FT   assembly_gap    13156087..13156106
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13175179..13175251
FT                   /estimated_length=73
FT                   /gap_type="unknown"
FT   assembly_gap    13180249..13180268
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13183434..13183591
FT                   /estimated_length=158
FT                   /gap_type="unknown"
FT   assembly_gap    13192651..13192670
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13197876..13202019
FT                   /estimated_length=4144
FT                   /gap_type="unknown"
FT   assembly_gap    13218596..13218626
FT                   /estimated_length=31
FT                   /gap_type="unknown"
FT   assembly_gap    13221975..13221994
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13226714..13226805
FT                   /estimated_length=92
FT                   /gap_type="unknown"
FT   assembly_gap    13232252..13236438
FT                   /estimated_length=4187
FT                   /gap_type="unknown"
FT   assembly_gap    13239788..13239821
FT                   /estimated_length=34
FT                   /gap_type="unknown"
FT   assembly_gap    13245330..13245420
FT                   /estimated_length=91
FT                   /gap_type="unknown"
FT   assembly_gap    13251197..13251405
FT                   /estimated_length=209
FT                   /gap_type="unknown"
FT   gene            complement(13265689..13266710)
FT                   /gene="Hdhd1a"
FT                   /locus_tag="mCG_15424"
FT                   /note="gene_id=mCG15424.0"
FT   mRNA            complement(13265689..13266710)
FT                   /gene="Hdhd1a"
FT                   /locus_tag="mCG_15424"
FT                   /product="haloacid dehalogenase-like hydrolase domain"
FT                   /note="gene_id=mCG15424.0 transcript_id=mCT16142.0 created
FT                   on 10-OCT-2002"
FT   CDS             complement(13265989..13266693)
FT                   /codon_start=1
FT                   /gene="Hdhd1a"
FT                   /locus_tag="mCG_15424"
FT                   /product="haloacid dehalogenase-like hydrolase domain"
FT                   /note="gene_id=mCG15424.0 transcript_id=mCT16142.0
FT                   protein_id=mCP18090.1"
FT                   /protein_id="EDL09930.1"
FT                   /translation="MAAAVPVPQFRPVTHLIFDLDGLILNTEDLYTDVFEEICNRYGKK
FT                   YNWDVKSLVMGKKALETAQTIVEFLNLPISKEELLKESQEKLQMVLHTAGFMPGAEELI
FT                   HHLKKHRLPFALATSSETVTFQTKTSRHTGFFGLFHHIVLGDDPEVKNGKPGMDIFLTC
FT                   AKRFSPPPDPKDCLVFEDSPNGVEAAIHCGMQVVMVPHENLSADLTRKATLVLSSLHDF
FT                   KPELFGLPAFTE"
FT   assembly_gap    13304979..13305136
FT                   /estimated_length=158
FT                   /gap_type="unknown"
FT   assembly_gap    13314061..13314080
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13345607..13345626
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13356836..13361749
FT                   /estimated_length=4914
FT                   /gap_type="unknown"
FT   assembly_gap    13380893..13380912
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13410474..13410493
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13442729..13442748
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13474604..13475034
FT                   /estimated_length=431
FT                   /gap_type="unknown"
FT   assembly_gap    13482199..13482218
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13483503..13486691
FT                   /estimated_length=3189
FT                   /gap_type="unknown"
FT   assembly_gap    13500426..13500638
FT                   /estimated_length=213
FT                   /gap_type="unknown"
FT   assembly_gap    13563287..13563414
FT                   /estimated_length=128
FT                   /gap_type="unknown"
FT   assembly_gap    13579250..13579367
FT                   /estimated_length=118
FT                   /gap_type="unknown"
FT   assembly_gap    13585043..13585062
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13629819..13629838
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13633029..13633059
FT                   /estimated_length=31
FT                   /gap_type="unknown"
FT   assembly_gap    13636793..13636812
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13642698..13643473
FT                   /estimated_length=776
FT                   /gap_type="unknown"
FT   assembly_gap    13648076..13648325
FT                   /estimated_length=250
FT                   /gap_type="unknown"
FT   assembly_gap    13661048..13661067
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13667153..13687643
FT                   /estimated_length=20491
FT                   /gap_type="unknown"
FT   gene            13688351..13689107
FT                   /pseudo
FT                   /locus_tag="mCG_18969"
FT                   /note="gene_id=mCG18969.0"
FT   mRNA            13688351..13689107
FT                   /pseudo
FT                   /locus_tag="mCG_18969"
FT                   /note="gene_id=mCG18969.0 transcript_id=mCT16656.0 created
FT                   on 10-OCT-2002"
FT   assembly_gap    13698290..13698309
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13728219..13728238
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13779226..13779335
FT                   /estimated_length=110
FT                   /gap_type="unknown"
FT   assembly_gap    13798521..13798660
FT                   /estimated_length=140
FT                   /gap_type="unknown"
FT   gene            13802919..13990008
FT                   /locus_tag="mCG_49157"
FT                   /note="gene_id=mCG49157.2"
FT   mRNA            join(13802919..13803276,13987223..13990008)
FT                   /locus_tag="mCG_49157"
FT                   /product="mCG49157"
FT                   /note="gene_id=mCG49157.2 transcript_id=mCT49340.2 created
FT                   on 17-OCT-2002"
FT   CDS             join(13803118..13803276,13987223..13987978)
FT                   /codon_start=1
FT                   /locus_tag="mCG_49157"
FT                   /product="mCG49157"
FT                   /note="gene_id=mCG49157.2 transcript_id=mCT49340.2
FT                   protein_id=mCP26432.2"
FT                   /protein_id="EDL09929.1"
FT                   /translation="MSAKSKGNPSSSSAAEGPPAASKTKVKEQIKIIVEDLELVLGDLK
FT                   DVAKELKEVVDQIDTLTSDLQLEDEMTDSSKTDTLNSSSSGTTASSIEKIKEQANAPLI
FT                   KPPAHPSAILTVLRKPNPPPPPPRLTPVRCEEPQRVVPTANPVKTNGTLLRNGGLAGRP
FT                   NKIPNGDICCIPNSNLDKAPLQSLMHRPEKDRSPQAGPRERVRFNEKVQYHGYCPDCES
FT                   RYNIKNREVHLHSEPVHPPGKIPHQGPLLHPPPHLPNFPLENGGLGISHSNSFPPPTPA
FT                   TVPPPAAPKPQKTILRKSTTTTV"
FT   assembly_gap    13815438..13815457
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13834960..13835081
FT                   /estimated_length=122
FT                   /gap_type="unknown"
FT   assembly_gap    13842097..13842116
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13847409..13847428
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13860042..13860151
FT                   /estimated_length=110
FT                   /gap_type="unknown"
FT   assembly_gap    13870774..13870793
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13875948..13876380
FT                   /estimated_length=433
FT                   /gap_type="unknown"
FT   assembly_gap    13938345..13938364
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13953952..13954261
FT                   /estimated_length=310
FT                   /gap_type="unknown"
FT   assembly_gap    13974274..13974293
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14009236..14009336
FT                   /estimated_length=101
FT                   /gap_type="unknown"
FT   assembly_gap    14047005..14047024
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14079280..14084749
FT                   /estimated_length=5470
FT                   /gap_type="unknown"
FT   assembly_gap    14108556..14108575
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14130724..14130743
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14139347..14139399
FT                   /estimated_length=53
FT                   /gap_type="unknown"
FT   assembly_gap    14149687..14150230
FT                   /estimated_length=544
FT                   /gap_type="unknown"
FT   assembly_gap    14185348..14185367
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14194173..14194192
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14196829..14196848
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14203329..14203348
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14204783..14210147
FT                   /estimated_length=5365
FT                   /gap_type="unknown"
FT   assembly_gap    14212750..14212769
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14228170..14228189
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14254874..14254893
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14283371..14283390
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14285652..14286052
FT                   /estimated_length=401
FT                   /gap_type="unknown"
FT   assembly_gap    14292822..14294002
FT                   /estimated_length=1181
FT                   /gap_type="unknown"
FT   assembly_gap    14303306..14305122
FT                   /estimated_length=1817
FT                   /gap_type="unknown"
FT   assembly_gap    14309912..14309931
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14311335..14311354
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14318302..14318321
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14325930..14325949
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14340382..14345004
FT                   /estimated_length=4623
FT                   /gap_type="unknown"
FT   assembly_gap    14347326..14347735
FT                   /estimated_length=410
FT                   /gap_type="unknown"
FT   assembly_gap    14349452..14351295
FT                   /estimated_length=1844
FT                   /gap_type="unknown"
FT   assembly_gap    14364384..14364403
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14371945..14371964
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14373589..14373608
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14398070..14399346
FT                   /estimated_length=1277
FT                   /gap_type="unknown"
FT   assembly_gap    14400490..14400509
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14409357..14410897
FT                   /estimated_length=1541
FT                   /gap_type="unknown"
FT   assembly_gap    14420472..14420491
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14433046..14433393
FT                   /estimated_length=348
FT                   /gap_type="unknown"
FT   assembly_gap    14502870..14502889
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14523180..14523199
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14549456..14549714
FT                   /estimated_length=259
FT                   /gap_type="unknown"
FT   assembly_gap    14554009..14556937
FT                   /estimated_length=2929
FT                   /gap_type="unknown"
FT   gene            complement(14560387..14561031)
FT                   /locus_tag="mCG_1283"
FT                   /note="gene_id=mCG1283.1"
FT   mRNA            complement(14560387..14561031)
FT                   /locus_tag="mCG_1283"
FT                   /product="mCG1283"
FT                   /note="gene_id=mCG1283.1 transcript_id=mCT8552.1 created on
FT                   10-OCT-2002"
FT   CDS             complement(14560398..14561015)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1283"
FT                   /product="mCG1283"
FT                   /note="gene_id=mCG1283.1 transcript_id=mCT8552.1
FT                   protein_id=mCP3478.2"
FT                   /protein_id="EDL09928.1"
FT                   /translation="MSIMPYNGGAVMAMKGKNCVAIAADRCFGIQAQMVTTDFQKIFAL
FT                   GDRLYIGLAGLATDIQTVAQRLKFRLNLYMLKEGRHIKPFTLMSMVANLLYEKRFGPYY
FT                   TEPVIAGLDPKTFKLFICSLDLIGCPMVTDDFVVSGTCSEQMHGMCESLWEPHMDPEHL
FT                   FETISQAMLNAVDRDAMSGMGVIVHVIEKDKITTRTLKARMD"
FT   assembly_gap    14561990..14562013
FT                   /estimated_length=24
FT                   /gap_type="unknown"
FT   assembly_gap    14614141..14614160
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14638406..14638425
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14647702..14647721
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14656448..14656593
FT                   /estimated_length=146
FT                   /gap_type="unknown"
FT   assembly_gap    14680098..14680377
FT                   /estimated_length=280
FT                   /gap_type="unknown"
FT   assembly_gap    14681718..14681737
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14732406..14732425
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14776956..14776975
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14820496..14820515
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14821994..14822013
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14830912..14830931
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14833526..14833988
FT                   /estimated_length=463
FT                   /gap_type="unknown"
FT   assembly_gap    14849506..14849566
FT                   /estimated_length=61
FT                   /gap_type="unknown"
FT   assembly_gap    14868125..14868144
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14872668..14872687
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14877170..14877189
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14889054..14889073
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14898962..14899814
FT                   /estimated_length=853
FT                   /gap_type="unknown"
FT   assembly_gap    14908535..14908554
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14927420..14927439
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14934976..14935059
FT                   /estimated_length=84
FT                   /gap_type="unknown"
FT   assembly_gap    14953611..14953731
FT                   /estimated_length=121
FT                   /gap_type="unknown"
FT   assembly_gap    14956516..14956912
FT                   /estimated_length=397
FT                   /gap_type="unknown"
FT   assembly_gap    15023796..15024266
FT                   /estimated_length=471
FT                   /gap_type="unknown"
FT   gene            15026416..15027666
FT                   /gene="Ftmt"
FT                   /locus_tag="mCG_1282"
FT                   /note="gene_id=mCG1282.0"
FT   mRNA            15026416..15027666
FT                   /gene="Ftmt"
FT                   /locus_tag="mCG_1282"
FT                   /product="ferritin mitochondrial"
FT                   /note="gene_id=mCG1282.0 transcript_id=mCT8551.0 created on
FT                   10-OCT-2002"
FT   CDS             15026495..15027208
FT                   /codon_start=1
FT                   /gene="Ftmt"
FT                   /locus_tag="mCG_1282"
FT                   /product="ferritin mitochondrial"
FT                   /note="gene_id=mCG1282.0 transcript_id=mCT8551.0
FT                   protein_id=mCP3477.1"
FT                   /protein_id="EDL09927.1"
FT                   /translation="MLSCFWLFSKHIGSALMSLPRVLHRFTAPQCLASRYPLGPLLASP
FT                   RRLLASVASSQDSTRPSRVRQNFHPDSEAAINRQINLELYASYVYLSMAYYFSRDDVAL
FT                   YNFSKYFLRQSLEEREHAEKLMKLQNQRGGRICLQDIKKPDKDDWECGLRAMECALLLE
FT                   KNVNQSLLDLHTLASEKGDPHLCDFLETHYLHEQVKSIKELGDHVHNLVTMGAPAAGLA
FT                   EYLFDKHTLGSESKH"
FT   assembly_gap    15028179..15028198
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15052086..15052105
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15069621..15069809
FT                   /estimated_length=189
FT                   /gap_type="unknown"
FT   assembly_gap    15076254..15079620
FT                   /estimated_length=3367
FT                   /gap_type="unknown"
FT   assembly_gap    15081170..15081189
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15083199..15090192
FT                   /estimated_length=6994
FT                   /gap_type="unknown"
FT   assembly_gap    15092063..15092082
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15095963..15100965
FT                   /estimated_length=5003
FT                   /gap_type="unknown"
FT   assembly_gap    15105484..15105503
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15112533..15112552
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15118019..15118070
FT                   /estimated_length=52
FT                   /gap_type="unknown"
FT   assembly_gap    15136765..15139060
FT                   /estimated_length=2296
FT                   /gap_type="unknown"
FT   assembly_gap    15142501..15142520
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            15150179..>15175623
FT                   /gene="Srfbp1"
FT                   /locus_tag="mCG_3251"
FT                   /note="gene_id=mCG3251.2"
FT   mRNA            join(15150179..15150273,15160078..15160166,
FT                   15160784..15160856,15175552..>15175623)
FT                   /gene="Srfbp1"
FT                   /locus_tag="mCG_3251"
FT                   /product="serum response factor binding protein 1,
FT                   transcript variant mCT2073"
FT                   /note="gene_id=mCG3251.2 transcript_id=mCT2073.2 created on
FT                   10-OCT-2002"
FT   CDS             join(15150208..15150273,15160078..15160166,
FT                   15160784..15160856,15175552..>15175623)
FT                   /codon_start=1
FT                   /gene="Srfbp1"
FT                   /locus_tag="mCG_3251"
FT                   /product="serum response factor binding protein 1, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG3251.2 transcript_id=mCT2073.2
FT                   protein_id=mCP3485.2 isoform=CRA_b"
FT                   /protein_id="EDL09926.1"
FT                   /translation="MAADPLPPSAMVQPGTLNLNNEVVKMRKEVKRIRVLVIRKLVRSV
FT                   GRLKSKKGTEDALLKNQRRAQRLLEEIHAMKELKPDVVTKSALSDDINFEKTCKK"
FT   mRNA            join(15150223..15150273,15160078..15160166,
FT                   15160784..15160856,15163928..15164422)
FT                   /gene="Srfbp1"
FT                   /locus_tag="mCG_3251"
FT                   /product="serum response factor binding protein 1,
FT                   transcript variant mCT174126"
FT                   /note="gene_id=mCG3251.2 transcript_id=mCT174126.0 created
FT                   on 10-OCT-2002"
FT   CDS             join(15150238..15150273,15160078..15160166,
FT                   15160784..15160856,15163928..15163936)
FT                   /codon_start=1
FT                   /gene="Srfbp1"
FT                   /locus_tag="mCG_3251"
FT                   /product="serum response factor binding protein 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG3251.2 transcript_id=mCT174126.0
FT                   protein_id=mCP97045.0 isoform=CRA_a"
FT                   /protein_id="EDL09925.1"
FT                   /translation="MVQPGTLNLNNEVVKMRKEVKRIRVLVIRKLVRSVGRLKSKKGTE
FT                   DALLKNQRRAQRLLEEIHAMKVL"
FT   assembly_gap    15165392..15165411
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15166825..15168858
FT                   /estimated_length=2034
FT                   /gap_type="unknown"
FT   assembly_gap    15170264..15170283
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15172582..15172601
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15173715..15173734
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15174838..15174857
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15176007..15176698
FT                   /estimated_length=692
FT                   /gap_type="unknown"
FT   assembly_gap    15179540..15179646
FT                   /estimated_length=107
FT                   /gap_type="unknown"
FT   gene            complement(15195643..15209220)
FT                   /gene="Lox"
FT                   /locus_tag="mCG_3257"
FT                   /note="gene_id=mCG3257.1"
FT   mRNA            complement(join(15195643..15198809,15200349..15200464,
FT                   15200798..15200893,15204636..15204792,15206418..15206555,
FT                   15207796..15207904,15208234..15209220))
FT                   /gene="Lox"
FT                   /locus_tag="mCG_3257"
FT                   /product="lysyl oxidase"
FT                   /note="gene_id=mCG3257.1 transcript_id=mCT2067.1 created on
FT                   10-OCT-2002"
FT   CDS             complement(join(15198803..15198809,15200349..15200464,
FT                   15200798..15200893,15204636..15204792,15206418..15206555,
FT                   15207796..15207904,15208234..15208846))
FT                   /codon_start=1
FT                   /gene="Lox"
FT                   /locus_tag="mCG_3257"
FT                   /product="lysyl oxidase"
FT                   /note="gene_id=mCG3257.1 transcript_id=mCT2067.1
FT                   protein_id=mCP3484.2"
FT                   /db_xref="GOA:Q3TXH3"
FT                   /db_xref="InterPro:IPR001695"
FT                   /db_xref="InterPro:IPR019828"
FT                   /db_xref="MGI:MGI:96817"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TXH3"
FT                   /protein_id="EDL09924.1"
FT                   /translation="MRFAWAVLLLGPLQLCPLLRCAPQTPREPPAAPGAWRQTIQWENN
FT                   GQVFSLLSLGAQYQPQRRRDPSATARRPDGDAASQPRTPILLLRDNRTASTRARTPSPS
FT                   GVAAGRPRPAARHWFQAGFSPSGARDGASRRAANRTASPQPPQLSNLRPPSHIDRMVGD
FT                   DPYNPYKYSDDNPYYNYYDTYERPRPGSRNRPGYGTGYFQYGLPDLVPDPYYIQASTYV
FT                   QKMSMYNLRCAAEENCLASSAYRADVRDYDHRVLLRFPQRVKNQGTSDFLPSRPRYSWE
FT                   WHSCHQHYHSMDEFSHYDLLDANTQRRVAEGHKASFCLEDTSCDYGYHRRFACTAHTQG
FT                   LSPGCYDTYAADIDCQWIDITDVQPGNYILKVSVNPSYLVPESDYTNNVVRCDIRYTGH
FT                   HAYASGCTISPY"
FT   gene            <15208177..15257470
FT                   /locus_tag="mCG_146105"
FT                   /note="gene_id=mCG146105.0"
FT   mRNA            join(<15208177..15208263,15243791..15244009,
FT                   15257227..15257470)
FT                   /locus_tag="mCG_146105"
FT                   /product="mCG146105"
FT                   /note="gene_id=mCG146105.0 transcript_id=mCT186208.0
FT                   created on 14-JUL-2003"
FT   CDS             join(<15208186..15208263,15243791..15243982)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146105"
FT                   /product="mCG146105"
FT                   /note="gene_id=mCG146105.0 transcript_id=mCT186208.0
FT                   protein_id=mCP107765.0"
FT                   /protein_id="EDL09923.1"
FT                   /translation="PAARVAGTYGGSRGAYRTGSNRCRIQIFRVDVATVRMFLNHRQEG
FT                   TAAIYSSWTWADTRIQELGTVIMSRTHDSQMKQGRSCPSGSADC"
FT   gene            15213256..15213753
FT                   /pseudo
FT                   /locus_tag="mCG_1033366"
FT                   /note="gene_id=mCG1033366.1"
FT   mRNA            15213256..15213753
FT                   /pseudo
FT                   /locus_tag="mCG_1033366"
FT                   /note="gene_id=mCG1033366.1 transcript_id=mCT151070.1
FT                   created on 10-MAR-2003"
FT   assembly_gap    15225036..15226481
FT                   /estimated_length=1446
FT                   /gap_type="unknown"
FT   assembly_gap    15229366..15229722
FT                   /estimated_length=357
FT                   /gap_type="unknown"
FT   assembly_gap    15288871..15288890
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15292308..15292327
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <15296063..15323668
FT                   /gene="Zfp474"
FT                   /locus_tag="mCG_3256"
FT                   /note="gene_id=mCG3256.1"
FT   mRNA            join(<15296063..15296234,15321910..15323668)
FT                   /gene="Zfp474"
FT                   /locus_tag="mCG_3256"
FT                   /product="zinc finger protein 474, transcript variant
FT                   mCT2069"
FT                   /note="gene_id=mCG3256.1 transcript_id=mCT2069.0 created on
FT                   10-OCT-2002"
FT   mRNA            join(15296131..15296234,15304738..15304860,
FT                   15305596..15305722,15321910..15323668)
FT                   /gene="Zfp474"
FT                   /locus_tag="mCG_3256"
FT                   /product="zinc finger protein 474, transcript variant
FT                   mCT174129"
FT                   /note="gene_id=mCG3256.1 transcript_id=mCT174129.0 created
FT                   on 10-OCT-2002"
FT   assembly_gap    15300148..15300167
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15307861..15307880
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15309183..15309202
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15310645..15310664
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15311974..15311993
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             <15322097..15323158
FT                   /codon_start=1
FT                   /gene="Zfp474"
FT                   /locus_tag="mCG_3256"
FT                   /product="zinc finger protein 474, isoform CRA_a"
FT                   /note="gene_id=mCG3256.1 transcript_id=mCT2069.0
FT                   protein_id=mCP3483.0 isoform=CRA_a"
FT                   /protein_id="EDL09921.1"
FT                   /translation="TKPPLFMESGNERISSQSQGTIHLSKEPTFLIQQATLPSDLHSTL
FT                   LQETQCGGLTKNIKANTQKRRPGTVILSKRSSRIMSETQPRPPVIPSRRPGFRICYICG
FT                   REFGSQSLAIHEPQCLEKWRTENSKLPKHLRRPEPSKPQPIGGTDSHSLQAANEEAFQS
FT                   AQAQLLPCENCGRTFLPDRLLVHQRSCKPKGENPGPPSMGSSNVPTGLKKASSGIPARP
FT                   RTLICYICGREFGTLSLPIHEPKCLEKWKIENDQLPRELRRPQPQKPQPLPAGQSSQEG
FT                   ASQAALVPCPNCGRTFAVDRLPVHQRSCKSQPSGPKTSNSNIERKGGPNPPTNSKQQRN
FT                   MEAPNGDKVTGVI"
FT   CDS             15322115..15323158
FT                   /codon_start=1
FT                   /gene="Zfp474"
FT                   /locus_tag="mCG_3256"
FT                   /product="zinc finger protein 474, isoform CRA_b"
FT                   /note="gene_id=mCG3256.1 transcript_id=mCT174129.0
FT                   protein_id=mCP97048.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q6V5K9"
FT                   /db_xref="InterPro:IPR026319"
FT                   /db_xref="MGI:MGI:1914008"
FT                   /protein_id="EDL09922.1"
FT                   /translation="MESGNERISSQSQGTIHLSKEPTFLIQQATLPSDLHSTLLQETQC
FT                   GGLTKNIKANTQKRRPGTVILSKRSSRIMSETQPRPPVIPSRRPGFRICYICGREFGSQ
FT                   SLAIHEPQCLEKWRTENSKLPKHLRRPEPSKPQPIGGTDSHSLQAANEEAFQSAQAQLL
FT                   PCENCGRTFLPDRLLVHQRSCKPKGENPGPPSMGSSNVPTGLKKASSGIPARPRTLICY
FT                   ICGREFGTLSLPIHEPKCLEKWKIENDQLPRELRRPQPQKPQPLPAGQSSQEGASQAAL
FT                   VPCPNCGRTFAVDRLPVHQRSCKSQPSGPKTSNSNIERKGGPNPPTNSKQQRNMEAPNG
FT                   DKVTGVI"
FT   gene            <15330075..15347541
FT                   /gene="1700034E13Rik"
FT                   /locus_tag="mCG_146104"
FT                   /note="gene_id=mCG146104.1"
FT   mRNA            join(<15330075..15330165,15344182..15344362,
FT                   15347375..15347541)
FT                   /gene="1700034E13Rik"
FT                   /locus_tag="mCG_146104"
FT                   /product="RIKEN cDNA 1700034E13, transcript variant
FT                   mCT190304"
FT                   /note="gene_id=mCG146104.1 transcript_id=mCT190304.0
FT                   created on 08-MAR-2004"
FT   mRNA            join(<15330079..15330165,15340194..15340237,
FT                   15344182..15344362,15347375..15347538)
FT                   /gene="1700034E13Rik"
FT                   /locus_tag="mCG_146104"
FT                   /product="RIKEN cDNA 1700034E13, transcript variant
FT                   mCT186207"
FT                   /note="gene_id=mCG146104.1 transcript_id=mCT186207.0
FT                   created on 14-JUL-2003"
FT   CDS             join(<15330127..15330165,15344182..15344362,
FT                   15347375..15347526)
FT                   /codon_start=1
FT                   /gene="1700034E13Rik"
FT                   /locus_tag="mCG_146104"
FT                   /product="RIKEN cDNA 1700034E13, isoform CRA_b"
FT                   /note="gene_id=mCG146104.1 transcript_id=mCT190304.0
FT                   protein_id=mCP111274.0 isoform=CRA_b"
FT                   /protein_id="EDL09920.1"
FT                   /translation="DPVALRCKKNNNKPTMIRRPPTIVCYICGREYGTKSISIHEPQCL
FT                   KKWHNENNLLPKELRRPEPKKPEVRTITAKGFYDLDALNEAAWTSAQSQLVPCNVCGRT
FT                   FLPDRLIVHQRSCKPKASK"
FT   CDS             join(<15340205..15340237,15344182..15344362,
FT                   15347375..15347526)
FT                   /codon_start=1
FT                   /gene="1700034E13Rik"
FT                   /locus_tag="mCG_146104"
FT                   /product="RIKEN cDNA 1700034E13, isoform CRA_a"
FT                   /note="gene_id=mCG146104.1 transcript_id=mCT186207.0
FT                   protein_id=mCP107764.0 isoform=CRA_a"
FT                   /protein_id="EDL09919.1"
FT                   /translation="KETYEKEERFIPTMIRRPPTIVCYICGREYGTKSISIHEPQCLKK
FT                   WHNENNLLPKELRRPEPKKPEVRTITAKGFYDLDALNEAAWTSAQSQLVPCNVCGRTFL
FT                   PDRLIVHQRSCKPKASK"
FT   assembly_gap    15340493..15340728
FT                   /estimated_length=236
FT                   /gap_type="unknown"
FT   assembly_gap    15358006..15358025
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15359096..15359115
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15364628..15364647
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15366970..15366989
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15373334..15373353
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15377501..15377520
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            15379300..15381289
FT                   /gene="Gykl1"
FT                   /locus_tag="mCG_3255"
FT                   /note="gene_id=mCG3255.0"
FT   mRNA            15379300..15381289
FT                   /gene="Gykl1"
FT                   /locus_tag="mCG_3255"
FT                   /product="glycerol kinase-like 1"
FT                   /note="gene_id=mCG3255.0 transcript_id=mCT2068.0 created on
FT                   10-OCT-2002"
FT   CDS             15379343..15380992
FT                   /codon_start=1
FT                   /gene="Gykl1"
FT                   /locus_tag="mCG_3255"
FT                   /product="glycerol kinase-like 1"
FT                   /note="gene_id=mCG3255.0 transcript_id=mCT2068.0
FT                   protein_id=mCP3482.1"
FT                   /db_xref="GOA:Q8C635"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="MGI:MGI:891990"
FT                   /db_xref="UniProtKB/TrEMBL:Q8C635"
FT                   /protein_id="EDL09918.1"
FT                   /translation="MAEAPKAVLGPLVGAVDQGTSSTRFLVFNPQTAELLCHHQVEIAQ
FT                   EFPKEGWVEQDPKAILQSVYECIEKACEKLGQQSIDISNIKAIGVTNQRETTIVWDKFT
FT                   GEPLYNAVVWLDLRTQSTVENLSKSISVSNNFVKNKTGLPISTYFSAVKLHWLIENVRK
FT                   VQKAIEDGRAIFGTVDSWLIWCMTGGINGGVHCTDVSNASRTMLFNIHSLQWDEELCDF
FT                   FGIPMTILPRIRSSSEIYGLVKSGVLEGVPISGCLGDQSAALVGQLCLQDGQAKSTYGT
FT                   GCFLLCNTGQKCVNSEHGLLTTVAYQLGRQEPVYYALEGSVAIAGAVVSWIKNNLQIIQ
FT                   SSSEIEKLAEVAGTSYGCYFVPAFSGLYAPYWDPSARGIICGLTQFTNKFHIAFAALEA
FT                   VCFQTREILDAMNSDCGIPLTHLQVDGGMTANRVLMQLQADILCIPVMKPFMPETTALG
FT                   VAMAAGAAEGVSVWSLDPKDLSSVQMEKFEPQINVEESEGRYATWKKAVLKSMGWVLTQ
FT                   SPDGRDPSIFSSLTLGFYVVSSMVILIGARYM"
FT   assembly_gap    15394179..15394313
FT                   /estimated_length=135
FT                   /gap_type="unknown"
FT   assembly_gap    15405013..15405446
FT                   /estimated_length=434
FT                   /gap_type="unknown"
FT   assembly_gap    15408279..15408298
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15424237..15424427
FT                   /estimated_length=191
FT                   /gap_type="unknown"
FT   assembly_gap    15430035..15430054
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15446983..15447061
FT                   /estimated_length=79
FT                   /gap_type="unknown"
FT   assembly_gap    15453905..15454889
FT                   /estimated_length=985
FT                   /gap_type="unknown"
FT   gene            15521839..15599510
FT                   /gene="Sncaip"
FT                   /locus_tag="mCG_3252"
FT                   /note="gene_id=mCG3252.1"
FT   mRNA            join(15521839..15521941,15535218..15535290,
FT                   15552278..15553146,15555042..15555221,15568370..15568483,
FT                   15578249..15578374,15581535..15581704,15589382..15589474,
FT                   15589995..15591054,15592187..15592257,15598885..15599510)
FT                   /gene="Sncaip"
FT                   /locus_tag="mCG_3252"
FT                   /product="synuclein, alpha interacting protein (synphilin),
FT                   transcript variant mCT2071"
FT                   /note="gene_id=mCG3252.1 transcript_id=mCT2071.0 created on
FT                   10-OCT-2002"
FT   mRNA            join(15521839..15521941,15535218..15535290,
FT                   15552278..15553146,15555042..15555221,15568370..15568483,
FT                   15578249..15578374,15581535..15581704,15589382..15589474,
FT                   15589995..15591054,15598885..15599510)
FT                   /gene="Sncaip"
FT                   /locus_tag="mCG_3252"
FT                   /product="synuclein, alpha interacting protein (synphilin),
FT                   transcript variant mCT174127"
FT                   /note="gene_id=mCG3252.1 transcript_id=mCT174127.0 created
FT                   on 10-OCT-2002"
FT   CDS             join(15521885..15521941,15535218..15535290,
FT                   15552278..15553146,15555042..15555221,15568370..15568483,
FT                   15578249..15578374,15581535..15581704,15589382..15589474,
FT                   15589995..15591054,15592187..15592257,15598885..15598969)
FT                   /codon_start=1
FT                   /gene="Sncaip"
FT                   /locus_tag="mCG_3252"
FT                   /product="synuclein, alpha interacting protein (synphilin),
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG3252.1 transcript_id=mCT2071.0
FT                   protein_id=mCP3486.1 isoform=CRA_b"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="MGI:MGI:1915097"
FT                   /db_xref="UniProtKB/TrEMBL:G5E848"
FT                   /protein_id="EDL09917.1"
FT                   /translation="MEAPEYLDLDEIDFSDDISYSVTSLKTIPALCRRCDSQNEDRSVS
FT                   SSGWNCGVSTLITNPQKPTGIADVYSKFRPVKRVSPLKHQPETLENNENEDQKNNTVEY
FT                   QKGGETDQGPQPEELSPEDGVGGLPGKGSEPSQALGELEHYDLDMDEILDVPYIKSSQQ
FT                   LAPLTKVTSEKRILGLCTTINGLSAKTCPIASTENSTPNMTPFCVLSPVKSPHLRKAPT
FT                   ALRDQHKLSTEDSESSPALGKCGPAYESENHSKDFLNKVFSDPHSRKIEKSGPDCKLRS
FT                   FHLQSSAAGAKTEEPINGMNWTNTQGTEERTEYLKKVRSILNIVNEGQISLLPHLAADN
FT                   LDKIHDENGNNLLHIAASKGHAECLQHLTSLMGEDCLNERNTEQLTPAGLAIKNGQLEC
FT                   VRWMVSETEAIAELSCSKDFPSLIHYAGCYGQEKILLWLLQFMQEQGISLDEVDREGNS
FT                   AVHVASQHGYLGCIQTLVEYGANVTMQNHAGEKPSQSAERHGHTLCSRYLVVVETCMSL
FT                   ASQVVKLTKQLKEQTVERVTLQSQLQQLLEAQKSEGKSLPSSPSSPSSPASTKSQWKAL
FT                   DTDEESTGKSKVGAQEGIQVLGSLSVSSRARTKGKDEDSDKILRQLLGKEISENVCTQE
FT                   KLSLEFQDAQASSRNSKKIPLEKRELKLARLRQLMQRSLSESDTDSNNSEDPKNTPVKR
FT                   ADRPRPQPIVESVENVDSAESLHLMIKKHSLASGRRFPFGMKASKSLDGHSPSPTSESS
FT                   EPDLDSHGPGLGMTPPTQPSTEATQSSPDSTAAQKVATSPKSALKSPSSKRRTSQNSKL
FT                   RVTFEEPVVQMEQTGLELNGEKDKDKGRAPQRTSESGEQMKRPFGTFRSIMESLSGNQN
FT                   NNNNYQPASQLKTCTLPLTSLGRKTADAKGNPVSPASKGKNKAAMYSSCIHLPSNALVE
FT                   EHLRDYARHNDIKRNATKTYHMKHTAEPEPRELFL"
FT   CDS             join(15521885..15521941,15535218..15535290,
FT                   15552278..15553146,15555042..15555221,15568370..15568483,
FT                   15578249..15578374,15581535..15581704,15589382..15589474,
FT                   15589995..15591054,15598885..15598890)
FT                   /codon_start=1
FT                   /gene="Sncaip"
FT                   /locus_tag="mCG_3252"
FT                   /product="synuclein, alpha interacting protein (synphilin),
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG3252.1 transcript_id=mCT174127.0
FT                   protein_id=mCP97046.0 isoform=CRA_a"
FT                   /db_xref="GOA:E9Q4E2"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="MGI:MGI:1915097"
FT                   /db_xref="UniProtKB/TrEMBL:E9Q4E2"
FT                   /protein_id="EDL09916.1"
FT                   /translation="MEAPEYLDLDEIDFSDDISYSVTSLKTIPALCRRCDSQNEDRSVS
FT                   SSGWNCGVSTLITNPQKPTGIADVYSKFRPVKRVSPLKHQPETLENNENEDQKNNTVEY
FT                   QKGGETDQGPQPEELSPEDGVGGLPGKGSEPSQALGELEHYDLDMDEILDVPYIKSSQQ
FT                   LAPLTKVTSEKRILGLCTTINGLSAKTCPIASTENSTPNMTPFCVLSPVKSPHLRKAPT
FT                   ALRDQHKLSTEDSESSPALGKCGPAYESENHSKDFLNKVFSDPHSRKIEKSGPDCKLRS
FT                   FHLQSSAAGAKTEEPINGMNWTNTQGTEERTEYLKKVRSILNIVNEGQISLLPHLAADN
FT                   LDKIHDENGNNLLHIAASKGHAECLQHLTSLMGEDCLNERNTEQLTPAGLAIKNGQLEC
FT                   VRWMVSETEAIAELSCSKDFPSLIHYAGCYGQEKILLWLLQFMQEQGISLDEVDREGNS
FT                   AVHVASQHGYLGCIQTLVEYGANVTMQNHAGEKPSQSAERHGHTLCSRYLVVVETCMSL
FT                   ASQVVKLTKQLKEQTVERVTLQSQLQQLLEAQKSEGKSLPSSPSSPSSPASTKSQWKAL
FT                   DTDEESTGKSKVGAQEGIQVLGSLSVSSRARTKGKDEDSDKILRQLLGKEISENVCTQE
FT                   KLSLEFQDAQASSRNSKKIPLEKRELKLARLRQLMQRSLSESDTDSNNSEDPKNTPVKR
FT                   ADRPRPQPIVESVENVDSAESLHLMIKKHSLASGRRFPFGMKASKSLDGHSPSPTSESS
FT                   EPDLDSHGPGLGMTPPTQPSTEATQSSPDSTAAQKVATSPKSALKSPSSKRRTSQNSKL
FT                   RVTFEEPVVQMEQTGLELNGEKDKDKGRAPQRTSESGEQMKRPFGTFRSIMESLSGNQN
FT                   NNNNYQPASQLKTCTLPLTSLGRKTADAKGNPVSPASKGKNKAA"
FT   assembly_gap    15528829..15528948
FT                   /estimated_length=120
FT                   /gap_type="unknown"
FT   assembly_gap    15532963..15532982
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15563248..15566439
FT                   /estimated_length=3192
FT                   /gap_type="unknown"
FT   assembly_gap    15584305..15584665
FT                   /estimated_length=361
FT                   /gap_type="unknown"
FT   assembly_gap    15611379..15611398
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15624342..15624361
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            15635217..15636002
FT                   /pseudo
FT                   /locus_tag="mCG_3254"
FT                   /note="gene_id=mCG3254.1"
FT   mRNA            15635217..15636002
FT                   /pseudo
FT                   /locus_tag="mCG_3254"
FT                   /note="gene_id=mCG3254.1 transcript_id=mCT2070.2 created on
FT                   10-OCT-2002"
FT   assembly_gap    15639937..15639956
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15642246..15642265
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15647093..15647112
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15673270..15673289
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15700313..15703033
FT                   /estimated_length=2721
FT                   /gap_type="unknown"
FT   assembly_gap    15759311..15759330
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15761430..15761449
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15766312..15766499
FT                   /estimated_length=188
FT                   /gap_type="unknown"
FT   assembly_gap    15767675..15767694
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15784577..15784596
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15830942..15830961
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            15852449..15897287
FT                   /locus_tag="mCG_3253"
FT                   /note="gene_id=mCG3253.2"
FT   mRNA            join(15852449..15852523,15852710..15852765,
FT                   15865843..15866023,15874111..15874177,15874442..15874485,
FT                   15876013..15876154,15879297..15879375,15885845..15885920,
FT                   15886587..15886700,15886956..15887049,15889010..15889215,
FT                   15892808..15892951,15894529..15894613,15894716..15894787,
FT                   15896799..15897287)
FT                   /locus_tag="mCG_3253"
FT                   /product="mCG3253, transcript variant mCT174128"
FT                   /note="gene_id=mCG3253.2 transcript_id=mCT174128.0 created
FT                   on 09-OCT-2002"
FT   mRNA            join(15852460..15852523,15852710..15852765,
FT                   15865906..15866023,15870685..15870848,15874111..15874177,
FT                   15874442..15874485,15876013..15876154,15879297..15879375,
FT                   15885845..15885920,15886587..15886700,15886956..15887049,
FT                   15889010..15889215,15892808..15892951,15894529..15894609,
FT                   15894716..15894787,15896799..15897287)
FT                   /locus_tag="mCG_3253"
FT                   /product="mCG3253, transcript variant mCT2072"
FT                   /note="gene_id=mCG3253.2 transcript_id=mCT2072.2 created on
FT                   09-OCT-2002"
FT   CDS             join(15852475..15852523,15852710..15852765,
FT                   15865906..15866023,15870685..15870848,15874111..15874177,
FT                   15874442..15874485,15876013..15876154,15879297..15879375,
FT                   15885845..15885920,15886587..15886700,15886956..15887049,
FT                   15889010..15889215,15892808..15892951,15894529..15894609,
FT                   15894716..15894787,15896799..15896849)
FT                   /codon_start=1
FT                   /locus_tag="mCG_3253"
FT                   /product="mCG3253, isoform CRA_b"
FT                   /note="gene_id=mCG3253.2 transcript_id=mCT2072.2
FT                   protein_id=mCP3480.2 isoform=CRA_b"
FT                   /protein_id="EDL09915.1"
FT                   /translation="MAAEREPPPLGDVKPTVEELEDGEDLFTSTVSTLESSPSSPEPAS
FT                   LPAEDISANSNGSKPVEVVLDDDREDLFAEATEEVSLDSPERELILSSEPSPAVTPVTP
FT                   TTLIAPRIESKSISAPVIFDRSRDEIEEEANGDIFDIEIGVSDPEKVGDGMNAYMAYRV
FT                   TTKTSLSMFSKSEFSVKRRFSDFLGLHSKLASKYLHVGYIVPPAPEKSIVGMTKVKVGK
FT                   EDSSSTEFVEKRRAALERYLQRTVKHPTLLQDPDLRQFLESSELPRAVNTQALSGAGIL
FT                   RMVNKAADAVNKMTIKMNESDAWFEEKQQQFENLDQQLRKLHASVEALVCHRKELSANT
FT                   AAFAKSAAMLGNSEDHTALSRALSQLAEVEEKIDQLHQEQAFADFYMFSELLSDYIRLI
FT                   AAVKGVFDHRMKCWQKWEDAQITLLKKRETEAKMMVANKPDKIQQAKNEIREWEAKVQQ
FT                   GERDFEQISKTIRKEVGRFEKERVKDFKAVIIKYLESLVQTQQQLIKYWEAFLPEAKAI
FT                   A"
FT   assembly_gap    15852529..15852707
FT                   /estimated_length=179
FT                   /gap_type="unknown"
FT   assembly_gap    15854255..15854813
FT                   /estimated_length=559
FT                   /gap_type="unknown"
FT   assembly_gap    15862791..15862810
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(15866000..15866023,15874111..15874177,
FT                   15874442..15874485,15876013..15876154,15879297..15879375,
FT                   15885845..15885920,15886587..15886700,15886956..15887049,
FT                   15889010..15889215,15892808..15892951,15894529..15894613,
FT                   15894716..15894717)
FT                   /codon_start=1
FT                   /locus_tag="mCG_3253"
FT                   /product="mCG3253, isoform CRA_a"
FT                   /note="gene_id=mCG3253.2 transcript_id=mCT174128.0
FT                   protein_id=mCP97047.0 isoform=CRA_a"
FT                   /protein_id="EDL09914.1"
FT                   /translation="MTEKIFSQIEEEANGDIFDIEIGVSDPEKVGDGMNAYMAYRVTTK
FT                   TSLSMFSKSEFSVKRRFSDFLGLHSKLASKYLHVGYIVPPAPEKSIVGMTKVKVGKEDS
FT                   SSTEFVEKRRAALERYLQRTVKHPTLLQDPDLRQFLESSELPRAVNTQALSGAGILRMV
FT                   NKAADAVNKMTIKMNESDAWFEEKQQQFENLDQQLRKLHASVEALVCHRKELSANTAAF
FT                   AKSAAMLGNSEDHTALSRALSQLAEVEEKIDQLHQEQAFADFYMFSELLSDYIRLIAAV
FT                   KGVFDHRMKCWQKWEDAQITLLKKRETEAKMMVANKPDKIQQAKNEIREWEAKVQQGER
FT                   DFEQISKTIRKEVGRFEA"
FT   assembly_gap    15890770..15890789
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(15897410..15898326)
FT                   /pseudo
FT                   /locus_tag="mCG_48828"
FT                   /note="gene_id=mCG48828.2"
FT   mRNA            complement(15897410..15898326)
FT                   /pseudo
FT                   /locus_tag="mCG_48828"
FT                   /note="gene_id=mCG48828.2 transcript_id=mCT49011.2 created
FT                   on 17-OCT-2002"
FT   assembly_gap    15913880..15914268
FT                   /estimated_length=389
FT                   /gap_type="unknown"
FT   assembly_gap    15915320..15915922
FT                   /estimated_length=603
FT                   /gap_type="unknown"
FT   gene            <15921422..16064513
FT                   /gene="Snx24"
FT                   /locus_tag="mCG_8358"
FT                   /note="gene_id=mCG8358.2"
FT   mRNA            join(15921422..15921507,16000955..16001038,
FT                   16013677..16013781,16056669..16056763,16058215..16058247,
FT                   16058775..16058839,16063113..16063212,16063988..16064419)
FT                   /gene="Snx24"
FT                   /locus_tag="mCG_8358"
FT                   /product="sorting nexing 24, transcript variant mCT173334"
FT                   /note="gene_id=mCG8358.2 transcript_id=mCT173334.0 created
FT                   on 19-SEP-2002"
FT   mRNA            join(<15921422..15921507,16000955..16001038,
FT                   16013677..16013781,16056669..16056763,16058215..16058247,
FT                   16058775..16058839,16063113..16063208,16063988..16064419)
FT                   /gene="Snx24"
FT                   /locus_tag="mCG_8358"
FT                   /product="sorting nexing 24, transcript variant mCT190282"
FT                   /note="gene_id=mCG8358.2 transcript_id=mCT190282.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(15921423..15921507,16000955..16001038,
FT                   16013677..16013781,16056669..16056763,16058215..16058247,
FT                   16058775..16058839,16063113..16064513)
FT                   /gene="Snx24"
FT                   /locus_tag="mCG_8358"
FT                   /product="sorting nexing 24, transcript variant mCT7423"
FT                   /note="gene_id=mCG8358.2 transcript_id=mCT7423.2 created on
FT                   19-SEP-2002"
FT   CDS             join(<15921424..15921507,16000955..16001038,
FT                   16013677..16013781,16056669..16056763,16058215..16058247,
FT                   16058775..16058839,16063113..16063180)
FT                   /codon_start=1
FT                   /gene="Snx24"
FT                   /locus_tag="mCG_8358"
FT                   /product="sorting nexing 24, isoform CRA_b"
FT                   /note="gene_id=mCG8358.2 transcript_id=mCT190282.0
FT                   protein_id=mCP111293.0 isoform=CRA_b"
FT                   /protein_id="EDL09912.1"
FT                   /translation="EWRGPAAAMEVYIPSFRHEDSDLERGYTVFKIEVLMNGRKHFVEK
FT                   RYSEFHALHKKLKKCIKTPEIPSKHVRNWVPKVLEQRRQGLETYLQAVILENEELPKLF
FT                   LDFLNVRHLPSLPKAESCGSFDETESEESSKLSHQPVLLFLGDPYVLPAASDFPNVVIE
FT                   GVLHGIFFSHLQPR"
FT   CDS             join(15921448..15921507,16000955..16001038,
FT                   16013677..16013781,16056669..16056763,16058215..16058247,
FT                   16058775..16058839,16063113..16063180)
FT                   /codon_start=1
FT                   /gene="Snx24"
FT                   /locus_tag="mCG_8358"
FT                   /product="sorting nexing 24, isoform CRA_a"
FT                   /note="gene_id=mCG8358.2 transcript_id=mCT173334.0
FT                   protein_id=mCP96253.0 isoform=CRA_a"
FT                   /protein_id="EDL09911.1"
FT                   /translation="MEVYIPSFRHEDSDLERGYTVFKIEVLMNGRKHFVEKRYSEFHAL
FT                   HKKLKKCIKTPEIPSKHVRNWVPKVLEQRRQGLETYLQAVILENEELPKLFLDFLNVRH
FT                   LPSLPKAESCGSFDETESEESSKLSHQPVLLFLGDPYVLPAASDFPNVVIEGVLHGIFF
FT                   SHLQPR"
FT   CDS             join(15921448..15921507,16000955..16001038,
FT                   16013677..16013781,16056669..16056763,16058215..16058247,
FT                   16058775..16058839,16063113..16063180)
FT                   /codon_start=1
FT                   /gene="Snx24"
FT                   /locus_tag="mCG_8358"
FT                   /product="sorting nexing 24, isoform CRA_a"
FT                   /note="gene_id=mCG8358.2 transcript_id=mCT7423.2
FT                   protein_id=mCP21495.2 isoform=CRA_a"
FT                   /protein_id="EDL09913.1"
FT                   /translation="MEVYIPSFRHEDSDLERGYTVFKIEVLMNGRKHFVEKRYSEFHAL
FT                   HKKLKKCIKTPEIPSKHVRNWVPKVLEQRRQGLETYLQAVILENEELPKLFLDFLNVRH
FT                   LPSLPKAESCGSFDETESEESSKLSHQPVLLFLGDPYVLPAASDFPNVVIEGVLHGIFF
FT                   SHLQPR"
FT   assembly_gap    15925553..15925676
FT                   /estimated_length=124
FT                   /gap_type="unknown"
FT   assembly_gap    15928299..15928482
FT                   /estimated_length=184
FT                   /gap_type="unknown"
FT   assembly_gap    15931114..15931133
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15965652..15965671
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16027853..16027872
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16036243..16036762
FT                   /estimated_length=520
FT                   /gap_type="unknown"
FT   assembly_gap    16065120..16065139
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16077685..16077704
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(16081113..16092862)
FT                   /gene="Ppic"
FT                   /locus_tag="mCG_8356"
FT                   /note="gene_id=mCG8356.2"
FT   mRNA            complement(join(16081113..16081840,16083898..16084082,
FT                   16085826..16085919,16086345..16086458,16092680..16092847))
FT                   /gene="Ppic"
FT                   /locus_tag="mCG_8356"
FT                   /product="peptidylprolyl isomerase C, transcript variant
FT                   mCT7426"
FT                   /note="gene_id=mCG8356.2 transcript_id=mCT7426.1 created on
FT                   09-OCT-2002"
FT   CDS             complement(join(16081712..16081840,16083898..16084082,
FT                   16085826..16085919,16086345..16086458,16092680..16092796))
FT                   /codon_start=1
FT                   /gene="Ppic"
FT                   /locus_tag="mCG_8356"
FT                   /product="peptidylprolyl isomerase C, isoform CRA_b"
FT                   /note="gene_id=mCG8356.2 transcript_id=mCT7426.1
FT                   protein_id=mCP21482.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q3UC73"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="MGI:MGI:97751"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UC73"
FT                   /protein_id="EDL09910.1"
FT                   /translation="MSPGPRLLLPAVLCLGLGALVSSSGSSGVRKRGPSVTDKVFFDVR
FT                   IGDKDVGRIVIGLFGNVVPKTVENFVALATGEKGYGYKGSIFHRVIKDFMIQGGDFTAR
FT                   DGTGGMSIYGETFPDENFKLKHYGIGWVSMANAGPDTNGSQFFITLTKPTWLDGKHVVF
FT                   GKVLDGMTVVHSIELQATDGHDRPLTDCTIVNSGKIDVKTPFVVEVPDW"
FT   assembly_gap    16085512..16085561
FT                   /estimated_length=50
FT                   /gap_type="unknown"
FT   mRNA            complement(join(16086254..16086458,16092680..16092862))
FT                   /gene="Ppic"
FT                   /locus_tag="mCG_8356"
FT                   /product="peptidylprolyl isomerase C, transcript variant
FT                   mCT174169"
FT                   /note="gene_id=mCG8356.2 transcript_id=mCT174169.0 created
FT                   on 09-OCT-2002"
FT   CDS             complement(join(16086303..16086458,16092680..16092796))
FT                   /codon_start=1
FT                   /gene="Ppic"
FT                   /locus_tag="mCG_8356"
FT                   /product="peptidylprolyl isomerase C, isoform CRA_a"
FT                   /note="gene_id=mCG8356.2 transcript_id=mCT174169.0
FT                   protein_id=mCP97088.0 isoform=CRA_a"
FT                   /protein_id="EDL09909.1"
FT                   /translation="MSPGPRLLLPAVLCLGLGALVSSSGSSGVRKRGPSVTDKVFFDVR
FT                   IGDKDVGRIVIGLFGNVVPKTVENFVALATGEVCPSLTAFNREQV"
FT   assembly_gap    16104319..16104338
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16108363..16109321
FT                   /estimated_length=959
FT                   /gap_type="unknown"
FT   gene            16121474..16240851
FT                   /locus_tag="mCG_125860"
FT                   /note="gene_id=mCG125860.1"
FT   mRNA            join(16121474..16121524,16136994..16137280,
FT                   16145664..16145964,16208301..16208428,16211885..16212009,
FT                   16223746..16224088,16233597..16233773,16240405..16240851)
FT                   /locus_tag="mCG_125860"
FT                   /product="mCG125860"
FT                   /note="gene_id=mCG125860.1 transcript_id=mCT127123.1
FT                   created on 09-OCT-2002"
FT   CDS             join(16121522..16121524,16136994..16137280,
FT                   16145664..16145964,16208301..16208428,16211885..16212009,
FT                   16223746..16224088,16233597..16233773,16240405..16240519)
FT                   /codon_start=1
FT                   /locus_tag="mCG_125860"
FT                   /product="mCG125860"
FT                   /note="gene_id=mCG125860.1 transcript_id=mCT127123.1
FT                   protein_id=mCP77960.1"
FT                   /protein_id="EDL09908.1"
FT                   /translation="MALAGLSALPVAQMPVFAPLAAAAVAAEPLPPKDLCLGASAGPGP
FT                   AKCGGGGGSVGDGRGVPRFRCSAEELDYYLYGQQRMEIIPLNQHTSDPNNRTMCADNRN
FT                   GECPMHGPLHSLRRLVGTSSAAAAAPPPELPEWLRDLPREVCLCTSTVPGLAYGICAAQ
FT                   RIQQGTWIGPFQGVLLSPEKVQTGVVRNTQHLWEIYDQDGTLQHFIDGGEPSKSSWMRY
FT                   IRCARHCGEQNLTVVQYRSNIFYRACIDIPRGTELLVWYNDSYTSFFGIPLQCIAQDEN
FT                   LNVPSTVMEAMCRQDALQPFNKSSKLSPSGQQRSVVFPQTPCSRNFSLLDKSGPMEAGF
FT                   NQINVKNQRVLASPTSTSQLHSEFSDWHLWKCGQCFKTFTQRILLQMHVCTQNPDRPYQ
FT                   CGHCSQSFSQPSELRNHVVTHSSDRPFKCGYCGRAFAGATTLNNHIRTHTGEKPFKCER
FT                   CERSFTQATQLSRHQRMPNECKPITESPESIEVD"
FT   assembly_gap    16132688..16132880
FT                   /estimated_length=193
FT                   /gap_type="unknown"
FT   assembly_gap    16136654..16136924
FT                   /estimated_length=271
FT                   /gap_type="unknown"
FT   assembly_gap    16145451..16145662
FT                   /estimated_length=212
FT                   /gap_type="unknown"
FT   assembly_gap    16175324..16177279
FT                   /estimated_length=1956
FT                   /gap_type="unknown"
FT   assembly_gap    16180158..16180177
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16183475..16183507
FT                   /estimated_length=33
FT                   /gap_type="unknown"
FT   assembly_gap    16185490..16185534
FT                   /estimated_length=45
FT                   /gap_type="unknown"
FT   assembly_gap    16190084..16190291
FT                   /estimated_length=208
FT                   /gap_type="unknown"
FT   assembly_gap    16196720..16197318
FT                   /estimated_length=599
FT                   /gap_type="unknown"
FT   assembly_gap    16201166..16202205
FT                   /estimated_length=1040
FT                   /gap_type="unknown"
FT   assembly_gap    16239430..16239449
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16261800..16263156
FT                   /estimated_length=1357
FT                   /gap_type="unknown"
FT   assembly_gap    16275598..16275743
FT                   /estimated_length=146
FT                   /gap_type="unknown"
FT   assembly_gap    16279492..16279574
FT                   /estimated_length=83
FT                   /gap_type="unknown"
FT   assembly_gap    16288916..16288935
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16293439..16293581
FT                   /estimated_length=143
FT                   /gap_type="unknown"
FT   assembly_gap    16311103..16311122
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <16313900..16376592
FT                   /locus_tag="mCG_144599"
FT                   /note="gene_id=mCG144599.0"
FT   mRNA            join(<16313900..16314119,16364006..16364072,
FT                   16374572..16376592)
FT                   /locus_tag="mCG_144599"
FT                   /product="mCG144599"
FT                   /note="gene_id=mCG144599.0 transcript_id=mCT184023.0
FT                   created on 05-JUN-2003"
FT   assembly_gap    16321081..16321867
FT                   /estimated_length=787
FT                   /gap_type="unknown"
FT   assembly_gap    16323031..16323050
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16324247..16324266
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16325513..16325532
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16328165..16328184
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16329635..16329654
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16333745..16333764
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16336057..16336076
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16351005..16351349
FT                   /estimated_length=345
FT                   /gap_type="unknown"
FT   gene            complement(16352897..>16415718)
FT                   /gene="AU016693"
FT                   /locus_tag="mCG_141305"
FT                   /note="gene_id=mCG141305.1"
FT   mRNA            complement(join(16352897..16354637,16357056..16357201,
FT                   16368709..16368849,16374294..16374416,16377992..16378153,
FT                   16380229..16380321,16384555..16384644,16385945..16386097,
FT                   16386181..16386277,16389627..16389809,16390396..16390545,
FT                   16392803..16392980,16394263..16394485,16395543..16395725,
FT                   16398673..16398870,16402217..16402365,16406753..16406894,
FT                   16409588..16409702,16411161..16411317,16415391..>16415439))
FT                   /gene="AU016693"
FT                   /locus_tag="mCG_141305"
FT                   /product="expressed sequence AU016693, transcript variant
FT                   mCT174468"
FT                   /note="gene_id=mCG141305.1 transcript_id=mCT174468.0
FT                   created on 08-OCT-2002"
FT   mRNA            complement(join(16352897..16354637,16357056..16357201,
FT                   16368751..16368849,16374294..16374416,16377992..16378676))
FT                   /gene="AU016693"
FT                   /locus_tag="mCG_141305"
FT                   /product="expressed sequence AU016693, transcript variant
FT                   mCT174469"
FT                   /note="gene_id=mCG141305.1 transcript_id=mCT174469.0
FT                   created on 08-OCT-2002"
FT   mRNA            complement(join(16352899..16354637,16357056..16357201,
FT                   16368751..16368849,16374294..16374416,16377992..16378153,
FT                   16380229..16380321,16384555..16384644,16385945..16386097,
FT                   16386181..16386277,16389627..16389809,16390396..16390545,
FT                   16392803..16392980,16394263..16394485,16395498..16395725,
FT                   16398673..16398870,16402217..16402365,16406753..16406894,
FT                   16409588..16409702,16411161..16411317,16415391..16415456,
FT                   16415597..>16415664))
FT                   /gene="AU016693"
FT                   /locus_tag="mCG_141305"
FT                   /product="expressed sequence AU016693, transcript variant
FT                   mCT190296"
FT                   /note="gene_id=mCG141305.1 transcript_id=mCT190296.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(16354406..16354637,16357056..16357201,
FT                   16368751..16368849,16374294..16374416,16377992..16378153,
FT                   16380229..16380321,16384555..16384644,16385945..16386097,
FT                   16386181..16386277,16389627..16389809,16390396..16390545,
FT                   16392803..16392980,16394263..16394485,16395498..16395725,
FT                   16398673..16398870,16402217..16402365,16406753..16406894,
FT                   16409588..16409702,16411161..16411317,16415391..16415456,
FT                   16415597..>16415618))
FT                   /codon_start=1
FT                   /gene="AU016693"
FT                   /locus_tag="mCG_141305"
FT                   /product="expressed sequence AU016693, isoform CRA_c"
FT                   /note="gene_id=mCG141305.1 transcript_id=mCT190296.0
FT                   protein_id=mCP111271.0 isoform=CRA_c"
FT                   /protein_id="EDL09904.1"
FT                   /translation="RLSRRQKDPAAATMVPKSDQLLIVVSILEGRHFPKRPKHLLVVEA
FT                   KFDGEQLATDPVDHTDQPEFATELAWEIDRKVLHQHRLQRTPIKLQCFALDPQTSAKET
FT                   VGYIVLDLRTAQETKQAPKWYQLLSNKYTKFKAEVQISLTLETDTKAQVDSYKAKAAPP
FT                   RDGKVLASLAGVDPKDIVAVLNEEGGYHQIGPAEHCTDPFILSVTIAFATQLEQLIPCT
FT                   MKLPERQPEFFFYYSLLGNDVTNEPFSDLINPNFEPERASVRIRSSVEILRVYLALHSK
FT                   LQIHLCCGDQSLGSTEIPLNGLLKKGSTEINQHPVTVEGAFTLDPPNRAKQKLAPVPLD
FT                   LAPTVGVSVALQREGIDSQSLIELKTQNGHEAEHSQKRVLTPIKEKTLTGPKSPRESPA
FT                   PPPPPNQTPPTKDDATESEVESLQYDKDPKPTVKGIGSVPASLAQPEATCGASEVVTSG
FT                   QKIAVPAASHHFCFSVDLRSVHDLELSFPVNCILRYSYPFFGSAAPIMTNPPVEVRKNM
FT                   EVFLPQSYCAFDFATMPHQLQDTFLRIPLLVELWHKDKMSKDLLLGVARIQLSNILSSE
FT                   KTRFLGANGEQCWRQTYSESVPVIAAQGSNNRILDLSYTMTLEDYGLVKMREIFVSESS
FT                   QGVPAVDQKPSSPPPAPCPSEIQMEPRETLEYKAALELEMWKEMQEDIFESQLKQKELA
FT                   HMQALAEEWKKRDRERESLVKKKVAEYSILEGKLQKALTELETREQQLASAEAELQRER
FT                   KELQLERERNLQELQDSVRRARDDCVYQVELERLKLKQLEEDKQRLQQQLNDAGNKYKT
FT                   LEKEFQQFKDQQNNKPEIRLQSEINLLTLEKVELERKLESATKSKLHYKQQWGRALKEL
FT                   ARLKQREQESQMARLKKQQEELEQMRLRYLAAEEKETVRTEQQELLDIRNELNRLRQQE
FT                   QNQYQDCKEIASGKLGSPRGSGLEEGLDDYLTRLIEERDTLMRTGVYNHEDRIISELDR
FT                   QIREVLTKNSAS"
FT   CDS             complement(join(16354406..16354637,16357056..16357201,
FT                   16368709..16368849,16374294..16374416,16377992..16378153,
FT                   16380229..16380321,16384555..16384644,16385945..16386097,
FT                   16386181..16386277,16389627..16389809,16390396..16390545,
FT                   16392803..16392980,16394263..16394485,16395543..16395725,
FT                   16398673..16398870,16402217..16402365,16406753..16406894,
FT                   16409588..16409702,16411161..16411317,16415391..16415439))
FT                   /codon_start=1
FT                   /gene="AU016693"
FT                   /locus_tag="mCG_141305"
FT                   /product="expressed sequence AU016693, isoform CRA_d"
FT                   /note="gene_id=mCG141305.1 transcript_id=mCT174468.0
FT                   protein_id=mCP97389.0 isoform=CRA_d"
FT                   /protein_id="EDL09905.1"
FT                   /translation="MVPKSDQLLIVVSILEGRHFPKRPKHLLVVEAKFDGEQLATDPVD
FT                   HTDQPEFATELAWEIDRKVLHQHRLQRTPIKLQCFALDPQTSAKETVGYIVLDLRTAQE
FT                   TKQAPKWYQLLSNKYTKFKAEVQISLTLETDTKAQVDSYKAKAAPPRDGKVLASLAGVD
FT                   PKDIVAVLNEEGGYHQIGPAEHCTDPFILSVTIAFATQLEQLIPCTMKLPERQPEFFFY
FT                   YSLLGNDVTNEPFSDLINPNFEPERASVRIRSSVEILRVYLALHSKLQIHLCCGDQSLG
FT                   STEIPLNGLLKKGSTEINQHPVTVEGAFTLDPPNRAKQKLAPVPLDLAPTSLIELKTQN
FT                   GHEAEHSQKRVLTPIKEKTLTGPKSPRESPAPPPPPNQTPPTKDDATESEVESLQYDKD
FT                   PKPTVKGIGSVPASLAQPEATCGASEVVTSGQKIAVPAASHHFCFSVDLRSVHDLELSF
FT                   PVNCILRYSYPFFGSAAPIMTNPPVEVRKNMEVFLPQSYCAFDFATMPHQLQDTFLRIP
FT                   LLVELWHKDKMSKDLLLGVARIQLSNILSSEKTRFLGANGEQCWRQTYSESVPVIAAQG
FT                   SNNRILDLSYTMTLEDYGLVKMREIFVSESSQGVPAVDQKPSSPPPAPCPSEIQMEPRE
FT                   TLEYKAALELEMWKEMQEDIFESQLKQKELAHMQALAEEWKKRDRERESLVKKKVAEYS
FT                   ILEGKLQKALTELETREQQLASAEAELQRERKELQLERERNLQELQDSVRRARDDCVYQ
FT                   VELERLKLKQLEEDKQRLQQQLNDAGNKYKTLEKEFQQFKDQQNNKPEIRLQSEINLLT
FT                   LEKVELERKLESATKSKLHYKQQWGRALKELARLKQVRGREQTLSSLRSFREQESQMAR
FT                   LKKQQEELEQMRLRYLAAEEKETVRTEQQELLDIRNELNRLRQQEQNQYQDCKEIASGK
FT                   LGSPRGSGLEEGLDDYLTRLIEERDTLMRTGVYNHEDRIISELDRQIREVLTKNSAS"
FT   CDS             complement(join(16354406..16354637,16357056..16357183))
FT                   /codon_start=1
FT                   /gene="AU016693"
FT                   /locus_tag="mCG_141305"
FT                   /product="expressed sequence AU016693, isoform CRA_a"
FT                   /note="gene_id=mCG141305.1 transcript_id=mCT174469.0
FT                   protein_id=mCP97387.0 isoform=CRA_a"
FT                   /protein_id="EDL09902.1"
FT                   /translation="MARLKKQQEELEQMRLRYLAAEEKETVRTEQQELLDIRNELNRLR
FT                   QQEQNQYQDCKEIASGKLGSPRGSGLEEGLDDYLTRLIEERDTLMRTGVYNHEDRIISE
FT                   LDRQIREVLTKNSAS"
FT   mRNA            complement(join(16356668..16357201,16368751..16368849,
FT                   16374294..16374416,16377992..16378153,16380229..16380321,
FT                   16384555..16384644,16385945..16386097,16386181..16386277,
FT                   16389627..16389809,16390396..16390545,16392803..16392980,
FT                   16394263..16394485,16395498..16395725,16398673..16398870,
FT                   16402217..16402365,16406753..16406894,16409588..16409702,
FT                   16411161..16411317,16415391..16415456,16415597..>16415718))
FT                   /gene="AU016693"
FT                   /locus_tag="mCG_141305"
FT                   /product="expressed sequence AU016693, transcript variant
FT                   mCT190295"
FT                   /note="gene_id=mCG141305.1 transcript_id=mCT190295.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(16357001..16357201,16368751..16368849,
FT                   16374294..16374416,16377992..16378153,16380229..16380321,
FT                   16384555..16384644,16385945..16386097,16386181..16386277,
FT                   16389627..16389809,16390396..16390545,16392803..16392980,
FT                   16394263..16394485,16395498..16395725,16398673..16398870,
FT                   16402217..16402365,16406753..16406894,16409588..16409702,
FT                   16411161..16411317,16415391..16415456,16415597..>16415618))
FT                   /codon_start=1
FT                   /gene="AU016693"
FT                   /locus_tag="mCG_141305"
FT                   /product="expressed sequence AU016693, isoform CRA_b"
FT                   /note="gene_id=mCG141305.1 transcript_id=mCT190295.0
FT                   protein_id=mCP111270.0 isoform=CRA_b"
FT                   /protein_id="EDL09903.1"
FT                   /translation="RLSRRQKDPAAATMVPKSDQLLIVVSILEGRHFPKRPKHLLVVEA
FT                   KFDGEQLATDPVDHTDQPEFATELAWEIDRKVLHQHRLQRTPIKLQCFALDPQTSAKET
FT                   VGYIVLDLRTAQETKQAPKWYQLLSNKYTKFKAEVQISLTLETDTKAQVDSYKAKAAPP
FT                   RDGKVLASLAGVDPKDIVAVLNEEGGYHQIGPAEHCTDPFILSVTIAFATQLEQLIPCT
FT                   MKLPERQPEFFFYYSLLGNDVTNEPFSDLINPNFEPERASVRIRSSVEILRVYLALHSK
FT                   LQIHLCCGDQSLGSTEIPLNGLLKKGSTEINQHPVTVEGAFTLDPPNRAKQKLAPVPLD
FT                   LAPTVGVSVALQREGIDSQSLIELKTQNGHEAEHSQKRVLTPIKEKTLTGPKSPRESPA
FT                   PPPPPNQTPPTKDDATESEVESLQYDKDPKPTVKGIGSVPASLAQPEATCGASEVVTSG
FT                   QKIAVPAASHHFCFSVDLRSVHDLELSFPVNCILRYSYPFFGSAAPIMTNPPVEVRKNM
FT                   EVFLPQSYCAFDFATMPHQLQDTFLRIPLLVELWHKDKMSKDLLLGVARIQLSNILSSE
FT                   KTRFLGANGEQCWRQTYSESVPVIAAQGSNNRILDLSYTMTLEDYGLVKMREIFVSESS
FT                   QGVPAVDQKPSSPPPAPCPSEIQMEPRETLEYKAALELEMWKEMQEDIFESQLKQKELA
FT                   HMQALAEEWKKRDRERESLVKKKVAEYSILEGKLQKALTELETREQQLASAEAELQRER
FT                   KELQLERERNLQELQDSVRRARDDCVYQVELERLKLKQLEEDKQRLQQQLNDAGNKYKT
FT                   LEKEFQQFKDQQNNKPEIRLQSEINLLTLEKVELERKLESATKSKLHYKQQWGRALKEL
FT                   ARLKQREQESQMARLKKQQEELEQMRLRYLAAEEKETVRTEQQELLDIRNELNRYCPYN
FT                   HSFSHQHRSDSQ"
FT   CDS             <16375444..16375737
FT                   /codon_start=1
FT                   /locus_tag="mCG_144599"
FT                   /product="mCG144599"
FT                   /note="gene_id=mCG144599.0 transcript_id=mCT184023.0
FT                   protein_id=mCP106242.0"
FT                   /protein_id="EDL09907.1"
FT                   /translation="LRSSHRLTGWADSEHEASPCLYLPAQGRQSISTRPSTLLRHLDPH
FT                   PGRNVCLAHTVSDRDMFLAPLLYLNKKYTNSKCIGFFTTHGHYHKRLPLLQL"
FT   assembly_gap    16394823..16394842
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            complement(join(16395338..16395725,16398673..16398870,
FT                   16402217..16402365,16406753..16406894,16409588..16409702,
FT                   16411161..16411317,16415391..16415456,16415597..16415673))
FT                   /gene="AU016693"
FT                   /locus_tag="mCG_141305"
FT                   /product="expressed sequence AU016693, transcript variant
FT                   mCT174470"
FT                   /note="gene_id=mCG141305.1 transcript_id=mCT174470.0
FT                   created on 08-OCT-2002"
FT   CDS             complement(join(16395438..16395725,16398673..16398870,
FT                   16402217..16402365,16406753..16406894,16409588..16409702,
FT                   16411161..16411317,16415391..16415439))
FT                   /codon_start=1
FT                   /gene="AU016693"
FT                   /locus_tag="mCG_141305"
FT                   /product="expressed sequence AU016693, isoform CRA_e"
FT                   /note="gene_id=mCG141305.1 transcript_id=mCT174470.0
FT                   protein_id=mCP97388.0 isoform=CRA_e"
FT                   /protein_id="EDL09906.1"
FT                   /translation="MVPKSDQLLIVVSILEGRHFPKRPKHLLVVEAKFDGEQLATDPVD
FT                   HTDQPEFATELAWEIDRKVLHQHRLQRTPIKLQCFALDPQTSAKETVGYIVLDLRTAQE
FT                   TKQAPKWYQLLSNKYTKFKAEVQISLTLETDTKAQVDSYKAKAAPPRDGKVLASLAGVD
FT                   PKDIVAVLNEEGGYHQIGPAEHCTDPFILSVTIAFATQLEQLIPCTMKLPERQPEFFFY
FT                   YSLLGNDVTNEPFSDLINPNFEPERASVRIRSSVEILRVYLALHSKLQIHLCCGDQSLG
FT                   STEIPLNGLLKKGSTEINQHPVTVEGAFTLDPPNRAKQKLAPVPLDLAPTVGVSVALQR
FT                   EGIDSQAGGDSAFTCQFSHARDDKR"
FT   assembly_gap    16447815..16447876
FT                   /estimated_length=62
FT                   /gap_type="unknown"
FT   assembly_gap    16476032..16476051
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16499849..16499868
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16503099..16503118
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16509945..16510378
FT                   /estimated_length=434
FT                   /gap_type="unknown"
FT   assembly_gap    16526477..16526707
FT                   /estimated_length=231
FT                   /gap_type="unknown"
FT   assembly_gap    16534977..16534996
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16536048..16536067
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16554715..16554864
FT                   /estimated_length=150
FT                   /gap_type="unknown"
FT   gene            16555409..16615394
FT                   /gene="Csnk1g3"
FT                   /locus_tag="mCG_8359"
FT                   /note="gene_id=mCG8359.1"
FT   mRNA            join(16555409..16555813,16562712..16562752,
FT                   16566455..16566524,16576870..16577018,16578775..16579009,
FT                   16589927..16590012,16590136..16590220,16592049..16592197,
FT                   16593309..16593404,16596712..16596807,16607908..16608014,
FT                   16608505..16608528,16613106..16615394)
FT                   /gene="Csnk1g3"
FT                   /locus_tag="mCG_8359"
FT                   /product="casein kinase 1, gamma 3, transcript variant
FT                   mCT174170"
FT                   /note="gene_id=mCG8359.1 transcript_id=mCT174170.0 created
FT                   on 08-OCT-2002"
FT   mRNA            join(16555546..16555813,16562712..16562752,
FT                   16566455..16566524,16576870..16577018,16578775..16579009,
FT                   16589927..16590012,16590136..16590220,16592049..16592197,
FT                   16593309..16593404,16607908..16608014,16608505..16608528,
FT                   16613106..16615394)
FT                   /gene="Csnk1g3"
FT                   /locus_tag="mCG_8359"
FT                   /product="casein kinase 1, gamma 3, transcript variant
FT                   mCT7429"
FT                   /note="gene_id=mCG8359.1 transcript_id=mCT7429.2 created on
FT                   08-OCT-2002"
FT   mRNA            join(16555546..16555813,16562712..16562752,
FT                   16566455..16566524,16576870..16577018,16578775..16579009,
FT                   16589927..16590012,16590136..16590220,16592049..16592197,
FT                   16593309..16593404,16607908..16608014,16613106..16615394)
FT                   /gene="Csnk1g3"
FT                   /locus_tag="mCG_8359"
FT                   /product="casein kinase 1, gamma 3, transcript variant
FT                   mCT174171"
FT                   /note="gene_id=mCG8359.1 transcript_id=mCT174171.0 created
FT                   on 08-OCT-2002"
FT   CDS             join(16555636..16555813,16562712..16562752,
FT                   16566455..16566524,16576870..16577018,16578775..16579009,
FT                   16589927..16590012,16590136..16590220,16592049..16592197,
FT                   16593309..16593404,16596712..16596807,16607908..16608014,
FT                   16608505..16608528,16613106..16613160)
FT                   /codon_start=1
FT                   /gene="Csnk1g3"
FT                   /locus_tag="mCG_8359"
FT                   /product="casein kinase 1, gamma 3, isoform CRA_a"
FT                   /note="gene_id=mCG8359.1 transcript_id=mCT174170.0
FT                   protein_id=mCP97090.0 isoform=CRA_a"
FT                   /protein_id="EDL09899.1"
FT                   /translation="MDNKKKDKDKSDDRMARPSGRSGHSTRGTGSSSSGVLMVGPNFRV
FT                   GKKIGCGNFGELRLGKNLYTNEYVAIKLEPMKSRAPQLHLEYRFYKQLGSGDGIPQVYY
FT                   FGPCGKYNAMVLELLGPSLEDLFDLCDRTFSLKTVLMIAIQLISRMEYVHSKNLIYRDV
FT                   KPENFLIGRPGNKAQQVIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHL
FT                   GKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCENFP
FT                   EEMATYLRYVRRLDFFEKPDYDYLRKLFTDLFDRKGYMFDYEYDWIGKQLPTPVGAVQQ
FT                   DPALSSNREAHQHRDKIQQSKNQSADHRAAWDSQQANPHHLRAHLAADRHGGSVQVVSS
FT                   TNGELNTDDPTAGRSNAPITAPTEVEVMDETNCQKVLNMWCCCFFKRRKRKTIQRHK"
FT   CDS             join(16555636..16555813,16562712..16562752,
FT                   16566455..16566524,16576870..16577018,16578775..16579009,
FT                   16589927..16590012,16590136..16590220,16592049..16592197,
FT                   16593309..16593404,16607908..16608014,16608505..16608528,
FT                   16613106..16613160)
FT                   /codon_start=1
FT                   /gene="Csnk1g3"
FT                   /locus_tag="mCG_8359"
FT                   /product="casein kinase 1, gamma 3, isoform CRA_b"
FT                   /note="gene_id=mCG8359.1 transcript_id=mCT7429.2
FT                   protein_id=mCP21503.2 isoform=CRA_b"
FT                   /protein_id="EDL09900.1"
FT                   /translation="MDNKKKDKDKSDDRMARPSGRSGHSTRGTGSSSSGVLMVGPNFRV
FT                   GKKIGCGNFGELRLGKNLYTNEYVAIKLEPMKSRAPQLHLEYRFYKQLGSGDGIPQVYY
FT                   FGPCGKYNAMVLELLGPSLEDLFDLCDRTFSLKTVLMIAIQLISRMEYVHSKNLIYRDV
FT                   KPENFLIGRPGNKAQQVIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHL
FT                   GKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCENFP
FT                   EEMATYLRYVRRLDFFEKPDYDYLRKLFTDLFDRKGYMFDYEYDWIGKQLPTPVGAVQQ
FT                   DPALSSNREAHQHRDKIQQSKNQVVSSTNGELNTDDPTAGRSNAPITAPTEVEVMDETN
FT                   CQKVLNMWCCCFFKRRKRKTIQRHK"
FT   CDS             join(16555636..16555813,16562712..16562752,
FT                   16566455..16566524,16576870..16577018,16578775..16579009,
FT                   16589927..16590012,16590136..16590220,16592049..16592197,
FT                   16593309..16593404,16607908..16608014,16613106..16613160)
FT                   /codon_start=1
FT                   /gene="Csnk1g3"
FT                   /locus_tag="mCG_8359"
FT                   /product="casein kinase 1, gamma 3, isoform CRA_c"
FT                   /note="gene_id=mCG8359.1 transcript_id=mCT174171.0
FT                   protein_id=mCP97089.0 isoform=CRA_c"
FT                   /protein_id="EDL09901.1"
FT                   /translation="MDNKKKDKDKSDDRMARPSGRSGHSTRGTGSSSSGVLMVGPNFRV
FT                   GKKIGCGNFGELRLGKNLYTNEYVAIKLEPMKSRAPQLHLEYRFYKQLGSGDGIPQVYY
FT                   FGPCGKYNAMVLELLGPSLEDLFDLCDRTFSLKTVLMIAIQLISRMEYVHSKNLIYRDV
FT                   KPENFLIGRPGNKAQQVIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHL
FT                   GKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCENFP
FT                   EEMATYLRYVRRLDFFEKPDYDYLRKLFTDLFDRKGYMFDYEYDWIGKQLPTPVGAVQQ
FT                   DPALSSNREAHQHRDKIQQSKNQVVSSTNGELNTDDPTAGRSNAPITAPTEVEVMDETK
FT                   CCCFFKRRKRKTIQRHK"
FT   assembly_gap    16569341..16569423
FT                   /estimated_length=83
FT                   /gap_type="unknown"
FT   assembly_gap    16577224..16577243
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16582099..16582150
FT                   /estimated_length=52
FT                   /gap_type="unknown"
FT   assembly_gap    16634741..16634760
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            16644123..16645241
FT                   /pseudo
FT                   /locus_tag="mCG_8357"
FT                   /note="gene_id=mCG8357.1"
FT   mRNA            16644123..16645241
FT                   /pseudo
FT                   /locus_tag="mCG_8357"
FT                   /note="gene_id=mCG8357.1 transcript_id=mCT7427.1 created on
FT                   08-OCT-2002"
FT   assembly_gap    16644690..16644709
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16649348..16649367
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16650557..16650923
FT                   /estimated_length=367
FT                   /gap_type="unknown"
FT   assembly_gap    16654007..16654026
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16677085..16677104
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(16690357..16691541)
FT                   /pseudo
FT                   /locus_tag="mCG_8353"
FT                   /note="gene_id=mCG8353.2"
FT   mRNA            complement(join(16690357..16690469,16690539..16690841,
FT                   16690876..16691541))
FT                   /pseudo
FT                   /locus_tag="mCG_8353"
FT                   /note="gene_id=mCG8353.2 transcript_id=mCT7428.2 created on
FT                   22-OCT-2002"
FT   assembly_gap    16719202..16721528
FT                   /estimated_length=2327
FT                   /gap_type="unknown"
FT   assembly_gap    16724906..16726056
FT                   /estimated_length=1151
FT                   /gap_type="unknown"
FT   assembly_gap    16758192..16758211
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16818934..16818953
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16833654..16834014
FT                   /estimated_length=361
FT                   /gap_type="unknown"
FT   assembly_gap    16875525..16875618
FT                   /estimated_length=94
FT                   /gap_type="unknown"
FT   assembly_gap    16886389..16886408
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16887828..16887847
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16889760..16889779
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16908685..16908780
FT                   /estimated_length=96
FT                   /gap_type="unknown"
FT   assembly_gap    16918023..16918159
FT                   /estimated_length=137
FT                   /gap_type="unknown"
FT   assembly_gap    16945676..16945695
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16946962..16946981
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16948383..16948402
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16949141..16951334
FT                   /estimated_length=2194
FT                   /gap_type="unknown"
FT   assembly_gap    16952905..16953283
FT                   /estimated_length=379
FT                   /gap_type="unknown"
FT   assembly_gap    16983956..16983975
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16985674..16985693
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16986855..16986874
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17010208..17011861
FT                   /estimated_length=1654
FT                   /gap_type="unknown"
FT   assembly_gap    17018143..17018162
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17031970..17032023
FT                   /estimated_length=54
FT                   /gap_type="unknown"
FT   assembly_gap    17061647..17062844
FT                   /estimated_length=1198
FT                   /gap_type="unknown"
FT   assembly_gap    17070987..17071006
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            17071549..>17072082
FT                   /locus_tag="mCG_1033306"
FT                   /note="gene_id=mCG1033306.1"
FT   mRNA            17071549..>17072082
FT                   /locus_tag="mCG_1033306"
FT                   /product="mCG1033306"
FT                   /note="gene_id=mCG1033306.1 transcript_id=mCT151010.1
FT                   created on 17-OCT-2002"
FT   CDS             17071591..>17072082
FT                   /codon_start=1
FT                   /locus_tag="mCG_1033306"
FT                   /product="mCG1033306"
FT                   /note="gene_id=mCG1033306.1 transcript_id=mCT151010.1
FT                   protein_id=mCP77502.1"
FT                   /protein_id="EDL09898.1"
FT                   /translation="MLRLPTVLRQMRPVSRALAPHLTRAYAKDVKFGADARALMLQGVD
FT                   LLADAVAVTMGPKGRTVIIEQSWGSPKVTKDGVTVAKSIDLKDKYKNIGAKLVQDVANN
FT                   TNEEAGDGTTTATVLARSIAKEGFEKISKGANPVEIRRGVMLAVDAVIAELKKQSKPVT
FT                   T"
FT   assembly_gap    17072083..17073504
FT                   /estimated_length=1422
FT                   /gap_type="unknown"
FT   assembly_gap    17077290..17077309
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <17077910..17108462
FT                   /locus_tag="mCG_145140"
FT                   /note="gene_id=mCG145140.0"
FT   mRNA            join(<17077910..17078177,17105310..17105416,
FT                   17107062..17108462)
FT                   /locus_tag="mCG_145140"
FT                   /product="mCG145140"
FT                   /note="gene_id=mCG145140.0 transcript_id=mCT184564.0
FT                   created on 05-JUN-2003"
FT   assembly_gap    17094185..17094421
FT                   /estimated_length=237
FT                   /gap_type="unknown"
FT   assembly_gap    17096697..17096716
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(<17105348..17105416,17107062..17107259)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145140"
FT                   /product="mCG145140"
FT                   /note="gene_id=mCG145140.0 transcript_id=mCT184564.0
FT                   protein_id=mCP106252.0"
FT                   /protein_id="EDL09897.1"
FT                   /translation="AFGLSWEDPERMTWPEDCPILHEEGRMSLTLHPECQLHFHPVLKK
FT                   YHAHPDSPGQTNTVETHWMHSEGSLIMKNEMPSSICRKMLRVP"
FT   assembly_gap    17144863..17145354
FT                   /estimated_length=492
FT                   /gap_type="unknown"
FT   gene            complement(17150383..17152280)
FT                   /locus_tag="mCG_147294"
FT                   /note="gene_id=mCG147294.0"
FT   mRNA            complement(join(17150383..17151342,17151918..17152280))
FT                   /locus_tag="mCG_147294"
FT                   /product="mCG147294"
FT                   /note="gene_id=mCG147294.0 transcript_id=mCT187557.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(17151090..17151212)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147294"
FT                   /product="mCG147294"
FT                   /note="gene_id=mCG147294.0 transcript_id=mCT187557.0
FT                   protein_id=mCP109681.0"
FT                   /protein_id="EDL09896.1"
FT                   /translation="MGDAKMETLSLEKIRWDLISYIWNIFMIRVDFRWDILGSH"
FT   assembly_gap    17155041..17155196
FT                   /estimated_length=156
FT                   /gap_type="unknown"
FT   assembly_gap    17160627..17160646
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17172190..17172490
FT                   /estimated_length=301
FT                   /gap_type="unknown"
FT   assembly_gap    17187855..17188114
FT                   /estimated_length=260
FT                   /gap_type="unknown"
FT   assembly_gap    17200047..17201624
FT                   /estimated_length=1578
FT                   /gap_type="unknown"
FT   assembly_gap    17246243..17246322
FT                   /estimated_length=80
FT                   /gap_type="unknown"
FT   assembly_gap    17251085..17251104
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17258535..17258571
FT                   /estimated_length=37
FT                   /gap_type="unknown"
FT   assembly_gap    17265885..17266034
FT                   /estimated_length=150
FT                   /gap_type="unknown"
FT   gene            <17267774..17295884
FT                   /locus_tag="mCG_145139"
FT                   /note="gene_id=mCG145139.0"
FT   mRNA            join(<17267774..17267945,17292196..17292587,
FT                   17294608..17295884)
FT                   /locus_tag="mCG_145139"
FT                   /product="mCG145139"
FT                   /note="gene_id=mCG145139.0 transcript_id=mCT184563.0
FT                   created on 05-JUN-2003"
FT   assembly_gap    17268180..17268199
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             <17295275..17295622
FT                   /codon_start=1
FT                   /locus_tag="mCG_145139"
FT                   /product="mCG145139"
FT                   /note="gene_id=mCG145139.0 transcript_id=mCT184563.0
FT                   protein_id=mCP106251.0"
FT                   /protein_id="EDL09895.1"
FT                   /translation="IDRAGCICLVICACVKVCVFITFLMFKKRSTIWKKTDNIGTLDEG
FT                   LTSGSFYQCPCSLIYSGNCPAANLKHIPKCTEKLDQVDFKSCQGQKQQQSQTRIPEETE
FT                   SDLHLSHLCLG"
FT   assembly_gap    17309610..17309629
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17341552..17341571
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17356722..17356933
FT                   /estimated_length=212
FT                   /gap_type="unknown"
FT   assembly_gap    17361330..17361349
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17367531..17367575
FT                   /estimated_length=45
FT                   /gap_type="unknown"
FT   assembly_gap    17391220..17391239
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17395904..17395923
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17409807..17410042
FT                   /estimated_length=236
FT                   /gap_type="unknown"
FT   assembly_gap    17419055..17419074
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17424507..17429322
FT                   /estimated_length=4816
FT                   /gap_type="unknown"
FT   assembly_gap    17432795..17434698
FT                   /estimated_length=1904
FT                   /gap_type="unknown"
FT   assembly_gap    17449284..17450026
FT                   /estimated_length=743
FT                   /gap_type="unknown"
FT   assembly_gap    17489735..17489754
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(17547176..17652321)
FT                   /locus_tag="mCG_8951"
FT                   /note="gene_id=mCG8951.2"
FT   mRNA            complement(join(17547176..17548208,17548941..17549022,
FT                   17550877..17551030,17553554..17553726,17554323..17554740,
FT                   17556268..17558722,17559292..17559379,17606417..17606672,
FT                   17647414..17648509,17652009..17652321))
FT                   /locus_tag="mCG_8951"
FT                   /product="mCG8951, transcript variant mCT171633"
FT                   /note="gene_id=mCG8951.2 transcript_id=mCT171633.0 created
FT                   on 08-OCT-2002"
FT   mRNA            complement(join(17547176..17548208,17548941..17549022,
FT                   17550877..17551030,17553554..17553726,17554323..17554740,
FT                   17556268..17558722,17559292..17559379,17606417..17606672,
FT                   17647414..17648509,17649629..17649981))
FT                   /locus_tag="mCG_8951"
FT                   /product="mCG8951, transcript variant mCT8853"
FT                   /note="gene_id=mCG8951.2 transcript_id=mCT8853.2 created on
FT                   08-OCT-2002"
FT   mRNA            complement(join(17547208..17548208,17548941..17549022,
FT                   17550877..17551030,17553554..17553726,17554323..17554740,
FT                   17556268..17558722,17559292..17559379,17606417..17606672,
FT                   17616357..17616526))
FT                   /locus_tag="mCG_8951"
FT                   /product="mCG8951, transcript variant mCT174172"
FT                   /note="gene_id=mCG8951.2 transcript_id=mCT174172.0 created
FT                   on 08-OCT-2002"
FT   mRNA            complement(join(17547866..17548208,17548941..17549022,
FT                   17550877..17551030,17553554..17553726,17554323..17554740,
FT                   17556268..17558722,17559292..17559379,17647414..17648509,
FT                   17652009..>17652284))
FT                   /locus_tag="mCG_8951"
FT                   /product="mCG8951, transcript variant mCT190292"
FT                   /note="gene_id=mCG8951.2 transcript_id=mCT190292.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(17548202..17548208,17548941..17549022,
FT                   17550877..17551030,17553554..17553726,17554323..17554740,
FT                   17556268..17558722,17559292..17559379,17606417..17606672,
FT                   17647414..17648316))
FT                   /codon_start=1
FT                   /locus_tag="mCG_8951"
FT                   /product="mCG8951, isoform CRA_a"
FT                   /note="gene_id=mCG8951.2 transcript_id=mCT171633.0
FT                   protein_id=mCP94552.0 isoform=CRA_a"
FT                   /db_xref="GOA:B9EKR3"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="MGI:MGI:2442338"
FT                   /db_xref="UniProtKB/TrEMBL:B9EKR3"
FT                   /protein_id="EDL09891.1"
FT                   /translation="MSVNVSTAGKGVDPNTVDTYDSGDDWEIGVGNLIIDLDADLEKDR
FT                   QKFEMNNSTNTTTNTTKDCGGPASNGTCSTSALADGLKFASVQPSAPQGNSHKETSKSK
FT                   VKRAKTSKDANKSLPSAALYGIPEISSTGKRQEVQGRPGEATGMNSALGQSVSGGGSSN
FT                   PNSNGTSTGTSAATAGAGSCGKSKEEKPGKSHSSRGAKRDKDAARSRKEKHDLLQGHQN
FT                   GGGGQAPSGGHLYGFGTKSNGSGASPFHCGGAGSGSVGAAGEVSKTAPDSTLMGNSMLV
FT                   KKEEEEEESHRRIKKLKTEKVDPLFTVPAPPPPIASSLAPQIPPSYFPPSSSNIAAPVE
FT                   QLLVRTRSVGVNTCEVGVVTEPECLGPCEPGTSVNLEGIVWHETEEGVLVVNVTWRNKT
FT                   YVGTLLDCTKHDWAPPRFCESPTSDLEMRGGRGRGKRARSAAAAPGSEVSFTESRGLQS
FT                   KNRGGANGKGRRGSLNASGRRTPPNCAAEDIKASPSSTNKRKNKPPMELDLNSSSEDSK
FT                   PGKRVRTNSRSTPTTPQGKPETTFLDQGCSSPVLIDCPHPNCNKKYKHINGLRYHQAHA
FT                   HLDPENKLEFEPDSEDKISDCEEALSNVALECNESSTSVSSYDQTKAPGSPGAGNPPGT
FT                   PKGKREHVSNGPGPIIGSKTGKNSGKKRGLNNELNNLPVISNMTAALDICSATDSNLTA
FT                   EMPKLEAEGLIDKKSLGDKEKGKKANNCKMDKNLSKLKSARPIAPAPAPTPPQLIAIPT
FT                   AAFTSTTTGTIPGLPSLTTTVVQATPKSPPLKPIQPKPTIMGEPITVNPALVSLKDRKK
FT                   KEKRKLKDKEGKETGGPKMDAKLGKLEEAKAASKDLSGHFLKDHLGKSEGLANGLSESQ
FT                   ESRMASIKAEADKVYTFTDNAPSPSIGSASRMECSTLVNGQAPMAPLHVLTQNGAESAA
FT                   AKTSSPAYSDISDAADDGGSDSRSEGMRSKASSPSDTFSNKDGVVKGHPSTSAQPSQLK
FT                   ESHSPYYHGYEPYYSPSYMHPGQVGAPAAGNGGSTQGMKIKKESEEDAEKKDKAEQLES
FT                   KKVDHTSAPLQPQHQSVITQRHPALAQSLYYGQYAYGLYMDQKSLMATSPAYRQQYEKY
FT                   YEDQRLAEQKMAQSGRGDCERKAELPLKELGKEDNKQKNMPSATISKAPSTPEPNKNHS
FT                   KLGPSVPNKTEETGKSQLLSSHQQQLQADSFKAKQMENHQLIKEAVEMKSVMDSMKQTG
FT                   VDPTSRFKQDPESRTWHHYVYQPKYLDQQKPEELDREKKLKEDSPRKTPNKESGVSSLP
FT                   VSLTNIKEEPKEGKRPDSQSVEENKLKNDDRKTPVNWKDSRGTRVAVSSPMSQHQSYIQ
FT                   YLHAYPYPQMYDPSHPAYRAVSPVLMHSYPGAYLSPGFHYPVYGKMSGREEAEKVNTSP
FT                   SINTKTASEAKALDLLQHHANQYRSKSPAPVEKASTEREREAERERDRHSPFSQRHLHT
FT                   HHHTHVGMGYPLIPGQYDPFQGLTSAALVASQQVAAQASASGMFPAQRRE"
FT   CDS             complement(join(17548202..17548208,17548941..17549022,
FT                   17550877..17551030,17553554..17553726,17554323..17554740,
FT                   17556268..17558722,17559292..17559379,17606417..17606672,
FT                   17647414..17648316))
FT                   /codon_start=1
FT                   /locus_tag="mCG_8951"
FT                   /product="mCG8951, isoform CRA_a"
FT                   /note="gene_id=mCG8951.2 transcript_id=mCT8853.2
FT                   protein_id=mCP21540.2 isoform=CRA_a"
FT                   /db_xref="GOA:B9EKR3"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="MGI:MGI:2442338"
FT                   /db_xref="UniProtKB/TrEMBL:B9EKR3"
FT                   /protein_id="EDL09894.1"
FT                   /translation="MSVNVSTAGKGVDPNTVDTYDSGDDWEIGVGNLIIDLDADLEKDR
FT                   QKFEMNNSTNTTTNTTKDCGGPASNGTCSTSALADGLKFASVQPSAPQGNSHKETSKSK
FT                   VKRAKTSKDANKSLPSAALYGIPEISSTGKRQEVQGRPGEATGMNSALGQSVSGGGSSN
FT                   PNSNGTSTGTSAATAGAGSCGKSKEEKPGKSHSSRGAKRDKDAARSRKEKHDLLQGHQN
FT                   GGGGQAPSGGHLYGFGTKSNGSGASPFHCGGAGSGSVGAAGEVSKTAPDSTLMGNSMLV
FT                   KKEEEEEESHRRIKKLKTEKVDPLFTVPAPPPPIASSLAPQIPPSYFPPSSSNIAAPVE
FT                   QLLVRTRSVGVNTCEVGVVTEPECLGPCEPGTSVNLEGIVWHETEEGVLVVNVTWRNKT
FT                   YVGTLLDCTKHDWAPPRFCESPTSDLEMRGGRGRGKRARSAAAAPGSEVSFTESRGLQS
FT                   KNRGGANGKGRRGSLNASGRRTPPNCAAEDIKASPSSTNKRKNKPPMELDLNSSSEDSK
FT                   PGKRVRTNSRSTPTTPQGKPETTFLDQGCSSPVLIDCPHPNCNKKYKHINGLRYHQAHA
FT                   HLDPENKLEFEPDSEDKISDCEEALSNVALECNESSTSVSSYDQTKAPGSPGAGNPPGT
FT                   PKGKREHVSNGPGPIIGSKTGKNSGKKRGLNNELNNLPVISNMTAALDICSATDSNLTA
FT                   EMPKLEAEGLIDKKSLGDKEKGKKANNCKMDKNLSKLKSARPIAPAPAPTPPQLIAIPT
FT                   AAFTSTTTGTIPGLPSLTTTVVQATPKSPPLKPIQPKPTIMGEPITVNPALVSLKDRKK
FT                   KEKRKLKDKEGKETGGPKMDAKLGKLEEAKAASKDLSGHFLKDHLGKSEGLANGLSESQ
FT                   ESRMASIKAEADKVYTFTDNAPSPSIGSASRMECSTLVNGQAPMAPLHVLTQNGAESAA
FT                   AKTSSPAYSDISDAADDGGSDSRSEGMRSKASSPSDTFSNKDGVVKGHPSTSAQPSQLK
FT                   ESHSPYYHGYEPYYSPSYMHPGQVGAPAAGNGGSTQGMKIKKESEEDAEKKDKAEQLES
FT                   KKVDHTSAPLQPQHQSVITQRHPALAQSLYYGQYAYGLYMDQKSLMATSPAYRQQYEKY
FT                   YEDQRLAEQKMAQSGRGDCERKAELPLKELGKEDNKQKNMPSATISKAPSTPEPNKNHS
FT                   KLGPSVPNKTEETGKSQLLSSHQQQLQADSFKAKQMENHQLIKEAVEMKSVMDSMKQTG
FT                   VDPTSRFKQDPESRTWHHYVYQPKYLDQQKPEELDREKKLKEDSPRKTPNKESGVSSLP
FT                   VSLTNIKEEPKEGKRPDSQSVEENKLKNDDRKTPVNWKDSRGTRVAVSSPMSQHQSYIQ
FT                   YLHAYPYPQMYDPSHPAYRAVSPVLMHSYPGAYLSPGFHYPVYGKMSGREEAEKVNTSP
FT                   SINTKTASEAKALDLLQHHANQYRSKSPAPVEKASTEREREAERERDRHSPFSQRHLHT
FT                   HHHTHVGMGYPLIPGQYDPFQGLTSAALVASQQVAAQASASGMFPAQRRE"
FT   CDS             complement(join(17548202..17548208,17548941..17549022,
FT                   17550877..17551030,17553554..17553726,17554323..17554740,
FT                   17556268..17558722,17559292..17559379,17647414..>17647417))
FT                   /codon_start=1
FT                   /locus_tag="mCG_8951"
FT                   /product="mCG8951, isoform CRA_c"
FT                   /note="gene_id=mCG8951.2 transcript_id=mCT190292.0
FT                   protein_id=mCP111294.0 isoform=CRA_c"
FT                   /protein_id="EDL09893.1"
FT                   /translation="EGVLVVNVTWRNKTYVGTLLDCTKHDWAPPRFCESPTSDLEMRGG
FT                   RGRGKRARSAAAAPGSEVSFTESRGLQSKNRGGANGKGRRGSLNASGRRTPPNCAAEDI
FT                   KASPSSTNKRKNKPPMELDLNSSSEDSKPGKRVRTNSRSTPTTPQGKPETTFLDQGCSS
FT                   PVLIDCPHPNCNKKYKHINGLRYHQAHAHLDPENKLEFEPDSEDKISDCEEALSNVALE
FT                   CNESSTSVSSYDQTKAPGSPGAGNPPGTPKGKREHVSNGPGPIIGSKTGKNSGKKRGLN
FT                   NELNNLPVISNMTAALDICSATDSNLTAEMPKLEAEGLIDKKSLGDKEKGKKANNCKMD
FT                   KNLSKLKSARPIAPAPAPTPPQLIAIPTAAFTSTTTGTIPGLPSLTTTVVQATPKSPPL
FT                   KPIQPKPTIMGEPITVNPALVSLKDRKKKEKRKLKDKEGKETGGPKMDAKLGKLEEAKA
FT                   ASKDLSGHFLKDHLGKSEGLANGLSESQESRMASIKAEADKVYTFTDNAPSPSIGSASR
FT                   MECSTLVNGQAPMAPLHVLTQNGAESAAAKTSSPAYSDISDAADDGGSDSRSEGMRSKA
FT                   SSPSDTFSNKDGVVKGHPSTSAQPSQLKESHSPYYHGYEPYYSPSYMHPGQVGAPAAGN
FT                   GGSTQGMKIKKESEEDAEKKDKAEQLESKKVDHTSAPLQPQHQSVITQRHPALAQSLYY
FT                   GQYAYGLYMDQKSLMATSPAYRQQYEKYYEDQRLAEQKMAQSGRGDCERKAELPLKELG
FT                   KEDNKQKNMPSATISKAPSTPEPNKNHSKLGPSVPNKTEETGKSQLLSSHQQQLQADSF
FT                   KAKQMENHQLIKEAVEMKSVMDSMKQTGVDPTSRFKQDPESRTWHHYVYQPKYLDQQKP
FT                   EELDREKKLKEDSPRKTPNKESGVSSLPVSLTNIKEEPKEGKRPDSQSVEENKLKNDDR
FT                   KTPVNWKDSRGTRVAVSSPMSQHQSYIQYLHAYPYPQMYDPSHPAYRAVSPVLMHSYPG
FT                   AYLSPGFHYPVYGKMSGREEAEKVNTSPSINTKTASEAKALDLLQHHANQYRSKSPAPV
FT                   EKASTEREREAERERDRHSPFSQRHLHTHHHTHVGMGYPLIPGQYDPFQGLTSAALVAS
FT                   QQVAAQASASGMFPAQRRE"
FT   CDS             complement(join(17548202..17548208,17548941..17549022,
FT                   17550877..17551030,17553554..17553726,17554323..17554740,
FT                   17556268..17558691))
FT                   /codon_start=1
FT                   /locus_tag="mCG_8951"
FT                   /product="mCG8951, isoform CRA_b"
FT                   /note="gene_id=mCG8951.2 transcript_id=mCT174172.0
FT                   protein_id=mCP97091.0 isoform=CRA_b"
FT                   /protein_id="EDL09892.1"
FT                   /translation="MRGGRGRGKRARSAAAAPGSEVSFTESRGLQSKNRGGANGKGRRG
FT                   SLNASGRRTPPNCAAEDIKASPSSTNKRKNKPPMELDLNSSSEDSKPGKRVRTNSRSTP
FT                   TTPQGKPETTFLDQGCSSPVLIDCPHPNCNKKYKHINGLRYHQAHAHLDPENKLEFEPD
FT                   SEDKISDCEEALSNVALECNESSTSVSSYDQTKAPGSPGAGNPPGTPKGKREHVSNGPG
FT                   PIIGSKTGKNSGKKRGLNNELNNLPVISNMTAALDICSATDSNLTAEMPKLEAEGLIDK
FT                   KSLGDKEKGKKANNCKMDKNLSKLKSARPIAPAPAPTPPQLIAIPTAAFTSTTTGTIPG
FT                   LPSLTTTVVQATPKSPPLKPIQPKPTIMGEPITVNPALVSLKDRKKKEKRKLKDKEGKE
FT                   TGGPKMDAKLGKLEEAKAASKDLSGHFLKDHLGKSEGLANGLSESQESRMASIKAEADK
FT                   VYTFTDNAPSPSIGSASRMECSTLVNGQAPMAPLHVLTQNGAESAAAKTSSPAYSDISD
FT                   AADDGGSDSRSEGMRSKASSPSDTFSNKDGVVKGHPSTSAQPSQLKESHSPYYHGYEPY
FT                   YSPSYMHPGQVGAPAAGNGGSTQGMKIKKESEEDAEKKDKAEQLESKKVDHTSAPLQPQ
FT                   HQSVITQRHPALAQSLYYGQYAYGLYMDQKSLMATSPAYRQQYEKYYEDQRLAEQKMAQ
FT                   SGRGDCERKAELPLKELGKEDNKQKNMPSATISKAPSTPEPNKNHSKLGPSVPNKTEET
FT                   GKSQLLSSHQQQLQADSFKAKQMENHQLIKEAVEMKSVMDSMKQTGVDPTSRFKQDPES
FT                   RTWHHYVYQPKYLDQQKPEELDREKKLKEDSPRKTPNKESGVSSLPVSLTNIKEEPKEG
FT                   KRPDSQSVEENKLKNDDRKTPVNWKDSRGTRVAVSSPMSQHQSYIQYLHAYPYPQMYDP
FT                   SHPAYRAVSPVLMHSYPGAYLSPGFHYPVYGKMSGREEAEKVNTSPSINTKTASEAKAL
FT                   DLLQHHANQYRSKSPAPVEKASTEREREAERERDRHSPFSQRHLHTHHHTHVGMGYPLI
FT                   PGQYDPFQGLTSAALVASQQVAAQASASGMFPAQRRE"
FT   assembly_gap    17559005..17559024
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17568104..17568254
FT                   /estimated_length=151
FT                   /gap_type="unknown"
FT   assembly_gap    17588106..17588125
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17599445..17599879
FT                   /estimated_length=435
FT                   /gap_type="unknown"
FT   assembly_gap    17602216..17602235
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17612046..17612065
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17640621..17640640
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17649982..17650001
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17651445..17651464
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17653251..17653270
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17664365..17666168
FT                   /estimated_length=1804
FT                   /gap_type="unknown"
FT   assembly_gap    17691031..17691050
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17692884..17692903
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17693936..17693955
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17695111..17695130
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            17720074..17742438
FT                   /locus_tag="mCG_147327"
FT                   /note="gene_id=mCG147327.0"
FT   mRNA            join(17720074..17720125,17739489..17742438)
FT                   /locus_tag="mCG_147327"
FT                   /product="mCG147327"
FT                   /note="gene_id=mCG147327.0 transcript_id=mCT187590.0
FT                   created on 13-JAN-2004"
FT   assembly_gap    17723396..17723415
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17726191..17726851
FT                   /estimated_length=661
FT                   /gap_type="unknown"
FT   assembly_gap    17734386..17735043
FT                   /estimated_length=658
FT                   /gap_type="unknown"
FT   CDS             17739616..17739831
FT                   /codon_start=1
FT                   /locus_tag="mCG_147327"
FT                   /product="mCG147327"
FT                   /note="gene_id=mCG147327.0 transcript_id=mCT187590.0
FT                   protein_id=mCP109716.0"
FT                   /protein_id="EDL09890.1"
FT                   /translation="MVNYMLCLFYHCAILSWFCTWENPVFLKGLKTVSCFILFVCEYTV
FT                   TVFRHTERGHQISLQMVVSYPVVAGN"
FT   assembly_gap    17755779..17755798
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17763336..17763462
FT                   /estimated_length=127
FT                   /gap_type="unknown"
FT   assembly_gap    17793714..17793846
FT                   /estimated_length=133
FT                   /gap_type="unknown"
FT   assembly_gap    17794539..17794700
FT                   /estimated_length=162
FT                   /gap_type="unknown"
FT   assembly_gap    17801229..17801248
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17817849..17817868
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17835083..17835655
FT                   /estimated_length=573
FT                   /gap_type="unknown"
FT   assembly_gap    17844015..17844034
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17852645..17852664
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17861098..17861200
FT                   /estimated_length=103
FT                   /gap_type="unknown"
FT   assembly_gap    17873833..17873852
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17876955..17876974
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17878366..17878385
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17881950..17882368
FT                   /estimated_length=419
FT                   /gap_type="unknown"
FT   assembly_gap    17916525..17916544
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17918544..17918563
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17942876..17942895
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17973645..17973707
FT                   /estimated_length=63
FT                   /gap_type="unknown"
FT   assembly_gap    17978715..17978734
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18039570..18039589
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18058487..18058506
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18071461..18071480
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18081818..18081837
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18087887..18088623
FT                   /estimated_length=737
FT                   /gap_type="unknown"
FT   assembly_gap    18089805..18089954
FT                   /estimated_length=150
FT                   /gap_type="unknown"
FT   assembly_gap    18091747..18091904
FT                   /estimated_length=158
FT                   /gap_type="unknown"
FT   assembly_gap    18107304..18107503
FT                   /estimated_length=200
FT                   /gap_type="unknown"
FT   assembly_gap    18122258..18122277
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18133457..18133476
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18135557..18135600
FT                   /estimated_length=44
FT                   /gap_type="unknown"
FT   assembly_gap    18156741..18156802
FT                   /estimated_length=62
FT                   /gap_type="unknown"
FT   assembly_gap    18171196..18171315
FT                   /estimated_length=120
FT                   /gap_type="unknown"
FT   assembly_gap    18182644..18182768
FT                   /estimated_length=125
FT                   /gap_type="unknown"
FT   assembly_gap    18200189..18200585
FT                   /estimated_length=397
FT                   /gap_type="unknown"
FT   assembly_gap    18201065..18201098
FT                   /estimated_length=34
FT                   /gap_type="unknown"
FT   assembly_gap    18203718..18203737
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18206533..18206763
FT                   /estimated_length=231
FT                   /gap_type="unknown"
FT   assembly_gap    18223059..18225893
FT                   /estimated_length=2835
FT                   /gap_type="unknown"
FT   assembly_gap    18241207..18241365
FT                   /estimated_length=159
FT                   /gap_type="unknown"
FT   assembly_gap    18258489..18258508
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18310976..18311384
FT                   /estimated_length=409
FT                   /gap_type="unknown"
FT   assembly_gap    18345783..18345802
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18351548..18351567
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18448453..18448472
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18450048..18452305
FT                   /estimated_length=2258
FT                   /gap_type="unknown"
FT   assembly_gap    18468661..18468680
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18473918..18473937
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(18492635..18493588)
FT                   /pseudo
FT                   /locus_tag="mCG_124916"
FT                   /note="gene_id=mCG124916.1"
FT   mRNA            complement(18492635..18493588)
FT                   /pseudo
FT                   /locus_tag="mCG_124916"
FT                   /note="gene_id=mCG124916.1 transcript_id=mCT126168.1
FT                   created on 08-OCT-2002"
FT   gene            18496238..18497649
FT                   /pseudo
FT                   /locus_tag="mCG_124917"
FT                   /note="gene_id=mCG124917.1"
FT   mRNA            18496238..18497649
FT                   /pseudo
FT                   /locus_tag="mCG_124917"
FT                   /note="gene_id=mCG124917.1 transcript_id=mCT126169.1
FT                   created on 08-OCT-2002"
FT   assembly_gap    18574696..18574715
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18592070..18592805
FT                   /estimated_length=736
FT                   /gap_type="unknown"
FT   assembly_gap    18600650..18600771
FT                   /estimated_length=122
FT                   /gap_type="unknown"
FT   assembly_gap    18606998..18607017
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18608626..18608645
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18611503..18618342
FT                   /estimated_length=6840
FT                   /gap_type="unknown"
FT   assembly_gap    18630180..18630199
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18634479..18634756
FT                   /estimated_length=278
FT                   /gap_type="unknown"
FT   gene            18640080..18641100
FT                   /pseudo
FT                   /locus_tag="mCG_5422"
FT                   /note="gene_id=mCG5422.2"
FT   mRNA            18640080..18641100
FT                   /pseudo
FT                   /locus_tag="mCG_5422"
FT                   /note="gene_id=mCG5422.2 transcript_id=mCT4719.2 created on
FT                   08-OCT-2002"
FT   assembly_gap    18665158..18665177
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18666605..18666624
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18667769..18667788
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18669181..18669200
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18670266..18670285
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18716626..18716645
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18724616..18724635
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18726201..18726220
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18754173..18757097
FT                   /estimated_length=2925
FT                   /gap_type="unknown"
FT   assembly_gap    18767521..18767932
FT                   /estimated_length=412
FT                   /gap_type="unknown"
FT   assembly_gap    18770429..18770456
FT                   /estimated_length=28
FT                   /gap_type="unknown"
FT   assembly_gap    18789380..18789703
FT                   /estimated_length=324
FT                   /gap_type="unknown"
FT   assembly_gap    18813215..18813530
FT                   /estimated_length=316
FT                   /gap_type="unknown"
FT   assembly_gap    18817306..18817366
FT                   /estimated_length=61
FT                   /gap_type="unknown"
FT   assembly_gap    18827265..18828247
FT                   /estimated_length=983
FT                   /gap_type="unknown"
FT   assembly_gap    18833391..18833410
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18834604..18834623
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18836293..18836312
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18837866..18837885
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18839636..18839655
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18840700..18842242
FT                   /estimated_length=1543
FT                   /gap_type="unknown"
FT   assembly_gap    18844576..18844595
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18848176..18848400
FT                   /estimated_length=225
FT                   /gap_type="unknown"
FT   assembly_gap    18851921..18851940
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18856529..18856548
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18858363..18861488
FT                   /estimated_length=3126
FT                   /gap_type="unknown"
FT   assembly_gap    18889388..18889407
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18895385..18895448
FT                   /estimated_length=64
FT                   /gap_type="unknown"
FT   assembly_gap    18924953..18925042
FT                   /estimated_length=90
FT                   /gap_type="unknown"
FT   assembly_gap    18931148..18931210
FT                   /estimated_length=63
FT                   /gap_type="unknown"
FT   assembly_gap    18932714..18932812
FT                   /estimated_length=99
FT                   /gap_type="unknown"
FT   assembly_gap    18934519..18935486
FT                   /estimated_length=968
FT                   /gap_type="unknown"
FT   assembly_gap    18966550..18966569
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18975787..18975806
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18987950..18988145
FT                   /estimated_length=196
FT                   /gap_type="unknown"
FT   assembly_gap    19018109..19018128
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19019250..19019269
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19021048..19021067
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19027039..19027058
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19031968..19032160
FT                   /estimated_length=193
FT                   /gap_type="unknown"
FT   assembly_gap    19033380..19033399
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19037359..19037647
FT                   /estimated_length=289
FT                   /gap_type="unknown"
FT   assembly_gap    19038705..19038724
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19059568..19059595
FT                   /estimated_length=28
FT                   /gap_type="unknown"
FT   assembly_gap    19061613..19061832
FT                   /estimated_length=220
FT                   /gap_type="unknown"
FT   gene            19062512..19063051
FT                   /pseudo
FT                   /locus_tag="mCG_1033362"
FT                   /note="gene_id=mCG1033362.1"
FT   mRNA            19062512..19063051
FT                   /pseudo
FT                   /locus_tag="mCG_1033362"
FT                   /note="gene_id=mCG1033362.1 transcript_id=mCT151066.1
FT                   created on 10-MAR-2003"
FT   gene            19074654..19181365
FT                   /gene="Gramd3"
FT                   /locus_tag="mCG_16293"
FT                   /note="gene_id=mCG16293.1"
FT   mRNA            join(19074654..19074896,19106444..19106682,
FT                   19143849..19143968,19148335..19148446,19150919..19150985,
FT                   19153165..19153268,19156939..19157034,19162735..19162806,
FT                   19162899..19162979,19166274..19166385,19167138..19167260,
FT                   19168194..19168281,19169451..19169555,19174892..19174985,
FT                   19180157..19181365)
FT                   /gene="Gramd3"
FT                   /locus_tag="mCG_16293"
FT                   /product="GRAM domain containing 3, transcript variant
FT                   mCT17034"
FT                   /note="gene_id=mCG16293.1 transcript_id=mCT17034.2 created
FT                   on 08-OCT-2002"
FT   mRNA            join(19074654..19074896,19143849..19143968,
FT                   19148335..19148446,19150919..19150985,19153165..19153268,
FT                   19156939..19157034,19162735..19162806,19162899..19162979,
FT                   19166274..19166385,19167138..19167260,19168194..19168281,
FT                   19169451..19169555,19174892..19174985,19180157..19181365)
FT                   /gene="Gramd3"
FT                   /locus_tag="mCG_16293"
FT                   /product="GRAM domain containing 3, transcript variant
FT                   mCT174115"
FT                   /note="gene_id=mCG16293.1 transcript_id=mCT174115.0 created
FT                   on 08-OCT-2002"
FT   CDS             join(19074775..19074896,19143849..19143968,
FT                   19148335..19148446,19150919..19150985,19153165..19153268,
FT                   19156939..19157034,19162735..19162806,19162899..19162979,
FT                   19166274..19166385,19167138..19167260,19168194..19168281,
FT                   19169451..19169555,19174892..19174985,19180157..19180198)
FT                   /codon_start=1
FT                   /gene="Gramd3"
FT                   /locus_tag="mCG_16293"
FT                   /product="GRAM domain containing 3, isoform CRA_d"
FT                   /note="gene_id=mCG16293.1 transcript_id=mCT174115.0
FT                   protein_id=mCP97035.0 isoform=CRA_d"
FT                   /protein_id="EDL09888.1"
FT                   /translation="MVKKRLSSSDNVFKFEIPSNSKTSAEAPHSSTDSPSSVFLSSEAE
FT                   NGAEDRRRVSKSPTAQSPTSSVEAESPDQKRSLGLWSKSSFDGSSLLSDKNDCKTESKT
FT                   DSKTERKKSSSSSQYKANMHFHKLFLDVPTEEPLRQSFTCALQKEILYQGKLFVSENWI
FT                   CFHSKVFGKDTKISIPAFSVTLIKKTKTALLVPNALIIATVTDRYIFVSLLSRDSTYKL
FT                   IKSVCGHLEKTSVGNSPNPSSAENSFRADRPSSLPLDFNDEFSDLDGVVRQRRQDLEGY
FT                   SSSGSQTPESENSRDFHVTESQTVLNVTKGETKPPRTDAHGSRAPDGKAKILPAHGQSE
FT                   TIGILHKMESRKCPTLHHILIVYAIIVCALIISTFYMRYRINTLEERLGTLTSIMDPHS
FT                   TEQTAPSGLGSQMQLNVEVLCQELTANIVKLEKIQNNLQKLLENGD"
FT   CDS             join(19074806..19074896,19106444..19106682,
FT                   19143849..19143860)
FT                   /codon_start=1
FT                   /gene="Gramd3"
FT                   /locus_tag="mCG_16293"
FT                   /product="GRAM domain containing 3, isoform CRA_a"
FT                   /note="gene_id=mCG16293.1 transcript_id=mCT17034.2
FT                   protein_id=mCP21476.1 isoform=CRA_a"
FT                   /protein_id="EDL09885.1"
FT                   /translation="MCSSSRSPATRRPVLRPHTAPLTAQAPCFSAQLGPIAPAPTCPCW
FT                   RPGSTAAWMRSARVPESWEPGAPNREPSAGVRPGRGPDDRAPARGGGRQASQSAHQERR
FT                   QSWPGPLRG"
FT   assembly_gap    19086463..19086482
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            join(<19093492..19093649,19143849..19143968,
FT                   19148335..19148446,19150919..19150985,19153165..19153268,
FT                   19156939..19157034,19162735..19162806,19162899..19162979,
FT                   19166274..19166385,19167138..19167260,19168194..19168281,
FT                   19169451..19169555,19174892..19174985,19180157..19181365)
FT                   /gene="Gramd3"
FT                   /locus_tag="mCG_16293"
FT                   /product="GRAM domain containing 3, transcript variant
FT                   mCT174114"
FT                   /note="gene_id=mCG16293.1 transcript_id=mCT174114.0 created
FT                   on 08-OCT-2002"
FT   CDS             join(<19093618..19093649,19143849..19143968,
FT                   19148335..19148446,19150919..19150985,19153165..19153268,
FT                   19156939..19157034,19162735..19162806,19162899..19162979,
FT                   19166274..19166385,19167138..19167260,19168194..19168281,
FT                   19169451..19169555,19174892..19174985,19180157..19180198)
FT                   /codon_start=1
FT                   /gene="Gramd3"
FT                   /locus_tag="mCG_16293"
FT                   /product="GRAM domain containing 3, isoform CRA_b"
FT                   /note="gene_id=mCG16293.1 transcript_id=mCT174114.0
FT                   protein_id=mCP97034.0 isoform=CRA_b"
FT                   /protein_id="EDL09886.1"
FT                   /translation="DIEILRIETESSEAENGAEDRRRVSKSPTAQSPTSSVEAESPDQK
FT                   RSLGLWSKSSFDGSSLLSDKNDCKTESKTDSKTERKKSSSSSQYKANMHFHKLFLDVPT
FT                   EEPLRQSFTCALQKEILYQGKLFVSENWICFHSKVFGKDTKISIPAFSVTLIKKTKTAL
FT                   LVPNALIIATVTDRYIFVSLLSRDSTYKLIKSVCGHLEKTSVGNSPNPSSAENSFRADR
FT                   PSSLPLDFNDEFSDLDGVVRQRRQDLEGYSSSGSQTPESENSRDFHVTESQTVLNVTKG
FT                   ETKPPRTDAHGSRAPDGKAKILPAHGQSETIGILHKMESRKCPTLHHILIVYAIIVCAL
FT                   IISTFYMRYRINTLEERLGTLTSIMDPHSTEQTAPSGLGSQMQLNVEVLCQELTANIVK
FT                   LEKIQNNLQKLLENGD"
FT   mRNA            join(19106518..19106587,19106609..19106682,
FT                   19143849..19143927,19148335..19148446,19150919..19150985,
FT                   19153165..19153268,19156939..19157034,19162735..19162806,
FT                   19162899..19162979,19166274..19166385,19167138..19167260,
FT                   19168194..19168281,19169451..19169555,19174892..19174985,
FT                   19180157..19181365)
FT                   /gene="Gramd3"
FT                   /locus_tag="mCG_16293"
FT                   /product="GRAM domain containing 3, transcript variant
FT                   mCT174117"
FT                   /note="gene_id=mCG16293.1 transcript_id=mCT174117.0 created
FT                   on 08-OCT-2002"
FT   assembly_gap    19111442..19111461
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            join(19143582..19143968,19148335..19148446,
FT                   19150919..19150985,19153165..19153268,19156939..19157034,
FT                   19162735..19162806,19162899..19162979,19166274..19166385,
FT                   19167138..19167260,19168194..19168281,19169451..19169555,
FT                   19174892..19174985,19180157..19181365)
FT                   /gene="Gramd3"
FT                   /locus_tag="mCG_16293"
FT                   /product="GRAM domain containing 3, transcript variant
FT                   mCT174116"
FT                   /note="gene_id=mCG16293.1 transcript_id=mCT174116.0 created
FT                   on 08-OCT-2002"
FT   CDS             join(19143748..19143968,19148335..19148446,
FT                   19150919..19150985,19153165..19153268,19156939..19157034,
FT                   19162735..19162806,19162899..19162979,19166274..19166385,
FT                   19167138..19167260,19168194..19168281,19169451..19169555,
FT                   19174892..19174985,19180157..19180198)
FT                   /codon_start=1
FT                   /gene="Gramd3"
FT                   /locus_tag="mCG_16293"
FT                   /product="GRAM domain containing 3, isoform CRA_c"
FT                   /note="gene_id=mCG16293.1 transcript_id=mCT174116.0
FT                   protein_id=mCP97036.0 isoform=CRA_c"
FT                   /protein_id="EDL09887.1"
FT                   /translation="MKIISLSRTQDHFLFSLSTSPWMSKVKRFSLFSSSEAENGAEDRR
FT                   RVSKSPTAQSPTSSVEAESPDQKRSLGLWSKSSFDGSSLLSDKNDCKTESKTDSKTERK
FT                   KSSSSSQYKANMHFHKLFLDVPTEEPLRQSFTCALQKEILYQGKLFVSENWICFHSKVF
FT                   GKDTKISIPAFSVTLIKKTKTALLVPNALIIATVTDRYIFVSLLSRDSTYKLIKSVCGH
FT                   LEKTSVGNSPNPSSAENSFRADRPSSLPLDFNDEFSDLDGVVRQRRQDLEGYSSSGSQT
FT                   PESENSRDFHVTESQTVLNVTKGETKPPRTDAHGSRAPDGKAKILPAHGQSETIGILHK
FT                   MESRKCPTLHHILIVYAIIVCALIISTFYMRYRINTLEERLGTLTSIMDPHSTEQTAPS
FT                   GLGSQMQLNVEVLCQELTANIVKLEKIQNNLQKLLENGD"
FT   CDS             join(19143863..19143927,19148335..19148446,
FT                   19150919..19150985,19153165..19153268,19156939..19157034,
FT                   19162735..19162806,19162899..19162979,19166274..19166385,
FT                   19167138..19167260,19168194..19168281,19169451..19169555,
FT                   19174892..19174985,19180157..19180198)
FT                   /codon_start=1
FT                   /gene="Gramd3"
FT                   /locus_tag="mCG_16293"
FT                   /product="GRAM domain containing 3, isoform CRA_e"
FT                   /note="gene_id=mCG16293.1 transcript_id=mCT174117.0
FT                   protein_id=mCP97033.0 isoform=CRA_e"
FT                   /protein_id="EDL09889.1"
FT                   /translation="MVRRTEGGSASRQQPNLLPHLWSKSSFDGSSLLSDKNDCKTESKT
FT                   DSKTERKKSSSSSQYKANMHFHKLFLDVPTEEPLRQSFTCALQKEILYQGKLFVSENWI
FT                   CFHSKVFGKDTKISIPAFSVTLIKKTKTALLVPNALIIATVTDRYIFVSLLSRDSTYKL
FT                   IKSVCGHLEKTSVGNSPNPSSAENSFRADRPSSLPLDFNDEFSDLDGVVRQRRQDLEGY
FT                   SSSGSQTPESENSRDFHVTESQTVLNVTKGETKPPRTDAHGSRAPDGKAKILPAHGQSE
FT                   TIGILHKMESRKCPTLHHILIVYAIIVCALIISTFYMRYRINTLEERLGTLTSIMDPHS
FT                   TEQTAPSGLGSQMQLNVEVLCQELTANIVKLEKIQNNLQKLLENGD"
FT   assembly_gap    19157700..19157719
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19159111..19159130
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19160682..19160701
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(19181831..19244822)
FT                   /gene="Aldh7a1"
FT                   /locus_tag="mCG_16296"
FT                   /note="gene_id=mCG16296.2"
FT   mRNA            complement(join(19181831..19181852,19196809..19197077,
FT                   19198298..19198373,19201478..19201551,19201699..19201796,
FT                   19201969..19202085,19202476..19202582,19204178..19204262,
FT                   19207177..19207271,19208620..19208661,19212036..19212135,
FT                   19214782..19214859,19216721..19216765,19218269..19218401,
FT                   19220119..19220242,19220984..19221064,19229028..19229093,
FT                   19230584..19230637,19231842..19232013,19232294..19232486,
FT                   19244756..19244784))
FT                   /gene="Aldh7a1"
FT                   /locus_tag="mCG_16296"
FT                   /product="aldehyde dehydrogenase family 7, member A1,
FT                   transcript variant mCT174120"
FT                   /note="gene_id=mCG16296.2 transcript_id=mCT174120.0 created
FT                   on 08-OCT-2002"
FT   assembly_gap    19185485..19185702
FT                   /estimated_length=218
FT                   /gap_type="unknown"
FT   assembly_gap    19188595..19195143
FT                   /estimated_length=6549
FT                   /gap_type="unknown"
FT   mRNA            complement(join(19195145..19197077,19198298..19198373,
FT                   19201478..19201551,19201699..19201754,19220198..19220242,
FT                   19220984..19221064,19229028..19229093,19230584..19230637,
FT                   19231842..19232013,19232294..19232486,19244756..19244822))
FT                   /gene="Aldh7a1"
FT                   /locus_tag="mCG_16296"
FT                   /product="aldehyde dehydrogenase family 7, member A1,
FT                   transcript variant mCT174119"
FT                   /note="gene_id=mCG16296.2 transcript_id=mCT174119.0 created
FT                   on 08-OCT-2002"
FT   mRNA            complement(join(19195145..19197077,19198298..19198373,
FT                   19201478..19201551,19201699..19201796,19201969..19202085,
FT                   19202476..19202582,19204178..19204262,19207177..19207271,
FT                   19208620..19208661,19212036..19212135,19214782..19214859,
FT                   19216721..19216765,19218269..19218401,19220119..19220242,
FT                   19220984..19221064,19229028..19229093,19230584..19230637,
FT                   19231842..19232013,19232294..19232486,19244756..19244822))
FT                   /gene="Aldh7a1"
FT                   /locus_tag="mCG_16296"
FT                   /product="aldehyde dehydrogenase family 7, member A1,
FT                   transcript variant mCT17037"
FT                   /note="gene_id=mCG16296.2 transcript_id=mCT17037.2 created
FT                   on 08-OCT-2002"
FT   mRNA            complement(join(19195145..19197077,19198298..19198373,
FT                   19201478..19201551,19201699..19201796,19201969..19202085,
FT                   19202476..19202582,19204178..19204262,19207177..19207271,
FT                   19208620..19208661,19212036..19212135,19214782..19214859,
FT                   19216721..19216765,19218269..19218401,19220119..19220242,
FT                   19220984..19221064,19229028..19229093,19230584..19230637,
FT                   19231842..19232119))
FT                   /gene="Aldh7a1"
FT                   /locus_tag="mCG_16296"
FT                   /product="aldehyde dehydrogenase family 7, member A1,
FT                   transcript variant mCT174118"
FT                   /note="gene_id=mCG16296.2 transcript_id=mCT174118.0 created
FT                   on 08-OCT-2002"
FT   mRNA            complement(join(19196815..19196872,19201755..19201796,
FT                   19201969..19202085,19202476..19202582,19204178..19204262,
FT                   19207177..19207271,19208620..19208661,19212036..19212135,
FT                   19214782..19214859,19216721..19216765,19218269..19218401,
FT                   19220119..19220242,19220984..19221064,19229028..19229093,
FT                   19230584..19230637,19231842..19232013,19232294..19232486,
FT                   19244756..19244784))
FT                   /gene="Aldh7a1"
FT                   /locus_tag="mCG_16296"
FT                   /product="aldehyde dehydrogenase family 7, member A1,
FT                   transcript variant mCT174121"
FT                   /note="gene_id=mCG16296.2 transcript_id=mCT174121.0 created
FT                   on 08-OCT-2002"
FT   mRNA            complement(join(19196845..19196973,19212032..19212135,
FT                   19214782..19214859,19216721..19216765,19218269..19218401,
FT                   19220119..19220242,19220984..19221064,19229028..19229093,
FT                   19230584..19230637,19231842..19232013,19232294..19232486,
FT                   19244756..19244784))
FT                   /gene="Aldh7a1"
FT                   /locus_tag="mCG_16296"
FT                   /product="aldehyde dehydrogenase family 7, member A1,
FT                   transcript variant mCT174123"
FT                   /note="gene_id=mCG16296.2 transcript_id=mCT174123.0 created
FT                   on 08-OCT-2002"
FT   CDS             complement(join(19196966..19196973,19212032..19212135,
FT                   19214782..19214859,19216721..19216765,19218269..19218401,
FT                   19220119..19220242,19220984..19221064,19229028..19229093,
FT                   19230584..19230637,19231842..19231949))
FT                   /codon_start=1
FT                   /gene="Aldh7a1"
FT                   /locus_tag="mCG_16296"
FT                   /product="aldehyde dehydrogenase family 7, member A1,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG16296.2 transcript_id=mCT174123.0
FT                   protein_id=mCP97037.0 isoform=CRA_c"
FT                   /protein_id="EDL09881.1"
FT                   /translation="MSTLLIHHPQYAWLQDLGLREDNEGVYNGSWGGRGEVITTYCPAN
FT                   NEPIARVRQASLKDYEETIGKAKKAWNIWADIPAPKRGEIVRKIGDAFREKIQLLGRLV
FT                   SLEMGKILVEGIGEVQEYVDVCDYAAGLSRMIGGPTLPSERPGHALIEMWNPLGLVGII
FT                   TAFNFPVAVFGWNNAIALITGNVCLWKGAPTTSLVSVAVTKIIAQVLEDNLLPGAICSL
FT                   VCGGADIGTTMARDERVNLLSFTGSTQVGKGGGPHGAGRGLVKA"
FT   mRNA            complement(join(19197002..19197077,19204197..19204262,
FT                   19207177..19207271,19208620..19208661,19212036..19212135,
FT                   19214782..19214859,19216721..19216765,19218269..19218401,
FT                   19220119..19220242,19220984..19221064,19229028..19229093,
FT                   19230584..19230637,19231842..19232013,19232294..19232486,
FT                   19244756..19244784))
FT                   /gene="Aldh7a1"
FT                   /locus_tag="mCG_16296"
FT                   /product="aldehyde dehydrogenase family 7, member A1,
FT                   transcript variant mCT174122"
FT                   /note="gene_id=mCG16296.2 transcript_id=mCT174122.0 created
FT                   on 08-OCT-2002"
FT   CDS             complement(join(19197023..19197077,19198298..19198373,
FT                   19201478..19201551,19201699..19201754,19220198..19220242,
FT                   19220984..19221064,19229028..19229093,19230584..19230637,
FT                   19231842..19231949))
FT                   /codon_start=1
FT                   /gene="Aldh7a1"
FT                   /locus_tag="mCG_16296"
FT                   /product="aldehyde dehydrogenase family 7, member A1,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG16296.2 transcript_id=mCT174119.0
FT                   protein_id=mCP97038.0 isoform=CRA_b"
FT                   /protein_id="EDL09879.1"
FT                   /translation="MSTLLIHHPQYAWLQDLGLREDNEGVYNGSWGGRGEVITTYCPAN
FT                   NEPIARVRQASLKDYEETIGKAKKAWNIWADIPAPKRGEIVRKIGDAFREKIQLLGRLV
FT                   SLEMGKILVEGIGEGLSSSIFTKDLGRIFRWLGPKGSDCGIVNVNIPTSGAEIGGAFGG
FT                   EKHTGGGRESGSDAWKQYMRRSTCTINYSTSLPLAQGIKFQ"
FT   CDS             complement(join(19207185..19207271,19208620..19208661,
FT                   19212036..19212135,19214782..19214859,19216721..19216765,
FT                   19218269..19218401,19220119..19220242,19220984..19221064,
FT                   19229028..19229093,19230584..19230637,19231842..19232033))
FT                   /codon_start=1
FT                   /gene="Aldh7a1"
FT                   /locus_tag="mCG_16296"
FT                   /product="aldehyde dehydrogenase family 7, member A1,
FT                   isoform CRA_d"
FT                   /note="gene_id=mCG16296.2 transcript_id=mCT174118.0
FT                   protein_id=mCP97040.0 isoform=CRA_d"
FT                   /protein_id="EDL09882.1"
FT                   /translation="MWRVPRRLCVQSVKTSKLSGPWSRPAAHMSTLLIHHPQYAWLQDL
FT                   GLREDNEGVYNGSWGGRGEVITTYCPANNEPIARVRQASLKDYEETIGKAKKAWNIWAD
FT                   IPAPKRGEIVRKIGDAFREKIQLLGRLVSLEMGKILVEGIGEVQEYVDVCDYAAGLSRM
FT                   IGGPTLPSERPGHALIEMWNPLGLVGIITAFNFPVAVFGWNNAIALITGNVCLWKGAPT
FT                   TSLVSVAVTKIIAQVLEDNLLPGAICSLVCGGADIGTTMARDERVNLLSFTGSTQVGKG
FT                   GGPHGAGRGLGKACWSLEETTPLLLSRTRTSAWLFHQFCLPPWEQLGKGVPL"
FT   CDS             complement(join(19207185..19207271,19208620..19208661,
FT                   19212036..19212135,19214782..19214859,19216721..19216765,
FT                   19218269..19218401,19220119..19220242,19220984..19221064,
FT                   19229028..19229093,19230584..19230637,19231842..19231949))
FT                   /codon_start=1
FT                   /gene="Aldh7a1"
FT                   /locus_tag="mCG_16296"
FT                   /product="aldehyde dehydrogenase family 7, member A1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG16296.2 transcript_id=mCT17037.2
FT                   protein_id=mCP21507.2 isoform=CRA_a"
FT                   /protein_id="EDL09878.1"
FT                   /translation="MSTLLIHHPQYAWLQDLGLREDNEGVYNGSWGGRGEVITTYCPAN
FT                   NEPIARVRQASLKDYEETIGKAKKAWNIWADIPAPKRGEIVRKIGDAFREKIQLLGRLV
FT                   SLEMGKILVEGIGEVQEYVDVCDYAAGLSRMIGGPTLPSERPGHALIEMWNPLGLVGII
FT                   TAFNFPVAVFGWNNAIALITGNVCLWKGAPTTSLVSVAVTKIIAQVLEDNLLPGAICSL
FT                   VCGGADIGTTMARDERVNLLSFTGSTQVGKGGGPHGAGRGLGKACWSLEETTPLLLSRT
FT                   RTSAWLFHQFCLPPWEQLGKGVPL"
FT   CDS             complement(join(19207185..19207271,19208620..19208661,
FT                   19212036..19212135,19214782..19214859,19216721..19216765,
FT                   19218269..19218401,19220119..19220242,19220984..19221064,
FT                   19229028..19229093,19230584..19230637,19231842..19231949))
FT                   /codon_start=1
FT                   /gene="Aldh7a1"
FT                   /locus_tag="mCG_16296"
FT                   /product="aldehyde dehydrogenase family 7, member A1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG16296.2 transcript_id=mCT174121.0
FT                   protein_id=mCP97039.0 isoform=CRA_a"
FT                   /protein_id="EDL09880.1"
FT                   /translation="MSTLLIHHPQYAWLQDLGLREDNEGVYNGSWGGRGEVITTYCPAN
FT                   NEPIARVRQASLKDYEETIGKAKKAWNIWADIPAPKRGEIVRKIGDAFREKIQLLGRLV
FT                   SLEMGKILVEGIGEVQEYVDVCDYAAGLSRMIGGPTLPSERPGHALIEMWNPLGLVGII
FT                   TAFNFPVAVFGWNNAIALITGNVCLWKGAPTTSLVSVAVTKIIAQVLEDNLLPGAICSL
FT                   VCGGADIGTTMARDERVNLLSFTGSTQVGKGGGPHGAGRGLGKACWSLEETTPLLLSRT
FT                   RTSAWLFHQFCLPPWEQLGKGVPL"
FT   CDS             complement(join(19207185..19207271,19208620..19208661,
FT                   19212036..19212135,19214782..19214859,19216721..19216765,
FT                   19218269..19218401,19220119..19220242,19220984..19221064,
FT                   19229028..19229093,19230584..19230637,19231842..19231949))
FT                   /codon_start=1
FT                   /gene="Aldh7a1"
FT                   /locus_tag="mCG_16296"
FT                   /product="aldehyde dehydrogenase family 7, member A1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG16296.2 transcript_id=mCT174120.0
FT                   protein_id=mCP97041.0 isoform=CRA_a"
FT                   /protein_id="EDL09883.1"
FT                   /translation="MSTLLIHHPQYAWLQDLGLREDNEGVYNGSWGGRGEVITTYCPAN
FT                   NEPIARVRQASLKDYEETIGKAKKAWNIWADIPAPKRGEIVRKIGDAFREKIQLLGRLV
FT                   SLEMGKILVEGIGEVQEYVDVCDYAAGLSRMIGGPTLPSERPGHALIEMWNPLGLVGII
FT                   TAFNFPVAVFGWNNAIALITGNVCLWKGAPTTSLVSVAVTKIIAQVLEDNLLPGAICSL
FT                   VCGGADIGTTMARDERVNLLSFTGSTQVGKGGGPHGAGRGLGKACWSLEETTPLLLSRT
FT                   RTSAWLFHQFCLPPWEQLGKGVPL"
FT   CDS             complement(join(19207185..19207271,19208620..19208661,
FT                   19212036..19212135,19214782..19214859,19216721..19216765,
FT                   19218269..19218401,19220119..19220242,19220984..19221064,
FT                   19229028..19229093,19230584..19230637,19231842..19231949))
FT                   /codon_start=1
FT                   /gene="Aldh7a1"
FT                   /locus_tag="mCG_16296"
FT                   /product="aldehyde dehydrogenase family 7, member A1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG16296.2 transcript_id=mCT174122.0
FT                   protein_id=mCP97042.0 isoform=CRA_a"
FT                   /protein_id="EDL09884.1"
FT                   /translation="MSTLLIHHPQYAWLQDLGLREDNEGVYNGSWGGRGEVITTYCPAN
FT                   NEPIARVRQASLKDYEETIGKAKKAWNIWADIPAPKRGEIVRKIGDAFREKIQLLGRLV
FT                   SLEMGKILVEGIGEVQEYVDVCDYAAGLSRMIGGPTLPSERPGHALIEMWNPLGLVGII
FT                   TAFNFPVAVFGWNNAIALITGNVCLWKGAPTTSLVSVAVTKIIAQVLEDNLLPGAICSL
FT                   VCGGADIGTTMARDERVNLLSFTGSTQVGKGGGPHGAGRGLGKACWSLEETTPLLLSRT
FT                   RTSAWLFHQFCLPPWEQLGKGVPL"
FT   assembly_gap    19208105..19208124
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            19232378..19259596
FT                   /gene="Rnuxa"
FT                   /locus_tag="mCG_16297"
FT                   /note="gene_id=mCG16297.2"
FT   mRNA            join(19232378..19232534,19247355..19247941,
FT                   19252068..19252188,19256175..19256258,19258761..19259394)
FT                   /gene="Rnuxa"
FT                   /locus_tag="mCG_16297"
FT                   /product="RNA U, small nuclear RNA export adaptor,
FT                   transcript variant mCT174124"
FT                   /note="gene_id=mCG16297.2 transcript_id=mCT174124.0 created
FT                   on 08-OCT-2002"
FT   CDS             join(19232505..19232534,19247355..19247941,
FT                   19252068..19252188,19256175..19256258,19258761..19259030)
FT                   /codon_start=1
FT                   /gene="Rnuxa"
FT                   /locus_tag="mCG_16297"
FT                   /product="RNA U, small nuclear RNA export adaptor, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG16297.2 transcript_id=mCT174124.0
FT                   protein_id=mCP97043.0 isoform=CRA_b"
FT                   /db_xref="GOA:G5E8V8"
FT                   /db_xref="InterPro:IPR019385"
FT                   /db_xref="MGI:MGI:1891839"
FT                   /db_xref="UniProtKB/TrEMBL:G5E8V8"
FT                   /protein_id="EDL09877.1"
FT                   /translation="MTSLTPVVAQKVLGGGSAACAPVSHYRTVKHVDSSEESLDSDDDC
FT                   SLWKRKRQKCHNTPPKPEPFPFGPSGQKTALNGGKKVNNIWGAVLQEQNQDAVATELGI
FT                   LGMEGSIDRSRQSETYNYLLAKKLAKKESQEYTKELDKDLDEYMHGDKKPGSKEDENGQ
FT                   GHLKRKRPVRDRLGNRVEMNYKGRYEITEEDAPEKVADEIAFRLQEPKKDLIARVVRIL
FT                   GNKKAIELLMETAEVEQNGGLFIMNGSRRRTPGGVFLNLLKNTPSISEEQIKDIFYVEN
FT                   QKEYENKKAARKRRTQLLGKKMKQAIKSLNFQEDDDTSRETFASDTNEALASLDEAQEG
FT                   PGETKLDAEEAIEVDHPQDLDIF"
FT   assembly_gap    19234065..19235297
FT                   /estimated_length=1233
FT                   /gap_type="unknown"
FT   assembly_gap    19240939..19240958
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            join(<19244951..19245046,19247355..19247941,
FT                   19252068..19252188,19256175..19256258,19258761..19259596)
FT                   /gene="Rnuxa"
FT                   /locus_tag="mCG_16297"
FT                   /product="RNA U, small nuclear RNA export adaptor,
FT                   transcript variant mCT17038"
FT                   /note="gene_id=mCG16297.2 transcript_id=mCT17038.1 created
FT                   on 08-OCT-2002"
FT   CDS             join(19244951..19245046,19247355..19247941,
FT                   19252068..19252188,19256175..19256258,19258761..19259030)
FT                   /codon_start=1
FT                   /gene="Rnuxa"
FT                   /locus_tag="mCG_16297"
FT                   /product="RNA U, small nuclear RNA export adaptor, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG16297.2 transcript_id=mCT17038.1
FT                   protein_id=mCP21559.0 isoform=CRA_a"
FT                   /protein_id="EDL09876.1"
FT                   /translation="MALEAGDMEEGQLSDSDSDMTVVPSDRPLQMAKVLGGGSAACAPV
FT                   SHYRTVKHVDSSEESLDSDDDCSLWKRKRQKCHNTPPKPEPFPFGPSGQKTALNGGKKV
FT                   NNIWGAVLQEQNQDAVATELGILGMEGSIDRSRQSETYNYLLAKKLAKKESQEYTKELD
FT                   KDLDEYMHGDKKPGSKEDENGQGHLKRKRPVRDRLGNRVEMNYKGRYEITEEDAPEKVA
FT                   DEIAFRLQEPKKDLIARVVRILGNKKAIELLMETAEVEQNGGLFIMNGSRRRTPGGVFL
FT                   NLLKNTPSISEEQIKDIFYVENQKEYENKKAARKRRTQLLGKKMKQAIKSLNFQEDDDT
FT                   SRETFASDTNEALASLDEAQEGPGETKLDAEEAIEVDHPQDLDIF"
FT   gene            19260229..19266660
FT                   /gene="1700065I17Rik"
FT                   /locus_tag="mCG_16299"
FT                   /note="gene_id=mCG16299.1"
FT   mRNA            join(19260229..19260353,19264254..19264362,
FT                   19266326..19266660)
FT                   /gene="1700065I17Rik"
FT                   /locus_tag="mCG_16299"
FT                   /product="RIKEN cDNA 1700065I17"
FT                   /note="gene_id=mCG16299.1 transcript_id=mCT17040.0 created
FT                   on 08-OCT-2002"
FT   CDS             join(19260318..19260353,19264254..19264362,
FT                   19266326..19266585)
FT                   /codon_start=1
FT                   /gene="1700065I17Rik"
FT                   /locus_tag="mCG_16299"
FT                   /product="RIKEN cDNA 1700065I17"
FT                   /note="gene_id=mCG16299.1 transcript_id=mCT17040.0
FT                   protein_id=mCP21564.1"
FT                   /protein_id="EDL09875.1"
FT                   /translation="MQTCRRAASTAQVGRYSLAPVLTKARDDPDPLRHALERKHEIQER
FT                   ESTASRSLWDLCWPFGRFSVLGLQREALPWGRSESRPEERPAGDKDYRHAFAFASLQIP
FT                   EHSDFPRFPEATDLIGGSRKLLSFGNGALA"
FT   assembly_gap    19276078..19277969
FT                   /estimated_length=1892
FT                   /gap_type="unknown"
FT   assembly_gap    19286232..19286467
FT                   /estimated_length=236
FT                   /gap_type="unknown"
FT   assembly_gap    19290504..19290539
FT                   /estimated_length=36
FT                   /gap_type="unknown"
FT   assembly_gap    19308971..19308990
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19322762..19322979
FT                   /estimated_length=218
FT                   /gap_type="unknown"
FT   assembly_gap    19326830..19327138
FT                   /estimated_length=309
FT                   /gap_type="unknown"
FT   assembly_gap    19330344..19330525
FT                   /estimated_length=182
FT                   /gap_type="unknown"
FT   gene            19343470..19344105
FT                   /pseudo
FT                   /locus_tag="mCG_50521"
FT                   /note="gene_id=mCG50521.2"
FT   mRNA            19343470..19344105
FT                   /pseudo
FT                   /locus_tag="mCG_50521"
FT                   /note="gene_id=mCG50521.2 transcript_id=mCT50704.2 created
FT                   on 17-OCT-2002"
FT   assembly_gap    19347694..19348325
FT                   /estimated_length=632
FT                   /gap_type="unknown"
FT   assembly_gap    19350065..19350519
FT                   /estimated_length=455
FT                   /gap_type="unknown"
FT   assembly_gap    19352695..19353259
FT                   /estimated_length=565
FT                   /gap_type="unknown"
FT   assembly_gap    19355814..19355866
FT                   /estimated_length=53
FT                   /gap_type="unknown"
FT   assembly_gap    19357533..19357601
FT                   /estimated_length=69
FT                   /gap_type="unknown"
FT   assembly_gap    19360106..19360410
FT                   /estimated_length=305
FT                   /gap_type="unknown"
FT   assembly_gap    19378140..19378159
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19383498..19383623
FT                   /estimated_length=126
FT                   /gap_type="unknown"
FT   gene            19383666..19430749
FT                   /gene="Lmnb1"
FT                   /locus_tag="mCG_16290"
FT                   /note="gene_id=mCG16290.2"
FT   mRNA            join(19383666..19384267,19405736..19405892,
FT                   19406624..19406749,19408307..19408477,19410539..19410664,
FT                   19417162..19417382,19418028..19418253,19420545..19420649,
FT                   19425295..19425414,19427017..19427127,19429925..19430740)
FT                   /gene="Lmnb1"
FT                   /locus_tag="mCG_16290"
FT                   /product="lamin B1, transcript variant mCT17031"
FT                   /note="gene_id=mCG16290.2 transcript_id=mCT17031.1 created
FT                   on 08-OCT-2002"
FT   CDS             join(19383906..19384267,19405736..19405892,
FT                   19406624..19406749,19408307..19408477,19410539..19410664,
FT                   19417162..19417382,19418028..19418253,19420545..19420649,
FT                   19425295..19425414,19427017..19427127,19429925..19429966)
FT                   /codon_start=1
FT                   /gene="Lmnb1"
FT                   /locus_tag="mCG_16290"
FT                   /product="lamin B1, isoform CRA_a"
FT                   /note="gene_id=mCG16290.2 transcript_id=mCT17031.1
FT                   protein_id=mCP21565.2 isoform=CRA_a"
FT                   /protein_id="EDL09872.1"
FT                   /translation="MATATPVQQQRAGSRASAPATPLSPTRLSRLQEKEELRELNDRLA
FT                   VYIDKVRSLETENSALQLQVTEREEVRGRELTGLKALYETELADARRALDDTARERAKL
FT                   QIELGKFKAEHDQLLLNYAKKESDLSGAQIKLREYEAALNSKDAALATALGDKKSLEGD
FT                   LEDLKDQIAQLEASLSAAKKQLADETLLKVDLENRCQSLTEDLEFRKNMYEEEINETRR
FT                   KHETRLVEVDSGRQIEYEYKLAQALHEMREQHDAQVRLYKEELEQTYHAKLENARLSSE
FT                   MNTSTVNSAREELMESRMRIESLSSQLSNLQKESRACLERIQELEDMLAKERDNSRRML
FT                   SDREREMAEIRDQMQQQLSDYEQLLDVKLALDMEISAYRKLLEGEEERLKLSPSPSSRV
FT                   TVSRASSSRSVRTTRGKRKRVDVEESEASSSVSISHSASATGNVCIEEIDVDGKFIRLK
FT                   NTSEQDQPMGGWEMIRKIGDTSVSYKYTSRYVLKAGQTVTVWAANAGVTASPPTDLIWK
FT                   NQNSWGTGEDVKVILKNSQGEEVAQRSTVFKTTIPEEEEEEEEEPIGVAVEEERFHQQG
FT                   APRASNKSCAIM"
FT   mRNA            join(19383968..19384267,19405736..19405892,
FT                   19406624..19406749,19408307..19408477,19410539..19410664,
FT                   19417162..19417382,19418028..19418253,19420545..19420591,
FT                   19427062..19427127,19429925..19430749)
FT                   /gene="Lmnb1"
FT                   /locus_tag="mCG_16290"
FT                   /product="lamin B1, transcript variant mCT174111"
FT                   /note="gene_id=mCG16290.2 transcript_id=mCT174111.0 created
FT                   on 08-OCT-2002"
FT   mRNA            join(19383968..19384267,19405736..19405892,
FT                   19406624..19406749,19408307..19408329,19430531..19430742)
FT                   /gene="Lmnb1"
FT                   /locus_tag="mCG_16290"
FT                   /product="lamin B1, transcript variant mCT174112"
FT                   /note="gene_id=mCG16290.2 transcript_id=mCT174112.0 created
FT                   on 08-OCT-2002"
FT   assembly_gap    19385441..19385460
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19387012..19387031
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(19406664..19406749,19408307..19408329,
FT                   19430531..19430574)
FT                   /codon_start=1
FT                   /gene="Lmnb1"
FT                   /locus_tag="mCG_16290"
FT                   /product="lamin B1, isoform CRA_c"
FT                   /note="gene_id=mCG16290.2 transcript_id=mCT174112.0
FT                   protein_id=mCP97031.0 isoform=CRA_c"
FT                   /protein_id="EDL09874.1"
FT                   /translation="MKLYLKWIWRIAVRALLRTWSFVKICMKRRSMRQGGITMYALWME
FT                   VLQSC"
FT   CDS             join(19406738..19406749,19408307..19408477,
FT                   19410539..19410664,19417162..19417382,19418028..19418253,
FT                   19420545..19420591,19427062..19427127,19429925..19430081)
FT                   /codon_start=1
FT                   /gene="Lmnb1"
FT                   /locus_tag="mCG_16290"
FT                   /product="lamin B1, isoform CRA_b"
FT                   /note="gene_id=mCG16290.2 transcript_id=mCT174111.0
FT                   protein_id=mCP97030.0 isoform=CRA_b"
FT                   /protein_id="EDL09873.1"
FT                   /translation="MYEEEINETRRKHETRLVEVDSGRQIEYEYKLAQALHEMREQHDA
FT                   QVRLYKEELEQTYHAKLENARLSSEMNTSTVNSAREELMESRMRIESLSSQLSNLQKES
FT                   RACLERIQELEDMLAKERDNSRRMLSDREREMAEIRDQMQQQLSDYEQLLDVKLALDME
FT                   ISAYRKLLEGEEERLKLSPSPSSRVTVSRASSSRSVRTTRGKRKRVDVEESEASSSVSI
FT                   SHSASATGNVCIEEIDVDGKFIRLKNTSEQDQPMGGWEMIRKIGDTRRRRRRRSPSEWL
FT                   WRRSVSTSREPQEHPIKAVPLCELVKTWSIFLKLEAWSPVYSAEPSQKHMIFLYFLYVN
FT                   F"
FT   assembly_gap    19432412..19432653
FT                   /estimated_length=242
FT                   /gap_type="unknown"
FT   gene            complement(19439130..19601847)
FT                   /gene="March3"
FT                   /locus_tag="mCG_16294"
FT                   /note="gene_id=mCG16294.3"
FT   mRNA            complement(join(19439130..19439982,19460412..19460621,
FT                   19485227..19485431,19489395..19489638,19601606..19601847))
FT                   /gene="March3"
FT                   /locus_tag="mCG_16294"
FT                   /product="membrane-associated ring finger (C3HC4) 3,
FT                   transcript variant mCT17035"
FT                   /note="gene_id=mCG16294.3 transcript_id=mCT17035.3 created
FT                   on 16-MAY-2003"
FT   CDS             complement(join(19439929..19439982,19460412..19460621,
FT                   19485227..19485431,19489395..19489582))
FT                   /codon_start=1
FT                   /gene="March3"
FT                   /locus_tag="mCG_16294"
FT                   /product="membrane-associated ring finger (C3HC4) 3,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG16294.3 transcript_id=mCT17035.3
FT                   protein_id=mCP21499.3 isoform=CRA_a"
FT                   /protein_id="EDL09870.1"
FT                   /translation="MTTSRCSHLPEVLPDCTSSAAPVVKTVEDCGSLVNGQPQYVMQVS
FT                   AKDGQLLSTVVRTLATQSPFNDRPMCRICHEGSSQEDLLSPCECTGTLGTIHRSCLEHW
FT                   LSSSNTSYCELCHFRFAVERKPRPLVEWLRNPGPQHEKRTLFGDMVCFLFITPLATISG
FT                   WLCLRGAVDHLHFSSRLEAVGLIALTVALFTIYLFWTLRRYGHQSKPFWNQSSRS"
FT   assembly_gap    19461618..19461637
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19465445..19465464
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19469188..19469351
FT                   /estimated_length=164
FT                   /gap_type="unknown"
FT   mRNA            complement(join(19481232..19485431,19489395..19489638,
FT                   19601606..19601847))
FT                   /gene="March3"
FT                   /locus_tag="mCG_16294"
FT                   /product="membrane-associated ring finger (C3HC4) 3,
FT                   transcript variant mCT182128"
FT                   /note="gene_id=mCG16294.3 transcript_id=mCT182128.0 created
FT                   on 16-MAY-2003"
FT   CDS             complement(join(19485203..19485431,19489395..19489582))
FT                   /codon_start=1
FT                   /gene="March3"
FT                   /locus_tag="mCG_16294"
FT                   /product="membrane-associated ring finger (C3HC4) 3,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG16294.3 transcript_id=mCT182128.0
FT                   protein_id=mCP105048.0 isoform=CRA_b"
FT                   /protein_id="EDL09871.1"
FT                   /translation="MTTSRCSHLPEVLPDCTSSAAPVVKTVEDCGSLVNGQPQYVMQVS
FT                   AKDGQLLSTVVRTLATQSPFNDRPMCRICHEGSSQEDLLSPCECTGTLGTIHRSCLEHW
FT                   LSSSNTSYCELCHFRFAVERKPRPLVEVSKWSAS"
FT   assembly_gap    19505110..19505129
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19506295..19506314
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19510373..19510392
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19554897..19554916
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19572408..19572427
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(19591608..19592320)
FT                   /pseudo
FT                   /locus_tag="mCG_1033361"
FT                   /note="gene_id=mCG1033361.1"
FT   mRNA            complement(19591608..19592320)
FT                   /pseudo
FT                   /locus_tag="mCG_1033361"
FT                   /note="gene_id=mCG1033361.1 transcript_id=mCT151065.1
FT                   created on 10-MAR-2003"
FT   assembly_gap    19595074..19595162
FT                   /estimated_length=89
FT                   /gap_type="unknown"
FT   assembly_gap    19597608..19597750
FT                   /estimated_length=143
FT                   /gap_type="unknown"
FT   assembly_gap    19605747..19606284
FT                   /estimated_length=538
FT                   /gap_type="unknown"
FT   assembly_gap    19620129..19620148
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(19632212..19649612)
FT                   /locus_tag="mCG_16291"
FT                   /note="gene_id=mCG16291.2"
FT   mRNA            complement(join(19632212..19634089,19634691..19634747,
FT                   19638534..19638651,19643231..19643327,19649511..19649612))
FT                   /locus_tag="mCG_16291"
FT                   /product="mCG16291, transcript variant mCT174113"
FT                   /note="gene_id=mCG16291.2 transcript_id=mCT174113.0 created
FT                   on 08-OCT-2002"
FT   mRNA            complement(join(19632212..19634089,19634691..19634747,
FT                   19638534..19638651,19649511..19649601))
FT                   /locus_tag="mCG_16291"
FT                   /product="mCG16291, transcript variant mCT17032"
FT                   /note="gene_id=mCG16291.2 transcript_id=mCT17032.2 created
FT                   on 08-OCT-2002"
FT   CDS             complement(join(19633910..19634089,19634691..19634747,
FT                   19638534..19638644))
FT                   /codon_start=1
FT                   /locus_tag="mCG_16291"
FT                   /product="mCG16291, isoform CRA_a"
FT                   /note="gene_id=mCG16291.2 transcript_id=mCT17032.2
FT                   protein_id=mCP21575.2 isoform=CRA_a"
FT                   /protein_id="EDL09868.1"
FT                   /translation="MLWFQGKSLQIAKSSFGLLRNLSASNRALPVLTLFTKAPCPLCDE
FT                   AKEVLQPYKDRFILQEVDITLPENSTWYERYKFDIPVFHLNGQFLMMHRVNTSKLEKQL
FT                   RKLEQQVLATN"
FT   CDS             complement(join(19633910..19634089,19634691..19634747,
FT                   19638534..19638644))
FT                   /codon_start=1
FT                   /locus_tag="mCG_16291"
FT                   /product="mCG16291, isoform CRA_a"
FT                   /note="gene_id=mCG16291.2 transcript_id=mCT174113.0
FT                   protein_id=mCP97032.0 isoform=CRA_a"
FT                   /protein_id="EDL09869.1"
FT                   /translation="MLWFQGKSLQIAKSSFGLLRNLSASNRALPVLTLFTKAPCPLCDE
FT                   AKEVLQPYKDRFILQEVDITLPENSTWYERYKFDIPVFHLNGQFLMMHRVNTSKLEKQL
FT                   RKLEQQVLATN"
FT   assembly_gap    19679140..19679263
FT                   /estimated_length=124
FT                   /gap_type="unknown"
FT   assembly_gap    19683969..19689854
FT                   /estimated_length=5886
FT                   /gap_type="unknown"
FT   assembly_gap    19691926..19692389
FT                   /estimated_length=464
FT                   /gap_type="unknown"
FT   assembly_gap    19710475..19710969
FT                   /estimated_length=495
FT                   /gap_type="unknown"
FT   assembly_gap    19713702..19713721
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19714414..19715274
FT                   /estimated_length=861
FT                   /gap_type="unknown"
FT   assembly_gap    19729007..19729026
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19731885..19732039
FT                   /estimated_length=155
FT                   /gap_type="unknown"
FT   assembly_gap    19747189..19748627
FT                   /estimated_length=1439
FT                   /gap_type="unknown"
FT   assembly_gap    19752626..19752863
FT                   /estimated_length=238
FT                   /gap_type="unknown"
FT   assembly_gap    19753919..19753938
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19762372..19762391
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19764113..19764333
FT                   /estimated_length=221
FT                   /gap_type="unknown"
FT   assembly_gap    19800285..19800304
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            19810617..19972163
FT                   /gene="Megf10"
FT                   /locus_tag="mCG_59698"
FT                   /note="gene_id=mCG59698.2"
FT   mRNA            join(19810617..19810970,19857519..19857651,
FT                   19866580..19866681,19868186..19868286,19889432..19889524,
FT                   19918185..19918431,19930283..19930495,19937406..19937580,
FT                   19938854..19938974,19939737..19939900,19942182..19942284,
FT                   19953499..19953645,19954735..19954941,19955414..19955542,
FT                   19959460..19959588,19961622..19961750,19963636..19963764,
FT                   19965611..19965847,19967115..19967242,19968229..19968352,
FT                   19969603..19969647,19970441..19970647,19971715..19972163)
FT                   /gene="Megf10"
FT                   /locus_tag="mCG_59698"
FT                   /product="multiple EGF-like-domains 10"
FT                   /note="gene_id=mCG59698.2 transcript_id=mCT126316.1 created
FT                   on 14-OCT-2002"
FT   assembly_gap    19849225..19849244
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(19857536..19857651,19866580..19866681,
FT                   19868186..19868286,19889432..19889524,19918185..19918431,
FT                   19930283..19930495,19937406..19937580,19938854..19938974,
FT                   19939737..19939900,19942182..19942284,19953499..19953645,
FT                   19954735..19954941,19955414..19955542,19959460..19959588,
FT                   19961622..19961750,19963636..19963764,19965611..19965847,
FT                   19967115..19967242,19968229..19968352,19969603..19969647,
FT                   19970441..19970647,19971715..19971926)
FT                   /codon_start=1
FT                   /gene="Megf10"
FT                   /locus_tag="mCG_59698"
FT                   /product="multiple EGF-like-domains 10"
FT                   /note="gene_id=mCG59698.2 transcript_id=mCT126316.1
FT                   protein_id=mCP77964.1"
FT                   /protein_id="EDL09867.1"
FT                   /translation="MAISSSSCLGLICSLLCHWVGTASSLNLEDPNVCSHWESYSVTVQ
FT                   ESYPHPFDQIYYTSCTDILNWFKCTRHRISYRTAYRHGEKTMYRRKSQCCPGFYESRDM
FT                   CVPHCADKCVHGRCIAPNTCQCEPGWGGTNCSSACDGDHWGPHCSSRCQCKNRALCNPI
FT                   TGACHCAAGYRGWRCEDRCEQGTYGNDCHQRCQCQNGATCDHITGECRCSPGYTGALCQ
FT                   DECPVGSYGVRCAEACRCVNGGKCYHVSGTCLCEAGFSGELCEARLCPEGLYGIKCDKR
FT                   CPCHLDNTHSCHPMSGECGCKPGWSGLYCNETCSPGFYGEACQQICSCQNGADCDSVTG
FT                   RCACAPGFKGTDCSTPCPLGRYGINCSSRCGCKNDAVCSPVDGSCICKAGWHGVDCSIR
FT                   CPSGTWGFGCNLTCQCLNGGACNTLDGTCTCAPGWRGAKCEFPCQDGTYGLNCAERCDC
FT                   SHADGCHPTTGHCRCLPGWSGVHCDSVCAEGRWGPNCSLPCYCKNGASCSPDDGICECA
FT                   PGFRGTTCQRISVNLCVEQEINPTWGSNYEFLFAVCSPGFYGHRCSQTCPQCVHSSGPC
FT                   HHITGLCDCLPGFTGALCNEVCPSGRFGKNCAGVCTCTNNGTCNPIDRSCQCYPGWIGS
FT                   DCSQPCPPAHWGPNCIHTCNCHNGAFCSAYDGECKCTPGWTGLYCTQRCPLGFYGKDCA
FT                   LICQCQNGADCDHISGQCTCRTGFMGRHCEQKCPAGTYGYGCRQICDCLNNSTCDHITG
FT                   TCYCSPGWKGARCDQAGVIIVGNLNSLSRTSTALPADSYQIGAIAGIVVLVLVVLFLLA
FT                   LFIIYRHKQKRKESSMPAVTYTPAMRVINADYTIAETLPHSNGGNANSHYFTNPSYHTL
FT                   SQCATSPHVNNRDRMTIAKSKNNQLFVNLKNVNPGKRGTLVDCTGTLPADWKQGGYLNE
FT                   LGAFGLDRSYMGKSLKDLGKNSEYNSSTCSLSSSENPYATIKDPPALLPKSSECGYVEM
FT                   KSPARRDSPYAEINNSTPANRNVYEVEPTVSVVQGVFSNSGHVTQDPYDLPKNSHIPCH
FT                   YDLLPVRDSSSSPKREDGGGSNSTSSNSTSSSSSSSE"
FT   assembly_gap    19880346..19880473
FT                   /estimated_length=128
FT                   /gap_type="unknown"
FT   assembly_gap    19891962..19900829
FT                   /estimated_length=8868
FT                   /gap_type="unknown"
FT   assembly_gap    19909892..19910025
FT                   /estimated_length=134
FT                   /gap_type="unknown"
FT   assembly_gap    19927657..19927676
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19931881..19932343
FT                   /estimated_length=463
FT                   /gap_type="unknown"
FT   assembly_gap    19950912..19950931
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19969886..19969985
FT                   /estimated_length=100
FT                   /gap_type="unknown"
FT   assembly_gap    19999863..19999961
FT                   /estimated_length=99
FT                   /gap_type="unknown"
FT   assembly_gap    20005770..20005789
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20011494..20011567
FT                   /estimated_length=74
FT                   /gap_type="unknown"
FT   assembly_gap    20025316..20025335
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(20031564..20032748)
FT                   /locus_tag="mCG_147318"
FT                   /note="gene_id=mCG147318.0"
FT   mRNA            complement(20031564..20032748)
FT                   /locus_tag="mCG_147318"
FT                   /product="mCG147318"
FT                   /note="gene_id=mCG147318.0 transcript_id=mCT187581.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(20031960..20032604)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147318"
FT                   /product="mCG147318"
FT                   /note="gene_id=mCG147318.0 transcript_id=mCT187581.0
FT                   protein_id=mCP109706.0"
FT                   /protein_id="EDL09866.1"
FT                   /translation="MDRVKGSLRGGDGHSRGSREEPLRPTGAGGLGSLCHVCRPGRAGR
FT                   RSAGLATRARAGGCGRESRDRGRSDAGRDPVVPTSVSAARSPRTPPLAGRPARPPGARP
FT                   RPVATARVTAQVHAHLGRSERLRRSCTRGSGSGAGSGVPRGDPAYGGRGRPEERVPRAK
FT                   MASAPPRCHVGDTPRHAPRPASTGLPHTHPQLARVHRRPRRSVPTPVTAGE"
FT   gene            20032095..20067576
FT                   /gene="1190002C06Rik"
FT                   /locus_tag="mCG_125065"
FT                   /note="gene_id=mCG125065.0"
FT   mRNA            join(20032095..20032247,20039748..20039864,
FT                   20040391..20040780,20042506..20042666,20048622..20048724,
FT                   20051782..20051945,20058865..20058968,20061409..20061511,
FT                   20066851..20067576)
FT                   /gene="1190002C06Rik"
FT                   /locus_tag="mCG_125065"
FT                   /product="RIKEN cDNA 1190002C06, transcript variant
FT                   mCT126318"
FT                   /note="gene_id=mCG125065.0 transcript_id=mCT126318.1
FT                   created on 08-OCT-2002"
FT   CDS             join(20039768..20039864,20040391..20040780,
FT                   20042506..20042666,20048622..20048724,20051782..20051945,
FT                   20058865..20058968,20061409..20061511,20066851..20067060)
FT                   /codon_start=1
FT                   /gene="1190002C06Rik"
FT                   /locus_tag="mCG_125065"
FT                   /product="RIKEN cDNA 1190002C06, isoform CRA_a"
FT                   /note="gene_id=mCG125065.0 transcript_id=mCT126318.1
FT                   protein_id=mCP77539.1 isoform=CRA_a"
FT                   /protein_id="EDL09864.1"
FT                   /translation="MMEESGIETTPPGTPPLHPAGLAAVPSTEAHSAATSSFSSPNVSG
FT                   MESLPPHVYSTPQPSLPPVQPSAPPPFVSMSPAPSVPLSGTSVPPSVSPSPATAFSGPP
FT                   MSHFPPATSASGALLSAPPSGPPISGFSVGTTYDITRGHAGRAPQTPLMPSFSAPPVTG
FT                   ILPAPITQQASMTSLAQGPGTTSAITFPEEQEDPRINRGQDDAPAGGIWGFIKGVAGNP
FT                   MVKSVLDKTKHSVESMITTLDPGMAPYIKSGGELDIVVTSNKEVKVAAVRDAFQEVFGL
FT                   AVVVGEAGQSNIAPQPVGYAAGLKGAQERIDSLRRSGAIHEKQTAVSVENFIAELLPDK
FT                   WFDIGCLVVEDPVHGIRLEAFTQATPVPLEFVQQAQSLTPQDYNLRWSGLLVTVGEVLE
FT                   KSLLNVSRTDWHLAFTGMSRRQMIYSAAKAVAGMYKQRLPPRPM"
FT   assembly_gap    20043587..20043786
FT                   /estimated_length=200
FT                   /gap_type="unknown"
FT   mRNA            join(20051154..20051338,20051782..20051945,
FT                   20058865..20058968,20061409..20061511,20066851..20067232)
FT                   /gene="1190002C06Rik"
FT                   /locus_tag="mCG_125065"
FT                   /product="RIKEN cDNA 1190002C06, transcript variant
FT                   mCT174094"
FT                   /note="gene_id=mCG125065.0 transcript_id=mCT174094.0
FT                   created on 08-OCT-2002"
FT   CDS             join(20051311..20051338,20051782..20051945,
FT                   20058865..20058968,20061409..20061511,20066851..20067060)
FT                   /codon_start=1
FT                   /gene="1190002C06Rik"
FT                   /locus_tag="mCG_125065"
FT                   /product="RIKEN cDNA 1190002C06, isoform CRA_b"
FT                   /note="gene_id=mCG125065.0 transcript_id=mCT174094.0
FT                   protein_id=mCP97013.0 isoform=CRA_b"
FT                   /protein_id="EDL09865.1"
FT                   /translation="MAHPGAREKESGGELDIVVTSNKEVKVAAVRDAFQEVFGLAVVVG
FT                   EAGQSNIAPQPVGYAAGLKGAQERIDSLRRSGAIHEKQTAVSVENFIAELLPDKWFDIG
FT                   CLVVEDPVHGIRLEAFTQATPVPLEFVQQAQSLTPQDYNLRWSGLLVTVGEVLEKSLLN
FT                   VSRTDWHLAFTGMSRRQMIYSAAKAVAGMYKQRLPPRPM"
FT   assembly_gap    20057766..20057785
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20062841..20062860
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <20083007..20093735
FT                   /locus_tag="mCG_145144"
FT                   /note="gene_id=mCG145144.0"
FT   mRNA            join(<20083007..20083359,20085180..20085366,
FT                   20090674..20090773,20091704..20092649,20092738..20093735)
FT                   /locus_tag="mCG_145144"
FT                   /product="mCG145144"
FT                   /note="gene_id=mCG145144.0 transcript_id=mCT184568.0
FT                   created on 05-JUN-2003"
FT   CDS             <20092207..20092614
FT                   /codon_start=1
FT                   /locus_tag="mCG_145144"
FT                   /product="mCG145144"
FT                   /note="gene_id=mCG145144.0 transcript_id=mCT184568.0
FT                   protein_id=mCP106255.0"
FT                   /protein_id="EDL09863.1"
FT                   /translation="LIFLAPMVGYYDLVSKVIVHFELMSQLLTSQLLTSQLSTWLGWFV
FT                   CVCVCVCVCVCVCVCFSQNSVWGRGIANLVMVISLRTANIFLAAVDLIILTAKTMFLCL
FT                   FSQPASLSGSALGLLVQFGKSFSKGEGTGLS"
FT   assembly_gap    20092650..20092737
FT                   /estimated_length=88
FT                   /gap_type="unknown"
FT   assembly_gap    20094187..20094206
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20097315..20097334
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20099399..20099418
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20101596..20101615
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20102731..20102750
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20111403..20111422
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20148371..20148493
FT                   /estimated_length=123
FT                   /gap_type="unknown"
FT   gene            20148870..20158444
FT                   /locus_tag="mCG_147297"
FT                   /note="gene_id=mCG147297.0"
FT   mRNA            join(20148870..20149181,20157349..20158444)
FT                   /locus_tag="mCG_147297"
FT                   /product="mCG147297"
FT                   /note="gene_id=mCG147297.0 transcript_id=mCT187560.0
FT                   created on 13-JAN-2004"
FT   CDS             20157448..20157690
FT                   /codon_start=1
FT                   /locus_tag="mCG_147297"
FT                   /product="mCG147297"
FT                   /note="gene_id=mCG147297.0 transcript_id=mCT187560.0
FT                   protein_id=mCP109685.0"
FT                   /protein_id="EDL09862.1"
FT                   /translation="MDGGQPVPSPLVPLGNGSDYSMSLEQKTTFVFVILLFIFLGILIV
FT                   RCFRILLDPYRSMPTSTWADGLEGLEKGQFDHALA"
FT   assembly_gap    20202270..20202289
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<20210614..>20213905)
FT                   /locus_tag="mCG_145152"
FT                   /note="gene_id=mCG145152.0"
FT   mRNA            complement(join(<20210614..20211221,20213607..20213676,
FT                   20213831..>20213905))
FT                   /locus_tag="mCG_145152"
FT                   /product="mCG145152"
FT                   /note="gene_id=mCG145152.0 transcript_id=mCT184576.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(<20210614..>20210796)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145152"
FT                   /product="mCG145152"
FT                   /note="gene_id=mCG145152.0 transcript_id=mCT184576.0
FT                   protein_id=mCP106262.0"
FT                   /protein_id="EDL09861.1"
FT                   /translation="TGWNMKDGSHETLAGKTVPAGPDVRGVHMQGSLDLTSPLCSSNKN
FT                   KRNSKSSLEEECPLNI"
FT   gene            <20213959..20411711
FT                   /locus_tag="mCG_21819"
FT                   /note="gene_id=mCG21819.1"
FT   mRNA            join(<20213959..20214149,20218211..20218262,
FT                   20242984..20243082,20271067..20271198,20273148..20273204,
FT                   20346991..20347123,20411360..20411711)
FT                   /locus_tag="mCG_21819"
FT                   /product="mCG21819, transcript variant mCT21377"
FT                   /note="gene_id=mCG21819.1 transcript_id=mCT21377.2 created
FT                   on 07-OCT-2002"
FT   mRNA            join(20213959..20214149,20218211..20218262,
FT                   20242984..20243082,20245882..20246098)
FT                   /locus_tag="mCG_21819"
FT                   /product="mCG21819, transcript variant mCT174125"
FT                   /note="gene_id=mCG21819.1 transcript_id=mCT174125.0 created
FT                   on 07-OCT-2002"
FT   mRNA            join(<20214010..20214149,20218211..20218262,
FT                   20242984..20243082,20271067..20271198,20273148..20273204,
FT                   20411360..20411710)
FT                   /locus_tag="mCG_21819"
FT                   /product="mCG21819, transcript variant mCT190279"
FT                   /note="gene_id=mCG21819.1 transcript_id=mCT190279.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<20214031..20214149,20218211..20218262,
FT                   20242984..20243082,20271067..20271198,20273148..20273204,
FT                   20346991..20347123,20411360..20411586)
FT                   /codon_start=1
FT                   /locus_tag="mCG_21819"
FT                   /product="mCG21819, isoform CRA_c"
FT                   /note="gene_id=mCG21819.1 transcript_id=mCT21377.2
FT                   protein_id=mCP21543.2 isoform=CRA_c"
FT                   /protein_id="EDL09858.1"
FT                   /translation="GMRLVGVCPWTEDLNGPAKMGGCHSKKVVIPDIETSARCRSMLGS
FT                   YQSYIQSQNRTSGNSPDSGQTVFSLEHLEICLKEAEEKARALLEQLTASEATKSQLLEK
FT                   VSMLEGRLEDVNRKNVGGELYENMVLEKDKCIEKLQAEVKASQEKLNIHKLKHKKAVKK
FT                   LQTDLAIAKQEAAITVLELNEKIMTLCEGRPFPRATNSVEVLSGGLPPVEESDRKFSLI
FT                   MELSTQLSLQTEKITQLEDTLAEKEKKIEELEAECTSQVPQGEDRLTEDL"
FT   CDS             join(<20214031..20214149,20218211..20218262,
FT                   20242984..20243082,20271067..20271198,20273148..20273204,
FT                   20411360..20411431)
FT                   /codon_start=1
FT                   /locus_tag="mCG_21819"
FT                   /product="mCG21819, isoform CRA_b"
FT                   /note="gene_id=mCG21819.1 transcript_id=mCT190279.0
FT                   protein_id=mCP111281.0 isoform=CRA_b"
FT                   /protein_id="EDL09857.1"
FT                   /translation="GMRLVGVCPWTEDLNGPAKMGGCHSKKVVIPDIETSARCRSMLGS
FT                   YQSYIQSQNRTSGNSPDSGQTVFSLEHLEICLKEAEEKARALLEQLTASEATKSQLLEK
FT                   VSMLEGRLEDVNRKNVGGELYENMVLEKDKCIEKLQAEVKASQEKLNIHQPTQWKYSPE
FT                   VSHLWKKATGSFP"
FT   CDS             join(20214034..20214149,20218211..20218262,
FT                   20242984..20243082,20245882..20245899)
FT                   /codon_start=1
FT                   /locus_tag="mCG_21819"
FT                   /product="mCG21819, isoform CRA_a"
FT                   /note="gene_id=mCG21819.1 transcript_id=mCT174125.0
FT                   protein_id=mCP97044.0 isoform=CRA_a"
FT                   /protein_id="EDL09856.1"
FT                   /translation="MRLVGVCPWTEDLNGPAKMGGCHSKKVVIPDIETSARCRSMLGSY
FT                   QSYIQSQNRTSGNSPDSGQTVFSLEHLEICLKEAEEKARALLEQTSFSL"
FT   assembly_gap    20217697..20218052
FT                   /estimated_length=356
FT                   /gap_type="unknown"
FT   gene            complement(20225532..20232052)
FT                   /locus_tag="mCG_21818"
FT                   /note="gene_id=mCG21818.1"
FT   mRNA            complement(join(20225532..20226035,20228450..20228546,
FT                   20229255..20229407,20231918..20232052))
FT                   /locus_tag="mCG_21818"
FT                   /product="mCG21818"
FT                   /note="gene_id=mCG21818.1 transcript_id=mCT21376.1 created
FT                   on 08-OCT-2002"
FT   CDS             complement(join(20225900..20226035,20228450..20228546,
FT                   20229255..20229267))
FT                   /codon_start=1
FT                   /locus_tag="mCG_21818"
FT                   /product="mCG21818"
FT                   /note="gene_id=mCG21818.1 transcript_id=mCT21376.1
FT                   protein_id=mCP21537.1"
FT                   /protein_id="EDL09860.1"
FT                   /translation="MNVEEIGLGMSEEQLEEKEERLIWRTERKGDGFAVPRSEKKVSSV
FT                   KAATKQPLHFLSSPRVQITQHINQNQQAYFKVTNFL"
FT   assembly_gap    20232138..20232235
FT                   /estimated_length=98
FT                   /gap_type="unknown"
FT   assembly_gap    20240794..20240813
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20243377..20243396
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20244446..20244550
FT                   /estimated_length=105
FT                   /gap_type="unknown"
FT   assembly_gap    20249234..20249461
FT                   /estimated_length=228
FT                   /gap_type="unknown"
FT   assembly_gap    20255850..20255869
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20269149..20269177
FT                   /estimated_length=29
FT                   /gap_type="unknown"
FT   assembly_gap    20283311..20283334
FT                   /estimated_length=24
FT                   /gap_type="unknown"
FT   gene            complement(20311170..>20317686)
FT                   /locus_tag="mCG_56487"
FT                   /note="gene_id=mCG56487.1"
FT   mRNA            complement(join(20311170..20311392,20315105..20315232,
FT                   20317577..>20317686))
FT                   /locus_tag="mCG_56487"
FT                   /product="mCG56487"
FT                   /note="gene_id=mCG56487.1 transcript_id=mCT56670.1 created
FT                   on 08-OCT-2002"
FT   CDS             complement(join(20311256..20311392,20315105..20315232,
FT                   20317577..>20317686))
FT                   /codon_start=1
FT                   /locus_tag="mCG_56487"
FT                   /product="mCG56487"
FT                   /note="gene_id=mCG56487.1 transcript_id=mCT56670.1
FT                   protein_id=mCP41578.1"
FT                   /protein_id="EDL09859.1"
FT                   /translation="SPFFSSHASARGKSSLAADTICSVTQHDPDGTNTFRRSHEQETSP
FT                   SGRGGTDPRRQQLLEAEWELLCHVGLLHSLHQGHISIIAELNHTTESHGPKTSNSWRAR
FT                   EKTVHIPDSSSTNPQKDMCT"
FT   assembly_gap    20331830..20331849
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20339911..20339930
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20364700..20366618
FT                   /estimated_length=1919
FT                   /gap_type="unknown"
FT   assembly_gap    20381282..20381892
FT                   /estimated_length=611
FT                   /gap_type="unknown"
FT   assembly_gap    20399586..20399605
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20417783..20417995
FT                   /estimated_length=213
FT                   /gap_type="unknown"
FT   assembly_gap    20427311..20427330
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20431182..20431241
FT                   /estimated_length=60
FT                   /gap_type="unknown"
FT   assembly_gap    20439375..20441705
FT                   /estimated_length=2331
FT                   /gap_type="unknown"
FT   assembly_gap    20446961..20446980
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20458877..20458896
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(20461583..>20467507)
FT                   /locus_tag="mCG_145147"
FT                   /note="gene_id=mCG145147.0"
FT   mRNA            complement(join(20461583..20463234,20465817..20466511,
FT                   20466763..20466872,20467002..>20467507))
FT                   /locus_tag="mCG_145147"
FT                   /product="mCG145147"
FT                   /note="gene_id=mCG145147.0 transcript_id=mCT184571.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(20462506..>20462766)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145147"
FT                   /product="mCG145147"
FT                   /note="gene_id=mCG145147.0 transcript_id=mCT184571.0
FT                   protein_id=mCP106258.0"
FT                   /protein_id="EDL09855.1"
FT                   /translation="SKASWGGEGFFGLHFKSLFIIEGRQGRDLEAGADEEAMEGCCIVP
FT                   CLLLMACSYRTQDHQLRGGTTLSHQLLMKKMSYWLAYSLML"
FT   assembly_gap    20493382..20493497
FT                   /estimated_length=116
FT                   /gap_type="unknown"
FT   assembly_gap    20499537..20499556
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20522669..20522688
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20526182..20526426
FT                   /estimated_length=245
FT                   /gap_type="unknown"
FT   assembly_gap    20541140..20541441
FT                   /estimated_length=302
FT                   /gap_type="unknown"
FT   assembly_gap    20544990..20545072
FT                   /estimated_length=83
FT                   /gap_type="unknown"
FT   assembly_gap    20556681..20557753
FT                   /estimated_length=1073
FT                   /gap_type="unknown"
FT   gene            20557754..20625170
FT                   /gene="Slc12a2"
FT                   /locus_tag="mCG_21827"
FT                   /note="gene_id=mCG21827.1"
FT   mRNA            join(20557754..20558100,20574732..20574851,
FT                   20575794..20575869,20576509..20576604,20577710..20577849,
FT                   20578472..20578582,20579806..20579914,20582574..20582701,
FT                   20582788..20582872,20584403..20584554,20588691..20588798,
FT                   20590340..20590463,20591311..20591412,20592580..20592735,
FT                   20593883..20593982,20597930..20598041,20600219..20600359,
FT                   20604883..20604989,20608632..20608711,20610957..20611082,
FT                   20613433..20613480,20614789..20614911,20616141..20616252,
FT                   20618617..20618703,20619492..20619627,20620119..20620186,
FT                   20622282..20625170)
FT                   /gene="Slc12a2"
FT                   /locus_tag="mCG_21827"
FT                   /product="solute carrier family 12, member 2"
FT                   /note="gene_id=mCG21827.1 transcript_id=mCT21401.1 created
FT                   on 07-OCT-2002"
FT   CDS             join(20557996..20558100,20574732..20574851,
FT                   20575794..20575869,20576509..20576604,20577710..20577849,
FT                   20578472..20578582,20579806..20579914,20582574..20582701,
FT                   20582788..20582872,20584403..20584554,20588691..20588798,
FT                   20590340..20590463,20591311..20591412,20592580..20592735,
FT                   20593883..20593982,20597930..20598041,20600219..20600359,
FT                   20604883..20604989,20608632..20608711,20610957..20611082,
FT                   20613433..20613480,20614789..20614911,20616141..20616252,
FT                   20618617..20618703,20619492..20619627,20620119..20620186,
FT                   20622282..20622417)
FT                   /codon_start=1
FT                   /gene="Slc12a2"
FT                   /locus_tag="mCG_21827"
FT                   /product="solute carrier family 12, member 2"
FT                   /note="gene_id=mCG21827.1 transcript_id=mCT21401.1
FT                   protein_id=mCP21561.2"
FT                   /protein_id="EDL09854.1"
FT                   /translation="MDAVPRIDHYRHTAAQLGEKLLRPSLAELHDELEKEPFEDGFANG
FT                   EESTPTRDAVVAYTAESKGVVKFGWIKGVLVRCMLNIWGVMLFIRLSWIVGQAGIGLSV
FT                   VVIAMATVVTTITGLSTSAIATNGFVRGGGAYYLISRSLGPEFGGAIGLIFAFANAVAV
FT                   AMYVVGFAETVVELLKEHSILMIDEINDIRIIGAITVVILLGISVAGMEWEAKAQIVLL
FT                   VILLLAIADFVIGTFISLESKKPKGFFGYKSEIFNENFGPDFREEETFFSVFAIFFPAA
FT                   TGILAGANISGDLADPQSAIPKGTLLAILITTVVYIGIAVSVGSCVVRDATGNVNDTIT
FT                   TELTNCTSAACKLNFDFSYCESNTCSYGLMNNFQVMSMVSGFAPLISAGIFSATLSSAL
FT                   ASLVSAPKIFQALCKDNIYPAFQMFAKGYGKNNEPLRGYILTFLIALGFILIAELNVIA
FT                   PIISNFFLASYALINFSVFHASLAKSPGWRPAFKYYNMWISLIGAILCCIVMFVINWWA
FT                   ALLTYVIVLGLYIYVTYKKPDVNWGSSTQALTYLSALQHSIRLSGVEDHVKNFRPQCLV
FT                   MTGSPNSRPALLHLVHDFTKNVGLMICGHVHMGPRRQAMKEMSIDQARYQRWLIKNKMK
FT                   AFYAPVHADDLREGAQYLMQAAGLGRMKPNTLVLGFKKDWLQADMRDVDMYINLFHDAF
FT                   DIQFGVVVIRLKEGLDISHLQGQEELLSSQEKSPGTKDVVVNVDYSKKSDQDTCKSSGE
FT                   KSITQKDEEEDGKTPTQPLLKKESKGPIVPLNVADQKLLEASTQFQKKQGKNTIDVWWL
FT                   FDDGGLTLLIPYLLTTKKKWKDCKIRVFIGGKINRIDHDRRAMATLLSKFRIDFSDIMV
FT                   LGDINTKPKKENIIAFDDMIEPYRLHEDDKEQDIADKMKEDEPWRITDNELELYKTKTY
FT                   RQIRLNELLKEHSSTANIIVMSLPVARKGAVSSALYMAWLEALSKDLPPVLLVRGNHQS
FT                   VLTFYS"
FT   assembly_gap    20559258..20559312
FT                   /estimated_length=55
FT                   /gap_type="unknown"
FT   assembly_gap    20646942..20647009
FT                   /estimated_length=68
FT                   /gap_type="unknown"
FT   assembly_gap    20658433..20658738
FT                   /estimated_length=306
FT                   /gap_type="unknown"
FT   assembly_gap    20669226..20669325
FT                   /estimated_length=100
FT                   /gap_type="unknown"
FT   assembly_gap    20672272..20672332
FT                   /estimated_length=61
FT                   /gap_type="unknown"
FT   assembly_gap    20678104..20678123
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(20686942..>20894307)
FT                   /gene="Fbn2"
FT                   /locus_tag="mCG_124634"
FT                   /note="gene_id=mCG124634.1"
FT   mRNA            complement(join(20686942..20688948,20690532..20690709,
FT                   20691949..20692180,20697034..20697153,20698667..20698795,
FT                   20699371..20699487,20701528..20701650,20703381..20703506,
FT                   20704688..20704894,20706173..20706298,20713688..20713819,
FT                   20714262..20714384,20715380..20715499,20716120..20716245,
FT                   20716591..20716656,20717690..20717842,20718458..20718583,
FT                   20721972..20722091,20722670..20722798,20723748..20723864,
FT                   20726406..20726531,20727044..20727169,20727310..20727435,
FT                   20728720..20728788,20731474..20731626,20732180..20732305,
FT                   20733358..20733483,20733946..20734014,20734725..20734886,
FT                   20736884..20737006,20737857..20737979,20740163..20740288,
FT                   20742029..20742151,20744516..20744638,20746785..20746910,
FT                   20747647..20747772,20747926..20748048,20748467..20748592,
FT                   20750313..20750438,20751074..20751202,20754514..20754633,
FT                   20755140..20755367,20758674..20758799,20759252..20759302,
FT                   20759836..20759973,20763094..20763213,20769101..20769226,
FT                   20771822..20771947,20773784..20773837,20774512..20774664,
FT                   20781077..20781199,20782729..20782851,20787912..20788037,
FT                   20789110..20789229,20796111..20796248,20797259..20797471,
FT                   20798460..20798612,20807343..20807468,20832146..20832271,
FT                   20836960..20837157,20873182..20873277,20888222..20888310,
FT                   20893101..20893183,20894054..>20894307))
FT                   /gene="Fbn2"
FT                   /locus_tag="mCG_124634"
FT                   /product="fibrillin 2, transcript variant mCT125882"
FT                   /note="gene_id=mCG124634.1 transcript_id=mCT125882.1
FT                   created on 07-OCT-2002"
FT   CDS             complement(join(20688574..20688948,20690532..20690709,
FT                   20691949..20692180,20697034..20697153,20698667..20698795,
FT                   20699371..20699487,20701528..20701650,20703381..20703506,
FT                   20704688..20704894,20706173..20706298,20713688..20713819,
FT                   20714262..20714384,20715380..20715499,20716120..20716245,
FT                   20716591..20716656,20717690..20717842,20718458..20718583,
FT                   20721972..20722091,20722670..20722798,20723748..20723864,
FT                   20726406..20726531,20727044..20727169,20727310..20727435,
FT                   20728720..20728788,20731474..20731626,20732180..20732305,
FT                   20733358..20733483,20733946..20734014,20734725..20734886,
FT                   20736884..20737006,20737857..20737979,20740163..20740288,
FT                   20742029..20742151,20744516..20744638,20746785..20746910,
FT                   20747647..20747772,20747926..20748048,20748467..20748592,
FT                   20750313..20750438,20751074..20751202,20754514..20754633,
FT                   20755140..20755367,20758674..20758799,20759252..20759302,
FT                   20759836..20759973,20763094..20763213,20769101..20769226,
FT                   20771822..20771947,20773784..20773837,20774512..20774664,
FT                   20781077..20781199,20782729..20782851,20787912..20788037,
FT                   20789110..20789229,20796111..20796248,20797259..20797471,
FT                   20798460..20798612,20807343..20807468,20832146..20832271,
FT                   20836960..20837157,20873182..20873277,20888222..20888310,
FT                   20893101..>20893162))
FT                   /codon_start=1
FT                   /gene="Fbn2"
FT                   /locus_tag="mCG_124634"
FT                   /product="fibrillin 2, isoform CRA_a"
FT                   /note="gene_id=mCG124634.1 transcript_id=mCT125882.1
FT                   protein_id=mCP78048.1 isoform=CRA_a"
FT                   /protein_id="EDL09852.1"
FT                   /translation="IPLLLLPRMEDAPWRKSMHCPHLQEQLWRWILFPPQHVYLFQWTN
FT                   IPDMRTVCENGCQNGGRCIGPNRCACVYGFTGPQCERDYRTGPCFTQVNNQMCQGQLTG
FT                   IVCTKTLCCATIGRAWGHPCEMCPAQPQPCRRGFIPNIRTGACQDVDECQAIPGLCQGG
FT                   NCINTVGSFECRCPAGHKQSETTQKCEDIDECSVIPGVCETGDCSNTVGSYFCLCPRGF
FT                   VTSTDGSRCIDQRAGTCFSGLVNGRCAQELPGRMAKAQCCCEPGRCWSIGTIPEACPVR
FT                   GSEEYRRLCLDGLPMGGIPGSSVSRPGGTGSNGNGYGPGGTGFLPIPGDNGFSPGVGGA
FT                   GVGAGGQGPIITGLTILNQTIDICKHHANLCLNGRCIPTVSSYRCECNMGYKQDANGDC
FT                   IDVDECTSNPCSNGDCVNTPGSYYCKCHAGFQRTPTKQACIDIDECIQNGVLCKNGRCV
FT                   NTDGSFQCICNAGFELTTDGKNCVDHDECTTTNMCLNGMCINEDGSFKCVCKPGFVLAP
FT                   NGRYCTDVDECQTPGICMNGHCINNEGSFRCDCPPGLAVGVDGRVCVDTHMRSTCYGEI
FT                   KKGVCVRPFPGAVTKSECCCANPDYGFGEPCQPCPAKNSAEFHGLCSSGIGITVDGRDI
FT                   NECALDPDICANGICENLRGSYRCNCNSGYEPDASGRNCIDIDECLVNRLLCDNGLCRN
FT                   TPGSYSCTCPPGYVFRTETETCEDVNECESNPCVNGACRNNLGSFHCECSPGSKLSSTG
FT                   LICIDSLKGTCWLNIQDNRCEVNINGATLKSECCATLGAAWGSPCERCELDAACPRGFA
FT                   RIKGVTCEDVNECEVFPGVCPNGRCVNSKGSFHCECPEGLTLDGTGRVCLDIRMEHCFL
FT                   KWDEDECIHPVPGKFRMDACCCAVGAAWGTECEECPKPGTKEYETLCPRGPGFANRGDI
FT                   LTGRPFYKDINECKAFPGMCTYGKCRNTIGSFKCRCNNGFALDMEERNYIDECRISPDL
FT                   CGSGICVNTPGSFECECFEGYESGFMMMKNCMDIDECERNPLLCRGGTCVNTEGSFQCD
FT                   CPLGHELSPSREDCVDINECSLSDNLCRNGKCVNMIGTYQCSCNPGYQATPDRQGCTDI
FT                   DECMIMNGGCDTQCTNSEGSYECSCSEGYALMPDGRSCADIDECENNPDICDGGQCTNI
FT                   PGEYRCLCYDGFMASMDMKTCIDVNECDLNPNICMFGECENTKGSFICHCQLGYSVKKG
FT                   TTGCTDVDECEIGAHNCDMHASCLNVPGSFKCSCREGWVGNGIKCIDLDECANGTHQCS
FT                   INAQCVNTPGSYQCACSEGFTGDGFTCSDVDECAENTNLCENGQCLNVPGAYRCECEMG
FT                   FTPASDSRSCQDIDECSFQNICVFGTCNNLPGMFHCICDDGYELDRTGGNCTDIDECAD
FT                   PINCVNGLCVNTPGRYECNCPPDFQLNPTGVGCVDNRVGNCYLKFGPRGDGSLSCNTEV
FT                   GVGVSRSSCCCSLGKAWGNPCETCPPVNSTEYYTLCPGGEGFRPNPITIILEDIDECQE
FT                   LPGLCQGGNCINTFGSFQCECPQGYYLSEETRICEDIDECFAHPGVCGPGTCYNTLGNY
FT                   TCICPPEYMQVNGGHNCMDMRKSFCYRSYNGTTCENELPFNVTKRMCCCTYNVGKAWNK
FT                   PCEPCPTPGTADFKTICGNIPGFTFDIHTGKAVDIDECKEIPGICANGVCINQIGSFRC
FT                   ECPTGFSYNDLLLVCEDIDECSNGDNLCQRNADCINSPGSYRCECAAGFKLSPNGACVD
FT                   RNECLEIPNVCSHGLCVDLQGSYQCICNNGFKASQDQTMCMDVDECERHPCGNGTCKNT
FT                   VGSYNCLCYPGFELTHNNDCLDIDECSSFFGQVCRNGRCFNEIGSFKCLCNEGYELTPD
FT                   GKNCIDTNECVALPGSCSPGTCQNLEGSFRCICPPGYEVRSENCIDINECDEDPNICLF
FT                   GSCTNTPGGFQCICPPGFVLSDNGRRCFDTRQSFCFTNFENGKCSVPKAFNTTKAKCCC
FT                   SKMPGEGWGDPCELCPKDDEVAFQDLCPYGHGTVPSLHDTREDVNECLESPGICSNGQC
FT                   INTDGSFRCECPMGYNLDYTGVRCVDTDECSIGNPCGNGTCTNVIGSFECTCNEGFEPG
FT                   PMMNCEDINECAQNPLLCAFRCMNTFGSYECTCPVGYALREDQKMCKDLDECAEGLHDC
FT                   ESRGMMCKNLIGTFMCICPPGMARRPDGEGCVDENECRTKPGICENGRCVNIIGSYRCE
FT                   CNEGFQSSSSGTECLDNRQGLCFAEVLQTMCQMASSSRNLVTKSECCCDGGRGWGHQCE
FT                   LCPLPGTAQYKKICPHGPGYATDGRDIDECKVMPSLCTNGQCVNTMGSFRCFCKVGYTT
FT                   DISGTACVDLDECSQSPKPCNFICKNTKGSYQCSCPRGYVLQEDGKTCKDLDECQTKQH
FT                   NCQFLCVNTLGGFTCKCPPGFTQHHTACIDNNECGSQPSLCGAKGICQNTPGSFSCECQ
FT                   RGFSLDASGLNCEDVDECDGNHRCQHGCQNILGGYRCGCPQGYVQHYQWNQCVDENECS
FT                   NPGACGSASCYNTLGSYKCACPSGFSFDQFSSACHDVNECSSSKNPCSYGCSNTEGGYL
FT                   CGCPPGYFRVGQGHCVSGMGFNKGQYLSVDAEAEDDENALSPEACYECKINGYTKKDGR
FT                   RKRSAQEPEPASAEEQISLESVAMDSPVNMKFNLSGLGSKEHILELVPAIEPLNNHIRY
FT                   VISQGNEDGVFRIHQRNGLSYLHTAKKKLAPGTYTLEITSIPLYGKKELRKLEEHNEDD
FT                   YLLGVLGEALRMRLQIQLY"
FT   assembly_gap    20691432..20691451
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20701039..20701206
FT                   /estimated_length=168
FT                   /gap_type="unknown"
FT   assembly_gap    20706919..20707403
FT                   /estimated_length=485
FT                   /gap_type="unknown"
FT   assembly_gap    20720563..20720710
FT                   /estimated_length=148
FT                   /gap_type="unknown"
FT   assembly_gap    20730096..20730187
FT                   /estimated_length=92
FT                   /gap_type="unknown"
FT   mRNA            complement(join(20744223..20744638,20746785..20746910,
FT                   20747647..20747772,20747926..20748048,20748467..20748592,
FT                   20750313..20750438,20751074..20751208,20754514..20754633,
FT                   20755140..20755367,20758674..20758799,20759252..20759302,
FT                   20759836..20759973,20763094..20763213,20769101..20769226,
FT                   20771822..20771947,20773784..20773837,20774512..20774664,
FT                   20781077..20781199,20782729..20782851,20787912..20788037,
FT                   20789110..20789229,20796111..20796248,20797259..20797471,
FT                   20798460..20798601,20807343..20807468,20832146..20832271,
FT                   20836960..20837157,20873182..20873275,20888213..20888310,
FT                   20893101..20893183,20894054..>20894307))
FT                   /gene="Fbn2"
FT                   /locus_tag="mCG_124634"
FT                   /product="fibrillin 2, transcript variant mCT174093"
FT                   /note="gene_id=mCG124634.1 transcript_id=mCT174093.0
FT                   created on 07-OCT-2002"
FT   assembly_gap    20754357..20754512
FT                   /estimated_length=156
FT                   /gap_type="unknown"
FT   assembly_gap    20764224..20764243
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20767443..20767462
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20772596..20772954
FT                   /estimated_length=359
FT                   /gap_type="unknown"
FT   assembly_gap    20783788..20786738
FT                   /estimated_length=2951
FT                   /gap_type="unknown"
FT   assembly_gap    20789407..20789486
FT                   /estimated_length=80
FT                   /gap_type="unknown"
FT   CDS             complement(join(20798519..20798601,20807343..20807468,
FT                   20832146..20832271,20836960..20837157,20873182..20873275,
FT                   20888213..20888310,20893101..20893183,20894054..20894307))
FT                   /codon_start=1
FT                   /gene="Fbn2"
FT                   /locus_tag="mCG_124634"
FT                   /product="fibrillin 2, isoform CRA_b"
FT                   /note="gene_id=mCG124634.1 transcript_id=mCT174093.0
FT                   protein_id=mCP97012.0 isoform=CRA_b"
FT                   /protein_id="EDL09853.1"
FT                   /translation="MGRRRRLCLQPYFVWLGCVALWAQGTDGQPQPPPPKTLRPQPPPQ
FT                   QVRPAVAGSEGGFMGPEYRDEGAVAASRVRRRGQQEILRGPNVCGSRFHSYCCPGWKTL
FT                   PGGNQCIVPICRNSCGDGFCSRPNMCTCSSGQISPTCGAKSVCENGCQNGGRCIGPNRC
FT                   ACVYGFTGPQCERDYRTGPCFTQVNNQMCQGQLTGIVCTKTLCCATIGRAWGHPCEMCP
FT                   AQPQPCRRGFIPNIRTGACQDVDECQAIPGLCQGGNCINTVGSFECRCPAGHKQSETTQ
FT                   KCEDIDECSVIPGVCETGDCSNTVGSYFCLCPRGFVTSTDGSRCIGNMLLRPGEWPLCP
FT                   RTPGPNGKSSMLL"
FT   assembly_gap    20801716..20801735
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20804709..20804728
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20835278..20835297
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20856462..20856481
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20858467..20858486
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20881962..20885656
FT                   /estimated_length=3695
FT                   /gap_type="unknown"
FT   assembly_gap    20891736..20891779
FT                   /estimated_length=44
FT                   /gap_type="unknown"
FT   assembly_gap    20894610..20895119
FT                   /estimated_length=510
FT                   /gap_type="unknown"
FT   assembly_gap    20941517..20941536
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20942573..20942592
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20943697..20943716
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20946964..20946983
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20950188..20950584
FT                   /estimated_length=397
FT                   /gap_type="unknown"
FT   assembly_gap    20955508..20955527
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20963745..20963764
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20967644..20967728
FT                   /estimated_length=85
FT                   /gap_type="unknown"
FT   assembly_gap    20977351..20977370
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20981045..20981064
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20996625..20996644
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21011241..21011388
FT                   /estimated_length=148
FT                   /gap_type="unknown"
FT   assembly_gap    21040930..21041218
FT                   /estimated_length=289
FT                   /gap_type="unknown"
FT   assembly_gap    21045702..21046193
FT                   /estimated_length=492
FT                   /gap_type="unknown"
FT   assembly_gap    21120268..21124087
FT                   /estimated_length=3820
FT                   /gap_type="unknown"
FT   assembly_gap    21133937..21133981
FT                   /estimated_length=45
FT                   /gap_type="unknown"
FT   assembly_gap    21144700..21144719
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21148925..21149125
FT                   /estimated_length=201
FT                   /gap_type="unknown"
FT   assembly_gap    21168473..21168562
FT                   /estimated_length=90
FT                   /gap_type="unknown"
FT   assembly_gap    21172399..21172418
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21207281..21207300
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21214113..21214249
FT                   /estimated_length=137
FT                   /gap_type="unknown"
FT   gene            <21226410..21282995
FT                   /locus_tag="mCG_12542"
FT                   /note="gene_id=mCG12542.1"
FT   mRNA            join(<21226410..21227114,21242200..21242403,
FT                   21249980..21250138,21252383..21252507,21268730..21268924,
FT                   21275209..21275299,21277749..21277947,21279295..21279392,
FT                   21279919..21280049,21282304..21282995)
FT                   /locus_tag="mCG_12542"
FT                   /product="mCG12542"
FT                   /note="gene_id=mCG12542.1 transcript_id=mCT13210.1 created
FT                   on 07-OCT-2002"
FT   CDS             join(<21226601..21227114,21242200..21242403,
FT                   21249980..21250138,21252383..21252507,21268730..21268924,
FT                   21275209..21275299,21277749..21277947,21279295..21279392,
FT                   21279919..21280049,21282304..21282480)
FT                   /codon_start=1
FT                   /locus_tag="mCG_12542"
FT                   /product="mCG12542"
FT                   /note="gene_id=mCG12542.1 transcript_id=mCT13210.1
FT                   protein_id=mCP21517.1"
FT                   /protein_id="EDL09851.1"
FT                   /translation="DPSGLLEVWAPMLLSWLTGLGAGLLSLHFLQKLLFPYFWDDFWYL
FT                   LKVVRYGIQMEMYKLRGELVTVLDKFLSHTRKQPRKAFIIYEGDVYTYEDVDKRSNRIA
FT                   HALLNHSSLKRGDVVALLMSNEPDFVHVWFGLAKLGCVVAFLNSNLRFDSLLHCINTCE
FT                   PTAVVVGGDLLGSIEEILPSLPKHVRVWGMKDSVPEGIDSLQEKLSLASDEPVPPSHHV
FT                   TSSLKSTCLYIFTSGTTGLPKAAVISQLQVLKGSVGLWAFGCTADDIIYITLPLYHSSG
FT                   SLLGIGGCVELGATCVLKKKFSASQFWNDCKKYNVTVFQYIGELCRYLCKQPQREGEKD
FT                   HRVRLAVGNGLSSDVWRQFLDRFGNIKMCELYGATEGNIVFMNHTGKIGSVGRANFFYS
FT                   LFFSFELIKYDFQKDEPWRNGQGWCSCVRKGEPGLLISRVNKKNPFFGYAGSDTHTKSK
FT                   LLFDVFRKGDVYFNTGDLMFQDQENFVYFWDRLGDTFRWKGENVATTEVADVLGRLDFI
FT                   QEANVYGVRVPGYEGKAGMTSVILKPNKSLDLEKMYNQVVTSLPAYACPLFLRIQDKME
FT                   TTGTFKLKKLQLVEEGFDPLKISDPLYFMDNLKKSYVPLTEEIYNQIMSEEVKL"
FT   assembly_gap    21242468..21242621
FT                   /estimated_length=154
FT                   /gap_type="unknown"
FT   assembly_gap    21307550..21307569
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21309541..21309560
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21323471..21323681
FT                   /estimated_length=211
FT                   /gap_type="unknown"
FT   gene            21329692..21350601
FT                   /gene="Isoc1"
FT                   /locus_tag="mCG_124636"
FT                   /note="gene_id=mCG124636.1"
FT   mRNA            join(21329692..21330007,21341447..21341566,
FT                   21341687..21341890,21343489..21343605,21348005..21350601)
FT                   /gene="Isoc1"
FT                   /locus_tag="mCG_124636"
FT                   /product="isochorismatase domain containing 1"
FT                   /note="gene_id=mCG124636.1 transcript_id=mCT125884.1
FT                   created on 07-OCT-2002"
FT   CDS             join(21329702..21330007,21341447..21341566,
FT                   21341687..21341890,21343489..21343605,21348005..21348151)
FT                   /codon_start=1
FT                   /gene="Isoc1"
FT                   /locus_tag="mCG_124636"
FT                   /product="isochorismatase domain containing 1"
FT                   /note="gene_id=mCG124636.1 transcript_id=mCT125884.1
FT                   protein_id=mCP77352.0"
FT                   /protein_id="EDL09850.1"
FT                   /translation="MAAAEPSVAALAGGGVGAGAPSGGVPVLFCFSVFARPASVPHGAG
FT                   YDVLIQKFLSLYGDQLDMHRKFVVQLFAEEWGQYVDLPKGFAVSERCKLRLVPLQIQLT
FT                   TLGNLTPPSTVFFCCDMQERFRPAIKYFGDIISVGQRLLQGARILGIPVIITEQYPKGL
FT                   GSTVQEIDLTGVKLVLPKTKFSMVLPEVEAALAEIPGVRSVVLFGVETHVCIQQTALEL
FT                   VGRGIEVHIVADATSSRSMMDRMFALERLARTGIIVTTSEAVLLQLVADKDHPKFKEIQ
FT                   NLIKASAPESGLLSKV"
FT   assembly_gap    21332489..21332515
FT                   /estimated_length=27
FT                   /gap_type="unknown"
FT   assembly_gap    21371146..21371165
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21388378..21388913
FT                   /estimated_length=536
FT                   /gap_type="unknown"
FT   assembly_gap    21396752..21396860
FT                   /estimated_length=109
FT                   /gap_type="unknown"
FT   assembly_gap    21397903..21397922
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21400212..21400231
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            21451828..21460175
FT                   /locus_tag="mCG_147306"
FT                   /note="gene_id=mCG147306.0"
FT   mRNA            join(21451828..21451879,21457720..21460175)
FT                   /locus_tag="mCG_147306"
FT                   /product="mCG147306"
FT                   /note="gene_id=mCG147306.0 transcript_id=mCT187569.0
FT                   created on 13-JAN-2004"
FT   CDS             21458461..21458640
FT                   /codon_start=1
FT                   /locus_tag="mCG_147306"
FT                   /product="mCG147306"
FT                   /note="gene_id=mCG147306.0 transcript_id=mCT187569.0
FT                   protein_id=mCP109695.0"
FT                   /protein_id="EDL09849.1"
FT                   /translation="MRGNNQDPLHTEPSKLYFRQIMKELSPESSLYIPQKTPTLYTDPR
FT                   SATFIAAQYTTARK"
FT   assembly_gap    21478572..21478751
FT                   /estimated_length=180
FT                   /gap_type="unknown"
FT   assembly_gap    21479639..21484461
FT                   /estimated_length=4823
FT                   /gap_type="unknown"
FT   assembly_gap    21488081..21491875
FT                   /estimated_length=3795
FT                   /gap_type="unknown"
FT   gene            21514661..21726117
FT                   /gene="Adamts19"
FT                   /locus_tag="mCG_141254"
FT                   /note="gene_id=mCG141254.0"
FT   mRNA            join(21514661..21515259,21515804..21516453,
FT                   21568513..21568678,21579099..21579271,21580342..21580425,
FT                   21581146..21581303,21606314..21606357,21621431..21621536,
FT                   21631383..21631523,21633549..21633699,21642505..21642606,
FT                   21647771..21647901,21648979..21649103,21651750..21651877,
FT                   21664193..21664313,21667900..21667980,21680399..21680580,
FT                   21684088..21684241,21697626..21697761,21704954..21705131,
FT                   21706069..21706236,21721973..21722150,21725716..21726117)
FT                   /gene="Adamts19"
FT                   /locus_tag="mCG_141254"
FT                   /product="a disintegrin-like and metallopeptidase
FT                   (reprolysin type) with thrombospondin type 1 motif, 19,
FT                   transcript variant mCT174091"
FT                   /note="gene_id=mCG141254.0 transcript_id=mCT174091.0
FT                   created on 07-OCT-2002"
FT   mRNA            join(<21515172..21515259,21515804..21516453,
FT                   21568513..21568678,21579099..21579271,21580342..21580425,
FT                   21581146..21581303,21606314..21606357,21621431..21621536,
FT                   21631383..21631523,21633549..21633699,21642505..21642606,
FT                   21647771..21647901,21648931..21649103,21651750..21651877,
FT                   21664193..21664313,21667900..21667980,21680423..21680580,
FT                   21684088..21684241,21697626..21697761,21704954..21705158,
FT                   21706069..21706221,21721973..21722150,21725716..>21725867)
FT                   /gene="Adamts19"
FT                   /locus_tag="mCG_141254"
FT                   /product="a disintegrin-like and metallopeptidase
FT                   (reprolysin type) with thrombospondin type 1 motif, 19,
FT                   transcript variant mCT190297"
FT                   /note="gene_id=mCG141254.0 transcript_id=mCT190297.0
FT                   created on 08-MAR-2004"
FT   CDS             join(21515172..21515259,21515804..21516453,
FT                   21568513..21568678,21579099..21579271,21580342..21580425,
FT                   21581146..21581303,21606314..21606357,21621431..21621536,
FT                   21631383..21631523,21633549..21633699,21642505..21642606,
FT                   21647771..21647901,21648931..21649103,21651750..21651877,
FT                   21664193..21664313,21667900..21667980,21680423..21680580,
FT                   21684088..21684241,21697626..21697761,21704954..21705158,
FT                   21706069..21706221,21721973..21722150,21725716..21725867)
FT                   /codon_start=1
FT                   /gene="Adamts19"
FT                   /locus_tag="mCG_141254"
FT                   /product="a disintegrin-like and metallopeptidase
FT                   (reprolysin type) with thrombospondin type 1 motif, 19,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG141254.0 transcript_id=mCT190297.0
FT                   protein_id=mCP111269.0 isoform=CRA_b"
FT                   /protein_id="EDL09848.1"
FT                   /translation="MGPEMRLTRICCCCCLLYQLGFLSHGTTSGLQLTPDLEEWEVVFP
FT                   ALWRRESLNATGLSGGSSDPGSGRSSGGGGRGQASGSSREVRSVARAPQEEATRGQSEP
FT                   WFGSPLEPGAEDEEELESQELPRGSSGDTALSSGTPASWQPPLPPQRPSSPPPAQQEEP
FT                   SAEEVLLRIPALSRDLYLLLRRDGRFLAQRFAVEQWPKPGPDPTRATADPGSSLLPDAS
FT                   CFYTGTVLRHPGSLASFSTCGGGLMGFIQLNEDFLFIEPFNDTMAIIGHPHRLYRQKRS
FT                   TEEKVTENSAVHRHHCGVISDKGRPRSKKIADNRREKRYSYKLSQEYNIETVVVADPAM
FT                   VSYHGADAARRFILTILNMVFNLFQHKSLGVQVNLRVLKLILLHETPADLYIGHHGEKM
FT                   LESFCKWQHEEFGRRNDVHLEMSTSWGEDIAAVDAAILITRKDFCVHKDEPCDTVGIAY
FT                   LNGMCSEKRKCIIAEDNGLNLAFTIAHEMGHNMGINHDNDHPSCADGLHIMSGEWIKGQ
FT                   NLGDVSWSRCSKEDLERFLRSKASSCLLHTDPQSLSSVLVPSKLPGMAYTADEQCQILF
FT                   GPLASFCQEMQHVICTGLWCKVEGEAECRTKLDPPMDGTDCDPGKWCKAGECTRRTPAP
FT                   EHLAGEWSPWSSCSRSCSSGVSSRERKCPGLGSEARDCNGPRKQYRICENPPCPAGLPG
FT                   FRDWQCQAYSVRTSYPKHALQWQAVFDEEKPCALFCSPVGKEQPVLLSEKVMDGTSCGY
FT                   QGLDICANGRCQKAGCDGLLGSLAREDHCGVCNGNGKSCKVIKGDFNHTRGAGYVEVLV
FT                   IPAGARRIKVVEEKPAHSFLALRDASKQSINSDWKIEHSGAFSLAGTTVHYLRRGLWEK
FT                   ISAKGPTTTPLHLLVLLFQDQNYGLHYEYTVPSDPLPDNQSSKEPGPLFMWTHAGWGDC
FT                   NATCGGGERKTMVSCTKIMSKNISLVDNKKCKDLTKPEPQIRKCNEQPCQTRWMMTEWT
FT                   TCSRTCGKGVQSRQVACTQQLENGTLIRAWERDCLGPKPATVQRCEGQDCMTVWEAGVW
FT                   SECSVKCGKGVRHRTVRCTNPRKKCVLSTRPREAEDCEDYSKCYVWRVGDWSKCSITCG
FT                   KGMQSRVIQCMHKITGRHGNECFSSEKPAAYRPCHLQPCNEKINVNTITSPRLAALTFK
FT                   CLGDQWPVYCRVIREKNLCQDMRWYQRCCETCRDFYAQKLQQKS"
FT   CDS             join(21515172..21515259,21515804..21516453,
FT                   21568513..21568678,21579099..21579271,21580342..21580425,
FT                   21581146..21581303,21606314..21606357,21621431..21621536,
FT                   21631383..21631523,21633549..21633699,21642505..21642606,
FT                   21647771..21647901,21648979..21649103,21651750..21651877,
FT                   21664193..21664313,21667900..21667980,21680399..21680580,
FT                   21684088..21684241,21697626..21697761,21704954..21705131,
FT                   21706069..21706236,21721973..21722150,21725716..21725867)
FT                   /codon_start=1
FT                   /gene="Adamts19"
FT                   /locus_tag="mCG_141254"
FT                   /product="a disintegrin-like and metallopeptidase
FT                   (reprolysin type) with thrombospondin type 1 motif, 19,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG141254.0 transcript_id=mCT174091.0
FT                   protein_id=mCP97010.0 isoform=CRA_a"
FT                   /protein_id="EDL09847.1"
FT                   /translation="MGPEMRLTRICCCCCLLYQLGFLSHGTTSGLQLTPDLEEWEVVFP
FT                   ALWRRESLNATGLSGGSSDPGSGRSSGGGGRGQASGSSREVRSVARAPQEEATRGQSEP
FT                   WFGSPLEPGAEDEEELESQELPRGSSGDTALSSGTPASWQPPLPPQRPSSPPPAQQEEP
FT                   SAEEVLLRIPALSRDLYLLLRRDGRFLAQRFAVEQWPKPGPDPTRATADPGSSLLPDAS
FT                   CFYTGTVLRHPGSLASFSTCGGGLMGFIQLNEDFLFIEPFNDTMAIIGHPHRLYRQKRS
FT                   TEEKVTENSAVHRHHCGVISDKGRPRSKKIADNRREKRYSYKLSQEYNIETVVVADPAM
FT                   VSYHGADAARRFILTILNMVFNLFQHKSLGVQVNLRVLKLILLHETPADLYIGHHGEKM
FT                   LESFCKWQHEEFGRRNDVHLEMSTSWGEDIAAVDAAILITRKDFCVHKDEPCDTVGIAY
FT                   LNGMCSEKRKCIIAEDNGLNLAFTIAHEMGHNMGINHDNDHPSCADGLHIMSGEWIKGQ
FT                   NLGDVSWSRCSKEDLERFLRSKASSCLLHTDPQSLSSVLVPSKLPGMAYTADEQCQILF
FT                   GPLASFCQEMQHVICTGLWCKVEGEAECRTKLDPPMDGTDCDPGKWCKAGECTRRTPAP
FT                   EHLAGEWSPWSSCSRSCSSGVSSRERKCPGICENPPCPAGLPGFRDWQCQAYSVRTSYP
FT                   KHALQWQAVFDEEKPCALFCSPVGKEQPVLLSEKVMDGTSCGYQGLDICANGRCQKAGC
FT                   DGLLGSLAREDHCGVCNGNGKSCKVIKGDFNHTRGAGYVEVLVIPAGARRIKVVEEKPA
FT                   HSFLDRVLHLFIALRDASKQSINSDWKIEHSGAFSLAGTTVHYLRRGLWEKISAKGPTT
FT                   TPLHLLVLLFQDQNYGLHYEYTVPSDPLPDNQSSKEPGPLFMWTHAGWGDCNATCGGGE
FT                   RKTMVSCTKIMSKNISLVDNKKCKDLTKPEPQIRKCNEQPCQTRWMMTEWTTCSRTCGK
FT                   GVQSRQVACTQQLENGTLIRAWERDCLGPKPATVQRCEGQDCMTCSVKCGKGVRHRTVR
FT                   CTNPRKKCVLSTRPREAEDCEDYSKCYVWRVGDWSKVRMICCSITCGKGMQSRVIQCMH
FT                   KITGRHGNECFSSEKPAAYRPCHLQPCNEKINVNTITSPRLAALTFKCLGDQWPVYCRV
FT                   IREKNLCQDMRWYQRCCETCRDFYAQKLQQKS"
FT   assembly_gap    21532417..21539079
FT                   /estimated_length=6663
FT                   /gap_type="unknown"
FT   assembly_gap    21540538..21540557
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21592528..21592741
FT                   /estimated_length=214
FT                   /gap_type="unknown"
FT   assembly_gap    21595087..21599521
FT                   /estimated_length=4435
FT                   /gap_type="unknown"
FT   assembly_gap    21604651..21604670
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21608724..21608743
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21661248..21661579
FT                   /estimated_length=332
FT                   /gap_type="unknown"
FT   assembly_gap    21662878..21662897
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21674414..21674433
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21690188..21690207
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21735405..21735774
FT                   /estimated_length=370
FT                   /gap_type="unknown"
FT   gene            21738954..21749024
FT                   /gene="A730017C20Rik"
FT                   /locus_tag="mCG_12547"
FT                   /note="gene_id=mCG12547.1"
FT   mRNA            join(21738954..21739008,21739940..21740112,
FT                   21745316..21745540,21748681..21749024)
FT                   /gene="A730017C20Rik"
FT                   /locus_tag="mCG_12547"
FT                   /product="RIKEN cDNA A730017C20, transcript variant
FT                   mCT13215"
FT                   /note="gene_id=mCG12547.1 transcript_id=mCT13215.2 created
FT                   on 10-FEB-2003"
FT   mRNA            join(21738955..21739008,21745316..21745540,
FT                   21748681..21749024)
FT                   /gene="A730017C20Rik"
FT                   /locus_tag="mCG_12547"
FT                   /product="RIKEN cDNA A730017C20, transcript variant
FT                   mCT174095"
FT                   /note="gene_id=mCG12547.1 transcript_id=mCT174095.0 created
FT                   on 10-FEB-2003"
FT   mRNA            join(21738955..21739008,21740014..21740112,
FT                   21745316..21745540,21748681..21748956)
FT                   /gene="A730017C20Rik"
FT                   /locus_tag="mCG_12547"
FT                   /product="RIKEN cDNA A730017C20, transcript variant
FT                   mCT174096"
FT                   /note="gene_id=mCG12547.1 transcript_id=mCT174096.1 created
FT                   on 10-FEB-2003"
FT   mRNA            join(21738955..21740112,21745316..21747787)
FT                   /gene="A730017C20Rik"
FT                   /locus_tag="mCG_12547"
FT                   /product="RIKEN cDNA A730017C20, transcript variant
FT                   mCT179942"
FT                   /note="gene_id=mCG12547.1 transcript_id=mCT179942.0 created
FT                   on 10-FEB-2003"
FT   CDS             join(21740062..21740112,21745316..21745540,
FT                   21748681..21748860)
FT                   /codon_start=1
FT                   /gene="A730017C20Rik"
FT                   /locus_tag="mCG_12547"
FT                   /product="RIKEN cDNA A730017C20, isoform CRA_a"
FT                   /note="gene_id=mCG12547.1 transcript_id=mCT13215.2
FT                   protein_id=mCP21478.2 isoform=CRA_a"
FT                   /protein_id="EDL09843.1"
FT                   /translation="MPAYQEDREEDTCTIGEREKTIATQRIKGFGVENPVLPESPPASM
FT                   SSVMKNNPLYGDITLEEAMEERKKSPSWTIEEYDKHSVHTNLSGHLKENPNDLRFWLGD
FT                   TYTPGFDTLLKKKKKRNKRSKLCHMGLILLLVASILVTIVTLSTIFS"
FT   CDS             join(21740062..21740112,21745316..21745540,
FT                   21748681..21748860)
FT                   /codon_start=1
FT                   /gene="A730017C20Rik"
FT                   /locus_tag="mCG_12547"
FT                   /product="RIKEN cDNA A730017C20, isoform CRA_a"
FT                   /note="gene_id=mCG12547.1 transcript_id=mCT174096.1
FT                   protein_id=mCP97014.0 isoform=CRA_a"
FT                   /protein_id="EDL09844.1"
FT                   /translation="MPAYQEDREEDTCTIGEREKTIATQRIKGFGVENPVLPESPPASM
FT                   SSVMKNNPLYGDITLEEAMEERKKSPSWTIEEYDKHSVHTNLSGHLKENPNDLRFWLGD
FT                   TYTPGFDTLLKKKKKRNKRSKLCHMGLILLLVASILVTIVTLSTIFS"
FT   CDS             join(21740062..21740112,21745316..21745573)
FT                   /codon_start=1
FT                   /gene="A730017C20Rik"
FT                   /locus_tag="mCG_12547"
FT                   /product="RIKEN cDNA A730017C20, isoform CRA_b"
FT                   /note="gene_id=mCG12547.1 transcript_id=mCT179942.0
FT                   protein_id=mCP102864.0 isoform=CRA_b"
FT                   /protein_id="EDL09845.1"
FT                   /translation="MPAYQEDREEDTCTIGEREKTIATQRIKGFGVENPVLPESPPASM
FT                   SSVMKNNPLYGDITLEEAMEERKKSPSWTIEEYDKHSVHTNLSGHLKVCVLRMVSNG"
FT   CDS             join(21745397..21745540,21748681..21748860)
FT                   /codon_start=1
FT                   /gene="A730017C20Rik"
FT                   /locus_tag="mCG_12547"
FT                   /product="RIKEN cDNA A730017C20, isoform CRA_c"
FT                   /note="gene_id=mCG12547.1 transcript_id=mCT174095.0
FT                   protein_id=mCP97015.0 isoform=CRA_c"
FT                   /protein_id="EDL09846.1"
FT                   /translation="MSSVMKNNPLYGDITLEEAMEERKKSPSWTIEEYDKHSVHTNLSG
FT                   HLKENPNDLRFWLGDTYTPGFDTLLKKKKKRNKRSKLCHMGLILLLVASILVTIVTLST
FT                   IFS"
FT   assembly_gap    21760128..21760147
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21762397..21763107
FT                   /estimated_length=711
FT                   /gap_type="unknown"
FT   assembly_gap    21767454..21767738
FT                   /estimated_length=285
FT                   /gap_type="unknown"
FT   assembly_gap    21772068..21772087
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21787480..21787499
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21789306..21794407
FT                   /estimated_length=5102
FT                   /gap_type="unknown"
FT   assembly_gap    21801683..21801868
FT                   /estimated_length=186
FT                   /gap_type="unknown"
FT   gene            21848222..22081259
FT                   /locus_tag="mCG_51595"
FT                   /note="gene_id=mCG51595.2"
FT   mRNA            join(21848222..21848265,21848314..21849349,
FT                   21852130..21852413,22078835..22081259)
FT                   /locus_tag="mCG_51595"
FT                   /product="mCG51595"
FT                   /note="gene_id=mCG51595.2 transcript_id=mCT174420.0 created
FT                   on 17-OCT-2002"
FT   assembly_gap    21848292..21848311
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(21848542..21849349,21852130..21852413,
FT                   22078835..22080397)
FT                   /codon_start=1
FT                   /locus_tag="mCG_51595"
FT                   /product="mCG51595"
FT                   /note="gene_id=mCG51595.2 transcript_id=mCT174420.0
FT                   protein_id=mCP97339.0"
FT                   /db_xref="GOA:Q5DTK1"
FT                   /db_xref="InterPro:IPR008428"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="MGI:MGI:1926173"
FT                   /protein_id="EDL09842.1"
FT                   /translation="MAVRSRRPWVSVALGLVLGFTAASWLIAPRVAELSEKRRRGSSLC
FT                   SYYGRSATGPRADAQQLLPQPQSRPRLEQSPPPASHELPGPQQPEAAPGGPSFRSSPWQ
FT                   QPALLPQRRRGHTPEGATALPGAPAAKGEPEEEDGGAADPRKGGRPGSSHNGSGDGGAA
FT                   VPTSGPGDFLYVGVMTAQKYLGSRALAAQRTWARFIPGRVEFFSSQQSPSAALGQPPPP
FT                   LPVIALPGVDDSYPPQKKSFMMIKYMHDHYLDKYEWFMRADDDVYIKGDKLEEFLRSLN
FT                   SSKPLYLGQTGLGNTEELGKLGLEPGENFCMGGPGMIFSREVLRRMVPHIGECLREMYT
FT                   THEDVEVGRCVRRFGGTQCVWSYEMQQLFHENYEHNRKGYIQDLHNSKIHAAITLHPNK
FT                   RPAYQYRLHNYMLSRKISELRYRTIQLHRESALMSKLSNSEVSKEDQQLGRTPSFNHFQ
FT                   PRERNEVMEWEFLTGKLLYSAAENQPPRQSINSILRSALDDTVLQVMEMINENAKSRGR
FT                   LIDFKEIQYGYRRVDPMHGVEYILDLLLLYKRHKGRKLTVPVRRHAYLQQPFSKPFFRE
FT                   VEELDVNRLVESINSGTQSFSVISNSLKILSSLQEAKDIGGHNEKKVHILVPLVGRYDI
FT                   FLRFMENFESTCLIPKQNVKLVIILFSRDAGQESIKHIELIQEYQSRYPSAEMMLIPMK
FT                   GEFSRGLGLEMASSQFDNDTLLLFCDVDLIFRGDFLQRCRDNTVQGQQVYYPIIFSQYD
FT                   PKVTHMRNPPTEGDFVFSKETGFWRDYGYGITCIYKSDLLGAGGFDTSIQGWGLEDVDL
FT                   YNKVILSGLRPFRSQEVGVVHIFHPVHCDPNLDPKQYKMCLGSKASTFASTMQLAELWL
FT                   EKHLGVRDNRTLS"
FT   assembly_gap    21906099..21906118
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(21918146..21918924)
FT                   /pseudo
FT                   /locus_tag="mCG_1033358"
FT                   /note="gene_id=mCG1033358.1"
FT   mRNA            complement(21918146..21918924)
FT                   /pseudo
FT                   /locus_tag="mCG_1033358"
FT                   /note="gene_id=mCG1033358.1 transcript_id=mCT151062.1
FT                   created on 10-MAR-2003"
FT   assembly_gap    21925524..21925543
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21968448..21968698
FT                   /estimated_length=251
FT                   /gap_type="unknown"
FT   assembly_gap    21975566..21975898
FT                   /estimated_length=333
FT                   /gap_type="unknown"
FT   assembly_gap    22049065..22049166
FT                   /estimated_length=102
FT                   /gap_type="unknown"
FT   assembly_gap    22056372..22056444
FT                   /estimated_length=73
FT                   /gap_type="unknown"
FT   assembly_gap    22062567..22062586
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22071930..22071949
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22086036..22086055
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22087144..22087163
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22088510..22088529
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22089576..22089595
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22098839..22099007
FT                   /estimated_length=169
FT                   /gap_type="unknown"
FT   assembly_gap    22101447..22101466
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22103993..22104113
FT                   /estimated_length=121
FT                   /gap_type="unknown"
FT   assembly_gap    22118072..22118091
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22119537..22119556
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22120862..22120881
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22150699..22150718
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22157268..22157287
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22169250..22169448
FT                   /estimated_length=199
FT                   /gap_type="unknown"
FT   assembly_gap    22173780..22178679
FT                   /estimated_length=4900
FT                   /gap_type="unknown"
FT   assembly_gap    22180732..22180839
FT                   /estimated_length=108
FT                   /gap_type="unknown"
FT   assembly_gap    22195531..22196256
FT                   /estimated_length=726
FT                   /gap_type="unknown"
FT   assembly_gap    22211476..22211523
FT                   /estimated_length=48
FT                   /gap_type="unknown"
FT   assembly_gap    22223563..22223582
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22245101..22245120
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22289845..22290265
FT                   /estimated_length=421
FT                   /gap_type="unknown"
FT   assembly_gap    22299451..22299852
FT                   /estimated_length=402
FT                   /gap_type="unknown"
FT   assembly_gap    22308416..22308435
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22313174..22313255
FT                   /estimated_length=82
FT                   /gap_type="unknown"
FT   assembly_gap    22318616..22318635
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22319754..22319773
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22320886..22320905
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22322605..22322677
FT                   /estimated_length=73
FT                   /gap_type="unknown"
FT   assembly_gap    22325885..22326433
FT                   /estimated_length=549
FT                   /gap_type="unknown"
FT   assembly_gap    22402673..22402723
FT                   /estimated_length=51
FT                   /gap_type="unknown"
FT   assembly_gap    22419885..22419935
FT                   /estimated_length=51
FT                   /gap_type="unknown"
FT   gene            complement(22439579..22439964)
FT                   /pseudo
FT                   /locus_tag="mCG_15633"
FT                   /note="gene_id=mCG15633.0"
FT   mRNA            complement(22439579..22439964)
FT                   /pseudo
FT                   /locus_tag="mCG_15633"
FT                   /note="gene_id=mCG15633.0 transcript_id=mCT19134.0 created
FT                   on 07-OCT-2002"
FT   assembly_gap    22475711..22475730
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(22490752..>22531492)
FT                   /locus_tag="mCG_145927"
FT                   /note="gene_id=mCG145927.0"
FT   mRNA            complement(join(22490752..22491046,22494854..22494936,
FT                   22499963..22500025,22521329..22521452,22522094..22522235,
FT                   22530626..22530720,22531467..>22531492))
FT                   /locus_tag="mCG_145927"
FT                   /product="mCG145927"
FT                   /note="gene_id=mCG145927.0 transcript_id=mCT186035.0
FT                   created on 04-JUL-2003"
FT   gene            22490755..22522195
FT                   /pseudo
FT                   /locus_tag="mCG_141255"
FT                   /note="gene_id=mCG141255.0"
FT   mRNA            join(22490755..22491048,22494861..22494936,
FT                   22499986..22500038,22521331..22521465,22522085..22522195)
FT                   /pseudo
FT                   /locus_tag="mCG_141255"
FT                   /note="gene_id=mCG141255.0 transcript_id=mCT174092.0
FT                   created on 07-OCT-2002"
FT   CDS             complement(join(22494918..22494936,22499963..22500025,
FT                   22521329..22521452,22522094..>22522094))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145927"
FT                   /product="mCG145927"
FT                   /note="gene_id=mCG145927.0 transcript_id=mCT186035.0
FT                   protein_id=mCP107759.0"
FT                   /protein_id="EDL09841.1"
FT                   /translation="GLWIEASILLCVVQVPADERRASLSLYQTEISSELHNCRNNLSCF
FT                   RGCYLEGFTILHANIIKKFYDIL"
FT   assembly_gap    22500143..22500194
FT                   /estimated_length=52
FT                   /gap_type="unknown"
FT   assembly_gap    22506776..22506795
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22508430..22508449
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22516359..22516378
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22538195..22538504
FT                   /estimated_length=310
FT                   /gap_type="unknown"
FT   assembly_gap    22541122..22542768
FT                   /estimated_length=1647
FT                   /gap_type="unknown"
FT   assembly_gap    22549794..22549942
FT                   /estimated_length=149
FT                   /gap_type="unknown"
FT   assembly_gap    22551593..22551612
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22562111..22562704
FT                   /estimated_length=594
FT                   /gap_type="unknown"
FT   gene            22565545..22565911
FT                   /pseudo
FT                   /locus_tag="mCG_1033356"
FT                   /note="gene_id=mCG1033356.1"
FT   mRNA            22565545..22565911
FT                   /pseudo
FT                   /locus_tag="mCG_1033356"
FT                   /note="gene_id=mCG1033356.1 transcript_id=mCT151060.1
FT                   created on 10-MAR-2003"
FT   assembly_gap    22568244..22569707
FT                   /estimated_length=1464
FT                   /gap_type="unknown"
FT   assembly_gap    22596966..22597091
FT                   /estimated_length=126
FT                   /gap_type="unknown"
FT   assembly_gap    22598647..22598695
FT                   /estimated_length=49
FT                   /gap_type="unknown"
FT   assembly_gap    22600845..22600864
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22602532..22602551
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22616024..22616043
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22621046..22621065
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22633019..22633249
FT                   /estimated_length=231
FT                   /gap_type="unknown"
FT   assembly_gap    22657102..22657121
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22662891..22662910
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22664609..22664628
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22669411..22669430
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22703396..22703415
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22711927..22711946
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22720839..22721089
FT                   /estimated_length=251
FT                   /gap_type="unknown"
FT   assembly_gap    22736147..22737366
FT                   /estimated_length=1220
FT                   /gap_type="unknown"
FT   assembly_gap    22741108..22741127
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22769888..22769907
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22775899..22776105
FT                   /estimated_length=207
FT                   /gap_type="unknown"
FT   assembly_gap    22786867..22786886
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22801245..22801296
FT                   /estimated_length=52
FT                   /gap_type="unknown"
FT   gene            22834515..23322106
FT                   /locus_tag="mCG_147283"
FT                   /note="gene_id=mCG147283.0"
FT   mRNA            join(22834515..22834544,23313971..23314401,
FT                   23317447..23317660,23319749..23322106)
FT                   /locus_tag="mCG_147283"
FT                   /product="mCG147283"
FT                   /note="gene_id=mCG147283.0 transcript_id=mCT187546.0
FT                   created on 13-JAN-2004"
FT   assembly_gap    22839336..22839355
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <22845057..>22845777
FT                   /locus_tag="mCG_1033355"
FT                   /note="gene_id=mCG1033355.1"
FT   mRNA            <22845057..>22845777
FT                   /locus_tag="mCG_1033355"
FT                   /product="mCG1033355"
FT                   /note="gene_id=mCG1033355.1 transcript_id=mCT151059.1
FT                   created on 10-MAR-2003"
FT   CDS             <22845376..>22845777
FT                   /codon_start=1
FT                   /locus_tag="mCG_1033355"
FT                   /product="mCG1033355"
FT                   /note="gene_id=mCG1033355.1 transcript_id=mCT151059.1
FT                   protein_id=mCP77318.1"
FT                   /protein_id="EDL09840.1"
FT                   /translation="CAYCEKAFSRKTEPTAYPLTHTGGKPYDCTECKNTLFHKSQLTIH
FT                   HRTNTGEKPYKSNDCGKAFCQKSHPFGHQRILTKEKKNYVCAECKKAFFQKSHITGHQQ
FT                   IPTEEKHYICAECGRPLLEVVLCSKSENSH"
FT   assembly_gap    22848999..22849018
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22850250..22850269
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22851469..22851488
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22852926..22852945
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22863486..22863549
FT                   /estimated_length=64
FT                   /gap_type="unknown"
FT   assembly_gap    22873250..22873483
FT                   /estimated_length=234
FT                   /gap_type="unknown"
FT   assembly_gap    22874438..22874457
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            22881791..22883156
FT                   /pseudo
FT                   /locus_tag="mCG_142656"
FT                   /note="gene_id=mCG142656.0"
FT   mRNA            22881791..22883156
FT                   /pseudo
FT                   /locus_tag="mCG_142656"
FT                   /note="gene_id=mCG142656.0 transcript_id=mCT181475.0
FT                   created on 24-MAR-2003"
FT   gene            22899909..22907723
FT                   /locus_tag="mCG_142655"
FT                   /note="gene_id=mCG142655.0"
FT   mRNA            join(22899909..22900001,22906332..22907723)
FT                   /locus_tag="mCG_142655"
FT                   /product="mCG142655"
FT                   /note="gene_id=mCG142655.0 transcript_id=mCT181474.0
FT                   created on 24-MAR-2003"
FT   CDS             22906352..22907572
FT                   /codon_start=1
FT                   /locus_tag="mCG_142655"
FT                   /product="mCG142655"
FT                   /note="gene_id=mCG142655.0 transcript_id=mCT181474.0
FT                   protein_id=mCP104397.0"
FT                   /db_xref="GOA:Q3UED7"
FT                   /db_xref="InterPro:IPR007743"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:3644953"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UED7"
FT                   /protein_id="EDL09839.1"
FT                   /translation="MGQLFSSRRSEDQDLSSSFIEYLKECEKGINIIPHEIITSIEINM
FT                   KKGNIQEVNSTVRDMLREIDNTPLNVALTGETGSGKSSFINTLRGIGHEEGGAAHTGVT
FT                   DKTKERHPYEHPKMPNVVFWDLPGTGSEDFQPKTYLEKMKFYEYDFFIIISATRFKKND
FT                   IDLAKAIGIMKKEFYFVRTQVDSDLRNEEDFKPQTFDREKVLQDIRLNCVNTFRENGIA
FT                   EPPIFLISNKNVCHYDFPVLMDKLISDLPVFKRQNFMFSLPNITDSVIEKKRNFLRWKT
FT                   WLEGFADGLLSFFLESDLETLEKSMKFYRTVFGVDDASLQRLARAWEIDQVDQVRAMIK
FT                   SPAVFTPTDEETIQERLSRYNQEFCLANGYLLPKNHCREILYLKLYFLDMVTEDAKTLL
FT                   KEICLRN"
FT   assembly_gap    22916909..22917117
FT                   /estimated_length=209
FT                   /gap_type="unknown"
FT   assembly_gap    22930313..22930332
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22933875..22933894
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22937772..22937791
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            22954003..22962187
FT                   /locus_tag="mCG_59313"
FT                   /note="gene_id=mCG59313.2"
FT   mRNA            join(22954003..22954728,22960849..22962187)
FT                   /locus_tag="mCG_59313"
FT                   /product="mCG59313"
FT                   /note="gene_id=mCG59313.2 transcript_id=mCT59496.2 created
FT                   on 07-OCT-2002"
FT   CDS             22960869..22962119
FT                   /codon_start=1
FT                   /locus_tag="mCG_59313"
FT                   /product="mCG59313"
FT                   /note="gene_id=mCG59313.2 transcript_id=mCT59496.2
FT                   protein_id=mCP41571.2"
FT                   /db_xref="GOA:G3UWE2"
FT                   /db_xref="InterPro:IPR007743"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:3588218"
FT                   /db_xref="UniProtKB/TrEMBL:G3UWE2"
FT                   /protein_id="EDL09838.1"
FT                   /translation="MGQLLSDTSKTEDNEDLVSSFNEYFKNIKTEKIISQETIDLIKLY
FT                   LNKGNIHGANSLISDALRNIDNAPINIAVTGESGAGKSSLINALIGIGPEEEGAAEVGV
FT                   IETTMKRTSYKHPKIETLTLWDLPGIGTQKFPPKTYLEEVKFKEYDFFIIVSATRFTKL
FT                   ELDLAKAITNMKKNYYFVRTKVDIDVENERKSKPRTFEREKALKQIQSYSVKIFNDNNM
FT                   AVPPIFLISNYDLSDYDFPFLVDTLIKELHVQKRHNFMLSLPNFTDQAIDRKYKATQQF
FT                   IWLEAFKIGVVAIFPVLGNLRNKDMKKIKNTLNYYQKIFGVDDESLELVAKDFQVPVEQ
FT                   VKKTMKTPHLLKKYREETFRNDFKKLVSTFGRLLAVGLYFPAIYYLQLHILDTVTEDAK
FT                   VLLRWKYSKPRSNSTYP"
FT   assembly_gap    22966154..22966740
FT                   /estimated_length=587
FT                   /gap_type="unknown"
FT   assembly_gap    22972586..22972605
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22996223..22996242
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22997883..22997902
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23000993..23006598
FT                   /estimated_length=5606
FT                   /gap_type="unknown"
FT   gene            23037592..23054198
FT                   /gene="LOC435565"
FT                   /locus_tag="mCG_15634"
FT                   /note="gene_id=mCG15634.1"
FT   mRNA            join(23037592..23037702,23051361..23054198)
FT                   /gene="LOC435565"
FT                   /locus_tag="mCG_15634"
FT                   /product="interferon-inducible GTPase-like, transcript
FT                   variant mCT19135"
FT                   /note="gene_id=mCG15634.1 transcript_id=mCT19135.1 created
FT                   on 07-OCT-2002"
FT   mRNA            join(23037619..23037702,23049828..23049939,
FT                   23051361..23054198)
FT                   /gene="LOC435565"
FT                   /locus_tag="mCG_15634"
FT                   /product="interferon-inducible GTPase-like, transcript
FT                   variant mCT174108"
FT                   /note="gene_id=mCG15634.1 transcript_id=mCT174108.0 created
FT                   on 07-OCT-2002"
FT   mRNA            join(23037647..23037702,23044176..23044358,
FT                   23051361..23054198)
FT                   /gene="LOC435565"
FT                   /locus_tag="mCG_15634"
FT                   /product="interferon-inducible GTPase-like, transcript
FT                   variant mCT174107"
FT                   /note="gene_id=mCG15634.1 transcript_id=mCT174107.0 created
FT                   on 07-OCT-2002"
FT   mRNA            join(23038965..23039166,23040134..23040179,
FT                   23051361..23054198)
FT                   /gene="LOC435565"
FT                   /locus_tag="mCG_15634"
FT                   /product="interferon-inducible GTPase-like, transcript
FT                   variant mCT174109"
FT                   /note="gene_id=mCG15634.1 transcript_id=mCT174109.0 created
FT                   on 07-OCT-2002"
FT   mRNA            join(23044281..23044358,23049049..23049165,
FT                   23049828..23049939,23051361..23054198)
FT                   /gene="LOC435565"
FT                   /locus_tag="mCG_15634"
FT                   /product="interferon-inducible GTPase-like, transcript
FT                   variant mCT174110"
FT                   /note="gene_id=mCG15634.1 transcript_id=mCT174110.0 created
FT                   on 07-OCT-2002"
FT   CDS             23051381..23052622
FT                   /codon_start=1
FT                   /gene="LOC435565"
FT                   /locus_tag="mCG_15634"
FT                   /product="interferon-inducible GTPase-like, isoform CRA_a"
FT                   /note="gene_id=mCG15634.1 transcript_id=mCT174107.0
FT                   protein_id=mCP97027.0 isoform=CRA_a"
FT                   /db_xref="GOA:J7NNX8"
FT                   /db_xref="InterPro:IPR007743"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1926259"
FT                   /db_xref="UniProtKB/TrEMBL:J7NNX8"
FT                   /protein_id="EDL09833.1"
FT                   /translation="MGQLFSSPKSDENNDLPSSFTGYFKKFNTGRKIISQEILNLIELR
FT                   MRKGNIQLTNSAISDALKEIDSSVLNVAVTGETGSGKSSFINTLRGIGNEEEGAAKTGV
FT                   VEVTMERHPYKHPNIPNVVFWDLPGIGSTNFPPNTYLEKMKFYEYDFFIIISATRFKKN
FT                   DIDIAKAISMMKKEFYFVRTKVDSDITNEADGKPQTFDKEKVLQDIRLNCVNTFRENGI
FT                   AEPPIFLLSNKNVCHYDFPVLMDKLISDLPIYKRHNFMVSLPNITDSVIEKKRQFLKQR
FT                   IWLEGFAADLVNIIPSLTFLLDSDLETLKKSMKFYRTVFGVDETSLQRLARDWEIEVDQ
FT                   VEAMIKSPAVFKPTDEETIQERLSRYIQEFCLANGYLLPKNSFLKEIFYLKYYFLDMVT
FT                   EDAKTLLKEICLRN"
FT   CDS             23051381..23052622
FT                   /codon_start=1
FT                   /gene="LOC435565"
FT                   /locus_tag="mCG_15634"
FT                   /product="interferon-inducible GTPase-like, isoform CRA_a"
FT                   /note="gene_id=mCG15634.1 transcript_id=mCT174108.0
FT                   protein_id=mCP97028.0 isoform=CRA_a"
FT                   /db_xref="GOA:J7NNX8"
FT                   /db_xref="InterPro:IPR007743"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1926259"
FT                   /db_xref="UniProtKB/TrEMBL:J7NNX8"
FT                   /protein_id="EDL09834.1"
FT                   /translation="MGQLFSSPKSDENNDLPSSFTGYFKKFNTGRKIISQEILNLIELR
FT                   MRKGNIQLTNSAISDALKEIDSSVLNVAVTGETGSGKSSFINTLRGIGNEEEGAAKTGV
FT                   VEVTMERHPYKHPNIPNVVFWDLPGIGSTNFPPNTYLEKMKFYEYDFFIIISATRFKKN
FT                   DIDIAKAISMMKKEFYFVRTKVDSDITNEADGKPQTFDKEKVLQDIRLNCVNTFRENGI
FT                   AEPPIFLLSNKNVCHYDFPVLMDKLISDLPIYKRHNFMVSLPNITDSVIEKKRQFLKQR
FT                   IWLEGFAADLVNIIPSLTFLLDSDLETLKKSMKFYRTVFGVDETSLQRLARDWEIEVDQ
FT                   VEAMIKSPAVFKPTDEETIQERLSRYIQEFCLANGYLLPKNSFLKEIFYLKYYFLDMVT
FT                   EDAKTLLKEICLRN"
FT   CDS             23051381..23052622
FT                   /codon_start=1
FT                   /gene="LOC435565"
FT                   /locus_tag="mCG_15634"
FT                   /product="interferon-inducible GTPase-like, isoform CRA_a"
FT                   /note="gene_id=mCG15634.1 transcript_id=mCT174110.0
FT                   protein_id=mCP97026.0 isoform=CRA_a"
FT                   /db_xref="GOA:J7NNX8"
FT                   /db_xref="InterPro:IPR007743"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1926259"
FT                   /db_xref="UniProtKB/TrEMBL:J7NNX8"
FT                   /protein_id="EDL09835.1"
FT                   /translation="MGQLFSSPKSDENNDLPSSFTGYFKKFNTGRKIISQEILNLIELR
FT                   MRKGNIQLTNSAISDALKEIDSSVLNVAVTGETGSGKSSFINTLRGIGNEEEGAAKTGV
FT                   VEVTMERHPYKHPNIPNVVFWDLPGIGSTNFPPNTYLEKMKFYEYDFFIIISATRFKKN
FT                   DIDIAKAISMMKKEFYFVRTKVDSDITNEADGKPQTFDKEKVLQDIRLNCVNTFRENGI
FT                   AEPPIFLLSNKNVCHYDFPVLMDKLISDLPIYKRHNFMVSLPNITDSVIEKKRQFLKQR
FT                   IWLEGFAADLVNIIPSLTFLLDSDLETLKKSMKFYRTVFGVDETSLQRLARDWEIEVDQ
FT                   VEAMIKSPAVFKPTDEETIQERLSRYIQEFCLANGYLLPKNSFLKEIFYLKYYFLDMVT
FT                   EDAKTLLKEICLRN"
FT   CDS             23051381..23052622
FT                   /codon_start=1
FT                   /gene="LOC435565"
FT                   /locus_tag="mCG_15634"
FT                   /product="interferon-inducible GTPase-like, isoform CRA_a"
FT                   /note="gene_id=mCG15634.1 transcript_id=mCT19135.1
FT                   protein_id=mCP21490.2 isoform=CRA_a"
FT                   /db_xref="GOA:J7NNX8"
FT                   /db_xref="InterPro:IPR007743"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1926259"
FT                   /db_xref="UniProtKB/TrEMBL:J7NNX8"
FT                   /protein_id="EDL09836.1"
FT                   /translation="MGQLFSSPKSDENNDLPSSFTGYFKKFNTGRKIISQEILNLIELR
FT                   MRKGNIQLTNSAISDALKEIDSSVLNVAVTGETGSGKSSFINTLRGIGNEEEGAAKTGV
FT                   VEVTMERHPYKHPNIPNVVFWDLPGIGSTNFPPNTYLEKMKFYEYDFFIIISATRFKKN
FT                   DIDIAKAISMMKKEFYFVRTKVDSDITNEADGKPQTFDKEKVLQDIRLNCVNTFRENGI
FT                   AEPPIFLLSNKNVCHYDFPVLMDKLISDLPIYKRHNFMVSLPNITDSVIEKKRQFLKQR
FT                   IWLEGFAADLVNIIPSLTFLLDSDLETLKKSMKFYRTVFGVDETSLQRLARDWEIEVDQ
FT                   VEAMIKSPAVFKPTDEETIQERLSRYIQEFCLANGYLLPKNSFLKEIFYLKYYFLDMVT
FT                   EDAKTLLKEICLRN"
FT   CDS             23051381..23052622
FT                   /codon_start=1
FT                   /gene="LOC435565"
FT                   /locus_tag="mCG_15634"
FT                   /product="interferon-inducible GTPase-like, isoform CRA_a"
FT                   /note="gene_id=mCG15634.1 transcript_id=mCT174109.0
FT                   protein_id=mCP97029.0 isoform=CRA_a"
FT                   /db_xref="GOA:J7NNX8"
FT                   /db_xref="InterPro:IPR007743"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1926259"
FT                   /db_xref="UniProtKB/TrEMBL:J7NNX8"
FT                   /protein_id="EDL09837.1"
FT                   /translation="MGQLFSSPKSDENNDLPSSFTGYFKKFNTGRKIISQEILNLIELR
FT                   MRKGNIQLTNSAISDALKEIDSSVLNVAVTGETGSGKSSFINTLRGIGNEEEGAAKTGV
FT                   VEVTMERHPYKHPNIPNVVFWDLPGIGSTNFPPNTYLEKMKFYEYDFFIIISATRFKKN
FT                   DIDIAKAISMMKKEFYFVRTKVDSDITNEADGKPQTFDKEKVLQDIRLNCVNTFRENGI
FT                   AEPPIFLLSNKNVCHYDFPVLMDKLISDLPIYKRHNFMVSLPNITDSVIEKKRQFLKQR
FT                   IWLEGFAADLVNIIPSLTFLLDSDLETLKKSMKFYRTVFGVDETSLQRLARDWEIEVDQ
FT                   VEAMIKSPAVFKPTDEETIQERLSRYIQEFCLANGYLLPKNSFLKEIFYLKYYFLDMVT
FT                   EDAKTLLKEICLRN"
FT   assembly_gap    23063761..23064775
FT                   /estimated_length=1015
FT                   /gap_type="unknown"
FT   assembly_gap    23067927..23068511
FT                   /estimated_length=585
FT                   /gap_type="unknown"
FT   assembly_gap    23075553..23075591
FT                   /estimated_length=39
FT                   /gap_type="unknown"
FT   gene            23078910..23079987
FT                   /locus_tag="mCG_15632"
FT                   /note="gene_id=mCG15632.2"
FT   mRNA            23078910..23079987
FT                   /locus_tag="mCG_15632"
FT                   /product="mCG15632"
FT                   /note="gene_id=mCG15632.2 transcript_id=mCT19133.2 created
FT                   on 07-OCT-2002"
FT   CDS             23079019..23079936
FT                   /codon_start=1
FT                   /locus_tag="mCG_15632"
FT                   /product="mCG15632"
FT                   /note="gene_id=mCG15632.2 transcript_id=mCT19133.2
FT                   protein_id=mCP21492.1"
FT                   /protein_id="EDL09832.1"
FT                   /translation="MEVLDEFDNEFPLSVTFCQLISEDDFERQAATYTERALRRLFSTL
FT                   DRNPALAERVVRKGKQTEFEQRGLLCSLWAKFVCAVQGDLNQCNDMGAIEMLRRLEQLK
FT                   RRIHRVHLYSQDAKKRRRRPKPKKPDPIFRDQSTSACLPPALLPPPLLPPPPQPVTTVA
FT                   SVVAASPSVYTMPWVFGPFPPLSGKPMEKLDISSSEVKLNWSGLSSTSKSHMVDLNPLV
FT                   LNPGGFHFSYLAGSSAHKLHCPGFPWTPACSRPSNTDETPSPVVKTSIFTPPVLLKFQP
FT                   VPRPNDDSENDPGSAESTPAKESQ"
FT   gene            23092032..23096636
FT                   /locus_tag="mCG_6032"
FT                   /note="gene_id=mCG6032.2"
FT   mRNA            join(23092032..23092235,23094516..23096037,
FT                   23096318..23096636)
FT                   /locus_tag="mCG_6032"
FT                   /product="mCG6032"
FT                   /note="gene_id=mCG6032.2 transcript_id=mCT4704.2 created on
FT                   07-OCT-2002"
FT   assembly_gap    23092908..23092927
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             23094535..23095191
FT                   /codon_start=1
FT                   /locus_tag="mCG_6032"
FT                   /product="mCG6032"
FT                   /note="gene_id=mCG6032.2 transcript_id=mCT4704.2
FT                   protein_id=mCP21566.2"
FT                   /protein_id="EDL09831.1"
FT                   /translation="MGQLFSNMPKDEDKGILESSFTEYFRNYKQETKIISEETTRSIEL
FT                   CLKKGDIQRANSIISDALKNIDNAPINIAVTGESGAGKSSLINALREIKAEEESAAEVG
FT                   VTETTMKVYSYKHPKVKNLTLWDLPGIGTKKFPPKTYLETVEFKKYDFFIIVSATRFTN
FT                   HEIELAKAIRIMKKNYYFVRSKVDFDLYNEEKSKPRNFNREKHSESDPKFLSGYI"
FT   assembly_gap    23113563..23114100
FT                   /estimated_length=538
FT                   /gap_type="unknown"
FT   gene            complement(23127083..23154036)
FT                   /gene="2010002N04Rik"
FT                   /locus_tag="mCG_147304"
FT                   /note="gene_id=mCG147304.0"
FT   mRNA            complement(join(23127083..23128475,23153904..23154036))
FT                   /gene="2010002N04Rik"
FT                   /locus_tag="mCG_147304"
FT                   /product="RIKEN cDNA 2010002N04"
FT                   /note="gene_id=mCG147304.0 transcript_id=mCT187567.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(23127723..23128148)
FT                   /codon_start=1
FT                   /gene="2010002N04Rik"
FT                   /locus_tag="mCG_147304"
FT                   /product="RIKEN cDNA 2010002N04"
FT                   /note="gene_id=mCG147304.0 transcript_id=mCT187567.0
FT                   protein_id=mCP109693.0"
FT                   /protein_id="EDL09830.1"
FT                   /translation="MSSRDLTLSPRLSLAFSRGSRPLPSYLTGLWEPRDSGGKSCLRAV
FT                   KPHRPCAVRSFEESKTPEAAAGTGGEGGWERGTLASAPHAEPSKMVHPSPSKSEFCFCF
FT                   CFQVTLFPFFLVWEKERVWQAREMSKSFRSVSANPCS"
FT   assembly_gap    23133266..23133407
FT                   /estimated_length=142
FT                   /gap_type="unknown"
FT   assembly_gap    23144459..23145673
FT                   /estimated_length=1215
FT                   /gap_type="unknown"
FT   assembly_gap    23155093..23155196
FT                   /estimated_length=104
FT                   /gap_type="unknown"
FT   assembly_gap    23157210..23157279
FT                   /estimated_length=70
FT                   /gap_type="unknown"
FT   gene            23178543..23210062
FT                   /gene="Dctn4"
FT                   /locus_tag="mCG_6022"
FT                   /note="gene_id=mCG6022.2"
FT   mRNA            join(23178543..23178743,23188953..23189133,
FT                   23192895..23192938,23195362..23195469,23197071..23197144,
FT                   23197544..23197656,23198091..23198200,23201495..23201568,
FT                   23203197..23203251,23204154..23204261,23206415..23206512,
FT                   23207536..23210062)
FT                   /gene="Dctn4"
FT                   /locus_tag="mCG_6022"
FT                   /product="dynactin 4, transcript variant mCT174152"
FT                   /note="gene_id=mCG6022.2 transcript_id=mCT174152.0 created
FT                   on 07-OCT-2002"
FT   mRNA            join(23178543..23178743,23185772..23185954,
FT                   23188955..23189133,23192895..23192938,23195362..23195469,
FT                   23196680..23196700,23197071..23197144,23197544..23197656,
FT                   23198091..23198200,23201495..23201568,23203197..23203251,
FT                   23204154..23204261,23206415..23206512,23207536..23209470)
FT                   /gene="Dctn4"
FT                   /locus_tag="mCG_6022"
FT                   /product="dynactin 4, transcript variant mCT174151"
FT                   /note="gene_id=mCG6022.2 transcript_id=mCT174151.0 created
FT                   on 07-OCT-2002"
FT   mRNA            join(23178544..23178743,23185772..23185954,
FT                   23188955..23189133,23192895..23192938,23195362..23195469,
FT                   23197071..23197144,23197544..23197656,23198091..23198200,
FT                   23201495..23201568,23203197..23203251,23204154..23204261,
FT                   23206415..23206512,23207536..23209470)
FT                   /gene="Dctn4"
FT                   /locus_tag="mCG_6022"
FT                   /product="dynactin 4, transcript variant mCT4716"
FT                   /note="gene_id=mCG6022.2 transcript_id=mCT4716.2 created on
FT                   07-OCT-2002"
FT   CDS             join(23178607..23178743,23185772..23185954,
FT                   23188955..23189133,23192895..23192938,23195362..23195469,
FT                   23196680..23196700,23197071..23197144,23197544..23197656,
FT                   23198091..23198200,23201495..23201568,23203197..23203251,
FT                   23204154..23204261,23206415..23206512,23207536..23207749)
FT                   /codon_start=1
FT                   /gene="Dctn4"
FT                   /locus_tag="mCG_6022"
FT                   /product="dynactin 4, isoform CRA_b"
FT                   /note="gene_id=mCG6022.2 transcript_id=mCT174151.0
FT                   protein_id=mCP97070.0 isoform=CRA_b"
FT                   /protein_id="EDL09827.1"
FT                   /translation="MASLLQSERVLYLVQGEKKVRAPLSQLYFCRYCSELRSLECVSHE
FT                   VCANCFDCPGCMHTLSTRATSISTQLPDDPAKTTMKKAYYLACGFCRWTSRDVGMADKS
FT                   VGECANCFDCPGCMHTLSTRATSISTQLPDDPAKTTMKKAYYLACGFCRWTSRDVGMAD
FT                   KSVASGGWQEPENPHTQRMNKLIEYYQQLAQKEKVERDRKKLARRRNYMPLAFSQHTIH
FT                   VVDKYSLGTRLQRPRAGASISTLAGLSLREGEDQKEVKIEPAQAVAEVEPLPEDYYTRP
FT                   VNLTEVTTLQQRLLQPDLQPVSASQLYPRHKHLLIKRSLRCRKCEHNLSKPEFNPTSIK
FT                   FKIQLVAVNYIPEVRIMSIPNLRYMKESQVLLTLTNPVENLTHVTLLECDEGDPDNINS
FT                   TAKVVVPPKELILAGKDAAAEYDELAEPQDFQDDPDIVAFRKANKVGIFIKVTPQREEG
FT                   EVTVCFKMKHDFKNLAAPIRPVEEGDQGTEVIWLTQHVELSFGPLLP"
FT   CDS             join(23178607..23178743,23185772..23185954,
FT                   23188955..23189133,23192895..23192938,23195362..23195469,
FT                   23197071..23197144,23197544..23197656,23198091..23198200,
FT                   23201495..23201568,23203197..23203251,23204154..23204261,
FT                   23206415..23206512,23207536..23207749)
FT                   /codon_start=1
FT                   /gene="Dctn4"
FT                   /locus_tag="mCG_6022"
FT                   /product="dynactin 4, isoform CRA_d"
FT                   /note="gene_id=mCG6022.2 transcript_id=mCT4716.2
FT                   protein_id=mCP21536.2 isoform=CRA_d"
FT                   /protein_id="EDL09829.1"
FT                   /translation="MASLLQSERVLYLVQGEKKVRAPLSQLYFCRYCSELRSLECVSHE
FT                   VCANCFDCPGCMHTLSTRATSISTQLPDDPAKTTMKKAYYLACGFCRWTSRDVGMADKS
FT                   VGECANCFDCPGCMHTLSTRATSISTQLPDDPAKTTMKKAYYLACGFCRWTSRDVGMAD
FT                   KSVASGGWQEPENPHTQRMNKLIEYYQQLAQKEKVERDRKKLARRRNYMPLAFSDKYSL
FT                   GTRLQRPRAGASISTLAGLSLREGEDQKEVKIEPAQAVAEVEPLPEDYYTRPVNLTEVT
FT                   TLQQRLLQPDLQPVSASQLYPRHKHLLIKRSLRCRKCEHNLSKPEFNPTSIKFKIQLVA
FT                   VNYIPEVRIMSIPNLRYMKESQVLLTLTNPVENLTHVTLLECDEGDPDNINSTAKVVVP
FT                   PKELILAGKDAAAEYDELAEPQDFQDDPDIVAFRKANKVGIFIKVTPQREEGEVTVCFK
FT                   MKHDFKNLAAPIRPVEEGDQGTEVIWLTQHVELSFGPLLP"
FT   CDS             join(23178726..23178743,23188953..23189133,
FT                   23192895..23192938,23195362..23195469,23197071..23197144,
FT                   23197544..23197656,23198091..23198200,23201495..23201568,
FT                   23203197..23203251,23204154..23204261,23206415..23206512,
FT                   23207536..23207749)
FT                   /codon_start=1
FT                   /gene="Dctn4"
FT                   /locus_tag="mCG_6022"
FT                   /product="dynactin 4, isoform CRA_c"
FT                   /note="gene_id=mCG6022.2 transcript_id=mCT174152.0
FT                   protein_id=mCP97069.0 isoform=CRA_c"
FT                   /protein_id="EDL09828.1"
FT                   /translation="MCVARGRCANCFDCPGCMHTLSTRATSISTQLPDDPAKTTMKKAY
FT                   YLACGFCRWTSRDVGMADKSVASGGWQEPENPHTQRMNKLIEYYQQLAQKEKVERDRKK
FT                   LARRRNYMPLAFSDKYSLGTRLQRPRAGASISTLAGLSLREGEDQKEVKIEPAQAVAEV
FT                   EPLPEDYYTRPVNLTEVTTLQQRLLQPDLQPVSASQLYPRHKHLLIKRSLRCRKCEHNL
FT                   SKPEFNPTSIKFKIQLVAVNYIPEVRIMSIPNLRYMKESQVLLTLTNPVENLTHVTLLE
FT                   CDEGDPDNINSTAKVVVPPKELILAGKDAAAEYDELAEPQDFQDDPDIVAFRKANKVGI
FT                   FIKVTPQREEGEVTVCFKMKHDFKNLAAPIRPVEEGDQGTEVIWLTQHVELSFGPLLP"
FT   assembly_gap    23180117..23184068
FT                   /estimated_length=3952
FT                   /gap_type="unknown"
FT   assembly_gap    23187018..23187037
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23188607..23188626
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23190984..23191003
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            join(23196557..23197144,23197544..23197656,
FT                   23198091..23198200,23201495..23201568,23203197..23203251,
FT                   23204154..23204261,23206415..23206512,23207536..23209470)
FT                   /gene="Dctn4"
FT                   /locus_tag="mCG_6022"
FT                   /product="dynactin 4, transcript variant mCT174150"
FT                   /note="gene_id=mCG6022.2 transcript_id=mCT174150.0 created
FT                   on 07-OCT-2002"
FT   CDS             join(23203222..23203251,23204154..23204261,
FT                   23206415..23206512,23207536..23207749)
FT                   /codon_start=1
FT                   /gene="Dctn4"
FT                   /locus_tag="mCG_6022"
FT                   /product="dynactin 4, isoform CRA_a"
FT                   /note="gene_id=mCG6022.2 transcript_id=mCT174150.0
FT                   protein_id=mCP97071.0 isoform=CRA_a"
FT                   /protein_id="EDL09826.1"
FT                   /translation="MSIPNLRYMKESQVLLTLTNPVENLTHVTLLECDEGDPDNINSTA
FT                   KVVVPPKELILAGKDAAAEYDELAEPQDFQDDPDIVAFRKANKVGIFIKVTPQREEGEV
FT                   TVCFKMKHDFKNLAAPIRPVEEGDQGTEVIWLTQHVELSFGPLLP"
FT   gene            23211628..23224114
FT                   /locus_tag="mCG_6024"
FT                   /note="gene_id=mCG6024.1"
FT   mRNA            join(23211628..23212186,23212558..23212611,
FT                   23215078..23215107,23215683..23215815,23216939..23217039,
FT                   23217674..23217846,23218677..23218877,23220663..23220827,
FT                   23222087..23222177,23222308..23222440,23223126..23224114)
FT                   /locus_tag="mCG_6024"
FT                   /product="mCG6024, transcript variant mCT4713"
FT                   /note="gene_id=mCG6024.1 transcript_id=mCT4713.1 created on
FT                   07-OCT-2002"
FT   mRNA            join(<23212086..23212186,23212558..23212611,
FT                   23215078..23215107,23215683..23215815,23216939..23217039,
FT                   23217674..23217846,23218677..23218877,23220663..23220827,
FT                   23222087..23222177,23222308..23222440,23223126..23223840,
FT                   23223921..23224025)
FT                   /locus_tag="mCG_6024"
FT                   /product="mCG6024, transcript variant mCT190312"
FT                   /note="gene_id=mCG6024.1 transcript_id=mCT190312.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<23212088..23212186,23212558..23212611,
FT                   23215078..23215107,23215683..23215815,23216939..23217039,
FT                   23217674..23217846,23218677..23218877,23220663..23220827,
FT                   23222087..23222177,23222308..23222440,23223126..23223256)
FT                   /codon_start=1
FT                   /locus_tag="mCG_6024"
FT                   /product="mCG6024, isoform CRA_b"
FT                   /note="gene_id=mCG6024.1 transcript_id=mCT190312.0
FT                   protein_id=mCP111302.0 isoform=CRA_b"
FT                   /protein_id="EDL09824.1"
FT                   /translation="SVSRVGSRSCPGTPDMATSLGSNTYNRQNWEDADFPILCQTCLGE
FT                   NPYIRMTKEKYGKECKICARPFTVFRWCPGVRMRFKKTEVCQTCSKLKNVCQTCLLDLE
FT                   YGLPIQVRDAGLSFKDDMPKSDVNKEYYTQNMEREISNSDGTRPVGMLGKATSTSDMLL
FT                   KLARTTPYYKRNRPHICSFWVKGECKRGEECPYRHEKPTDPDDPLADQNIKDRYYGIND
FT                   PVADKLLKRASTMPRLDPPEDKTITTLYVGGLGDTITETDLRNHFYQFGEIRTITVVQR
FT                   QQCAFIQFATRQAAEVAAEKSFNKLIVNGRRLNVKWGRSQAARGKEKEKDGTTDSGDQA
FT                   RTCARTALEVFSPPPAAEEEASANYFNLPPSGPPAVVNIALPPPPGIAPPPPPGFGPHM
FT                   FHPMGPPPPFMRAPGPIHYPSQDPQRMGAHAGKHSSP"
FT   CDS             join(23212133..23212186,23212558..23212611,
FT                   23215078..23215107,23215683..23215815,23216939..23217039,
FT                   23217674..23217846,23218677..23218877,23220663..23220827,
FT                   23222087..23222177,23222308..23222440,23223126..23223256)
FT                   /codon_start=1
FT                   /locus_tag="mCG_6024"
FT                   /product="mCG6024, isoform CRA_c"
FT                   /note="gene_id=mCG6024.1 transcript_id=mCT4713.1
FT                   protein_id=mCP21577.2 isoform=CRA_c"
FT                   /protein_id="EDL09825.1"
FT                   /translation="MATSLGSNTYNRQNWEDADFPILCQTCLGENPYIRMTKEKYGKEC
FT                   KICARPFTVFRWCPGVRMRFKKTEVCQTCSKLKNVCQTCLLDLEYGLPIQVRDAGLSFK
FT                   DDMPKSDVNKEYYTQNMEREISNSDGTRPVGMLGKATSTSDMLLKLARTTPYYKRNRPH
FT                   ICSFWVKGECKRGEECPYRHEKPTDPDDPLADQNIKDRYYGINDPVADKLLKRASTMPR
FT                   LDPPEDKTITTLYVGGLGDTITETDLRNHFYQFGEIRTITVVQRQQCAFIQFATRQAAE
FT                   VAAEKSFNKLIVNGRRLNVKWGRSQAARGKEKEKDGTTDSGDQARTCARTALEVFSPPP
FT                   AAEEEASANYFNLPPSGPPAVVNIALPPPPGIAPPPPPGFGPHMFHPMGPPPPFMRAPG
FT                   PIHYPSQDPQRMGAHAGKHSSP"
FT   mRNA            join(23221983..23222177,23222308..23222440,
FT                   23223126..23224114)
FT                   /locus_tag="mCG_6024"
FT                   /product="mCG6024, transcript variant mCT174153"
FT                   /note="gene_id=mCG6024.1 transcript_id=mCT174153.0 created
FT                   on 07-OCT-2002"
FT   CDS             23223140..23223256
FT                   /codon_start=1
FT                   /locus_tag="mCG_6024"
FT                   /product="mCG6024, isoform CRA_a"
FT                   /note="gene_id=mCG6024.1 transcript_id=mCT174153.0
FT                   protein_id=mCP97072.0 isoform=CRA_a"
FT                   /protein_id="EDL09823.1"
FT                   /translation="MFHPMGPPPPFMRAPGPIHYPSQDPQRMGAHAGKHSSP"
FT   assembly_gap    23227478..23227674
FT                   /estimated_length=197
FT                   /gap_type="unknown"
FT   gene            complement(23227718..23241779)
FT                   /locus_tag="mCG_142210"
FT                   /note="gene_id=mCG142210.0"
FT   mRNA            complement(join(23227718..23227936,23240177..23240238,
FT                   23241679..23241779))
FT                   /locus_tag="mCG_142210"
FT                   /product="mCG142210"
FT                   /note="gene_id=mCG142210.0 transcript_id=mCT179415.0
FT                   created on 06-FEB-2003"
FT   CDS             complement(join(23227905..23227936,23240177..23240237))
FT                   /codon_start=1
FT                   /locus_tag="mCG_142210"
FT                   /product="mCG142210"
FT                   /note="gene_id=mCG142210.0 transcript_id=mCT179415.0
FT                   protein_id=mCP102337.0"
FT                   /protein_id="EDL09822.1"
FT                   /translation="MIPKEQKEPVMAVPGDLAEPGPPCHLEDPT"
FT   assembly_gap    23229473..23236120
FT                   /estimated_length=6648
FT                   /gap_type="unknown"
FT   gene            complement(23243969..>23254160)
FT                   /locus_tag="mCG_6023"
FT                   /note="gene_id=mCG6023.2"
FT   mRNA            complement(join(23243969..23246474,23250400..>23254160))
FT                   /locus_tag="mCG_6023"
FT                   /product="mCG6023"
FT                   /note="gene_id=mCG6023.2 transcript_id=mCT4714.2 created on
FT                   07-OCT-2002"
FT   CDS             complement(23252088..23254160)
FT                   /codon_start=1
FT                   /locus_tag="mCG_6023"
FT                   /product="mCG6023"
FT                   /note="gene_id=mCG6023.2 transcript_id=mCT4714.2
FT                   protein_id=mCP21477.2"
FT                   /db_xref="GOA:Q3URF1"
FT                   /db_xref="InterPro:IPR028753"
FT                   /db_xref="MGI:MGI:1099446"
FT                   /db_xref="UniProtKB/TrEMBL:Q3URF1"
FT                   /protein_id="EDL09821.1"
FT                   /translation="MEGYSEEASLLRHLEKVASEEEEVPLVVYLKENAALLTANGLHLS
FT                   QSRETQQSSPNPPDTEVPSPAADINQNPSSPNATLTTLASSSHHSQPTADINQNPPAAI
FT                   TPVPQNSSQAQCSPNGTLDSKPGTLCADDGQSPVPAEEVRSSILLIDKVSAPPSAASTF
FT                   SREATPLSSSGPPAADLMSSSLLIDMQPSTLVAPAEQEVPGHVAVTTPTKVYSEVHLTL
FT                   AKPASVVNRTARPFGIQSPGTSQIEQSPMMGRRQFGEKAWAPPASSMADRSPQPQRHIM
FT                   SRSPMVERRLLGQRSPVLERRPLGNFTPPPTYAETLSTAPVASRVRSPPSYSTLYPSSD
FT                   PKPSHLKGQVAPANKTGILEESMARRGSRKSMFTFVEKPKVTPNPDLLDLVQTADEKRR
FT                   QRDHGEVGMEEEPFALGAEASNFQQEPIARDRASPAAAEEAVPEWASCLKSPRIQAKPK
FT                   PKPNQNLSEASGKGAELYARRQSRMEKYVIESSGHAELARCPSPTMSLPSSWKYTTNAP
FT                   GGFRVASLSPARTPPASLYHGYLPENGVLRPEPTKQQPYQMRPSLYALSPVKEPAKASS
FT                   RATSSRTPSRTVSPRAASPAKPSSLDLVPNLPRAGLPPSPALPRPSRSSPGLYTAPVQD
FT                   SLQPTAVSPTYSSDISPVSPSRAWSPRAKQAPRPSFSTRNAGIEAQVWKPSFCFK"
FT   gene            complement(23255888..>23310001)
FT                   /locus_tag="mCG_145148"
FT                   /note="gene_id=mCG145148.0"
FT   mRNA            complement(join(23255888..23257029,23279368..23280000,
FT                   23302784..23302892,23309959..>23310001))
FT                   /locus_tag="mCG_145148"
FT                   /product="mCG145148"
FT                   /note="gene_id=mCG145148.0 transcript_id=mCT184572.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(23256974..23257029,23279368..>23279986))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145148"
FT                   /product="mCG145148"
FT                   /note="gene_id=mCG145148.0 transcript_id=mCT184572.0
FT                   protein_id=mCP106257.0"
FT                   /protein_id="EDL09820.1"
FT                   /translation="RGHPNRTQEDKEKVLDFVFTQPRKNLPYPSARSHSSPVCQQKKVN
FT                   LQRTQGDLERTQEQDSLTPARQWWLLGTAKEGAIMLGAHFPPPPLGASEGRAAPCTFQI
FT                   PDGSYRCLALEAEESSSEDGLQGEVRLVDLEEEGTSQSRANHGTPPLSRAPAIIQPSSC
FT                   HREARGGFQRSDRPSHDWDVVQARKVMTASGSSSPVPRVAQKPAKKPMTLGEDESLPKP
FT                   QG"
FT   assembly_gap    23274203..23274477
FT                   /estimated_length=275
FT                   /gap_type="unknown"
FT   assembly_gap    23312464..23312483
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             23320057..23320392
FT                   /codon_start=1
FT                   /locus_tag="mCG_147283"
FT                   /product="mCG147283"
FT                   /note="gene_id=mCG147283.0 transcript_id=mCT187546.0
FT                   protein_id=mCP109671.0"
FT                   /protein_id="EDL09819.1"
FT                   /translation="MPGKPEQLLRRSTQLEGSQGSQACGQGRLWSGVATHPFRWGPQRL
FT                   GKWLCEQCLTLFLANSATPYTSPPLTPTDHIFCPPPPKNNPDATHPVPLGSLTQHTGQG
FT                   RRGGGGF"
FT   assembly_gap    23332118..23332233
FT                   /estimated_length=116
FT                   /gap_type="unknown"
FT   gene            complement(23335074..23398909)
FT                   /gene="Ndst1"
FT                   /locus_tag="mCG_6025"
FT                   /note="gene_id=mCG6025.2"
FT   mRNA            complement(join(23335074..23339944,23340544..23340646,
FT                   23341759..23341868,23342510..23342680,23345909..23346083,
FT                   23347640..23347763,23349012..23349108,23350081..23350263,
FT                   23350945..23351073,23353346..23353531,23354310..23354464,
FT                   23355649..23355736,23358174..23358668,23363296..23364205,
FT                   23398887..23398909))
FT                   /gene="Ndst1"
FT                   /locus_tag="mCG_6025"
FT                   /product="N-deacetylase/N-sulfotransferase (heparan
FT                   glucosaminyl) 1, transcript variant mCT4712"
FT                   /note="gene_id=mCG6025.2 transcript_id=mCT4712.2 created on
FT                   07-OCT-2002"
FT   mRNA            complement(join(23335074..23339944,23340544..23340646,
FT                   23341759..23341868,23342510..23342680,23345909..23346083,
FT                   23347640..23347763,23349012..23349108,23350081..23350263,
FT                   23350945..23351073,23353346..23353531,23354310..23354464,
FT                   23355649..23355736,23358174..23358668,23363296..23364205,
FT                   23378045..23378136))
FT                   /gene="Ndst1"
FT                   /locus_tag="mCG_6025"
FT                   /product="N-deacetylase/N-sulfotransferase (heparan
FT                   glucosaminyl) 1, transcript variant mCT174155"
FT                   /note="gene_id=mCG6025.2 transcript_id=mCT174155.0 created
FT                   on 07-OCT-2002"
FT   mRNA            complement(join(23335614..23339944,23340544..23340646,
FT                   23341759..23341868,23342510..23342680,23345909..23346083,
FT                   23347640..23347763,23349012..23349108,23350081..23350263,
FT                   23350945..23351073,23353346..23353531,23354310..23354464,
FT                   23355649..23355736,23358174..23358668,23363296..23364205,
FT                   23383579..23383651))
FT                   /gene="Ndst1"
FT                   /locus_tag="mCG_6025"
FT                   /product="N-deacetylase/N-sulfotransferase (heparan
FT                   glucosaminyl) 1, transcript variant mCT174154"
FT                   /note="gene_id=mCG6025.2 transcript_id=mCT174154.0 created
FT                   on 07-OCT-2002"
FT   CDS             complement(join(23339825..23339944,23340544..23340646,
FT                   23341759..23341868,23342510..23342680,23345909..23346083,
FT                   23347640..23347763,23349012..23349108,23350081..23350263,
FT                   23350945..23351073,23353346..23353531,23354310..23354464,
FT                   23355649..23355736,23358174..23358668,23363296..23363808))
FT                   /codon_start=1
FT                   /gene="Ndst1"
FT                   /locus_tag="mCG_6025"
FT                   /product="N-deacetylase/N-sulfotransferase (heparan
FT                   glucosaminyl) 1, isoform CRA_a"
FT                   /note="gene_id=mCG6025.2 transcript_id=mCT174154.0
FT                   protein_id=mCP97073.0 isoform=CRA_a"
FT                   /protein_id="EDL09816.1"
FT                   /translation="MPALACLRRLCRHLSPQAVLFLLFVFCLFSVFVSAYYLYGWNRGL
FT                   EPSADASESDCGDPPPVAPSRLLPIKPVQAVAPSRTDPLVLVFVESLYSQLGQEVVAIL
FT                   ESSRFKYRTEIAPGKGDMPTLTDKGRGRFALIIYENILKYVNLDAWNRELLDKYCVAYG
FT                   VGIIGFFKANENSLLSAQLKGFPLFLHSNLGLKDCSINPKSPLLYVTRPSEVEKGVLPG
FT                   EDWTVFQSNHSTYEPVLLAKTRSSESIPHLGADAGLHAALHATVVQDLGLHDGIQRVLF
FT                   GNNLNFWLHKLVFVDAVAFLTGKRLSLPLDRYILVDIDDIFVGKEGTRMKVEDVKALFD
FT                   TQNELRTHIPNFTFNLGYSGKFFHTGTDAEDAGDDLLLSYVKEFWWFPHMWSHMQPHLF
FT                   HNQSVLAEQMALNKKFAVEHGIPTDMGYAVAPHHSGVYPVHVQLYEAWKQVWGIRVTST
FT                   EEYPHLKPARYRRGFIHNGIMVLPRQTCGLFTHTIFYNEYPGGSSELDKIINGGELFLT
FT                   VLLNPISIFMTHLSNYGNDRLGLYTFKHLVRFLHSWTNLRLQTLPPVQLAQKYFQIFSE
FT                   EKDPLWQDPCEDKRHKDIWSKEKTCDRFPKLLIIGPQKTGTTALYLFLGMHPDLSSNYP
FT                   SSETFEEIQFFNGHNYHKGIDWYMEFFPIPSNTTSDFYFEKSANYFDSEVAPRRAAALL
FT                   PKAKILSILINPADRAYSWYQHQRAHDDPVALKYTFHEVITAGPDASSKLRALQNRCLV
FT                   PGWYATHIERWLSAFHANQILVLDGKLLRTEPAKVMDTVQKFLGVTSTVDYHKTLAFDP
FT                   KKGFWCQLLEGGKTKCLGKSKGRKYPEMDLDSRAFLKDYFRDHNIELSKLLYKMGQTLP
FT                   TWLREDLQNTR"
FT   CDS             complement(join(23339825..23339944,23340544..23340646,
FT                   23341759..23341868,23342510..23342680,23345909..23346083,
FT                   23347640..23347763,23349012..23349108,23350081..23350263,
FT                   23350945..23351073,23353346..23353531,23354310..23354464,
FT                   23355649..23355736,23358174..23358668,23363296..23363808))
FT                   /codon_start=1
FT                   /gene="Ndst1"
FT                   /locus_tag="mCG_6025"
FT                   /product="N-deacetylase/N-sulfotransferase (heparan
FT                   glucosaminyl) 1, isoform CRA_a"
FT                   /note="gene_id=mCG6025.2 transcript_id=mCT174155.0
FT                   protein_id=mCP97074.0 isoform=CRA_a"
FT                   /protein_id="EDL09817.1"
FT                   /translation="MPALACLRRLCRHLSPQAVLFLLFVFCLFSVFVSAYYLYGWNRGL
FT                   EPSADASESDCGDPPPVAPSRLLPIKPVQAVAPSRTDPLVLVFVESLYSQLGQEVVAIL
FT                   ESSRFKYRTEIAPGKGDMPTLTDKGRGRFALIIYENILKYVNLDAWNRELLDKYCVAYG
FT                   VGIIGFFKANENSLLSAQLKGFPLFLHSNLGLKDCSINPKSPLLYVTRPSEVEKGVLPG
FT                   EDWTVFQSNHSTYEPVLLAKTRSSESIPHLGADAGLHAALHATVVQDLGLHDGIQRVLF
FT                   GNNLNFWLHKLVFVDAVAFLTGKRLSLPLDRYILVDIDDIFVGKEGTRMKVEDVKALFD
FT                   TQNELRTHIPNFTFNLGYSGKFFHTGTDAEDAGDDLLLSYVKEFWWFPHMWSHMQPHLF
FT                   HNQSVLAEQMALNKKFAVEHGIPTDMGYAVAPHHSGVYPVHVQLYEAWKQVWGIRVTST
FT                   EEYPHLKPARYRRGFIHNGIMVLPRQTCGLFTHTIFYNEYPGGSSELDKIINGGELFLT
FT                   VLLNPISIFMTHLSNYGNDRLGLYTFKHLVRFLHSWTNLRLQTLPPVQLAQKYFQIFSE
FT                   EKDPLWQDPCEDKRHKDIWSKEKTCDRFPKLLIIGPQKTGTTALYLFLGMHPDLSSNYP
FT                   SSETFEEIQFFNGHNYHKGIDWYMEFFPIPSNTTSDFYFEKSANYFDSEVAPRRAAALL
FT                   PKAKILSILINPADRAYSWYQHQRAHDDPVALKYTFHEVITAGPDASSKLRALQNRCLV
FT                   PGWYATHIERWLSAFHANQILVLDGKLLRTEPAKVMDTVQKFLGVTSTVDYHKTLAFDP
FT                   KKGFWCQLLEGGKTKCLGKSKGRKYPEMDLDSRAFLKDYFRDHNIELSKLLYKMGQTLP
FT                   TWLREDLQNTR"
FT   CDS             complement(join(23339825..23339944,23340544..23340646,
FT                   23341759..23341868,23342510..23342680,23345909..23346083,
FT                   23347640..23347763,23349012..23349108,23350081..23350263,
FT                   23350945..23351073,23353346..23353531,23354310..23354464,
FT                   23355649..23355736,23358174..23358668,23363296..23363808))
FT                   /codon_start=1
FT                   /gene="Ndst1"
FT                   /locus_tag="mCG_6025"
FT                   /product="N-deacetylase/N-sulfotransferase (heparan
FT                   glucosaminyl) 1, isoform CRA_a"
FT                   /note="gene_id=mCG6025.2 transcript_id=mCT4712.2
FT                   protein_id=mCP21544.2 isoform=CRA_a"
FT                   /protein_id="EDL09818.1"
FT                   /translation="MPALACLRRLCRHLSPQAVLFLLFVFCLFSVFVSAYYLYGWNRGL
FT                   EPSADASESDCGDPPPVAPSRLLPIKPVQAVAPSRTDPLVLVFVESLYSQLGQEVVAIL
FT                   ESSRFKYRTEIAPGKGDMPTLTDKGRGRFALIIYENILKYVNLDAWNRELLDKYCVAYG
FT                   VGIIGFFKANENSLLSAQLKGFPLFLHSNLGLKDCSINPKSPLLYVTRPSEVEKGVLPG
FT                   EDWTVFQSNHSTYEPVLLAKTRSSESIPHLGADAGLHAALHATVVQDLGLHDGIQRVLF
FT                   GNNLNFWLHKLVFVDAVAFLTGKRLSLPLDRYILVDIDDIFVGKEGTRMKVEDVKALFD
FT                   TQNELRTHIPNFTFNLGYSGKFFHTGTDAEDAGDDLLLSYVKEFWWFPHMWSHMQPHLF
FT                   HNQSVLAEQMALNKKFAVEHGIPTDMGYAVAPHHSGVYPVHVQLYEAWKQVWGIRVTST
FT                   EEYPHLKPARYRRGFIHNGIMVLPRQTCGLFTHTIFYNEYPGGSSELDKIINGGELFLT
FT                   VLLNPISIFMTHLSNYGNDRLGLYTFKHLVRFLHSWTNLRLQTLPPVQLAQKYFQIFSE
FT                   EKDPLWQDPCEDKRHKDIWSKEKTCDRFPKLLIIGPQKTGTTALYLFLGMHPDLSSNYP
FT                   SSETFEEIQFFNGHNYHKGIDWYMEFFPIPSNTTSDFYFEKSANYFDSEVAPRRAAALL
FT                   PKAKILSILINPADRAYSWYQHQRAHDDPVALKYTFHEVITAGPDASSKLRALQNRCLV
FT                   PGWYATHIERWLSAFHANQILVLDGKLLRTEPAKVMDTVQKFLGVTSTVDYHKTLAFDP
FT                   KKGFWCQLLEGGKTKCLGKSKGRKYPEMDLDSRAFLKDYFRDHNIELSKLLYKMGQTLP
FT                   TWLREDLQNTR"
FT   gene            23397674..23429199
FT                   /locus_tag="mCG_6028"
FT                   /note="gene_id=mCG6028.2"
FT   mRNA            join(23397674..23397797,23427053..23427203,
FT                   23427582..23427743,23428467..23428543,23429085..23429199)
FT                   /locus_tag="mCG_6028"
FT                   /product="mCG6028, transcript variant mCT182090"
FT                   /note="gene_id=mCG6028.2 transcript_id=mCT182090.0 created
FT                   on 02-MAY-2003"
FT   assembly_gap    23401723..23401742
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23415684..23415703
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23423791..23423845
FT                   /estimated_length=55
FT                   /gap_type="unknown"
FT   mRNA            join(23425300..23425338,23427053..23427203,
FT                   23427582..23427743,23428467..23428543,23429085..23429199)
FT                   /locus_tag="mCG_6028"
FT                   /product="mCG6028, transcript variant mCT4726"
FT                   /note="gene_id=mCG6028.2 transcript_id=mCT4726.3 created on
FT                   02-MAY-2003"
FT   mRNA            join(23425349..23425433,23427053..23427203,
FT                   23427582..23427743,23428467..23428543,23429085..23429199)
FT                   /locus_tag="mCG_6028"
FT                   /product="mCG6028, transcript variant mCT174162"
FT                   /note="gene_id=mCG6028.2 transcript_id=mCT174162.1 created
FT                   on 02-MAY-2003"
FT   mRNA            join(23425879..23425969,23427053..23427203,
FT                   23427582..23427743,23428467..23428543,23429085..23429199)
FT                   /locus_tag="mCG_6028"
FT                   /product="mCG6028, transcript variant mCT174161"
FT                   /note="gene_id=mCG6028.2 transcript_id=mCT174161.1 created
FT                   on 02-MAY-2003"
FT   mRNA            join(23426889..23427203,23427582..23427743,
FT                   23428467..23428543,23429085..23429199)
FT                   /locus_tag="mCG_6028"
FT                   /product="mCG6028, transcript variant mCT174163"
FT                   /note="gene_id=mCG6028.2 transcript_id=mCT174163.1 created
FT                   on 02-MAY-2003"
FT   CDS             join(23427055..23427203,23427582..23427743,
FT                   23428467..23428543,23429085..23429152)
FT                   /codon_start=1
FT                   /locus_tag="mCG_6028"
FT                   /product="mCG6028, isoform CRA_a"
FT                   /note="gene_id=mCG6028.2 transcript_id=mCT174161.1
FT                   protein_id=mCP97082.0 isoform=CRA_a"
FT                   /protein_id="EDL09811.1"
FT                   /translation="MAPRKGKEKKEEQVISLGPQVAEGENVFGVCHIFASFNDTFVHVT
FT                   DLSGKETICRVTGGMKVKADRDESSPYAAMLAAQDVAQRCKELGITALHIKLRATGGNR
FT                   TKTPGPGAQSALRALARSGMKIGRIEDVTPIPSDSTRRKGGRRGRRL"
FT   CDS             join(23427055..23427203,23427582..23427743,
FT                   23428467..23428543,23429085..23429152)
FT                   /codon_start=1
FT                   /locus_tag="mCG_6028"
FT                   /product="mCG6028, isoform CRA_a"
FT                   /note="gene_id=mCG6028.2 transcript_id=mCT174162.1
FT                   protein_id=mCP97081.1 isoform=CRA_a"
FT                   /protein_id="EDL09812.1"
FT                   /translation="MAPRKGKEKKEEQVISLGPQVAEGENVFGVCHIFASFNDTFVHVT
FT                   DLSGKETICRVTGGMKVKADRDESSPYAAMLAAQDVAQRCKELGITALHIKLRATGGNR
FT                   TKTPGPGAQSALRALARSGMKIGRIEDVTPIPSDSTRRKGGRRGRRL"
FT   CDS             join(23427055..23427203,23427582..23427743,
FT                   23428467..23428543,23429085..23429152)
FT                   /codon_start=1
FT                   /locus_tag="mCG_6028"
FT                   /product="mCG6028, isoform CRA_a"
FT                   /note="gene_id=mCG6028.2 transcript_id=mCT174163.1
FT                   protein_id=mCP97080.0 isoform=CRA_a"
FT                   /protein_id="EDL09813.1"
FT                   /translation="MAPRKGKEKKEEQVISLGPQVAEGENVFGVCHIFASFNDTFVHVT
FT                   DLSGKETICRVTGGMKVKADRDESSPYAAMLAAQDVAQRCKELGITALHIKLRATGGNR
FT                   TKTPGPGAQSALRALARSGMKIGRIEDVTPIPSDSTRRKGGRRGRRL"
FT   CDS             join(23427055..23427203,23427582..23427743,
FT                   23428467..23428543,23429085..23429152)
FT                   /codon_start=1
FT                   /locus_tag="mCG_6028"
FT                   /product="mCG6028, isoform CRA_a"
FT                   /note="gene_id=mCG6028.2 transcript_id=mCT182090.0
FT                   protein_id=mCP105012.0 isoform=CRA_a"
FT                   /protein_id="EDL09814.1"
FT                   /translation="MAPRKGKEKKEEQVISLGPQVAEGENVFGVCHIFASFNDTFVHVT
FT                   DLSGKETICRVTGGMKVKADRDESSPYAAMLAAQDVAQRCKELGITALHIKLRATGGNR
FT                   TKTPGPGAQSALRALARSGMKIGRIEDVTPIPSDSTRRKGGRRGRRL"
FT   CDS             join(23427055..23427203,23427582..23427743,
FT                   23428467..23428543,23429085..23429152)
FT                   /codon_start=1
FT                   /locus_tag="mCG_6028"
FT                   /product="mCG6028, isoform CRA_a"
FT                   /note="gene_id=mCG6028.2 transcript_id=mCT4726.3
FT                   protein_id=mCP21549.2 isoform=CRA_a"
FT                   /protein_id="EDL09815.1"
FT                   /translation="MAPRKGKEKKEEQVISLGPQVAEGENVFGVCHIFASFNDTFVHVT
FT                   DLSGKETICRVTGGMKVKADRDESSPYAAMLAAQDVAQRCKELGITALHIKLRATGGNR
FT                   TKTPGPGAQSALRALARSGMKIGRIEDVTPIPSDSTRRKGGRRGRRL"
FT   assembly_gap    23429541..23429560
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(23430236..23430763)
FT                   /pseudo
FT                   /locus_tag="mCG_6031"
FT                   /note="gene_id=mCG6031.2"
FT   mRNA            complement(23430236..23430763)
FT                   /pseudo
FT                   /locus_tag="mCG_6031"
FT                   /note="gene_id=mCG6031.2 transcript_id=mCT4708.2 created on
FT                   17-OCT-2002"
FT   assembly_gap    23437917..23438139
FT                   /estimated_length=223
FT                   /gap_type="unknown"
FT   assembly_gap    23441492..23442396
FT                   /estimated_length=905
FT                   /gap_type="unknown"
FT   assembly_gap    23444768..23444787
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23448076..23448191
FT                   /estimated_length=116
FT                   /gap_type="unknown"
FT   assembly_gap    23451167..23451186
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23452315..23452583
FT                   /estimated_length=269
FT                   /gap_type="unknown"
FT   gene            23455747..23465305
FT                   /gene="Cd74"
FT                   /locus_tag="mCG_6027"
FT                   /note="gene_id=mCG6027.2"
FT   mRNA            join(23455747..23455908,23460564..23460733,
FT                   23460889..23460968,23461685..23461747,23462639..23462731,
FT                   23462985..23463075,23464516..23464578,23464809..23465305)
FT                   /gene="Cd74"
FT                   /locus_tag="mCG_6027"
FT                   /product="CD74 antigen (invariant polypeptide of major
FT                   histocompatibility complex, class II antigen-associated),
FT                   transcript variant mCT174157"
FT                   /note="gene_id=mCG6027.2 transcript_id=mCT174157.0 created
FT                   on 07-OCT-2002"
FT   mRNA            join(23455748..23455908,23460564..23460733,
FT                   23460889..23460968,23461685..23461747,23462639..23462731,
FT                   23462985..23463075,23463951..23464142,23464516..23464578,
FT                   23464809..23465020,23465078..23465305)
FT                   /gene="Cd74"
FT                   /locus_tag="mCG_6027"
FT                   /product="CD74 antigen (invariant polypeptide of major
FT                   histocompatibility complex, class II antigen-associated),
FT                   transcript variant mCT4725"
FT                   /note="gene_id=mCG6027.2 transcript_id=mCT4725.2 created on
FT                   07-OCT-2002"
FT   mRNA            join(23455758..23455908,23459809..23459863,
FT                   23460619..23460733,23460889..23460968,23461685..23461747,
FT                   23462639..23462731,23462985..23463075,23464516..23464578,
FT                   23464809..23465013)
FT                   /gene="Cd74"
FT                   /locus_tag="mCG_6027"
FT                   /product="CD74 antigen (invariant polypeptide of major
FT                   histocompatibility complex, class II antigen-associated),
FT                   transcript variant mCT174158"
FT                   /note="gene_id=mCG6027.2 transcript_id=mCT174158.0 created
FT                   on 07-OCT-2002"
FT   mRNA            join(23455760..23455908,23459809..23459851,
FT                   23460607..23460733,23460889..23460968,23461685..23461747,
FT                   23462639..23462731,23462985..23463075,23464516..23464578,
FT                   23464809..23465016)
FT                   /gene="Cd74"
FT                   /locus_tag="mCG_6027"
FT                   /product="CD74 antigen (invariant polypeptide of major
FT                   histocompatibility complex, class II antigen-associated),
FT                   transcript variant mCT174160"
FT                   /note="gene_id=mCG6027.2 transcript_id=mCT174160.0 created
FT                   on 07-OCT-2002"
FT   mRNA            join(23455774..23455908,23460564..23460733,
FT                   23460889..23460968,23461685..23461747,23462639..23462731,
FT                   23462985..23463075,23464516..23464578,23464961..23465097)
FT                   /gene="Cd74"
FT                   /locus_tag="mCG_6027"
FT                   /product="CD74 antigen (invariant polypeptide of major
FT                   histocompatibility complex, class II antigen-associated),
FT                   transcript variant mCT174156"
FT                   /note="gene_id=mCG6027.2 transcript_id=mCT174156.0 created
FT                   on 07-OCT-2002"
FT   mRNA            join(23455774..23455908,23460564..23460733,
FT                   23460889..23460968,23461685..23461751,23462641..23462731,
FT                   23462985..23463049)
FT                   /gene="Cd74"
FT                   /locus_tag="mCG_6027"
FT                   /product="CD74 antigen (invariant polypeptide of major
FT                   histocompatibility complex, class II antigen-associated),
FT                   transcript variant mCT174159"
FT                   /note="gene_id=mCG6027.2 transcript_id=mCT174159.0 created
FT                   on 07-OCT-2002"
FT   CDS             join(23455832..23455908,23460564..23460733,
FT                   23460889..23460968,23461685..23461747,23462639..23462731,
FT                   23462985..23463075,23464516..23464578,23464961..23464974)
FT                   /codon_start=1
FT                   /gene="Cd74"
FT                   /locus_tag="mCG_6027"
FT                   /product="CD74 antigen (invariant polypeptide of major
FT                   histocompatibility complex, class II antigen-associated),
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG6027.2 transcript_id=mCT174156.0
FT                   protein_id=mCP97075.0 isoform=CRA_a"
FT                   /protein_id="EDL09805.1"
FT                   /translation="MDDQRDLISNHEQLPILGNRPREPERCSRGALYTGVSVLVALLLA
FT                   GQATTAYFLYQQQGRLDKLTITSQNLQLESLRMKLPKSAKPVSQMRMATPLLMRPMSMD
FT                   NMLLGPVKNVTKYGNMTQDHVMHLLTRSGPLEYPQLKGTFPENLKHLKNSMDGVNWKIF
FT                   ESWMKQWLLFEMSKNSLEEKKPTEAPPKEPLDMEDLSSGLGVTRQELGQGHGK"
FT   CDS             join(23455832..23455908,23459809..23459863,
FT                   23460619..23460733,23460889..23460968,23461685..23461747,
FT                   23462639..23462731,23462985..23463075,23464516..23464578,
FT                   23464809..23464819)
FT                   /codon_start=1
FT                   /gene="Cd74"
FT                   /locus_tag="mCG_6027"
FT                   /product="CD74 antigen (invariant polypeptide of major
FT                   histocompatibility complex, class II antigen-associated),
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG6027.2 transcript_id=mCT174158.0
FT                   protein_id=mCP97078.0 isoform=CRA_c"
FT                   /db_xref="GOA:Q545Y5"
FT                   /db_xref="InterPro:IPR011988"
FT                   /db_xref="InterPro:IPR015386"
FT                   /db_xref="InterPro:IPR022339"
FT                   /db_xref="MGI:MGI:96534"
FT                   /db_xref="UniProtKB/TrEMBL:Q545Y5"
FT                   /protein_id="EDL09807.1"
FT                   /translation="MDDQRDLISNHEQLPILGNRPREPERCSRGALYTGVSVLVALLLA
FT                   GQATTAYFLYQQQGRLDKLTITSQNLQLESLRMKLPKSAKPVSQMRMATPLLMRPMSMD
FT                   NMLLGPVKNVTKYGNMTQDHVMHLLTRSGPLEYPQLKGTFPENLKHLKNSMDGVNWKIF
FT                   ESWMKQWLLFEMSKNSLEEKKPTEAPPKEPLDMEDLSSGLGVTRQELGQVTL"
FT   CDS             join(23455832..23455908,23459809..23459851,
FT                   23460607..23460733,23460889..23460968,23461685..23461747,
FT                   23462639..23462731,23462985..23463075,23464516..23464578,
FT                   23464809..23464819)
FT                   /codon_start=1
FT                   /gene="Cd74"
FT                   /locus_tag="mCG_6027"
FT                   /product="CD74 antigen (invariant polypeptide of major
FT                   histocompatibility complex, class II antigen-associated),
FT                   isoform CRA_e"
FT                   /note="gene_id=mCG6027.2 transcript_id=mCT174160.0
FT                   protein_id=mCP97077.0 isoform=CRA_e"
FT                   /db_xref="GOA:Q545Y5"
FT                   /db_xref="InterPro:IPR011988"
FT                   /db_xref="InterPro:IPR015386"
FT                   /db_xref="InterPro:IPR022339"
FT                   /db_xref="MGI:MGI:96534"
FT                   /db_xref="UniProtKB/TrEMBL:Q545Y5"
FT                   /protein_id="EDL09809.1"
FT                   /translation="MDDQRDLISNHEQLPILGNRPREPERCSRGALYTGVSVLVALLLA
FT                   GQATTAYFLYQQQGRLDKLTITSQNLQLESLRMKLPKSAKPVSQMRMATPLLMRPMSMD
FT                   NMLLGPVKNVTKYGNMTQDHVMHLLTRSGPLEYPQLKGTFPENLKHLKNSMDGVNWKIF
FT                   ESWMKQWLLFEMSKNSLEEKKPTEAPPKEPLDMEDLSSGLGVTRQELGQVTL"
FT   CDS             join(23455832..23455908,23460564..23460733,
FT                   23460889..23460968,23461685..23461747,23462639..23462731,
FT                   23462985..23463075,23463951..23464142,23464516..23464578,
FT                   23464809..23464819)
FT                   /codon_start=1
FT                   /gene="Cd74"
FT                   /locus_tag="mCG_6027"
FT                   /product="CD74 antigen (invariant polypeptide of major
FT                   histocompatibility complex, class II antigen-associated),
FT                   isoform CRA_f"
FT                   /note="gene_id=mCG6027.2 transcript_id=mCT4725.2
FT                   protein_id=mCP21553.2 isoform=CRA_f"
FT                   /db_xref="GOA:Q3U4Q8"
FT                   /db_xref="InterPro:IPR000716"
FT                   /db_xref="InterPro:IPR011988"
FT                   /db_xref="InterPro:IPR015386"
FT                   /db_xref="InterPro:IPR022339"
FT                   /db_xref="MGI:MGI:96534"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U4Q8"
FT                   /protein_id="EDL09810.1"
FT                   /translation="MDDQRDLISNHEQLPILGNRPREPERCSRGALYTGVSVLVALLLA
FT                   GQATTAYFLYQQQGRLDKLTITSQNLQLESLRMKLPKSAKPVSQMRMATPLLMRPMSMD
FT                   NMLLGPVKNVTKYGNMTQDHVMHLLTRSGPLEYPQLKGTFPENLKHLKNSMDGVNWKIF
FT                   ESWMKQWLLFEMSKNSLEEKKPTEAPPKVLTKCQEEVSHIPAVYPGAFRPKCDENGNYL
FT                   PLQCHGSTGYCWCVFPNGTEVPHTKSRGRHNCSEPLDMEDLSSGLGVTRQELGQVTL"
FT   CDS             join(23455832..23455908,23460564..23460733,
FT                   23460889..23460968,23461685..23461747,23462639..23462731,
FT                   23462985..23463075,23464516..23464578,23464809..23464819)
FT                   /codon_start=1
FT                   /gene="Cd74"
FT                   /locus_tag="mCG_6027"
FT                   /product="CD74 antigen (invariant polypeptide of major
FT                   histocompatibility complex, class II antigen-associated),
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG6027.2 transcript_id=mCT174157.0
FT                   protein_id=mCP97079.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q545Y5"
FT                   /db_xref="InterPro:IPR011988"
FT                   /db_xref="InterPro:IPR015386"
FT                   /db_xref="InterPro:IPR022339"
FT                   /db_xref="MGI:MGI:96534"
FT                   /db_xref="UniProtKB/TrEMBL:Q545Y5"
FT                   /protein_id="EDL09806.1"
FT                   /translation="MDDQRDLISNHEQLPILGNRPREPERCSRGALYTGVSVLVALLLA
FT                   GQATTAYFLYQQQGRLDKLTITSQNLQLESLRMKLPKSAKPVSQMRMATPLLMRPMSMD
FT                   NMLLGPVKNVTKYGNMTQDHVMHLLTRSGPLEYPQLKGTFPENLKHLKNSMDGVNWKIF
FT                   ESWMKQWLLFEMSKNSLEEKKPTEAPPKEPLDMEDLSSGLGVTRQELGQVTL"
FT   CDS             join(23455832..23455908,23460564..23460733,
FT                   23460889..23460968,23461685..23461751,23462641..23462669)
FT                   /codon_start=1
FT                   /gene="Cd74"
FT                   /locus_tag="mCG_6027"
FT                   /product="CD74 antigen (invariant polypeptide of major
FT                   histocompatibility complex, class II antigen-associated),
FT                   isoform CRA_d"
FT                   /note="gene_id=mCG6027.2 transcript_id=mCT174159.0
FT                   protein_id=mCP97076.0 isoform=CRA_d"
FT                   /protein_id="EDL09808.1"
FT                   /translation="MDDQRDLISNHEQLPILGNRPREPERCSRGALYTGVSVLVALLLA
FT                   GQATTAYFLYQQQGRLDKLTITSQNLQLESLRMKLPKSAKPVSQMRMATPLLMRPMSMD
FT                   NMLLGPVKNVTKYGNMTQDHVMHLLTVSLDPWSTRS"
FT   assembly_gap    23459870..23459889
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(23466412..23501608)
FT                   /gene="Tcof1"
FT                   /locus_tag="mCG_6035"
FT                   /note="gene_id=mCG6035.1"
FT   mRNA            complement(join(23466412..23466845,23467181..23467226,
FT                   23467616..23467710,23468659..23469186,23470688..23470868,
FT                   23471520..23471602,23472046..23472268,23474300..23474421,
FT                   23475461..23475647,23481021..23481215,23481312..23481491,
FT                   23481670..23481771,23484164..23484331,23484425..23484646,
FT                   23484817..23484960,23485078..23485275,23485372..23485581,
FT                   23486071..23486283,23488300..23488551,23490542..23490615,
FT                   23491320..23491506,23492217..23492278,23495852..23495997,
FT                   23498437..23498492,23501375..23501608))
FT                   /gene="Tcof1"
FT                   /locus_tag="mCG_6035"
FT                   /product="Treacher Collins Franceschetti syndrome 1,
FT                   homolog, transcript variant mCT4706"
FT                   /note="gene_id=mCG6035.1 transcript_id=mCT4706.2 created on
FT                   04-OCT-2002"
FT   mRNA            complement(join(23466421..23466845,23467181..23467226,
FT                   23467616..23467710,23468659..23469186,23470688..23470868,
FT                   23471520..23471602,23472046..23472268,23474300..23474421,
FT                   23475461..23475647,23481021..23481215,23481312..23481491,
FT                   23481670..23481771,23484164..23484331,23484425..23484646,
FT                   23485078..23485275,23485372..23485581,23486071..23486283,
FT                   23488300..23488551,23490542..23490615,23491320..23491506,
FT                   23492217..23492278,23495852..23495997,23498437..23498492,
FT                   23501375..23501532))
FT                   /gene="Tcof1"
FT                   /locus_tag="mCG_6035"
FT                   /product="Treacher Collins Franceschetti syndrome 1,
FT                   homolog, transcript variant mCT174423"
FT                   /note="gene_id=mCG6035.1 transcript_id=mCT174423.0 created
FT                   on 04-OCT-2002"
FT   mRNA            complement(join(23466421..23466845,23467181..23467226,
FT                   23467616..23467710,23468659..23469186,23470688..23470868,
FT                   23471520..23471602,23472046..23472268,23474300..23474421,
FT                   23475461..23475647,23481021..23481215,23481312..23481491,
FT                   23481670..23481771,23484164..23484331,23484425..23484646,
FT                   23484817..23484960,23485078..23485275,23485372..23485581,
FT                   23486071..23486283,23488300..23488551,23490542..23490615,
FT                   23491320..23491446,23492213..23492278,23495852..23495997,
FT                   23498437..23498492,23501375..>23501530))
FT                   /gene="Tcof1"
FT                   /locus_tag="mCG_6035"
FT                   /product="Treacher Collins Franceschetti syndrome 1,
FT                   homolog, transcript variant mCT190289"
FT                   /note="gene_id=mCG6035.1 transcript_id=mCT190289.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(23466421..23466845,23467181..23467226,
FT                   23467616..23467710,23468659..23469186,23470688..23470868,
FT                   23471520..23471602,23472046..23472070,23472140..23472268,
FT                   23474300..23474421,23475461..23475647,23481021..23481215,
FT                   23481312..23481491,23481670..23481771,23484164..23484331,
FT                   23484425..23484646,23484817..23484960,23485078..23485275,
FT                   23485372..23485581,23486071..23486283,23488300..23488551,
FT                   23490542..23490615,23491320..23491448,23492213..23492278,
FT                   23495852..23495997,23498437..23498492,23501375..23501530))
FT                   /gene="Tcof1"
FT                   /locus_tag="mCG_6035"
FT                   /product="Treacher Collins Franceschetti syndrome 1,
FT                   homolog, transcript variant mCT174424"
FT                   /note="gene_id=mCG6035.1 transcript_id=mCT174424.0 created
FT                   on 04-OCT-2002"
FT   mRNA            complement(join(23466421..23466845,23467181..23467226,
FT                   23467616..23467710,23468659..23469186,23470688..23470868,
FT                   23471520..23471602,23472046..23472268,23474300..23474421,
FT                   23475461..23475647,23481021..23481215,23481312..23481491,
FT                   23481670..23481771,23484164..23484331,23484425..23484646,
FT                   23484817..23484960,23485078..23485275,23485372..23485581,
FT                   23486071..23486283,23488300..23488551,23490542..23490615,
FT                   23491320..23491448,23492213..23492278,23495852..23495997,
FT                   23498437..23498492,23501375..23501530))
FT                   /gene="Tcof1"
FT                   /locus_tag="mCG_6035"
FT                   /product="Treacher Collins Franceschetti syndrome 1,
FT                   homolog, transcript variant mCT174425"
FT                   /note="gene_id=mCG6035.1 transcript_id=mCT174425.0 created
FT                   on 04-OCT-2002"
FT   mRNA            complement(join(23466755..23466845,23467181..23467226,
FT                   23467616..23467710,23468659..23469186,23470688..23470868,
FT                   23471520..23471602,23472046..23472268,23474300..23474421,
FT                   23475461..23475647,23479996..23480103,23481021..23481215,
FT                   23481312..23481491,23481670..23481771,23484164..23484331,
FT                   23484425..23484646,23484817..23484960,23485078..23485275,
FT                   23485372..23485581,23486071..23486283,23488300..23488551,
FT                   23490542..23490615,23491320..23491506,23492217..23492278,
FT                   23495852..23495997,23498437..23498492,23501375..23501532))
FT                   /gene="Tcof1"
FT                   /locus_tag="mCG_6035"
FT                   /product="Treacher Collins Franceschetti syndrome 1,
FT                   homolog, transcript variant mCT174426"
FT                   /note="gene_id=mCG6035.1 transcript_id=mCT174426.0 created
FT                   on 04-OCT-2002"
FT   assembly_gap    23467093..23467140
FT                   /estimated_length=48
FT                   /gap_type="unknown"
FT   CDS             complement(join(23467200..23467226,23467616..23467710,
FT                   23468659..23469186,23470688..23470868,23471520..23471602,
FT                   23472046..23472268,23474300..23474421,23475461..23475647,
FT                   23481021..23481215,23481312..23481491,23481670..23481771,
FT                   23484164..23484331,23484425..23484646,23485078..23485275,
FT                   23485372..23485581,23486071..23486283,23488300..23488551,
FT                   23490542..23490615,23491320..23491506,23492217..23492278,
FT                   23495852..23495997,23498437..23498492,23501375..23501482))
FT                   /codon_start=1
FT                   /gene="Tcof1"
FT                   /locus_tag="mCG_6035"
FT                   /product="Treacher Collins Franceschetti syndrome 1,
FT                   homolog, isoform CRA_a"
FT                   /note="gene_id=mCG6035.1 transcript_id=mCT174423.0
FT                   protein_id=mCP97342.0 isoform=CRA_a"
FT                   /protein_id="EDL09798.1"
FT                   /translation="MAEARKRRELLPLIYHHLLQAGYVRAAREVKEQSGQKSFLTQPVT
FT                   LLDIYTHWQQTSELGQKQKAEDDETLQAKKSRVSDPVSSSESSDQEKEEEAATERAKAT
FT                   PRPTPVNSATAALPSKVKEKGKTKTANKTVNSVSHPGSGKTVVHLLSGKSPKKSAEPLA
FT                   NTVLASETEEEGNAQALGPTAKSGTVSAGQGSSSSEDSSISSDETDVEVKSPAKPAQAK
FT                   ASAAPAKDPPARTAPGPTKLGNVAPTPAKPARAAAAAAAAAVAAAAAAAAEESESSEED
FT                   SDSEDEAPAGLPSQVKASGKGPHVRADSVSAKGISGKGPILATPGKTGPAATQAKAERP
FT                   EKDSETSSEDDSDSEDEMPVTVNTPQARTSGKSPRARGTSAPAKESSQKGAPAVTPGKA
FT                   RPVAAQAGKPEAKSSEESESDSGETPAAATLTTSPAKVKPLGKSSQVRPVSTVTPGSSG
FT                   KGANLPCPGKVGSAALRVQMVKKEDVSESSSAELDSDGPGSPAKAKPALEKQMKASSRK
FT                   GTPASATGASTSSHCKAGAVTSSASLSSPALAKGTQRSDVDSSSESESEGAAPSTPRVQ
FT                   GKSGGKGLQGKAALGQGVAPVHTQKTGPSVKAMAQEDSESLEEDSSSEEEDETPAQATP
FT                   LGRLPQAKANPPPTKTPPASASGKAVAAPTKGKPPVPNSTVSARGQRSVPAAGKAGAPA
FT                   TQAQKGPVAGTGEDSESSSKEESDSEEETPAQIKPVGKTSQVRAASAPAKESPKKGAHP
FT                   GTPGKTGSSATQAQPGKTEDSDSSSEESDSDTEMPSAQAIKSPPVSVNRNSSPAVPAPT
FT                   PEGVQAVNTTKKASGTTAQSSSSESEDGDEDLIPATQPSTYALRTSVTTPAALSRAASQ
FT                   PSKSEQSSRMPKGKKAKAAASAQTSSAVETLPMMPPQSAPIQPKATNKLGKSKLPEKQQ
FT                   LAPGYPKAPRSSEDSSDTSSEDEEDAKRPQMPKSAHRLDPDPSQKETVVEETPTESSED
FT                   EMVAPSQSLLSGYMTPGLTVANSQASKATPRPDSNSLASSAPATKDNPDGKQKSKSQHA
FT                   ADTALPKTGRKEASSGSTPQKPKKPKKSTSSSPAPTQTLPNSITQRLLEQAWPLSEAQV
FT                   QASVVKVLTELLEQERLKATEAIKESGKKSQKRKLSGDLEAGAPKNKKKKEQPVPRASA
FT                   VSPEKAPMTSKAKSKLDKGSAGGKGKGSPGPQGAKEKPDGELLGIKLESGEQSDPKSKS
FT                   KKKKSLKKKKDKEKKEKKKGKKSLAKDSASPIQKKKKKKKKSAEPAV"
FT   CDS             complement(join(23467200..23467226,23467616..23467710,
FT                   23468659..23469186,23470688..23470868,23471520..23471602,
FT                   23472046..23472268,23474300..23474421,23475461..23475647,
FT                   23481021..23481215,23481312..23481491,23481670..23481771,
FT                   23484164..23484331,23484425..23484646,23484817..23484960,
FT                   23485078..23485275,23485372..23485581,23486071..23486283,
FT                   23488300..23488551,23490542..23490615,23491320..23491506,
FT                   23492217..23492278,23495852..23495997,23498437..23498492,
FT                   23501375..23501482))
FT                   /codon_start=1
FT                   /gene="Tcof1"
FT                   /locus_tag="mCG_6035"
FT                   /product="Treacher Collins Franceschetti syndrome 1,
FT                   homolog, isoform CRA_f"
FT                   /note="gene_id=mCG6035.1 transcript_id=mCT4706.2
FT                   protein_id=mCP21555.2 isoform=CRA_f"
FT                   /protein_id="EDL09803.1"
FT                   /translation="MAEARKRRELLPLIYHHLLQAGYVRAAREVKEQSGQKSFLTQPVT
FT                   LLDIYTHWQQTSELGQKQKAEDDETLQAKKSRVSDPVSSSESSDQEKEEEAATERAKAT
FT                   PRPTPVNSATAALPSKVKEKGKTKTANKTVNSVSHPGSGKTVVHLLSGKSPKKSAEPLA
FT                   NTVLASETEEEGNAQALGPTAKSGTVSAGQGSSSSEDSSISSDETDVEVKSPAKPAQAK
FT                   ASAAPAKDPPARTAPGPTKLGNVAPTPAKPARAAAAAAAAAVAAAAAAAAEESESSEED
FT                   SDSEDEAPAGLPSQVKASGKGPHVRADSVSAKGISGKGPILATPGKTGPAATQAKAERP
FT                   EKDSETSSEDDSDSEDEMPVTVNTPQARTSGKSPRARGTSAPAKESSQKGAPAVTPGKA
FT                   RPVAAQAGKPEAKSSEESESDSGETPAAATLTTSPAKVKPLGKSSQVRPVSTVTPGSSG
FT                   KGANLPCPGKVGSAALRVQMVKKEDVSESSSAELDSDGPGSPAKAKASLALPQKVRPVA
FT                   TQVKTDRGKGHSGSSEESSDSEEEAAPAASAAQAKPALEKQMKASSRKGTPASATGAST
FT                   SSHCKAGAVTSSASLSSPALAKGTQRSDVDSSSESESEGAAPSTPRVQGKSGGKGLQGK
FT                   AALGQGVAPVHTQKTGPSVKAMAQEDSESLEEDSSSEEEDETPAQATPLGRLPQAKANP
FT                   PPTKTPPASASGKAVAAPTKGKPPVPNSTVSARGQRSVPAAGKAGAPATQAQKGPVAGT
FT                   GEDSESSSKEESDSEEETPAQIKPVGKTSQVRAASAPAKESPKKGAHPGTPGKTGSSAT
FT                   QAQPGKTEDSDSSSEESDSDTEMPSAQAIKSPPVSVNRNSSPAVPAPTPEGVQAVNTTK
FT                   KASGTTAQSSSSESEDGDEDLIPATQPSTYALRTSVTTPAALSRAASQPSKSEQSSRMP
FT                   KGKKAKAAASAQTSSAVETLPMMPPQSAPIQPKATNKLGKSKLPEKQQLAPGYPKAPRS
FT                   SEDSSDTSSEDEEDAKRPQMPKSAHRLDPDPSQKETVVEETPTESSEDEMVAPSQSLLS
FT                   GYMTPGLTVANSQASKATPRPDSNSLASSAPATKDNPDGKQKSKSQHAADTALPKTGRK
FT                   EASSGSTPQKPKKPKKSTSSSPAPTQTLPNSITQRLLEQAWPLSEAQVQASVVKVLTEL
FT                   LEQERLKATEAIKESGKKSQKRKLSGDLEAGAPKNKKKKEQPVPRASAVSPEKAPMTSK
FT                   AKSKLDKGSAGGKGKGSPGPQGAKEKPDGELLGIKLESGEQSDPKSKSKKKKSLKKKKD
FT                   KEKKEKKKGKKSLAKDSASPIQKKKKKKKKSAEPAV"
FT   CDS             complement(join(23467200..23467226,23467616..23467710,
FT                   23468659..23469186,23470688..23470868,23471520..23471602,
FT                   23472046..23472268,23474300..23474421,23475461..23475647,
FT                   23479996..23480103,23481021..23481215,23481312..23481491,
FT                   23481670..23481771,23484164..23484331,23484425..23484646,
FT                   23484817..23484960,23485078..23485275,23485372..23485581,
FT                   23486071..23486283,23488300..23488551,23490542..23490615,
FT                   23491320..23491506,23492217..23492278,23495852..23495997,
FT                   23498437..23498492,23501375..23501482))
FT                   /codon_start=1
FT                   /gene="Tcof1"
FT                   /locus_tag="mCG_6035"
FT                   /product="Treacher Collins Franceschetti syndrome 1,
FT                   homolog, isoform CRA_c"
FT                   /note="gene_id=mCG6035.1 transcript_id=mCT174426.0
FT                   protein_id=mCP97343.0 isoform=CRA_c"
FT                   /protein_id="EDL09800.1"
FT                   /translation="MAEARKRRELLPLIYHHLLQAGYVRAAREVKEQSGQKSFLTQPVT
FT                   LLDIYTHWQQTSELGQKQKAEDDETLQAKKSRVSDPVSSSESSDQEKEEEAATERAKAT
FT                   PRPTPVNSATAALPSKVKEKGKTKTANKTVNSVSHPGSGKTVVHLLSGKSPKKSAEPLA
FT                   NTVLASETEEEGNAQALGPTAKSGTVSAGQGSSSSEDSSISSDETDVEVKSPAKPAQAK
FT                   ASAAPAKDPPARTAPGPTKLGNVAPTPAKPARAAAAAAAAAVAAAAAAAAEESESSEED
FT                   SDSEDEAPAGLPSQVKASGKGPHVRADSVSAKGISGKGPILATPGKTGPAATQAKAERP
FT                   EKDSETSSEDDSDSEDEMPVTVNTPQARTSGKSPRARGTSAPAKESSQKGAPAVTPGKA
FT                   RPVAAQAGKPEAKSSEESESDSGETPAAATLTTSPAKVKPLGKSSQVRPVSTVTPGSSG
FT                   KGANLPCPGKVGSAALRVQMVKKEDVSESSSAELDSDGPGSPAKAKASLALPQKVRPVA
FT                   TQVKTDRGKGHSGSSEESSDSEEEAAPAASAAQAKPALEKQMKASSRKGTPASATGAST
FT                   SSHCKAGAVTSSASLSSPALAKGTQRSDVDSSSESESEGAAPSTPRVQGKSGGKGLQGK
FT                   AALGQGVAPVHTQKTGPSVKAMAQEDSESLEEDSSSEEEDETPAQATPLGRLPQAKANP
FT                   PPTKTPPASASGKAVAAPTKGKPPVPNSTVSARGQRSVPAAGKAGAPATQAQKGPVAGT
FT                   GEDSESSSKEESDSEEETPAQIKPVGKTSQVRAASAPAKESPKKGAHPGTPGKTGSSAT
FT                   QAQPGKTEDSDSSSEESDSDTEMPSAQDAISQPARGKASGPASPEKSIEGSSESSDEDL
FT                   PSGQAIKSPPVSVNRNSSPAVPAPTPEGVQAVNTTKKASGTTAQSSSSESEDGDEDLIP
FT                   ATQPSTYALRTSVTTPAALSRAASQPSKSEQSSRMPKGKKAKAAASAQTSSAVETLPMM
FT                   PPQSAPIQPKATNKLGKSKLPEKQQLAPGYPKAPRSSEDSSDTSSEDEEDAKRPQMPKS
FT                   AHRLDPDPSQKETVVEETPTESSEDEMVAPSQSLLSGYMTPGLTVANSQASKATPRPDS
FT                   NSLASSAPATKDNPDGKQKSKSQHAADTALPKTGRKEASSGSTPQKPKKPKKSTSSSPA
FT                   PTQTLPNSITQRLLEQAWPLSEAQVQASVVKVLTELLEQERLKATEAIKESGKKSQKRK
FT                   LSGDLEAGAPKNKKKKEQPVPRASAVSPEKAPMTSKAKSKLDKGSAGGKGKGSPGPQGA
FT                   KEKPDGELLGIKLESGEQSDPKSKSKKKKSLKKKKDKEKKEKKKGKKSLAKDSASPIQK
FT                   KKKKKKKSAEPAV"
FT   CDS             complement(join(23467200..23467226,23467616..23467710,
FT                   23468659..23469186,23470688..23470868,23471520..23471602,
FT                   23472046..23472070,23472140..23472268,23474300..23474421,
FT                   23475461..23475647,23481021..23481215,23481312..23481491,
FT                   23481670..23481771,23484164..23484331,23484425..23484646,
FT                   23484817..23484960,23485078..23485275,23485372..23485581,
FT                   23486071..23486283,23488300..23488551,23490542..23490615,
FT                   23491320..23491448,23492213..23492278,23495852..23495997,
FT                   23498437..23498492,23501375..23501482))
FT                   /codon_start=1
FT                   /gene="Tcof1"
FT                   /locus_tag="mCG_6035"
FT                   /product="Treacher Collins Franceschetti syndrome 1,
FT                   homolog, isoform CRA_g"
FT                   /note="gene_id=mCG6035.1 transcript_id=mCT174424.0
FT                   protein_id=mCP97344.0 isoform=CRA_g"
FT                   /protein_id="EDL09804.1"
FT                   /translation="MAEARKRRELLPLIYHHLLQAGYVRAAREVKEQSGQKSFLTQPVT
FT                   LLDIYTHWQQTSELGQKQKAEDDETLQAKKSRVSDPVSSSESSDQEKEEEAATERAKAT
FT                   PRPTPVNSATAALPSKVKEKVKTVVHLLSGKSPKKSAEPLANTVLASETEEEGNAQALG
FT                   PTAKSGTVSAGQGSSSSEDSSISSDETDVEVKSPAKPAQAKASAAPAKDPPARTAPGPT
FT                   KLGNVAPTPAKPARAAAAAAAAAVAAAAAAAAEESESSEEDSDSEDEAPAGLPSQVKAS
FT                   GKGPHVRADSVSAKGISGKGPILATPGKTGPAATQAKAERPEKDSETSSEDDSDSEDEM
FT                   PVTVNTPQARTSGKSPRARGTSAPAKESSQKGAPAVTPGKARPVAAQAGKPEAKSSEES
FT                   ESDSGETPAAATLTTSPAKVKPLGKSSQVRPVSTVTPGSSGKGANLPCPGKVGSAALRV
FT                   QMVKKEDVSESSSAELDSDGPGSPAKAKASLALPQKVRPVATQVKTDRGKGHSGSSEES
FT                   SDSEEEAAPAASAAQAKPALEKQMKASSRKGTPASATGASTSSHCKAGAVTSSASLSSP
FT                   ALAKGTQRSDVDSSSESESEGAAPSTPRVQGKSGGKGLQGKAALGQGVAPVHTQKTGPS
FT                   VKAMAQEDSESLEEDSSSEEEDETPAQATPLGRLPQAKANPPPTKTPPASASGKAVAAP
FT                   TKGKPPVPNSTVSARGQRSVPAAGKAGAPATQAQKGPVAGTGEDSESSSKEESDSEEET
FT                   PAQIKPVGKTSQVRAASAPAKESPKKGAHPGTPGKTGSSATQAQPGKTEDSDSSSEESD
FT                   SDTEMPSAQAIKSPPVSVNRNSSPAVPAPTPEGVQAVNTTKKASGTTAQSSSSESEDGD
FT                   EDLIPATQPSTYALRTSVTTPAALSRAASQPSKSEQSSRMPKGKKAKAAASAQTSSAVE
FT                   TLPMMPPQSAPIQPKATNKLGKSKLPEKQQLAPGYPKMPKSAHRLDPDPSQKETVVEET
FT                   PTESSEDEMVAPSQSLLSGYMTPGLTVANSQASKATPRPDSNSLASSAPATKDNPDGKQ
FT                   KSKSQHAADTALPKTGRKEASSGSTPQKPKKPKKSTSSSPAPTQTLPNSITQRLLEQAW
FT                   PLSEAQVQASVVKVLTELLEQERLKATEAIKESGKKSQKRKLSGDLEAGAPKNKKKKEQ
FT                   PVPRASAVSPEKAPMTSKAKSKLDKGSAGGKGKGSPGPQGAKEKPDGELLGIKLESGEQ
FT                   SDPKSKSKKKKSLKKKKDKEKKEKKKGKKSLAKDSASPIQKKKKKKKKSAEPAV"
FT   CDS             complement(join(23467200..23467226,23467616..23467710,
FT                   23468659..23469186,23470688..23470868,23471520..23471602,
FT                   23472046..23472268,23474300..23474421,23475461..23475647,
FT                   23481021..23481215,23481312..23481491,23481670..23481771,
FT                   23484164..23484331,23484425..23484646,23484817..23484960,
FT                   23485078..23485275,23485372..23485581,23486071..23486283,
FT                   23488300..23488551,23490542..23490615,23491320..23491448,
FT                   23492213..23492278,23495852..23495997,23498437..23498492,
FT                   23501375..23501482))
FT                   /codon_start=1
FT                   /gene="Tcof1"
FT                   /locus_tag="mCG_6035"
FT                   /product="Treacher Collins Franceschetti syndrome 1,
FT                   homolog, isoform CRA_b"
FT                   /note="gene_id=mCG6035.1 transcript_id=mCT174425.0
FT                   protein_id=mCP97345.0 isoform=CRA_b"
FT                   /protein_id="EDL09799.1"
FT                   /translation="MAEARKRRELLPLIYHHLLQAGYVRAAREVKEQSGQKSFLTQPVT
FT                   LLDIYTHWQQTSELGQKQKAEDDETLQAKKSRVSDPVSSSESSDQEKEEEAATERAKAT
FT                   PRPTPVNSATAALPSKVKEKVKTVVHLLSGKSPKKSAEPLANTVLASETEEEGNAQALG
FT                   PTAKSGTVSAGQGSSSSEDSSISSDETDVEVKSPAKPAQAKASAAPAKDPPARTAPGPT
FT                   KLGNVAPTPAKPARAAAAAAAAAVAAAAAAAAEESESSEEDSDSEDEAPAGLPSQVKAS
FT                   GKGPHVRADSVSAKGISGKGPILATPGKTGPAATQAKAERPEKDSETSSEDDSDSEDEM
FT                   PVTVNTPQARTSGKSPRARGTSAPAKESSQKGAPAVTPGKARPVAAQAGKPEAKSSEES
FT                   ESDSGETPAAATLTTSPAKVKPLGKSSQVRPVSTVTPGSSGKGANLPCPGKVGSAALRV
FT                   QMVKKEDVSESSSAELDSDGPGSPAKAKASLALPQKVRPVATQVKTDRGKGHSGSSEES
FT                   SDSEEEAAPAASAAQAKPALEKQMKASSRKGTPASATGASTSSHCKAGAVTSSASLSSP
FT                   ALAKGTQRSDVDSSSESESEGAAPSTPRVQGKSGGKGLQGKAALGQGVAPVHTQKTGPS
FT                   VKAMAQEDSESLEEDSSSEEEDETPAQATPLGRLPQAKANPPPTKTPPASASGKAVAAP
FT                   TKGKPPVPNSTVSARGQRSVPAAGKAGAPATQAQKGPVAGTGEDSESSSKEESDSEEET
FT                   PAQIKPVGKTSQVRAASAPAKESPKKGAHPGTPGKTGSSATQAQPGKTEDSDSSSEESD
FT                   SDTEMPSAQAIKSPPVSVNRNSSPAVPAPTPEGVQAVNTTKKASGTTAQSSSSESEDGD
FT                   EDLIPATQPSTYALRTSVTTPAALSRAASQPSKSEQSSRMPKGKKAKAAASAQTSSAVE
FT                   TLPMMPPQSAPIQPKATNKLGKSKLPEKQQLAPGYPKAPRSSEDSSDTSSEDEEDAKRP
FT                   QMPKSAHRLDPDPSQKETVVEETPTESSEDEMVAPSQSLLSGYMTPGLTVANSQASKAT
FT                   PRPDSNSLASSAPATKDNPDGKQKSKSQHAADTALPKTGRKEASSGSTPQKPKKPKKST
FT                   SSSPAPTQTLPNSITQRLLEQAWPLSEAQVQASVVKVLTELLEQERLKATEAIKESGKK
FT                   SQKRKLSGDLEAGAPKNKKKKEQPVPRASAVSPEKAPMTSKAKSKLDKGSAGGKGKGSP
FT                   GPQGAKEKPDGELLGIKLESGEQSDPKSKSKKKKSLKKKKDKEKKEKKKGKKSLAKDSA
FT                   SPIQKKKKKKKKSAEPAV"
FT   CDS             complement(join(23467200..23467226,23467616..23467710,
FT                   23468659..23469186,23470688..23470868,23471520..23471602,
FT                   23472046..23472268,23474300..23474421,23475461..23475647,
FT                   23481021..23481215,23481312..23481491,23481670..23481771,
FT                   23484164..23484331,23484425..23484646,23484817..23484960,
FT                   23485078..23485275,23485372..23485581,23486071..23486283,
FT                   23488300..23488551,23490542..23490615,23491320..>23491446))
FT                   /codon_start=1
FT                   /gene="Tcof1"
FT                   /locus_tag="mCG_6035"
FT                   /product="Treacher Collins Franceschetti syndrome 1,
FT                   homolog, isoform CRA_e"
FT                   /note="gene_id=mCG6035.1 transcript_id=mCT190289.0
FT                   protein_id=mCP111290.0 isoform=CRA_e"
FT                   /protein_id="EDL09802.1"
FT                   /translation="TVVHLLSGKSPKKSAEPLANTVLASETEEEGNAQALGPTAKSGTV
FT                   SAGQGSSSSEDSSISSDETDVEVKSPAKPAQAKASAAPAKDPPARTAPGPTKLGNVAPT
FT                   PAKPARAAAAAAAAAVAAAAAAAAEESESSEEDSDSEDEAPAGLPSQVKASGKGPHVRA
FT                   DSVSAKGISGKGPILATPGKTGPAATQAKAERPEKDSETSSEDDSDSEDEMPVTVNTPQ
FT                   ARTSGKSPRARGTSAPAKESSQKGAPAVTPGKARPVAAQAGKPEAKSSEESESDSGETP
FT                   AAATLTTSPAKVKPLGKSSQVRPVSTVTPGSSGKGANLPCPGKVGSAALRVQMVKKEDV
FT                   SESSSAELDSDGPGSPAKAKASLALPQKVRPVATQVKTDRGKGHSGSSEESSDSEEEAA
FT                   PAASAAQAKPALEKQMKASSRKGTPASATGASTSSHCKAGAVTSSASLSSPALAKGTQR
FT                   SDVDSSSESESEGAAPSTPRVQGKSGGKGLQGKAALGQGVAPVHTQKTGPSVKAMAQED
FT                   SESLEEDSSSEEEDETPAQATPLGRLPQAKANPPPTKTPPASASGKAVAAPTKGKPPVP
FT                   NSTVSARGQRSVPAAGKAGAPATQAQKGPVAGTGEDSESSSKEESDSEEETPAQIKPVG
FT                   KTSQVRAASAPAKESPKKGAHPGTPGKTGSSATQAQPGKTEDSDSSSEESDSDTEMPSA
FT                   QAIKSPPVSVNRNSSPAVPAPTPEGVQAVNTTKKASGTTAQSSSSESEDGDEDLIPATQ
FT                   PSTYALRTSVTTPAALSRAASQPSKSEQSSRMPKGKKAKAAASAQTSSAVETLPMMPPQ
FT                   SAPIQPKATNKLGKSKLPEKQQLAPGYPKAPRSSEDSSDTSSEDEEDAKRPQMPKSAHR
FT                   LDPDPSQKETVVEETPTESSEDEMVAPSQSLLSGYMTPGLTVANSQASKATPRPDSNSL
FT                   ASSAPATKDNPDGKQKSKSQHAADTALPKTGRKEASSGSTPQKPKKPKKSTSSSPAPTQ
FT                   TLPNSITQRLLEQAWPLSEAQVQASVVKVLTELLEQERLKATEAIKESGKKSQKRKLSG
FT                   DLEAGAPKNKKKKEQPVPRASAVSPEKAPMTSKAKSKLDKGSAGGKGKGSPGPQGAKEK
FT                   PDGELLGIKLESGEQSDPKSKSKKKKSLKKKKDKEKKEKKKGKKSLAKDSASPIQKKKK
FT                   KKKKSAEPAV"
FT   mRNA            complement(join(23468660..23469186,23470688..23470868,
FT                   23471520..23471602,23472046..23472268,23474290..23474421,
FT                   23475461..23475647,23479996..23480103,23481021..23481215,
FT                   23481312..23481491,23481670..23481771,23484164..23484331,
FT                   23484425..23484646,23484817..23484960,23485078..23485275,
FT                   23485372..23485581,23486071..23486283,23488300..23488551,
FT                   23490542..23490615,23491320..23491506,23492217..23492278,
FT                   23495852..23495997,23498437..23498492,23501375..>23501575))
FT                   /gene="Tcof1"
FT                   /locus_tag="mCG_6035"
FT                   /product="Treacher Collins Franceschetti syndrome 1,
FT                   homolog, transcript variant mCT190288"
FT                   /note="gene_id=mCG6035.1 transcript_id=mCT190288.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(23472171..23472268,23474290..23474421,
FT                   23475461..23475647,23479996..23480103,23481021..23481215,
FT                   23481312..23481491,23481670..23481771,23484164..23484331,
FT                   23484425..23484646,23484817..23484960,23485078..23485275,
FT                   23485372..23485581,23486071..23486283,23488300..23488551,
FT                   23490542..23490615,23491320..23491506,23492217..23492278,
FT                   23495852..23495997,23498437..23498492,23501375..>23501557))
FT                   /codon_start=1
FT                   /gene="Tcof1"
FT                   /locus_tag="mCG_6035"
FT                   /product="Treacher Collins Franceschetti syndrome 1,
FT                   homolog, isoform CRA_d"
FT                   /note="gene_id=mCG6035.1 transcript_id=mCT190288.0
FT                   protein_id=mCP111289.0 isoform=CRA_d"
FT                   /protein_id="EDL09801.1"
FT                   /translation="GSRARGKRLAGARGRARESPGQISGMAEARKRRELLPLIYHHLLQ
FT                   AGYVRAAREVKEQSGQKSFLTQPVTLLDIYTHWQQTSELGQKQKAEDDETLQAKKSRVS
FT                   DPVSSSESSDQEKEEEAATERAKATPRPTPVNSATAALPSKVKEKGKTKTANKTVNSVS
FT                   HPGSGKTVVHLLSGKSPKKSAEPLANTVLASETEEEGNAQALGPTAKSGTVSAGQGSSS
FT                   SEDSSISSDETDVEVKSPAKPAQAKASAAPAKDPPARTAPGPTKLGNVAPTPAKPARAA
FT                   AAAAAAAVAAAAAAAAEESESSEEDSDSEDEAPAGLPSQVKASGKGPHVRADSVSAKGI
FT                   SGKGPILATPGKTGPAATQAKAERPEKDSETSSEDDSDSEDEMPVTVNTPQARTSGKSP
FT                   RARGTSAPAKESSQKGAPAVTPGKARPVAAQAGKPEAKSSEESESDSGETPAAATLTTS
FT                   PAKVKPLGKSSQVRPVSTVTPGSSGKGANLPCPGKVGSAALRVQMVKKEDVSESSSAEL
FT                   DSDGPGSPAKAKASLALPQKVRPVATQVKTDRGKGHSGSSEESSDSEEEAAPAASAAQA
FT                   KPALEKQMKASSRKGTPASATGASTSSHCKAGAVTSSASLSSPALAKGTQRSDVDSSSE
FT                   SESEGAAPSTPRVQGKSGGKGLQGKAALGQGVAPVHTQKTGPSVKAMAQEDSESLEEDS
FT                   SSEEEDETPAQATPLGRLPQAKANPPPTKTPPASASGKAVAAPTKGKPPVPNSTVSARG
FT                   QRSVPAAGKAGAPATQAQKGPVAGTGEDSESSSKEESDSEEETPAQIKPVGKTSQVRAA
FT                   SAPAKESPKKGAHPGTPGKTGSSATQAQPGKTEDSDSSSEESDSDTEMPSAQDAISQPA
FT                   RGKASGPASPEKSIEGSSESSDEDLPSGQAIKSPPVSVNRNSSPAVPAPTPEGVQAVNT
FT                   TKKASGTTAQSSSSESEDGDEDLIPATQPSTYALRTSVTTPAALSRAASQPSKSEQSSR
FT                   MPKGKKAKAAASAQVLSDQQCRGNTPHDASPERTHPAQSHQQAREIQAP"
FT   assembly_gap    23506476..23506495
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23507845..23507864
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23512005..23512596
FT                   /estimated_length=592
FT                   /gap_type="unknown"
FT   assembly_gap    23515569..23515651
FT                   /estimated_length=83
FT                   /gap_type="unknown"
FT   assembly_gap    23529460..23529526
FT                   /estimated_length=67
FT                   /gap_type="unknown"
FT   assembly_gap    23543294..23543313
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23547568..23547671
FT                   /estimated_length=104
FT                   /gap_type="unknown"
FT   assembly_gap    23551401..23551420
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            23565780..23572288
FT                   /locus_tag="mCG_6034"
FT                   /note="gene_id=mCG6034.2"
FT   mRNA            join(23565780..23566334,23570141..23572288)
FT                   /locus_tag="mCG_6034"
FT                   /product="mCG6034"
FT                   /note="gene_id=mCG6034.2 transcript_id=mCT4702.2 created on
FT                   04-OCT-2002"
FT   CDS             join(23566024..23566334,23570141..23571551)
FT                   /codon_start=1
FT                   /locus_tag="mCG_6034"
FT                   /product="mCG6034"
FT                   /note="gene_id=mCG6034.2 transcript_id=mCT4702.2
FT                   protein_id=mCP21567.1"
FT                   /db_xref="GOA:Q32KI9"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024607"
FT                   /db_xref="MGI:MGI:2670959"
FT                   /protein_id="EDL09797.1"
FT                   /translation="MHALSGFSLVSLLSLGYLSWDWAKPGLVADGPAEAGDQPSVAPPQ
FT                   PPHIIFILTDDQGYHDVGYHGSDIETPTLDRLAAEGVKLENYYIQPICTPSRSQLLTGR
FT                   YQIHTGLQHSIIRPRQPNCLPLDQVTLPQKLQEAGYSTHMVGKWHLGFYRKECLPTRRG
FT                   FDTFLGSLTGNVDYYTYDNCDGPGVCGFDLHEGESVAWGLSGQYSTMLYAQRASHILAS
FT                   HNPQNPLFLYVAFQAVHTPLQSPREYLYRYRTMGNVARRKYAAMVTCMDEAVRNITWAL
FT                   KRYGFYNNSVIIFSSDNGGQTFSGGSNWPLRGRKGTYWEGGVRGLGFVHSPLLKKKRRT
FT                   SRALVHITDWYPTLVGLAGGTTSAADGLDGYDVWPAISEGRASPRTEILHNIDPLYNHA
FT                   RHGSLEGGFGIWNTAVQAAIRVGEWKLLTGDPGYGDWIPPQTLASFPGSWWNLERMASI
FT                   RQAVWLFNISADPYEREDLAGQRPDVVRTLLARLADYNRTAIPVRYPAANPRAHPDFNG
FT                   GAWGPWASEEEEEEEEEEEEGRARSFSRGRRKKKCKICKLRSFFRKLNTRLMSHRI"
FT   gene            23579404..23640203
FT                   /gene="Camk2a"
FT                   /locus_tag="mCG_127781"
FT                   /note="gene_id=mCG127781.1"
FT   mRNA            join(23579404..23579611,23595076..23595170,
FT                   23600775..23600834,23605162..23605216,23606003..23606068,
FT                   23606154..23606226,23609407..23609509,23610974..23611057,
FT                   23611170..23611264,23612011..23612133,23612443..23612526,
FT                   23613873..23613915,23617793..23617833,23623733..23623781,
FT                   23631675..23631750,23633778..23633872,23638135..23638363,
FT                   23638586..23640203)
FT                   /gene="Camk2a"
FT                   /locus_tag="mCG_127781"
FT                   /product="calcium/calmodulin-dependent protein kinase II
FT                   alpha, transcript variant mCT129074"
FT                   /note="gene_id=mCG127781.1 transcript_id=mCT129074.1
FT                   created on 04-OCT-2002"
FT   mRNA            join(23579537..23579611,23595076..23595170,
FT                   23596898..23597183)
FT                   /gene="Camk2a"
FT                   /locus_tag="mCG_127781"
FT                   /product="calcium/calmodulin-dependent protein kinase II
FT                   alpha, transcript variant mCT173858"
FT                   /note="gene_id=mCG127781.1 transcript_id=mCT173858.0
FT                   created on 04-OCT-2002"
FT   CDS             join(23579550..23579611,23595076..23595170,
FT                   23600775..23600834,23605162..23605216,23606003..23606068,
FT                   23606154..23606226,23609407..23609509,23610974..23611057,
FT                   23611170..23611264,23612011..23612133,23612443..23612526,
FT                   23613873..23613915,23617793..23617833,23623733..23623781,
FT                   23631675..23631750,23633778..23633872,23638135..23638363,
FT                   23638586..23638589)
FT                   /codon_start=1
FT                   /gene="Camk2a"
FT                   /locus_tag="mCG_127781"
FT                   /product="calcium/calmodulin-dependent protein kinase II
FT                   alpha, isoform CRA_c"
FT                   /note="gene_id=mCG127781.1 transcript_id=mCT129074.1
FT                   protein_id=mCP77875.1 isoform=CRA_c"
FT                   /protein_id="EDL09795.1"
FT                   /translation="MATITCTRFTEEYQLFEELGKGAFSVVRRCVKVLAGQEYAAKIIN
FT                   TKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGHHYLIFDLVTGGELFEDIVAR
FT                   EYYSEADASHCIQQILEAVLHCHQMGVVHRDLKPENLLLASKLKGAAVKLADFGLAIEV
FT                   EGEQQAWFGFAGTPGYLSPEVLRKDPYGKPVDLWACGVILYILLVGYPPFWDEDQHRLY
FT                   QQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPSKRITAAEALKHPWISHRSTVASCM
FT                   HRQETVDCLKKFNARRKLKGAILTTMLATRNFSGGKSGGNKKNDGVKESSESTNTTIED
FT                   EDTKVRKQEIIKVTEQLIEAISNGDFESYTKMCDPGMTAFEPEALGNLVEGLDFHRFYF
FT                   ENLWSRNSKPVHTTILNPHIHLMGDESACIAYIRITQYLDAGGIPRTAQSEETRVWHRR
FT                   DGKWQIVHFHRSGAPSVLPH"
FT   CDS             join(23579550..23579611,23595076..23595170,
FT                   23596898..23597067)
FT                   /codon_start=1
FT                   /gene="Camk2a"
FT                   /locus_tag="mCG_127781"
FT                   /product="calcium/calmodulin-dependent protein kinase II
FT                   alpha, isoform CRA_b"
FT                   /note="gene_id=mCG127781.1 transcript_id=mCT173858.0
FT                   protein_id=mCP96776.0 isoform=CRA_b"
FT                   /db_xref="GOA:D3Z7K9"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="MGI:MGI:88256"
FT                   /db_xref="UniProtKB/TrEMBL:D3Z7K9"
FT                   /protein_id="EDL09794.1"
FT                   /translation="MATITCTRFTEEYQLFEELGKGAFSVVRRCVKVLAGQEYAAKIIN
FT                   TKKLSARGGFYSCHFWQYSLNFSCCLSGMTSCSSLQEQTYPGRLSTPFSKLWPPLAHTL
FT                   PGLF"
FT   mRNA            join(23580720..23580790,23595061..23595170,
FT                   23600775..23600834,23605162..23605216,23606003..23606068,
FT                   23606154..23606226,23609407..23609509,23610974..23611057,
FT                   23611170..23611264,23612011..23612133,23612443..23612526,
FT                   23613873..23613915,23617793..23617833,23623733..23623781,
FT                   23631675..23631750,23633778..23633872,23638135..>23638291)
FT                   /gene="Camk2a"
FT                   /locus_tag="mCG_127781"
FT                   /product="calcium/calmodulin-dependent protein kinase II
FT                   alpha, transcript variant mCT173857"
FT                   /note="gene_id=mCG127781.1 transcript_id=mCT173857.0
FT                   created on 04-OCT-2002"
FT   CDS             join(23580765..23580790,23595061..23595170,
FT                   23600775..23600834,23605162..23605216,23606003..23606068,
FT                   23606154..23606226,23609407..23609509,23610974..23611057,
FT                   23611170..23611264,23612011..23612133,23612443..23612526,
FT                   23613873..23613915,23617793..23617833,23623733..23623781,
FT                   23631675..23631750,23633778..23633872,23638135..>23638291)
FT                   /codon_start=1
FT                   /gene="Camk2a"
FT                   /locus_tag="mCG_127781"
FT                   /product="calcium/calmodulin-dependent protein kinase II
FT                   alpha, isoform CRA_a"
FT                   /note="gene_id=mCG127781.1 transcript_id=mCT173857.0
FT                   protein_id=mCP96777.0 isoform=CRA_a"
FT                   /protein_id="EDL09793.1"
FT                   /translation="MDMHLCAHVSLSPRGAFSVVRRCVKVLAGQEYAAKIINTKKLSAR
FT                   DHQKLEREARICRLLKHPNIVRLHDSISEEGHHYLIFDLVTGGELFEDIVAREYYSEAD
FT                   ASHCIQQILEAVLHCHQMGVVHRDLKPENLLLASKLKGAAVKLADFGLAIEVEGEQQAW
FT                   FGFAGTPGYLSPEVLRKDPYGKPVDLWACGVILYILLVGYPPFWDEDQHRLYQQIKAGA
FT                   YDFPSPEWDTVTPEAKDLINKMLTINPSKRITAAEALKHPWISHRSTVASCMHRQETVD
FT                   CLKKFNARRKLKGAILTTMLATRNFSGGKSGGNKKNDGVKESSESTNTTIEDEDTKVRK
FT                   QEIIKVTEQLIEAISNGDFESYTKMCDPGMTAFEPEALGNLVEGLDFHRFYFENLWSRN
FT                   SKPVHTTILNPHIHLMGDESACIAYIRITQYLDAGGIPRTAQSEETRV"
FT   mRNA            join(23617424..23617833,23622750..23622782,
FT                   23623733..23623781,23631675..23631750,23633778..23633872,
FT                   23638135..23638363,23638586..23638672)
FT                   /gene="Camk2a"
FT                   /locus_tag="mCG_127781"
FT                   /product="calcium/calmodulin-dependent protein kinase II
FT                   alpha, transcript variant mCT173856"
FT                   /note="gene_id=mCG127781.1 transcript_id=mCT173856.0
FT                   created on 04-OCT-2002"
FT   CDS             join(23617717..23617833,23622750..23622782,
FT                   23623733..23623781,23631675..23631750,23633778..23633872,
FT                   23638135..23638363,23638586..23638589)
FT                   /codon_start=1
FT                   /gene="Camk2a"
FT                   /locus_tag="mCG_127781"
FT                   /product="calcium/calmodulin-dependent protein kinase II
FT                   alpha, isoform CRA_d"
FT                   /note="gene_id=mCG127781.1 transcript_id=mCT173856.0
FT                   protein_id=mCP96775.0 isoform=CRA_d"
FT                   /protein_id="EDL09796.1"
FT                   /translation="MLLFLTLWALVPCLVLLTLYFLSSTGGKSGGNKKNDGVKKRKSSS
FT                   SVQLMESSESTNTTIEDEDTKVRKQEIIKVTEQLIEAISNGDFESYTKMCDPGMTAFEP
FT                   EALGNLVEGLDFHRFYFENLWSRNSKPVHTTILNPHIHLMGDESACIAYIRITQYLDAG
FT                   GIPRTAQSEETRVWHRRDGKWQIVHFHRSGAPSVLPH"
FT   assembly_gap    23621001..23621364
FT                   /estimated_length=364
FT                   /gap_type="unknown"
FT   assembly_gap    23637964..23638068
FT                   /estimated_length=105
FT                   /gap_type="unknown"
FT   assembly_gap    23641642..23642170
FT                   /estimated_length=529
FT                   /gap_type="unknown"
FT   gene            complement(23649239..>23668085)
FT                   /gene="Slc6a7"
FT                   /locus_tag="mCG_140805"
FT                   /note="gene_id=mCG140805.0"
FT   mRNA            complement(join(23649239..23650713,23654312..23654479,
FT                   23655182..23655282,23655460..23655559,23656013..23656131,
FT                   23657127..23657251,23657373..23657476,23658277..23658411,
FT                   23659600..23659738,23661261..23661495,23661602..23661733,
FT                   23663308..23663491,23667863..23668085))
FT                   /gene="Slc6a7"
FT                   /locus_tag="mCG_140805"
FT                   /product="solute carrier family 6 (neurotransmitter
FT                   transporter, L-proline), member 7, transcript variant
FT                   mCT171603"
FT                   /note="gene_id=mCG140805.0 transcript_id=mCT171603.0
FT                   created on 06-AUG-2002"
FT   mRNA            complement(join(23649244..23650713,23654312..23654479,
FT                   23655182..23655282,23655460..23655559,23656013..23656144,
FT                   23656216..23656328,23657127..23657251,23657373..23657476,
FT                   23658277..23658411,23659600..23659738,23661261..23661495,
FT                   23661602..23661733,23663308..23663491,23667863..>23668085))
FT                   /gene="Slc6a7"
FT                   /locus_tag="mCG_140805"
FT                   /product="solute carrier family 6 (neurotransmitter
FT                   transporter, L-proline), member 7, transcript variant
FT                   mCT190277"
FT                   /note="gene_id=mCG140805.0 transcript_id=mCT190277.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(23650501..23650713,23654312..23654479,
FT                   23655182..23655282,23655460..23655559,23656013..23656144,
FT                   23656216..23656328,23657127..23657251,23657373..23657476,
FT                   23658277..23658411,23659600..23659738,23661261..23661495,
FT                   23661602..23661733,23663308..23663491,23667863..>23667964))
FT                   /codon_start=1
FT                   /gene="Slc6a7"
FT                   /locus_tag="mCG_140805"
FT                   /product="solute carrier family 6 (neurotransmitter
FT                   transporter, L-proline), member 7, isoform CRA_b"
FT                   /note="gene_id=mCG140805.0 transcript_id=mCT190277.0
FT                   protein_id=mCP111267.0 isoform=CRA_b"
FT                   /protein_id="EDL09792.1"
FT                   /translation="DQCSAPAWLALCALASCPRRLSKMKKLQEAHLRKPITPDLLMTPS
FT                   DQGDVDLDVDFAADRGNWTGKLDFLLSCIGYCVGLGNVWRFPYRAYTNGGGAFLVPYFL
FT                   MLAICGIPLFFLELSLGQFSSLGPLAVWKISPLFKGAGAAMLLIVGLVAIYYNMIIAYV
FT                   LFYLFASLTSNLPWEHCGNWWNTELCLEHRGPKSGNGVLPLNLSSTVSPSEEYWSRYVL
FT                   HIQGSQGIGRPGEIRWNLCLCLLLAWVIVFLCILKGVKSSGKVVYFTATFPYLILLMLL
FT                   VRGVTLPGAWKGIQFYLTPQFHHLLSSKVWIEAALQIFYSLGVGFGGLLTFASYNTFHQ
FT                   NIYRDTFIVTLGNAITSILAGFAIFSVLGYMSQELGVPVDQVAKAGPGLAFVVYPQAMT
FT                   MLPLSPFWSFLFFFMLLTLGLDSQFAFLETIVTAVTDEFPYYLRPKKAVFSGLICVAMY
FT                   LMGLILTTDGGMYWLVLLDDYSASFGLMVVVITTCLAVTRVYGIQRFCRDIHMMLGFKP
FT                   GLYFRACWLFLSPATLLALLVYSIVKYQPSEYGSYRFPAWAELLGILMGLLSCLMIPAG
FT                   MLVAVLREEGSLWERLQQASRPAMDWGPSLEENRTGMYVATLAGSQSPKPLMVHMRKYG
FT                   GITSFENTAIEVDREIAEEEEESMM"
FT   CDS             complement(join(23650501..23650713,23654312..23654479,
FT                   23655182..23655282,23655460..23655559,23656013..23656131,
FT                   23657127..23657251,23657373..23657476,23658277..23658411,
FT                   23659600..23659738,23661261..23661495,23661602..23661733,
FT                   23663308..23663491,23667863..23667895))
FT                   /codon_start=1
FT                   /gene="Slc6a7"
FT                   /locus_tag="mCG_140805"
FT                   /product="solute carrier family 6 (neurotransmitter
FT                   transporter, L-proline), member 7, isoform CRA_a"
FT                   /note="gene_id=mCG140805.0 transcript_id=mCT171603.0
FT                   protein_id=mCP94522.0 isoform=CRA_a"
FT                   /protein_id="EDL09791.1"
FT                   /translation="MKKLQEAHLRKPITPDLLMTPSDQGDVDLDVDFAADRGNWTGKLD
FT                   FLLSCIGYCVGLGNVWRFPYRAYTNGGGAFLVPYFLMLAICGIPLFFLELSLGQFSSLG
FT                   PLAVWKISPLFKGAGAAMLLIVGLVAIYYNMIIAYVLFYLFASLTSNLPWEHCGNWWNT
FT                   ELCLEHRGPKSGNGVLPLNLSSTVSPSEEYWSRYVLHIQGSQGIGRPGEIRWNLCLCLL
FT                   LAWVIVFLCILKGVKSSGKVVYFTATFPYLILLMLLVRGVTLPGAWKGIQFYLTPQFHH
FT                   LLSSKVWIEAALQIFYSLGVGFGGLLTFASYNTFHQNIYRDTFIVTLGNAITSILAGFA
FT                   IFSVLGYMSQELGVPVDQVAKAETIVTAVTDEFPYYLRPKKAVFSGLICVAMYLMGLIL
FT                   TTDGGMYWLVLLDDYSASFGLMVVVITTCLAVTRVYGIQRFCRDIHMMLGFKPGLYFRA
FT                   CWLFLSPATLLALLVYSIVKYQPSEYGSYRFPAWAELLGILMGLLSCLMIPAGMLVAVL
FT                   REEGSLWERLQQASRPAMDWGPSLEENRTGMYVATLAGSQSPKPLMVHMRKYGGITSFE
FT                   NTAIEVDREIAEEEEESMM"
FT   gene            complement(23672750..23689940)
FT                   /gene="Cdx1"
FT                   /locus_tag="mCG_6367"
FT                   /note="gene_id=mCG6367.2"
FT   mRNA            complement(join(23672750..23673827,23674260..23674405,
FT                   23689560..23689940))
FT                   /gene="Cdx1"
FT                   /locus_tag="mCG_6367"
FT                   /product="caudal type homeobox 1"
FT                   /note="gene_id=mCG6367.2 transcript_id=mCT4721.1 created on
FT                   04-OCT-2002"
FT   CDS             complement(join(23674349..23674405,23689560..23689778))
FT                   /codon_start=1
FT                   /gene="Cdx1"
FT                   /locus_tag="mCG_6367"
FT                   /product="caudal type homeobox 1"
FT                   /note="gene_id=mCG6367.2 transcript_id=mCT4721.1
FT                   protein_id=mCP21545.1"
FT                   /protein_id="EDL09790.1"
FT                   /translation="MARAPRPQPPARPRWPSGPLRTLARCPRLPGLVPASWRSPSGLRA
FT                   HRPRQERQGGRPTNGCGAAWRLQAAVAAVRPEPRTSTVWSTQTTNA"
FT   gene            <23699028..23738931
FT                   /gene="Pdgfrb"
FT                   /locus_tag="mCG_6019"
FT                   /note="gene_id=mCG6019.2"
FT   mRNA            join(<23699028..23699456,23713841..23713886,
FT                   23714902..23715222,23717564..23717830,23718494..23718621,
FT                   23718702..23718876,23719420..23719612,23720203..23720318,
FT                   23721821..23721944,23722467..23722681,23725386..23725480,
FT                   23726355..23726487,23726966..23727070,23727353..23727463,
FT                   23730244..23730403,23731414..23731574,23732325..23732443,
FT                   23732674..23732796,23733420..23733531,23734092..23734191,
FT                   23734751..23734856,23735613..23735845,23737093..23738931)
FT                   /gene="Pdgfrb"
FT                   /locus_tag="mCG_6019"
FT                   /product="platelet derived growth factor receptor, beta
FT                   polypeptide, transcript variant mCT190287"
FT                   /note="gene_id=mCG6019.2 transcript_id=mCT190287.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(23699325..23699456,23713841..23713886,
FT                   23714902..23715222,23717564..23717830,23718494..23718621,
FT                   23718702..23718876,23719420..23719612,23720203..23720318,
FT                   23721821..23721944,23722470..23722681,23725386..23725480,
FT                   23726355..23726487,23726966..23727070,23727353..23727463,
FT                   23730244..23730403,23731414..23731574,23732325..23732443,
FT                   23732674..23732796,23733420..23733531,23734092..23734191,
FT                   23734751..23734856,23735613..23735845,23737093..23738931)
FT                   /gene="Pdgfrb"
FT                   /locus_tag="mCG_6019"
FT                   /product="platelet derived growth factor receptor, beta
FT                   polypeptide, transcript variant mCT4724"
FT                   /note="gene_id=mCG6019.2 transcript_id=mCT4724.0 created on
FT                   04-OCT-2002"
FT   mRNA            join(23699325..23699456,23713841..23713886,
FT                   23714902..23715222,23717564..23717830,23718494..23718621,
FT                   23718702..23718876,23719420..23719612,23720203..23720318,
FT                   23721821..23721944,23722470..23722681,23725386..23725480,
FT                   23726355..23726487,23726966..23727070,23727353..23727463,
FT                   23730244..23730403,23731414..23731574,23732325..23732443,
FT                   23732674..23732796,23733420..23733531,23734092..23734191,
FT                   23734751..23734856,23735613..23735845,23737093..23737146,
FT                   23737319..23737731)
FT                   /gene="Pdgfrb"
FT                   /locus_tag="mCG_6019"
FT                   /product="platelet derived growth factor receptor, beta
FT                   polypeptide, transcript variant mCT173920"
FT                   /note="gene_id=mCG6019.2 transcript_id=mCT173920.0 created
FT                   on 04-OCT-2002"
FT   CDS             join(<23699430..23699456,23713841..23713886,
FT                   23714902..23715222,23717564..23717830,23718494..23718621,
FT                   23718702..23718876,23719420..23719612,23720203..23720318,
FT                   23721821..23721944,23722467..23722681,23725386..23725480,
FT                   23726355..23726487,23726966..23727070,23727353..23727463,
FT                   23730244..23730403,23731414..23731574,23732325..23732443,
FT                   23732674..23732796,23733420..23733531,23734092..23734191,
FT                   23734751..23734856,23735613..23735845,23737093..23737255)
FT                   /codon_start=1
FT                   /gene="Pdgfrb"
FT                   /locus_tag="mCG_6019"
FT                   /product="platelet derived growth factor receptor, beta
FT                   polypeptide, isoform CRA_b"
FT                   /note="gene_id=mCG6019.2 transcript_id=mCT190287.0
FT                   protein_id=mCP111286.0 isoform=CRA_b"
FT                   /protein_id="EDL09788.1"
FT                   /translation="LTSEAICSPDTMGLPGVIPALVLRGQLLLSVLWLLGPQTSRGLVI
FT                   TPPGPEFVLNISSTFVLTCSGSAPVMWEQMSQVPWQEAAMNQDGTFSSVLTLTNVTGGD
FT                   TGEYFCVYNNSLGPELSERKRIYIFVPDPTMGFLPMDSEDLFIFVTDVTETTIPCRVTD
FT                   PQLEVTLHEKKVDIPLHVPYDHQRGFTGTFEDKTYICKTTIGDREVDSDTYYVYSLQVS
FT                   SINVSVNAVQTVVRQGESITIRCIVMGNDVVNFQWTYPRMKSGRLVEPVTDYLFGVPSR
FT                   IGSILHIPTAELSDSGTYTCNVSVSVNDHGDEKAINISVIENGYVRLLETLGDVEIAEL
FT                   HRSRTLRVVFEAYPMPSVLWLKDNRTLGDSGAGELVLSTRNMSETRYVSELILVRVKVS
FT                   EAGYYTMRAFHEDDEVQLSFKLQVNVPVRVLELSESHPANGEQTIRCRGRGMPQPNVTW
FT                   STCRDLKSRCPRKLSPTPLGNSSKEESQLETNVTFWEEDQEYEVVSTLRLRHVDQPLSV
FT                   RCMLQNSMGGDSQEVTVVPHSLPFKVVVISAILALVVLTVISLIILIMLWQKKPRYEIR
FT                   WKVIESVSSDGHEYIYVDPVQLPYDSTWELPRDQLVLGRTLGSGAFGQVVEATAHGLSH
FT                   SQATMKVAVKMLKSTARSSEKQALMSELKIMSHLGPHLNVVNLLGACTKGGPIYIITEY
FT                   CRYGDLVDYLHRNKHTFLQRHSNKHCPPSAELYSNALPVGFSLPSHLNLTGESDGGYMD
FT                   MSKDESIDYVPMLDMKGDIKYADIESPSYMAPYDNYVPSAPERTYRATLINDSPVLSYT
FT                   DLVGFSYQVANGMDFLASKNCVHRDLAARNVLICEGKLVKICDFGLARDIMRDSNYISK
FT                   GSTFLPLKWMAPESIFNSLYTTLSDVWSFGILLWEIFTLGGTPYPELPMNDQFYNAIKR
FT                   GYRMAQPAHASDEIYEIMQKCWEEKFETRPPFSQLVLLLERLLGEGYKKKYQQVDEEFL
FT                   RSDHPAILRSQARFPGIHSLRSPLDTSSVLYTAVQPNESDNDYIIPLPDPKPDVADEGL
FT                   PEGSPSLASSTLNEVNTSSTISCDSPLELQEEPQQAEPEAQLEQPQDSGCPGPLAEAED
FT                   SFL"
FT   assembly_gap    23704570..23704610
FT                   /estimated_length=41
FT                   /gap_type="unknown"
FT   assembly_gap    23709196..23709231
FT                   /estimated_length=36
FT                   /gap_type="unknown"
FT   assembly_gap    23713181..23713200
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(23713847..23713886,23714902..23715222,
FT                   23717564..23717830,23718494..23718621,23718702..23718876,
FT                   23719420..23719612,23720203..23720318,23721821..23721944,
FT                   23722470..23722681,23725386..23725480,23726355..23726487,
FT                   23726966..23727070,23727353..23727463,23730244..23730403,
FT                   23731414..23731574,23732325..23732443,23732674..23732796,
FT                   23733420..23733531,23734092..23734191,23734751..23734856,
FT                   23735613..23735845,23737093..23737146,23737319..23737607)
FT                   /codon_start=1
FT                   /gene="Pdgfrb"
FT                   /locus_tag="mCG_6019"
FT                   /product="platelet derived growth factor receptor, beta
FT                   polypeptide, isoform CRA_a"
FT                   /note="gene_id=mCG6019.2 transcript_id=mCT173920.0
FT                   protein_id=mCP96839.0 isoform=CRA_a"
FT                   /protein_id="EDL09787.1"
FT                   /translation="MGLPGVIPALVLRGQLLLSVLWLLGPQTSRGLVITPPGPEFVLNI
FT                   SSTFVLTCSGSAPVMWEQMSQVPWQEAAMNQDGTFSSVLTLTNVTGGDTGEYFCVYNNS
FT                   LGPELSERKRIYIFVPDPTMGFLPMDSEDLFIFVTDVTETTIPCRVTDPQLEVTLHEKK
FT                   VDIPLHVPYDHQRGFTGTFEDKTYICKTTIGDREVDSDTYYVYSLQVSSINVSVNAVQT
FT                   VVRQGESITIRCIVMGNDVVNFQWTYPRMKSGRLVEPVTDYLFGVPSRIGSILHIPTAE
FT                   LSDSGTYTCNVSVSVNDHGDEKAINISVIENGYVRLLETLGDVEIAELHRSRTLRVVFE
FT                   AYPMPSVLWLKDNRTLGDSGAGELVLSTRNMSETRYVSELILVRVKVSEAGYYTMRAFH
FT                   EDDEVQLSFKLQVNVPVRVLELSESHPANGEQTIRCRGRGMPQPNVTWSTCRDLKRCPR
FT                   KLSPTPLGNSSKEESQLETNVTFWEEDQEYEVVSTLRLRHVDQPLSVRCMLQNSMGGDS
FT                   QEVTVVPHSLPFKVVVISAILALVVLTVISLIILIMLWQKKPRYEIRWKVIESVSSDGH
FT                   EYIYVDPVQLPYDSTWELPRDQLVLGRTLGSGAFGQVVEATAHGLSHSQATMKVAVKML
FT                   KSTARSSEKQALMSELKIMSHLGPHLNVVNLLGACTKGGPIYIITEYCRYGDLVDYLHR
FT                   NKHTFLQRHSNKHCPPSAELYSNALPVGFSLPSHLNLTGESDGGYMDMSKDESIDYVPM
FT                   LDMKGDIKYADIESPSYMAPYDNYVPSAPERTYRATLINDSPVLSYTDLVGFSYQVANG
FT                   MDFLASKNCVHRDLAARNVLICEGKLVKICDFGLARDIMRDSNYISKGSTFLPLKWMAP
FT                   ESIFNSLYTTLSDVWSFGILLWEIFTLGGTPYPELPMNDQFYNAIKRGYRMAQPAHASD
FT                   EIYEIMQKCWEEKFETRPPFSQLVLLLERLLGEGYKKKYQQVDEEFLRSDHPAILRSQA
FT                   RFPGIHSLRSPLDTSSVLYTAVQPNESDNDYIIPLPDPKPDVADEGLPEGSPSLASSTL
FT                   NEVNTSSTISCDSPLLAWPGLASQQLHCHKLSPRGKPLVCSTQGPGTQLSLGGKRTLPR
FT                   EGHGTLNQGSSRGLSFPKCKRKSCTWLQDRSGARIPAEIHDCTVVCSYPPV"
FT   CDS             join(23713847..23713886,23714902..23715222,
FT                   23717564..23717830,23718494..23718621,23718702..23718876,
FT                   23719420..23719612,23720203..23720318,23721821..23721944,
FT                   23722470..23722681,23725386..23725480,23726355..23726487,
FT                   23726966..23727070,23727353..23727463,23730244..23730403,
FT                   23731414..23731574,23732325..23732443,23732674..23732796,
FT                   23733420..23733531,23734092..23734191,23734751..23734856,
FT                   23735613..23735845,23737093..23737255)
FT                   /codon_start=1
FT                   /gene="Pdgfrb"
FT                   /locus_tag="mCG_6019"
FT                   /product="platelet derived growth factor receptor, beta
FT                   polypeptide, isoform CRA_c"
FT                   /note="gene_id=mCG6019.2 transcript_id=mCT4724.0
FT                   protein_id=mCP21546.1 isoform=CRA_c"
FT                   /protein_id="EDL09789.1"
FT                   /translation="MGLPGVIPALVLRGQLLLSVLWLLGPQTSRGLVITPPGPEFVLNI
FT                   SSTFVLTCSGSAPVMWEQMSQVPWQEAAMNQDGTFSSVLTLTNVTGGDTGEYFCVYNNS
FT                   LGPELSERKRIYIFVPDPTMGFLPMDSEDLFIFVTDVTETTIPCRVTDPQLEVTLHEKK
FT                   VDIPLHVPYDHQRGFTGTFEDKTYICKTTIGDREVDSDTYYVYSLQVSSINVSVNAVQT
FT                   VVRQGESITIRCIVMGNDVVNFQWTYPRMKSGRLVEPVTDYLFGVPSRIGSILHIPTAE
FT                   LSDSGTYTCNVSVSVNDHGDEKAINISVIENGYVRLLETLGDVEIAELHRSRTLRVVFE
FT                   AYPMPSVLWLKDNRTLGDSGAGELVLSTRNMSETRYVSELILVRVKVSEAGYYTMRAFH
FT                   EDDEVQLSFKLQVNVPVRVLELSESHPANGEQTIRCRGRGMPQPNVTWSTCRDLKRCPR
FT                   KLSPTPLGNSSKEESQLETNVTFWEEDQEYEVVSTLRLRHVDQPLSVRCMLQNSMGGDS
FT                   QEVTVVPHSLPFKVVVISAILALVVLTVISLIILIMLWQKKPRYEIRWKVIESVSSDGH
FT                   EYIYVDPVQLPYDSTWELPRDQLVLGRTLGSGAFGQVVEATAHGLSHSQATMKVAVKML
FT                   KSTARSSEKQALMSELKIMSHLGPHLNVVNLLGACTKGGPIYIITEYCRYGDLVDYLHR
FT                   NKHTFLQRHSNKHCPPSAELYSNALPVGFSLPSHLNLTGESDGGYMDMSKDESIDYVPM
FT                   LDMKGDIKYADIESPSYMAPYDNYVPSAPERTYRATLINDSPVLSYTDLVGFSYQVANG
FT                   MDFLASKNCVHRDLAARNVLICEGKLVKICDFGLARDIMRDSNYISKGSTFLPLKWMAP
FT                   ESIFNSLYTTLSDVWSFGILLWEIFTLGGTPYPELPMNDQFYNAIKRGYRMAQPAHASD
FT                   EIYEIMQKCWEEKFETRPPFSQLVLLLERLLGEGYKKKYQQVDEEFLRSDHPAILRSQA
FT                   RFPGIHSLRSPLDTSSVLYTAVQPNESDNDYIIPLPDPKPDVADEGLPEGSPSLASSTL
FT                   NEVNTSSTISCDSPLELQEEPQQAEPEAQLEQPQDSGCPGPLAEAEDSFL"
FT   assembly_gap    23730786..23730886
FT                   /estimated_length=101
FT                   /gap_type="unknown"
FT   assembly_gap    23736639..23736878
FT                   /estimated_length=240
FT                   /gap_type="unknown"
FT   assembly_gap    23750873..23751182
FT                   /estimated_length=310
FT                   /gap_type="unknown"
FT   gene            <23759790..23784799
FT                   /gene="Csf1r"
FT                   /locus_tag="mCG_6021"
FT                   /note="gene_id=mCG6021.2"
FT   mRNA            join(<23759790..23759977,23763575..23763832,
FT                   23764180..23764464,23765917..23766053,23766661..23766820,
FT                   23768710..23768896,23771000..23771115,23771251..23771371,
FT                   23771491..23771722,23772911..23773026,23778160..23778286,
FT                   23778436..23778540,23778772..23778882,23779337..23779499,
FT                   23781528..23781616,23781732..23781829,23782650..23782772,
FT                   23782933..23783044,23783366..23783465,23783767..23783875,
FT                   23783967..23784799)
FT                   /gene="Csf1r"
FT                   /locus_tag="mCG_6021"
FT                   /product="colony stimulating factor 1 receptor, transcript
FT                   variant mCT190306"
FT                   /note="gene_id=mCG6021.2 transcript_id=mCT190306.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(23759854..23759977,23763575..23763832,
FT                   23764180..23764464,23765917..23766053,23766661..23766820,
FT                   23768710..23768896,23771000..23771115,23771251..23771371,
FT                   23771491..23771681,23772911..23773026,23778160..23778286,
FT                   23778436..23778540,23778772..23778882,23779337..23779499,
FT                   23781528..23781616,23781732..23781829,23782650..23782772,
FT                   23782933..23783044,23783366..23783465,23783767..23783875,
FT                   23783967..23784796)
FT                   /gene="Csf1r"
FT                   /locus_tag="mCG_6021"
FT                   /product="colony stimulating factor 1 receptor, transcript
FT                   variant mCT4715"
FT                   /note="gene_id=mCG6021.2 transcript_id=mCT4715.1 created on
FT                   04-OCT-2002"
FT   mRNA            join(<23759860..23759977,23763575..23763832,
FT                   23764180..23764464,23765917..23766053,23766661..23766820,
FT                   23768710..23768896,23771000..23771115,23771251..23771371,
FT                   23771491..23771681,23772911..23773026,23778160..23778286,
FT                   23778436..23778540,23778772..23778882,23779337..23780750)
FT                   /gene="Csf1r"
FT                   /locus_tag="mCG_6021"
FT                   /product="colony stimulating factor 1 receptor, transcript
FT                   variant mCT190307"
FT                   /note="gene_id=mCG6021.2 transcript_id=mCT190307.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<23759863..23759977,23763575..23763832,
FT                   23764180..23764464,23765917..23766053,23766661..23766820,
FT                   23768710..23768896,23771000..23771115,23771251..23771371,
FT                   23771491..23771681,23772911..23773026,23778160..23778286,
FT                   23778436..23778540,23778772..23778882,23779337..23779503)
FT                   /codon_start=1
FT                   /gene="Csf1r"
FT                   /locus_tag="mCG_6021"
FT                   /product="colony stimulating factor 1 receptor, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG6021.2 transcript_id=mCT190307.0
FT                   protein_id=mCP111288.0 isoform=CRA_b"
FT                   /protein_id="EDL09785.1"
FT                   /translation="QLGAPCPADSPTCIGSRYPLEAMELGPPLVLLLATVWHGQGAPVI
FT                   EPSGPELVVEPGETVTLRCVSNGSVEWDGPISPYWTLDPESPGSTLTTRNATFKNTGTY
FT                   RCTELEDPMAGSTTIHLYVKDPAHSWNLLAQEVTVVEGQEAVLPCLITDPALKDSVSLM
FT                   REGGRQVLRKTVYFFSPWRGFIIRKAKVLDSNTYVCKTMVNGRESTSTGIWLKVNRVHP
FT                   EPPQIKLEPSKLVRIRGEAAQIVCSATNAEVGFNVILKRGDTKLEIPLNSDFQDNYYKK
FT                   VRALSLNAVDFQDAGIYSCVASNDVGTRTATMNFQVVESAYLNLTSEQSLLQEVSVGDS
FT                   LILTVHADAYPSIQHYNWTYLGPFFEDQRKLEFITQRAIYRYTFKLFLNRVKASEAGQY
FT                   FLMAQNKAGWNNLTFELTLRYPPEVSVTWMPVNGSDVLFCDVSGYPQPSVTWMECRGHT
FT                   DRCDEAQALQVWNDTHPEVLSQKPFDKVIIQSQLPIGTLKHNMTYFCKTHNSVGNSSQY
FT                   FRAVSLGQSKQLPDESLFTPVVVACMSVMSLLVLLLLLLLYKYKQKPKYQVRWKIIERY
FT                   EGNSYTFIDPTQLPYNEKWEFPRNNLQFGKTLGAGAFGKVVEATAFGLGKEDAVLKVAV
FT                   KMLKSTAHADEKEALMSELKIMSHLGQHENIVNLLGACTHGGPVLVITEYCCYGDLLNF
FT                   LRRKAEAMLGPSLSPGQDSEGDSSYKNIHLEKKYVRR"
FT   CDS             join(<23759863..23759977,23763575..23763832,
FT                   23764180..23764464,23765917..23766053,23766661..23766820,
FT                   23768710..23768896,23771000..23771115,23771251..23771371,
FT                   23771491..23771722,23772911..23773026,23778160..23778286,
FT                   23778436..23778447)
FT                   /codon_start=1
FT                   /gene="Csf1r"
FT                   /locus_tag="mCG_6021"
FT                   /product="colony stimulating factor 1 receptor, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG6021.2 transcript_id=mCT190306.0
FT                   protein_id=mCP111287.0 isoform=CRA_a"
FT                   /protein_id="EDL09784.1"
FT                   /translation="QLGAPCPADSPTCIGSRYPLEAMELGPPLVLLLATVWHGQGAPVI
FT                   EPSGPELVVEPGETVTLRCVSNGSVEWDGPISPYWTLDPESPGSTLTTRNATFKNTGTY
FT                   RCTELEDPMAGSTTIHLYVKDPAHSWNLLAQEVTVVEGQEAVLPCLITDPALKDSVSLM
FT                   REGGRQVLRKTVYFFSPWRGFIIRKAKVLDSNTYVCKTMVNGRESTSTGIWLKVNRVHP
FT                   EPPQIKLEPSKLVRIRGEAAQIVCSATNAEVGFNVILKRGDTKLEIPLNSDFQDNYYKK
FT                   VRALSLNAVDFQDAGIYSCVASNDVGTRTATMNFQVVESAYLNLTSEQSLLQEVSVGDS
FT                   LILTVHADAYPSIQHYNWTYLGPFFEDQRKLEFITQRAIYRYTFKLFLNRVKASEAGQY
FT                   FLMAQNKAGWNNLTFELTLRYPPEVSVTWMPVNGSDVLFCDVSGYPQPSVTWMECRGHT
FT                   DRCDEAQALQVWNDTHPEVLSQKPFDKVIIQSQLPIGTLKHNMTYFCKTHNSVGNSSQY
FT                   FRAVSLGNPSFLLLSKNGHQDKASSSPMSPSSLRWWWPVCLSCLCWCYCCCCSCTSTSR
FT                   SRSTRCAGRSSRDTKAIATPSLTLPSCPTMRSGSSLGTTCSLVRL"
FT   CDS             join(23759929..23759977,23763575..23763832,
FT                   23764180..23764464,23765917..23766053,23766661..23766820,
FT                   23768710..23768896,23771000..23771115,23771251..23771371,
FT                   23771491..23771681,23772911..23773026,23778160..23778286,
FT                   23778436..23778540,23778772..23778882,23779337..23779499,
FT                   23781528..23781616,23781732..23781829,23782650..23782772,
FT                   23782933..23783044,23783366..23783465,23783767..23783875,
FT                   23783967..23784143)
FT                   /codon_start=1
FT                   /gene="Csf1r"
FT                   /locus_tag="mCG_6021"
FT                   /product="colony stimulating factor 1 receptor, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG6021.2 transcript_id=mCT4715.1
FT                   protein_id=mCP21560.2 isoform=CRA_c"
FT                   /db_xref="GOA:Q0P635"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR001824"
FT                   /db_xref="InterPro:IPR003598"
FT                   /db_xref="InterPro:IPR003599"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR008266"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR013098"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016243"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR020635"
FT                   /db_xref="MGI:MGI:1339758"
FT                   /db_xref="UniProtKB/TrEMBL:Q0P635"
FT                   /protein_id="EDL09786.1"
FT                   /translation="MELGPPLVLLLATVWHGQGAPVIEPSGPELVVEPGETVTLRCVSN
FT                   GSVEWDGPISPYWTLDPESPGSTLTTRNATFKNTGTYRCTELEDPMAGSTTIHLYVKDP
FT                   AHSWNLLAQEVTVVEGQEAVLPCLITDPALKDSVSLMREGGRQVLRKTVYFFSPWRGFI
FT                   IRKAKVLDSNTYVCKTMVNGRESTSTGIWLKVNRVHPEPPQIKLEPSKLVRIRGEAAQI
FT                   VCSATNAEVGFNVILKRGDTKLEIPLNSDFQDNYYKKVRALSLNAVDFQDAGIYSCVAS
FT                   NDVGTRTATMNFQVVESAYLNLTSEQSLLQEVSVGDSLILTVHADAYPSIQHYNWTYLG
FT                   PFFEDQRKLEFITQRAIYRYTFKLFLNRVKASEAGQYFLMAQNKAGWNNLTFELTLRYP
FT                   PEVSVTWMPVNGSDVLFCDVSGYPQPSVTWMECRGHTDRCDEAQALQVWNDTHPEVLSQ
FT                   KPFDKVIIQSQLPIGTLKHNMTYFCKTHNSVGNSSQYFRAVSLGQSKQLPDESLFTPVV
FT                   VACMSVMSLLVLLLLLLLYKYKQKPKYQVRWKIIERYEGNSYTFIDPTQLPYNEKWEFP
FT                   RNNLQFGKTLGAGAFGKVVEATAFGLGKEDAVLKVAVKMLKSTAHADEKEALMSELKIM
FT                   SHLGQHENIVNLLGACTHGGPVLVITEYCCYGDLLNFLRRKAEAMLGPSLSPGQDSEGD
FT                   SSYKNIHLEKKYVRRDSGFSSQGVDTYVEMRPVSTSSSDSFFKQDLDKEASRPLELWDL
FT                   LHFSSQVAQGMAFLASKNCIHRDVAARNVLLTSGHVAKIGDFGLARDIMNDSNYVVKGN
FT                   ARLPVKWMAPESIFDCVYTVQSDVWSYGILLWEIFSLGLNPYPGILVNNKFYKLVKDGY
FT                   QMAQPVFAPKNIYSIMQSCWDLEPTRRPTFQQICFLLQEQARLERRDQDYANLPSSGGS
FT                   SGSDSGGGSSGGSSSEPEEESSSEHLACCEPGDIAQPLLQPNNYQFC"
FT   assembly_gap    23779127..23779146
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(23784842..23830593)
FT                   /gene="A630042L21Rik"
FT                   /locus_tag="mCG_130312"
FT                   /note="gene_id=mCG130312.1"
FT   mRNA            complement(join(23784842..23785444,23789850..23789909,
FT                   23790952..23791171,23794335..23794519,23795203..23795334,
FT                   23799973..23800100,23800791..23801092,23803913..23804062,
FT                   23805727..23805825,23808570..23808667,23808802..23808974,
FT                   23810884..23811302,23816438..23816569,23819033..23819131,
FT                   23820742..23821239,23824752..23824926,23825695..23825830,
FT                   23830121..23830540))
FT                   /gene="A630042L21Rik"
FT                   /locus_tag="mCG_130312"
FT                   /product="RIKEN cDNA A630042L21, transcript variant
FT                   mCT173869"
FT                   /note="gene_id=mCG130312.1 transcript_id=mCT173869.0
FT                   created on 04-OCT-2002"
FT   mRNA            complement(join(23784942..23786258,23787515..23787724,
FT                   23789020..23789136,23789776..23789909,23790952..23791171,
FT                   23794335..23794519,23795203..23795334,23799973..23800100,
FT                   23800791..23801092,23803913..23804062,23805727..23805825,
FT                   23808570..23808667,23808802..23808974,23810884..23811302,
FT                   23816438..23816569,23819033..23819131,23820742..23821239,
FT                   23824752..23824926,23825695..23825830,23830121..23830593))
FT                   /gene="A630042L21Rik"
FT                   /locus_tag="mCG_130312"
FT                   /product="RIKEN cDNA A630042L21, transcript variant
FT                   mCT173868"
FT                   /note="gene_id=mCG130312.1 transcript_id=mCT173868.0
FT                   created on 04-OCT-2002"
FT   mRNA            complement(join(23784942..23786258,23787515..23787724,
FT                   23789020..23789136,23789776..23789909,23790952..23791171,
FT                   23794335..23794519,23795203..23795334,23799973..23800100,
FT                   23800791..23801092,23803913..23804062,23805727..23805825,
FT                   23808570..23808667,23808802..23808974,23810884..23811302,
FT                   23812699..23813346))
FT                   /gene="A630042L21Rik"
FT                   /locus_tag="mCG_130312"
FT                   /product="RIKEN cDNA A630042L21, transcript variant
FT                   mCT173867"
FT                   /note="gene_id=mCG130312.1 transcript_id=mCT173867.0
FT                   created on 04-OCT-2002"
FT   mRNA            complement(join(23784943..23786258,23787515..23787724,
FT                   23789020..23789136,23789776..23789909,23790952..23791171,
FT                   23794335..23794519,23795203..23795334,23799973..23800100,
FT                   23800791..23801092,23803913..23804062,23805727..23805825,
FT                   23808570..23808667,23808802..23808974,23810884..23811059,
FT                   23811156..23811302,23816438..23816569,23819033..23819131,
FT                   23820742..23821239,23824752..23824926,23825695..23825830,
FT                   23830121..23830593))
FT                   /gene="A630042L21Rik"
FT                   /locus_tag="mCG_130312"
FT                   /product="RIKEN cDNA A630042L21, transcript variant
FT                   mCT131635"
FT                   /note="gene_id=mCG130312.1 transcript_id=mCT131635.1
FT                   created on 04-OCT-2002"
FT   CDS             complement(join(23785137..23785444,23789850..23789909,
FT                   23790952..23791171,23794335..23794519,23795203..23795334,
FT                   23799973..23800100,23800791..23801092,23803913..23804062,
FT                   23805727..23805825,23808570..23808667,23808802..23808974,
FT                   23810884..23811302,23816438..23816569,23819033..23819131,
FT                   23820742..23821239,23824752..23824926,23825695..23825828))
FT                   /codon_start=1
FT                   /gene="A630042L21Rik"
FT                   /locus_tag="mCG_130312"
FT                   /product="RIKEN cDNA A630042L21, isoform CRA_d"
FT                   /note="gene_id=mCG130312.1 transcript_id=mCT173869.0
FT                   protein_id=mCP96786.0 isoform=CRA_d"
FT                   /protein_id="EDL09783.1"
FT                   /translation="MDAPYDGAEVTVLMEEIEEAYYTSPGPPKKKKKYKIHGEKAKKPR
FT                   SAYLLYYYDIYLKVQQELPHLPQSEINKKISESWRLLSVAERSYYLEKAKLEKEGLDPN
FT                   SKLSALTAVVPDIPGFRKILPRSEYIIIPKSTLQEDRSCPQLELCVAQNQMSPKGSTLM
FT                   SNASPDVVASHAGMAEQCLAVEALAEEVGALPQPGTVQEIATSEILSHDMLLEEASLEV
FT                   GESHQPYQTSLVIEETLVNGSSDLPTGSLAVPHSQVGESLSVVTVMRDSSESSPSAPAT
FT                   QFIMLPLPAYSVVENPSSIKLTTTYTRRGHGTCTSPGCSFTYVTRHKPPKCPTCGNFLG
FT                   GKWIPKEKPAKVKVELASGVSSKGSVIKRNQQSVTTEQNPSKENASKLTLENSEAVSQL
FT                   LNVAPPGEGGEDREWEEVIVSDAHVLVKEVPGNRGTAVTKMPVVKSGAQAEISLGTTEN
FT                   DSPGPDILPSAEGTSSSSLLQAHKKSPGVDLFTTGPKAPELKGRARGKPSLLAAARPMR
FT                   AILPAPTSVGRGSGVGLPRARQAFPLDKTPSVRTCGLKPSTLKQLGQPIQQPPSTGEVK
FT                   LSNCASSRTPQLKIVEVKPDLFPPYKYSCTVTLDLGLATSRGRGKCKNPSCSYVYTNRH
FT                   KPRICPSCGFNLAKDRTEKTPKAIEASSPHPDVPSTTEALNPTQREVQRQSTLQLLRKV
FT                   LQIPENESELAEVFALIHELNSSRLILSNVSEETVTIEQTSWSNYYESPSTQCLLCSSP
FT                   LFKGGHNSLAGPQECWLLTANRLQVVTAQVKMCLNPHCLALHSFTDIYTGLFNVGNKLL
FT                   VSLDLLFAIRNQIKLGEDPRVSVGVVLKSVQEQTEKTLTSEELSQLQELLCNGYWAFEC
FT                   LTVRDYNDMICGICGVAPKVEMAQRNEENVLALKSVEFTWPEFLGSSEVNVEDFWTTME
FT                   TEVIEQVAFPASIPITKFDASVIAPFFPPLMRGAVVVNTEKDKTQDMQPVPGNGSALVR
FT                   LLQEGTCKLEELGSCLVGFLACLAGLFTLGIPWGPSFSLKEGCILCSSNSPCSHTLGQL
FT                   RRRNSSSRTLSAPGLGEENPSSFLWPLLLYPTSSGSSDPHHRGDVARGCDIADKQ"
FT   CDS             complement(join(23785803..23786258,23787515..23787724,
FT                   23789020..23789136,23789776..23789909,23790952..23791171,
FT                   23794335..23794519,23795203..23795334,23799973..23800100,
FT                   23800791..23801092,23803913..23804062,23805727..23805825,
FT                   23808570..23808667,23808802..23808974,23810884..23811059,
FT                   23811156..23811302,23816438..23816569,23819033..23819131,
FT                   23820742..23821239,23824752..23824926,23825695..23825828))
FT                   /codon_start=1
FT                   /gene="A630042L21Rik"
FT                   /locus_tag="mCG_130312"
FT                   /product="RIKEN cDNA A630042L21, isoform CRA_a"
FT                   /note="gene_id=mCG130312.1 transcript_id=mCT131635.1
FT                   protein_id=mCP77712.1 isoform=CRA_a"
FT                   /db_xref="GOA:G3X9M3"
FT                   /db_xref="InterPro:IPR009071"
FT                   /db_xref="MGI:MGI:2441817"
FT                   /db_xref="UniProtKB/TrEMBL:G3X9M3"
FT                   /protein_id="EDL09780.1"
FT                   /translation="MDAPYDGAEVTVLMEEIEEAYYTSPGPPKKKKKYKIHGEKAKKPR
FT                   SAYLLYYYDIYLKVQQELPHLPQSEINKKISESWRLLSVAERSYYLEKAKLEKEGLDPN
FT                   SKLSALTAVVPDIPGFRKILPRSEYIIIPKSTLQEDRSCPQLELCVAQNQMSPKGSTLM
FT                   SNASPDVVASHAGMAEQCLAVEALAEEVGALPQPGTVQEIATSEILSHDMLLEEASLEV
FT                   GESHQPYQTSLVIEETLVNGSSDLPTGSLAVPHSQVGESLSVVTVMRDSSESSPSAPAT
FT                   QFIMLPLPAYSVVENPSSIKLTTTYTRRGHGTCTSPGCSFTYVTRHKPPKCPTCGNFLG
FT                   GKWIPKEKPAKVKVELASGVSSKGSVIKRNQQSVTTEQNPSKENASKLTLENSEAEVPG
FT                   NRGTAVTKMPVVKSGAQAEISLGTTENDSPGPDILPSAEGTSSSSLLQAHKKSPGVDLF
FT                   TTGPKAPELKGRARGKPSLLAAARPMRAILPAPTSVGRGSGVGLPRARQAFPLDKTPSV
FT                   RTCGLKPSTLKQLGQPIQQPPSTGEVKLSNCASSRTPQLKIVEVKPDLFPPYKYSCTVT
FT                   LDLGLATSRGRGKCKNPSCSYVYTNRHKPRICPSCGFNLAKDRTEKTPKAIEASSPHPD
FT                   VPSTTEALNPTQREVQRQSTLQLLRKVLQIPENESELAEVFALIHELNSSRLILSNVSE
FT                   ETVTIEQTSWSNYYESPSTQCLLCSSPLFKGGHNSLAGPQECWLLTANRLQVVTAQVKM
FT                   CLNPHCLALHSFTDIYTGLFNVGNKLLVSLDLLFAIRNQIKLGEDPRVSVGVVLKSVQE
FT                   QTEKTLTSEELSQLQELLCNGYWAFECLTVRDYNDMICGICGVAPKVEMAQRNEENVLA
FT                   LKSVEFTWPEFLGSSEVNVEDFWTTMETEVIEQVAFPASIPITKFDASVIAPFFPPLMR
FT                   GAVVVNTEKDKTQDMQPVPGNGSALVRLLQEGTCKLEELGSYSGEELQYLLEQCDIPFS
FT                   PEDSRDQLCFSLLALYESVQNGARARPPPAHFTGGKIYKVCPHQVVCGSKYLVRGESAR
FT                   DHVDLLASSRHWPPVYVVDMATPVALCADLCYPELTSQMWGKNQGCFSNPTEPVVSVSC
FT                   PELLDQHYSVDVTEAENSVQHPVTKSATRRIVHANTKPDPSDPSAGHRSLSLCPELAPY
FT                   ASTTDSKLSSVRQRPIAFDNATHYYLYNRLMDFLTSREIVNRQIHDIVQSCQPGEVVIR
FT                   DTLYRLGVAQIKTEAQEEGEEEEVASVVE"
FT   CDS             complement(join(23785803..23786258,23787515..23787724,
FT                   23789020..23789136,23789776..23789909,23790952..23791171,
FT                   23794335..23794519,23795203..23795334,23799973..23800100,
FT                   23800791..23801092,23803913..23804062,23805727..23805825,
FT                   23808570..23808667,23808802..23808974,23810884..23811302,
FT                   23816438..23816569,23819033..23819131,23820742..23821239,
FT                   23824752..23824926,23825695..23825828))
FT                   /codon_start=1
FT                   /gene="A630042L21Rik"
FT                   /locus_tag="mCG_130312"
FT                   /product="RIKEN cDNA A630042L21, isoform CRA_c"
FT                   /note="gene_id=mCG130312.1 transcript_id=mCT173868.0
FT                   protein_id=mCP96788.0 isoform=CRA_c"
FT                   /db_xref="GOA:Q6AXF8"
FT                   /db_xref="InterPro:IPR009071"
FT                   /db_xref="MGI:MGI:2441817"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AXF8"
FT                   /protein_id="EDL09782.1"
FT                   /translation="MDAPYDGAEVTVLMEEIEEAYYTSPGPPKKKKKYKIHGEKAKKPR
FT                   SAYLLYYYDIYLKVQQELPHLPQSEINKKISESWRLLSVAERSYYLEKAKLEKEGLDPN
FT                   SKLSALTAVVPDIPGFRKILPRSEYIIIPKSTLQEDRSCPQLELCVAQNQMSPKGSTLM
FT                   SNASPDVVASHAGMAEQCLAVEALAEEVGALPQPGTVQEIATSEILSHDMLLEEASLEV
FT                   GESHQPYQTSLVIEETLVNGSSDLPTGSLAVPHSQVGESLSVVTVMRDSSESSPSAPAT
FT                   QFIMLPLPAYSVVENPSSIKLTTTYTRRGHGTCTSPGCSFTYVTRHKPPKCPTCGNFLG
FT                   GKWIPKEKPAKVKVELASGVSSKGSVIKRNQQSVTTEQNPSKENASKLTLENSEAVSQL
FT                   LNVAPPGEGGEDREWEEVIVSDAHVLVKEVPGNRGTAVTKMPVVKSGAQAEISLGTTEN
FT                   DSPGPDILPSAEGTSSSSLLQAHKKSPGVDLFTTGPKAPELKGRARGKPSLLAAARPMR
FT                   AILPAPTSVGRGSGVGLPRARQAFPLDKTPSVRTCGLKPSTLKQLGQPIQQPPSTGEVK
FT                   LSNCASSRTPQLKIVEVKPDLFPPYKYSCTVTLDLGLATSRGRGKCKNPSCSYVYTNRH
FT                   KPRICPSCGFNLAKDRTEKTPKAIEASSPHPDVPSTTEALNPTQREVQRQSTLQLLRKV
FT                   LQIPENESELAEVFALIHELNSSRLILSNVSEETVTIEQTSWSNYYESPSTQCLLCSSP
FT                   LFKGGHNSLAGPQECWLLTANRLQVVTAQVKMCLNPHCLALHSFTDIYTGLFNVGNKLL
FT                   VSLDLLFAIRNQIKLGEDPRVSVGVVLKSVQEQTEKTLTSEELSQLQELLCNGYWAFEC
FT                   LTVRDYNDMICGICGVAPKVEMAQRNEENVLALKSVEFTWPEFLGSSEVNVEDFWTTME
FT                   TEVIEQVAFPASIPITKFDASVIAPFFPPLMRGAVVVNTEKDKTQDMQPVPGNGSALVR
FT                   LLQEGTCKLEELGSYSGEELQYLLEQCDIPFSPEDSRDQLCFSLLALYESVQNGARARP
FT                   PPAHFTGGKIYKVCPHQVVCGSKYLVRGESARDHVDLLASSRHWPPVYVVDMATPVALC
FT                   ADLCYPELTSQMWGKNQGCFSNPTEPVVSVSCPELLDQHYSVDVTEAENSVQHPVTKSA
FT                   TRRIVHANTKPDPSDPSAGHRSLSLCPELAPYASTTDSKLSSVRQRPIAFDNATHYYLY
FT                   NRLMDFLTSREIVNRQIHDIVQSCQPGEVVIRDTLYRLGVAQIKTEAQEEGEEEEVASV
FT                   VE"
FT   CDS             complement(join(23785803..23786258,23787515..23787724,
FT                   23789020..23789136,23789776..23789909,23790952..23791171,
FT                   23794335..23794519,23795203..23795334,23799973..23800100,
FT                   23800791..23801092,23803913..23804062,23805727..23805825,
FT                   23808570..23808667,23808802..23808974,23810884..23811023))
FT                   /codon_start=1
FT                   /gene="A630042L21Rik"
FT                   /locus_tag="mCG_130312"
FT                   /product="RIKEN cDNA A630042L21, isoform CRA_b"
FT                   /note="gene_id=mCG130312.1 transcript_id=mCT173867.0
FT                   protein_id=mCP96787.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q6NZP6"
FT                   /db_xref="MGI:MGI:2441817"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NZP6"
FT                   /protein_id="EDL09781.1"
FT                   /translation="MPVVKSGAQAEISLGTTENDSPGPDILPSAEGTSSSSLLQAHKKS
FT                   PGVDLFTTGPKAPELKGRARGKPSLLAAARPMRAILPAPTSVGRGSGVGLPRARQAFPL
FT                   DKTPSVRTCGLKPSTLKQLGQPIQQPPSTGEVKLSNCASSRTPQLKIVEVKPDLFPPYK
FT                   YSCTVTLDLGLATSRGRGKCKNPSCSYVYTNRHKPRICPSCGFNLAKDRTEKTPKAIEA
FT                   SSPHPDVPSTTEALNPTQREVQRQSTLQLLRKVLQIPENESELAEVFALIHELNSSRLI
FT                   LSNVSEETVTIEQTSWSNYYESPSTQCLLCSSPLFKGGHNSLAGPQECWLLTANRLQVV
FT                   TAQVKMCLNPHCLALHSFTDIYTGLFNVGNKLLVSLDLLFAIRNQIKLGEDPRVSVGVV
FT                   LKSVQEQTEKTLTSEELSQLQELLCNGYWAFECLTVRDYNDMICGICGVAPKVEMAQRN
FT                   EENVLALKSVEFTWPEFLGSSEVNVEDFWTTMETEVIEQVAFPASIPITKFDASVIAPF
FT                   FPPLMRGAVVVNTEKDKTQDMQPVPGNGSALVRLLQEGTCKLEELGSYSGEELQYLLEQ
FT                   CDIPFSPEDSRDQLCFSLLALYESVQNGARARPPPAHFTGGKIYKVCPHQVVCGSKYLV
FT                   RGESARDHVDLLASSRHWPPVYVVDMATPVALCADLCYPELTSQMWGKNQGCFSNPTEP
FT                   VVSVSCPELLDQHYSVDVTEAENSVQHPVTKSATRRIVHANTKPDPSDPSAGHRSLSLC
FT                   PELAPYASTTDSKLSSVRQRPIAFDNATHYYLYNRLMDFLTSREIVNRQIHDIVQSCQP
FT                   GEVVIRDTLYRLGVAQIKTEAQEEGEEEEVASVVE"
FT   assembly_gap    23834580..23834648
FT                   /estimated_length=69
FT                   /gap_type="unknown"
FT   assembly_gap    23835805..23835824
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(23850216..23864878)
FT                   /gene="Slc26a2"
FT                   /locus_tag="mCG_6033"
FT                   /note="gene_id=mCG6033.1"
FT   mRNA            complement(join(23850216..23853015,23855077..23855799,
FT                   23857706..23857841,23864794..23864878))
FT                   /gene="Slc26a2"
FT                   /locus_tag="mCG_6033"
FT                   /product="solute carrier family 26 (sulfate transporter),
FT                   member 2"
FT                   /note="gene_id=mCG6033.1 transcript_id=mCT4705.1 created on
FT                   04-OCT-2002"
FT   CDS             complement(join(23851495..23853015,23855077..23855775))
FT                   /codon_start=1
FT                   /gene="Slc26a2"
FT                   /locus_tag="mCG_6033"
FT                   /product="solute carrier family 26 (sulfate transporter),
FT                   member 2"
FT                   /note="gene_id=mCG6033.1 transcript_id=mCT4705.1
FT                   protein_id=mCP21551.1"
FT                   /db_xref="GOA:Q62273"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR018045"
FT                   /db_xref="MGI:MGI:892977"
FT                   /protein_id="EDL09779.1"
FT                   /translation="MSSENKEQHDLSPRDLPEEAFGFPSELPLETQRRSGTDLRQSETG
FT                   HGRRAFRRIHMELREKPDTDIKQFVIRELQKSCQCSAAKVRDGAFDFFPVLRWLPKYDL
FT                   KKNILGDVMSGLIVGILLVPQSIAYSLLAGQEPIYGLYTSFFASIIYFLFGTSRHISVG
FT                   IFGILCLMIGEVVDRELHKACPDTDATSSSIAVFSSGCVVVNHTLDGLCDKSCYAIKIG
FT                   STVTFMAGVYQVAMGFFQVGFVSVYLSDALLSGFVTGASFTILTSQAKYLLGLSLPRSH
FT                   GVGSVITTWIHIFRNIRNTNICDLITSLLCLLVLVPSKELNEHFKDKLKAPIPVELIVV
FT                   VAATLASHFGKLNGNYNSSIAGHIPTGFMPPKAPDWSLIPNVAVDAIAISIIGFAITVS
FT                   LSEMFAKKHGYTVKANQEMYAIGFCNIIPSFFHCITTSAALAKTLVKESTGCQTQLSAI
FT                   VTALVLLLVLLVIAPLFYSLQKCVLGVITIVNLRGALLKFRDLPKMWRLSRMDTVIWFV
FT                   TMLSSALLSTEIGLLVGVCFSMFCVILRTQKPKNSLLGLEEESETFESISTYKNLRSKS
FT                   GIKVFRFIAPLYYINKECFKSALYKKALNPVLVKAAWKKAAKRKLKEEMVTFRGDPDEV
FT                   SMQLSHDPLEVHTIVIDCSAIQFLDTAGIHTLKEVRRDYEAVGIQVLLAQCNPSVRDSL
FT                   ARGEYCKKEEETLLFYSLSEAVAFAEDSQNQKGVCVVNGLSLSGD"
FT   assembly_gap    23854887..23854906
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23868708..23868727
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            23873888..23939460
FT                   /gene="Pde6a"
FT                   /locus_tag="mCG_130305"
FT                   /note="gene_id=mCG130305.0"
FT   mRNA            join(23873888..23874470,23884720..23884872,
FT                   23886212..23886301,23888100..23888240,23891870..23891944,
FT                   23898744..23898808,23903151..23903217,23906335..23906382,
FT                   23906872..23907021,23907508..23907651,23910195..23910260,
FT                   23910392..23910538,23911417..23911524,23914750..23914859,
FT                   23916259..23916346,23916509..23916609,23917294..23917401,
FT                   23933335..23933398,23933642..23933716,23934741..23934824,
FT                   23936646..23936793,23938859..23939460)
FT                   /gene="Pde6a"
FT                   /locus_tag="mCG_130305"
FT                   /product="phosphodiesterase 6A, cGMP-specific, rod, alpha"
FT                   /note="gene_id=mCG130305.0 transcript_id=mCT131628.0
FT                   created on 17-JUN-2003"
FT   CDS             join(23873997..23874470,23884720..23884872,
FT                   23886212..23886301,23888100..23888240,23891870..23891944,
FT                   23898744..23898808,23903151..23903217,23906335..23906382,
FT                   23906872..23907021,23907508..23907651,23910195..23910260,
FT                   23910392..23910538,23911417..23911524,23914750..23914859,
FT                   23916259..23916346,23916509..23916609,23917294..23917401,
FT                   23933335..23933398,23933642..23933716,23934741..23934824,
FT                   23936646..23936793,23938859..23938935)
FT                   /codon_start=1
FT                   /gene="Pde6a"
FT                   /locus_tag="mCG_130305"
FT                   /product="phosphodiesterase 6A, cGMP-specific, rod, alpha"
FT                   /note="gene_id=mCG130305.0 transcript_id=mCT131628.0
FT                   protein_id=mCP78050.1"
FT                   /db_xref="GOA:Q8K0A8"
FT                   /db_xref="InterPro:IPR002073"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR023088"
FT                   /db_xref="InterPro:IPR023174"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="MGI:MGI:97524"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K0A8"
FT                   /protein_id="EDL09778.1"
FT                   /translation="MGEVTAEEVEKFLDSNIGFAKQYYNFHYRGKVISDLLGAKEAAVD
FT                   FSNYHDVNSVEESEIIFDLLRDVQENLQAEKCTFNVMKKLCFLLRADRMSLFMYRTRNG
FT                   IAELATRLFNVHKDAVLEDCLVMPDSEIVFPLDMGVVGHVAHSKKIANVPNTEEDEHFC
FT                   DFVDNLTEYQTKNILASPIMNGKDVVAIIMAVNKIDEPHFTKRDEEILLKYLNFVNLIM
FT                   KVFHLSYLHNCETRRGQILLWSGSKVFEELTDIERQFHKALYTVRAFLNCDRYSVGLLD
FT                   MTKQKEFFDVWPVLMGEAPAYSGPRTPDGREINFYKVIDYILHGKEDIKVIPNPPADHW
FT                   ALVSGLPTYVAQNGLICNIMNAPAEDFFEFQKEPLDESGWMIKNVLSMPIVNKKEEIVG
FT                   VATFYNRKDGKPFDDMDETLMESLTQFLGWSVLNPDTYESMNKLENRKDIFQDIVKYHV
FT                   KCDNEEIQKILKTREVYGKEPWECEEEELAEILQGELPDAESYEINKFHFSDLPLTELE
FT                   LVKCGIQMYYELRVVDKFHIPQEALVRFMYSLSKGYRRITYHNWRHGFNVGQTMFSLLV
FT                   TGKLKRYFTDLEALAMVTAAFCHDIDHRGTNNLYQMKSQNPLAKLHGSSILERHHLEFG
FT                   KTLLRDESLNIFQNLNRRQHEHAIHMMDIAIIATDLALYFKKRTMFQKIVDQSKTYEST
FT                   QEWTQYMMLEQTRKEIVMAMMMTACDLSAITKPWEVQSKVALLVAAEFWEQGDLERTVL
FT                   QQNPIPMMDRNKADELPKLQVGFIDFVCTFVYKEFSRFHEEITPMLDGITNNRKEWKAL
FT                   ADEYEAKMKALEEEKQKQQAAKQAASGNQPGGNPTPGGAPASKSCCIQ"
FT   assembly_gap    23875148..23875206
FT                   /estimated_length=59
FT                   /gap_type="unknown"
FT   assembly_gap    23884141..23884536
FT                   /estimated_length=396
FT                   /gap_type="unknown"
FT   assembly_gap    23887879..23887987
FT                   /estimated_length=109
FT                   /gap_type="unknown"
FT   assembly_gap    23897336..23897355
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23914384..23914442
FT                   /estimated_length=59
FT                   /gap_type="unknown"
FT   assembly_gap    23930678..23930697
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23934097..23934116
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(23948875..24050869)
FT                   /gene="Ppargc1b"
FT                   /locus_tag="mCG_130315"
FT                   /note="gene_id=mCG130315.1"
FT   mRNA            complement(join(23948875..23949501,23950304..23950458,
FT                   23953337..23953458,23955426..23955501,23957925..23958732,
FT                   23959751..23959812,23960364..23960400,23961125..23962226,
FT                   23962872..23962988,23966458..23966670,23973860..23974033,
FT                   24050728..24050869))
FT                   /gene="Ppargc1b"
FT                   /locus_tag="mCG_130315"
FT                   /product="peroxisome proliferative activated receptor,
FT                   gamma, coactivator 1 beta, transcript variant mCT131638"
FT                   /note="gene_id=mCG130315.1 transcript_id=mCT131638.1
FT                   created on 04-OCT-2002"
FT   mRNA            complement(join(23948881..23949501,23950304..23950458,
FT                   23953337..23953458,23955426..23955501,23957925..23958096,
FT                   23961529..23961881))
FT                   /gene="Ppargc1b"
FT                   /locus_tag="mCG_130315"
FT                   /product="peroxisome proliferative activated receptor,
FT                   gamma, coactivator 1 beta, transcript variant mCT173870"
FT                   /note="gene_id=mCG130315.1 transcript_id=mCT173870.0
FT                   created on 04-OCT-2002"
FT   mRNA            complement(join(23949226..23949501,23950304..23950458,
FT                   23953337..23953458,23955426..23955501,23957925..23958732,
FT                   23959751..23959812,23960364..23960400,23961125..23962226,
FT                   23962872..23962988,23966458..23966670,23973860..23974033,
FT                   24032900..24032978,24050728..>24050840))
FT                   /gene="Ppargc1b"
FT                   /locus_tag="mCG_130315"
FT                   /product="peroxisome proliferative activated receptor,
FT                   gamma, coactivator 1 beta, transcript variant mCT190269"
FT                   /note="gene_id=mCG130315.1 transcript_id=mCT190269.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(23949401..23949501,23950304..23950458,
FT                   23953337..23953458,23955426..23955501,23957925..23958732,
FT                   23959751..23959812,23960364..23960400,23961125..23962226,
FT                   23962872..23962988,23966458..23966670,23973860..23974033,
FT                   24032900..24032978,24050728..>24050840))
FT                   /codon_start=1
FT                   /gene="Ppargc1b"
FT                   /locus_tag="mCG_130315"
FT                   /product="peroxisome proliferative activated receptor,
FT                   gamma, coactivator 1 beta, isoform CRA_b"
FT                   /note="gene_id=mCG130315.1 transcript_id=mCT190269.0
FT                   protein_id=mCP111265.0 isoform=CRA_b"
FT                   /protein_id="EDL09776.1"
FT                   /translation="LTPPHAAAAAGRWRGTTAARCWMKSSRPSSSTISLTRRSAEGLEE
FT                   VDHEALDRDGCGRRRLADMGGDSGEEQLCADLPELDLSQLDASDFDSATCFGELQWCPE
FT                   TSETEPSQYSPDDSELFQIDSENEALLAALTKTLDDIPEDDVGLAAFPELDEGDTPSCT
FT                   PASPAPLSAPPSPTLERLLSPASDVDELSLLQKLLLATSSPTASSDALKDGATWSQTSL
FT                   SSRSQRPCVKVDGTQDKKTPTLRAQSRPCTELHKHLTSVLPCPRVKACSPTPHPSPRLL
FT                   SKEEEEEVGEDCPSPWPTPASPQDSLAQDTASPDSAQPPEEDVRAMVQLIRYMHTYCLP
FT                   QRKLPQRAPEPIPQACSSLSRQVQPRSRHPPKAFWTEFSILRELLAQDILCDVSKPYRL
FT                   AIPVYASLTPQSRPRPPKDSQASPAHSAMAEEVRITASPKSTGPRPSLRPLRLEVKRDV
FT                   NKPTRQKREEDEEEEEEEEEEEEEKEEEEEEWGRKRPGRGLPWTKLGRKMDSSVCPVRR
FT                   SRRLNPELGPWLTFTDEPLGALPSMCLDTETHNLEEDLGSLTDSSQGRQLPQGSQIPAL
FT                   ESPCESGCGDTDEDPSCPQPTSRDSSRCLMLALSQSDSLGKKSFEESLTVELCGTAGLT
FT                   PPTTPPYKPMEEDPFKPDTKLSPGQDTAPSLPSPEALPLTATPGASHKLPKRHPERSEL
FT                   LSHLQHATTQPVSQAGQKRPFSCSFGDHDYCQVLRPEAALQRKVLRSWEPIGVHLEDLA
FT                   QQGAPLPTETKAPRREANQNCDPTHKDSMQLRDHEIRASLTKHFGLLETALEGEDLASC
FT                   KSPEYDTVFEDSSSSSGESSFLLEEEEEEEEGGEEDDEGEDSGVSPPCSDHCPYQSPPS
FT                   KASRQLCSRSRSSSGSSSCSSWSPATRKNFRRESRGPCSDGTPSVRHARKRREKAIGEG
FT                   RVVYIRNLSSDMSSRELKKRFEVFGEIVECQVLTRSKRGQKHGFITFRCSEHAALSVRN
FT                   GATLRKRNEPSFHLSYGGLRHFRWPRYTDYDPTSEESLPSSGKSKYEAMDFDSLLKEAQ
FT                   QSLH"
FT   CDS             complement(join(23949401..23949501,23950304..23950458,
FT                   23953337..23953458,23955426..23955501,23957925..23958732,
FT                   23959751..23959812,2