Dbfetch

ID   CH466528; SV 2; linear; genomic DNA; CON; MUS; 49650983 BP.
XX
AC   CH466528;
XX
PR   Project:PRJNA11785;
XX
DT   04-AUG-2005 (Rel. 84, Created)
DT   10-JUN-2007 (Rel. 92, Last updated, Version 7)
XX
DE   Mus musculus 232000009757810 genomic scaffold, whole genome shotgun
DE   sequence.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-49650983
RX   DOI; 10.1126/science.1069193.
RX   PUBMED; 12040188.
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Miklos G.L., Wides R.,
RA   Halpern A., Li P.W., Sutton G.G., Nadeau J., Salzberg S.L., Holt R.A.,
RA   Kodira C.D., Lu F., Chen L., Deng Z., Evangelista C.C., Gan W.,
RA   Heiman T.J., Li J., Li Z., Merkulov G.V., Milshina N.V., Naik A.K., Qi R.,
RA   Shue B.C., Wang A., Wang J., Wang X., Yan X., Ye J., Yooseph S., Zhao Q.,
RA   Zheng L., Zhu S.C., Biddick K., Bolanos R., Delcher A.L., Dew I.M.,
RA   Fasulo D., Flanigan M.J., Huson D.H., Kravitz S.A., Miller J.R.,
RA   Mobarry C.M., Reinert K., Remington K.A., Zhang Q., Zheng X.H.,
RA   Nusskern D.R., Lai Z., Lei Y., Zhong W., Yao A., Guan P., Ji R.R., Gu Z.,
RA   Wang Z.Y., Zhong F., Xiao C., Chiang C.C., Yandell M., Wortman J.R.,
RA   Amanatides P.G., Hladun S.L., Pratts E.C., Johnson J.E., Dodson K.L.,
RA   Woodford K.J., Evans C.A., Gropman B., Rusch D.B., Venter E., Wang M.,
RA   Smith T.J., Houck J.T., Tompkins D.E., Haynes C., Jacob D., Chin S.H.,
RA   Allen D.R., Dahlke C.E., Sanders R., Li K., Liu X., Levitsky A.A.,
RA   Majoros W.H., Chen Q., Xia A.C., Lopez J.R., Donnelly M.T., Newman M.H.,
RA   Glodek A., Kraft C.L., Nodell M., Ali F., An H.J., Baldwin-Pitts D.,
RA   Beeson K.Y., Cai S., Carnes M., Carver A., Caulk P.M., Center A.,
RA   Chen Y.H., Cheng M.L., Coyne M.D., Crowder M., Danaher S., Davenport L.B.,
RA   Desilets R., Dietz S.M., Doup L., Dullaghan P., Ferriera S., Fosler C.R.,
RA   Gire H.C., Gluecksmann A., Gocayne J.D., Gray J., Hart B., Haynes J.,
RA   Hoover J., Howland T., Ibegwam C., Jalali M., Johns D., Kline L., Ma D.S.,
RA   MacCawley S., Magoon A., Mann F., May D., McIntosh T.C., Mehta S., Moy L.,
RA   Moy M.C., Murphy B.J., Murphy S.D., Nelson K.A., Nuri Z., Parker K.A.,
RA   Prudhomme A.C., Puri V.N., Qureshi H., Raley J.C., Reardon M.S.,
RA   Regier M.A., Rogers Y.H., Romblad D.L., Schutz J., Scott J.L., Scott R.,
RA   Sitter C.D., Smallwood M., Sprague A.C., Stewart E., Strong R.V., Suh E.,
RA   Sylvester K., Thomas R., Tint N.N., Tsonis C., Wang G., Wang G.,
RA   Williams M.S., Williams S.M., Windsor S.M., Wolfe K., Wu M.M., Zaveri J.,
RA   Chaturvedi K., Gabrielian A.E., Ke Z., Sun J., Subramanian G., Venter J.C.,
RA   Pfannkoch C.M., Barnstead M., Stephenson L.D.;
RT   "A comparison of whole-genome shotgun-derived mouse chromosome 16 and the
RT   human genome";
RL   Science, e1252229 296(5573):1661-1671(2002).
XX
RN   [2]
RP   1-49650983
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (05-JUL-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
RN   [3]
RP   1-49650983
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (02-SEP-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
DR   MD5; 6193fa81d88c83e5c4bcf6d10f693280.
DR   ENA; AAHY01000000; SET.
DR   ENA; AAHY00000000; SET.
DR   ENA-CON; CM000226.
DR   BioSample; SAMN03004379.
DR   Ensembl-Gn; ENSMUSG00000001473; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000007480; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000008301; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000023036; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024427; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024440; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024454; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024471; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024480; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024493; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024497; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024498; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024500; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024502; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024505; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024511; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024512; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024515; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024516; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024518; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024525; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024526; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024529; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024534; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024538; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024544; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024552; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024560; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024570; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024571; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024575; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024576; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024580; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024589; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024610; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024617; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024621; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024622; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024645; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024646; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025423; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025428; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025880; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025885; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026322; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000033032; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000033319; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000033323; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000034320; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000036412; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000036585; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000036880; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038791; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000040560; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000041607; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000042705; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000043079; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000043313; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000043458; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000044022; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000044024; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000044176; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000045569; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000045657; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000045730; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000045876; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000046387; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000046886; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000047033; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000047307; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000047466; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000047910; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000048347; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000048410; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000048875; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000049090; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000050304; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000050875; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000051050; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000051486; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000051732; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000052102; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000052713; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000053477; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000053624; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000053846; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000054072; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000054477; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000056812; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000057561; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000058152; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000059336; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000060450; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000060534; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000061144; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000062328; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000071855; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000071856; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000071858; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000073542; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000073555; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000073591; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000078963; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000079608; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000079614; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000090942; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000102543; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000103088; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000103144; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000103332; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000103567; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000103897; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000104063; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024317; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024319; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024320; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024321; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024323; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024324; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024325; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024326; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024327; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024329; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024330; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024331; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024333; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024334; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024339; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024343; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024346; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024348; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024352; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024353; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024356; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024362; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024365; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024367; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024369; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024378; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024380; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024381; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024386; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024388; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024389; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024391; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024393; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024399; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024401; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024406; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024407; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024410; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024413; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024416; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024418; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024423; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024428; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024429; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024431; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024432; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024435; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024439; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024442; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024456; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024457; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024458; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024459; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024465; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024468; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024470; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024471; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024475; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024476; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024477; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024478; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024481; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024484; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024485; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024488; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024490; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024500; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024501; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024506; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024511; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024513; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024521; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024522; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024523; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024527; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024530; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024532; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024535; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024536; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024538; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024540; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024541; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024543; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024546; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024548; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024555; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024558; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024559; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024560; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024561; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024564; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024572; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024577; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024579; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024583; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024584; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024590; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024593; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024596; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024601; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024605; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024606; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024610; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024612; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0024284; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024286; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024287; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024288; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024289; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024291; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024292; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024293; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024294; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024295; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024297; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024298; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024299; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024301; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024302; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024307; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024311; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024319; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024320; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024323; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024328; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024329; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024330; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024332; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024334; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024336; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024345; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024347; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024348; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024353; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024355; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024356; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024358; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024360; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024366; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024368; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024373; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024374; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024377; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024380; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024382; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024384; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024389; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024394; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024395; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024397; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024398; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024401; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024405; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024408; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024422; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024423; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024425; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024427; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024432; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024435; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024437; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024438; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024442; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024443; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024444; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024445; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024448; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024451; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024452; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024455; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024457; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024467; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024468; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024473; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024478; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024480; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024488; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024489; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024490; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024494; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024497; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024499; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024502; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024503; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024505; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024507; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024508; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024510; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024513; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024515; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024522; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024525; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024526; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024527; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024528; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024531; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024539; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024544; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024546; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024550; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024557; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024560; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024563; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024568; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024572; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024573; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024577; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024579; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0024252; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024254; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024255; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024256; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024257; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024259; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024260; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024261; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024262; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024263; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024265; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024266; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024267; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024269; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024270; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024275; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024279; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024282; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024284; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024288; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024289; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024292; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024298; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024301; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024303; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024305; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024314; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024316; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024317; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024322; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024324; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024325; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024327; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024329; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024335; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024337; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024342; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024343; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024346; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024349; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024351; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024354; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024359; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024364; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024365; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024367; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024368; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024371; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024375; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024378; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024392; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024393; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024394; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024396; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024397; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024402; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024405; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024407; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024408; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024412; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024413; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024414; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024415; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024418; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024421; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024422; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024425; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024427; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024437; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024438; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024443; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024448; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024450; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024458; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024459; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024460; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024465; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024468; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024470; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024473; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024474; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024476; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024478; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024479; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024481; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024484; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024486; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024493; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024496; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024497; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024498; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024499; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024502; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024510; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024515; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024517; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024521; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024522; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024528; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024531; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024534; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024539; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024543; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024544; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024548; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024550; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024283; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024285; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024286; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024287; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024288; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024290; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024291; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024292; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024293; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024294; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024296; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024297; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024298; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024300; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024301; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024306; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024310; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024313; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024319; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024320; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024323; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024329; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024332; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024334; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024336; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024345; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024347; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024348; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024353; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024355; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024356; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024358; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024360; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024366; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024368; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024373; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024374; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024377; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024380; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024382; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024384; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024389; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024394; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024395; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024397; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024398; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024401; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024405; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024408; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024422; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024423; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024425; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024426; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024431; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024435; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024436; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024437; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024441; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024442; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024443; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024444; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024447; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024450; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024451; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024454; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024456; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024466; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024467; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024472; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024477; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024479; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024487; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024488; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024489; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024494; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024497; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024499; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024502; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024503; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024505; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024507; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024508; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024510; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024513; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024515; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024522; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024525; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024526; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024527; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024528; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024531; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024538; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024543; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024545; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024549; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024550; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024555; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024558; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024561; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024566; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024570; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024571; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024575; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024577; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028076; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024050; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024052; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024053; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024054; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024056; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024057; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024058; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024059; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024060; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024062; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024063; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024064; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024066; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024067; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024072; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024076; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024079; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024085; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024086; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024089; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024095; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024096; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024098; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024100; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024102; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024111; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024113; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024114; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024120; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024122; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024123; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024125; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024127; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024133; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024135; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024140; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024141; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024144; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024147; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024149; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024151; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024156; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024161; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024162; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024164; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024165; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024168; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024172; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024175; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024189; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024190; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024191; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024193; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024194; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024199; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024202; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024204; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024205; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024209; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024210; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024211; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024212; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024215; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024218; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024219; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024222; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024224; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024234; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024235; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024240; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024245; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024247; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024255; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024256; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024257; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024262; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024265; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024267; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024270; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024271; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024273; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024275; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024276; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024278; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024281; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024283; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024290; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024293; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024294; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024295; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024296; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024299; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024307; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024312; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024314; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024318; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024319; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024324; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024327; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024330; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024335; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024339; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024340; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024344; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024346; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024725; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024727; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024728; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024729; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024730; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024732; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024733; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024734; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024735; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024736; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024738; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024739; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024740; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024742; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024743; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024748; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024752; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024755; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024757; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024761; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024762; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024765; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024771; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024772; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024774; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024776; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024778; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024787; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024789; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024790; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024797; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024799; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024800; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024802; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024804; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024810; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024812; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024817; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024818; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024821; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024824; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024827; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024830; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024835; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024840; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024841; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024843; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024844; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024847; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024851; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024854; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024868; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024869; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024870; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024872; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024873; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024878; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024881; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024883; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024884; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024888; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024889; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024890; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024891; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024894; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024897; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024898; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024901; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024903; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024913; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024914; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024919; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024924; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024926; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024934; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024935; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024936; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024940; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024943; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024945; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024948; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024949; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024951; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024953; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024954; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024956; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024959; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024961; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024968; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024971; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024972; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024973; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024974; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024977; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024985; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024990; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024992; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024996; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024997; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025002; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025005; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025008; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025013; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025017; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025018; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025022; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025024; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023528; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023529; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023530; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023532; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023533; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023534; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023535; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023536; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023538; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023539; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023540; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023542; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023543; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023548; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023552; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023556; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023560; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023561; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023564; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023570; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023571; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023573; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023575; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023577; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023586; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023588; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023589; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023594; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023596; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023597; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023599; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023601; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023607; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023609; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023614; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023615; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023621; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023624; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023626; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023631; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023635; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023636; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023638; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023639; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023642; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023646; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023649; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023663; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023664; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023665; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023672; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023675; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023677; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023678; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023682; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023683; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023684; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023685; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023688; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023691; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023692; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023695; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023697; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023707; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023708; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023713; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023718; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023720; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023728; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023729; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023730; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023734; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023737; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023740; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023743; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023744; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023746; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023748; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023749; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023751; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023754; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023756; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023763; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023766; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023767; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023768; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023772; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023779; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023784; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023786; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023790; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023797; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023800; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023803; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023808; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023812; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023813; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023817; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023819; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0024019; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024021; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024022; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024023; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024024; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024026; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024027; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024028; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024029; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024030; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024032; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024033; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024034; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024036; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024037; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024042; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024046; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024049; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024055; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024056; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024059; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024065; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024066; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024068; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024070; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024072; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024081; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024083; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024084; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024089; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024091; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024092; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024094; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024096; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024102; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024104; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024109; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024110; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024116; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024118; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024121; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024126; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024131; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024132; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024134; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024135; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024138; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024142; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024145; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024159; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024160; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024161; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024163; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024164; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024169; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024172; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024174; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024175; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024179; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024180; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024181; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024182; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024185; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024188; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024189; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024192; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024194; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024204; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024205; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024210; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024215; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024217; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024225; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024226; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024227; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024231; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024234; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024236; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024239; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024240; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024242; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024244; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024245; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024247; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024250; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024252; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024259; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024262; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024263; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024264; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024265; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024268; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024276; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024281; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024283; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024287; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024294; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024297; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024300; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024305; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024309; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024310; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024314; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024316; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0024149; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024151; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024152; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024153; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024154; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024156; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024157; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024158; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024159; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024160; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024162; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024163; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024164; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024166; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024167; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024172; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024176; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024179; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024181; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024185; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024186; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024189; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024195; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024196; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024198; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024200; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024202; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024211; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024213; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024214; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024219; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024221; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024222; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024224; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024226; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024232; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024234; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024239; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024240; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024243; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024246; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024248; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024251; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024256; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024261; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024262; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024264; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024265; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024268; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024272; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024275; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024289; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024290; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024291; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024293; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024294; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024299; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024302; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024304; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024305; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024309; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024310; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024311; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024312; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024315; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024318; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024319; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024322; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024324; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024334; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024335; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024340; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024345; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024347; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024355; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024356; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024357; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024361; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024364; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024366; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024369; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024370; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024372; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024374; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024375; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024380; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024382; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024389; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024392; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024393; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024394; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024395; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024398; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024406; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024411; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024413; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024417; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024418; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024424; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024427; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024430; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024435; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024439; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024440; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024443; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024445; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0024116; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024118; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024120; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024122; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024123; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024124; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024125; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024126; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024128; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024129; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024130; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024132; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024133; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024138; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024142; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024145; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024147; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024151; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024152; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024155; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024161; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024164; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024166; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024168; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024177; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024179; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024180; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024185; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024187; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024188; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024190; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024192; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024198; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024200; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024205; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024206; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024209; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024212; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024215; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024218; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024223; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024228; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024229; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024231; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024232; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024235; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024239; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024242; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024256; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024257; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024258; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024259; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024260; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024265; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024268; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024270; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024271; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024275; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024276; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024277; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024278; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024281; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024284; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024285; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024288; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024290; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024300; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024301; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024306; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024311; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024313; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024321; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024322; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024323; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024327; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024330; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024332; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024335; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024336; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024338; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024340; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024341; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024343; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024346; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024348; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024355; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024358; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024359; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024360; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024361; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024364; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024372; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024377; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024379; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024383; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024384; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024390; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024393; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024396; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024401; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024405; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024406; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024410; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024412; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0024233; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024235; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024236; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024237; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024238; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024240; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024241; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024242; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024243; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024244; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024246; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024247; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024248; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024250; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024251; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024256; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024260; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024263; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024265; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024269; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024270; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024273; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024279; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024282; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024284; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024286; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024295; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024297; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024298; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024303; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024305; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024306; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024308; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024310; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024316; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024318; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024323; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024324; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024327; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024330; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024333; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024336; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024341; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024346; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024347; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024349; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024350; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024353; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024357; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024360; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024374; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024375; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024376; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024377; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024382; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024385; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024387; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024388; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024392; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024393; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024394; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024395; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024398; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024401; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024402; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024406; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024408; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024412; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024418; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024419; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024424; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024429; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024431; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024439; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024440; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024441; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024445; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024448; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024450; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024453; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024454; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024456; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024458; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024459; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024461; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024464; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024466; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024473; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024476; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024477; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024478; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024479; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024482; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024490; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024495; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024497; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024501; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024502; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024508; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024511; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024514; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024519; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024523; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024524; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024528; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024530; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024146; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024148; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024151; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024153; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024154; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024155; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024156; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024157; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024159; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024160; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024161; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024163; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024164; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024169; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024173; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024176; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024178; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024182; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024183; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024186; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024191; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024192; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024193; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024195; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024197; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024199; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024208; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024210; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024211; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024216; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024218; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024219; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024221; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024223; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024229; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024231; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024236; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024237; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024240; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024243; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024246; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024248; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024253; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024258; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024259; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024261; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024262; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024265; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024269; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024272; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024286; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024287; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024288; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024294; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024297; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024299; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024300; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024304; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024305; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024306; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024307; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024310; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024313; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024314; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024317; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024319; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024329; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024330; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024335; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024340; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024342; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024350; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024351; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024352; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024357; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024360; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024362; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024365; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024366; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024368; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024370; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024371; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024373; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024376; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024378; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024385; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024388; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024389; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024390; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024391; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024394; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024402; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024407; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024409; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024413; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024414; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024420; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024423; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024426; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024431; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024435; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024436; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024440; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024442; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027322; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024774; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024776; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024777; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024778; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024779; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024781; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024782; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024783; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024784; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024785; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024787; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024788; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024789; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024791; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024792; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024797; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024801; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024804; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024806; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024810; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024811; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024814; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024819; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024820; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024821; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024823; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024825; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024827; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024836; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024838; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024839; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024844; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024846; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024847; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024849; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024851; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024857; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024859; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024864; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024865; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024868; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024871; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024874; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024877; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024882; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024887; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024888; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024890; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024891; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024894; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024898; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024901; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024915; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024916; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024917; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024919; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024920; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024925; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024928; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024930; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024931; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024935; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024936; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024937; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024938; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024941; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024944; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024945; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024948; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024950; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024960; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024961; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024966; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024971; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024973; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024981; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024982; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024983; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024988; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024991; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024993; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024996; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024997; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024999; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025001; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025002; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025004; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025007; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025009; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025016; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025019; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025020; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025021; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025022; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025025; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025033; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025038; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025040; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025044; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025045; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025051; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025054; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025057; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025062; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025066; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025067; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025071; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025073; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023266; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023270; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023272; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023273; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023274; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023276; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023277; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023278; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023279; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023280; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023282; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023283; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023284; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023286; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023287; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023292; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023296; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023300; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023304; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023305; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023308; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023314; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023315; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023317; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023319; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023321; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023330; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023332; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023333; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023338; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023340; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023341; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023343; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023345; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023351; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023353; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023358; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023359; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023367; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023369; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023374; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023379; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023380; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023382; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023383; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023386; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023390; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023393; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023407; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023408; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023410; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023415; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023418; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023420; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023421; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023425; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023426; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023427; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023428; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023431; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023435; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023438; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023440; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023450; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023451; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023456; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023461; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023463; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023471; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023472; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023473; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023479; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023482; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023484; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023487; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023488; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023490; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023492; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023493; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023495; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023498; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023500; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023507; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023510; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023511; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023512; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023513; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023516; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023524; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023529; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023531; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023535; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023536; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023542; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023545; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023548; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023553; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023557; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023558; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023562; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023564; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023588; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023590; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023592; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023594; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023595; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023596; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023597; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023598; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023600; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023601; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023602; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023604; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023605; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023610; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023614; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023617; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023619; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023623; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023624; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023627; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023632; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023633; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023634; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023636; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023638; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023640; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023649; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023651; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023652; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023657; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023659; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023660; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023662; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023664; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023670; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023672; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023677; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023678; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023681; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023684; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023687; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023689; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023694; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023698; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023699; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023701; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023702; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023705; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023709; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023712; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023726; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023727; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023728; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023730; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023731; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023736; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023739; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023741; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023742; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023746; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023747; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023748; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023749; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023752; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023756; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023759; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023761; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023771; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023772; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023777; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023782; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023784; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023792; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023793; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023794; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023798; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023801; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023803; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023806; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023807; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023809; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023811; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023812; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023814; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023817; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023819; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023826; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023829; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023830; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023831; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023832; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023835; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023843; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023848; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023850; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023854; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023855; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023859; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023862; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023865; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023870; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023874; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023875; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023879; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023881; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000001513; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000003599; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025295; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025311; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025349; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025357; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025374; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025375; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025377; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025383; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025390; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025393; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025396; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025403; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025404; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025409; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025413; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025419; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025421; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025434; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025444; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025462; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025463; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025468; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025477; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025523; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025547; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025549; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000026999; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027560; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031549; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000032473; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000036226; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000040359; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000040647; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000041053; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000043498; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000049388; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000050034; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000050487; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000051126; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000051163; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000051442; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000052347; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000053073; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000053640; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000053856; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000055495; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000055935; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000055949; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000056460; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000056915; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000058633; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000058635; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000059571; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000060223; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000060328; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000061405; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000062991; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000063219; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000063775; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000063814; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000064763; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000066140; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000066149; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000066193; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000066532; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000066890; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000066912; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000069749; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000072376; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000072666; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000072726; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000072835; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000073379; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000074157; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000074653; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000078079; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000079716; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000080418; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000080721; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000081271; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000082254; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000091789; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000091813; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000091884; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000091932; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000096570; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000097542; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000097563; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000097590; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114748; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114939; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114943; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114959; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114977; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115268; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115297; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115318; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115498; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115582; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000117687; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000117692; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000118510; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000120472; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000120632; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000121693; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000121875; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000125127; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000125763; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000126432; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000127234; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000130163; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000131348; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000146409; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000155195; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000160180; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000160292; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000160639; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000161003; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000162265; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000162511; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000163590; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000163742; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000164223; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000164666; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000165123; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000166219; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000167610; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000168249; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000168382; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000168882; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000168918; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000170811; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000171297; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000171461; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000171470; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000172148; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000174118; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000175830; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000178011; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000178678; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000187157; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000192409; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000193414; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000193869; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000194012; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000194190; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000194928; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000201094; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000201410; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000201631; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000202057; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000202477; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000209270; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0049422; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0049425; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0049426; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0049427; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0049429; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0049430; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0049431; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0049432; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0049433; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0049435; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0049436; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0049438; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0049440; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0049442; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0049449; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0049455; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0049460; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0049462; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0049469; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0049472; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0049489; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0049517; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0049523; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0049529; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0049557; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0049569; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0049572; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0049573; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0049589; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0049591; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0049594; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0049597; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0049600; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0049608; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0049612; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0049631; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0049632; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0049638; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0049641; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0049646; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0049657; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0049684; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0049689; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0049691; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0049694; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0049695; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0049705; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0049712; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0049723; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0049752; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0049759; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0049760; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0049761; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0049772; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0049791; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0049798; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0049799; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0049811; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0049813; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0049814; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0049818; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0049824; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0049838; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0049839; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0049845; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0049847; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0049877; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0049878; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0049888; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0049914; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0049924; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0049941; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0049942; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0049943; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0049949; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0049955; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0049958; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0049969; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0049970; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0049972; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050034; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050038; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050040; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050053; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050057; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050078; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050084; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050095; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050096; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050097; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050100; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050140; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050158; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050160; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050168; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050171; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050178; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050192; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050207; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050218; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050240; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050241; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050256; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050262; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0049405; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0049408; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0049409; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0049410; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0049411; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0049413; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0049414; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0049415; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0049416; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0049417; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0049419; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0049420; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0049421; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0049423; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0049425; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0049433; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0049439; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0049452; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0049455; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0049471; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0049496; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0049499; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0049500; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0049505; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0049511; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0049539; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0049551; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0049554; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0049555; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0049571; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0049573; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0049576; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0049579; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0049582; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0049590; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0049594; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0049613; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0049614; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0049620; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0049624; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0049627; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0049638; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0049665; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0049670; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0049672; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0049675; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0049676; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0049686; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0049692; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0049703; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0049731; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0049738; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0049740; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0049742; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0049752; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0049771; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0049780; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0049781; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0049793; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0049795; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0049796; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0049800; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0049806; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0049820; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0049821; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0049827; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0049829; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0049859; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0049860; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0049869; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0049897; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0049907; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0049924; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0049925; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0049926; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0049931; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0049937; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0049939; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0049950; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0049951; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0049953; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0050015; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0050019; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0050021; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0050034; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0050038; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0050058; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0050064; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0050075; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0050076; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0050077; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0050080; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0050117; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0050134; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0050136; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0050144; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0050154; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0050168; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0050183; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0050194; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0050218; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0050219; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0050234; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0050240; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0049363; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0049366; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0049367; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0049368; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0049369; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0049371; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0049372; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0049373; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0049374; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0049375; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0049377; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0049378; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0049380; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0049382; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0049384; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0049392; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0049398; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0049403; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0049405; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0049412; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0049415; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0049432; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0049460; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0049466; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0049472; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0049500; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0049512; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0049515; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0049516; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0049532; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0049534; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0049537; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0049539; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0049542; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0049550; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0049554; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0049573; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0049574; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0049580; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0049584; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0049588; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0049602; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0049629; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0049635; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0049637; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0049640; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0049641; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0049651; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0049657; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0049668; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0049696; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0049703; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0049704; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0049706; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0049707; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0049717; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0049736; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0049743; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0049744; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0049756; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0049758; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0049759; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0049763; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0049769; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0049783; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0049784; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0049790; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0049792; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0049822; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0049823; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0049832; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0049852; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0049862; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0049880; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0049881; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0049883; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0049890; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0049896; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0049900; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0049911; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0049912; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0049914; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0049976; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0049980; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0049982; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0049993; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0049997; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0050017; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0050023; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0050034; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0050035; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0050036; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0050039; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0050076; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0050094; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0050096; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0050104; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0050107; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0050114; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0050128; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0050143; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0050154; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0050178; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0050179; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0050194; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0050200; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0049364; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0049367; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0049368; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0049369; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0049370; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0049372; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0049373; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0049374; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0049375; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0049376; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0049378; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0049379; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0049380; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0049382; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0049384; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0049392; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0049398; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0049403; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0049412; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0049415; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0049433; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0049461; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0049467; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0049473; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0049500; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0049512; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0049515; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0049516; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0049532; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0049534; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0049537; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0049539; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0049542; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0049550; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0049554; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0049573; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0049574; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0049580; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0049584; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0049587; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0049598; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0049624; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0049629; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0049631; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0049634; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0049635; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0049645; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0049651; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0049662; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0049690; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0049697; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0049699; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0049700; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0049710; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0049731; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0049736; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0049737; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0049749; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0049751; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0049752; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0049756; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0049762; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0049776; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0049777; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0049783; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0049785; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0049815; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0049816; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0049826; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0049847; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0049857; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0049874; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0049875; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0049876; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0049882; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0049888; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0049891; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0049902; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0049903; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0049905; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0049967; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0049971; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0049973; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0049989; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0049993; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050013; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050019; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050030; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050031; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050032; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050035; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050071; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050089; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050091; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050099; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050102; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050108; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050122; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050137; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050148; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050172; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050173; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050188; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050194; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0064859; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049100; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049103; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049104; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049105; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049107; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049108; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049109; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049110; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049111; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049113; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049114; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049116; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049118; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049120; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049126; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049132; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049137; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049146; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049149; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049165; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049193; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049194; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049199; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049205; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049233; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049245; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049248; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049249; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049266; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049268; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049271; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049273; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049276; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049284; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049288; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049306; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049307; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049313; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049317; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049321; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049332; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049359; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049364; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049366; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049369; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049370; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049380; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049386; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049397; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049425; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049432; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049433; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049435; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049436; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049446; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049465; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049470; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049471; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049483; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049485; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049486; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049490; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049496; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049510; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049511; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049517; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049519; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049549; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049550; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049559; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049587; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049597; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049615; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049616; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049617; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049624; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049630; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049633; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049644; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049645; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049647; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049709; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049713; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049715; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049729; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049733; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049753; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049759; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049770; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049771; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049772; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049775; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049814; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049832; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049834; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049842; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049845; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049851; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049865; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049880; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049891; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049915; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049916; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049931; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049937; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0049847; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0049850; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0049851; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0049852; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0049853; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0049855; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0049856; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0049857; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0049858; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0049859; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0049861; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0049862; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0049864; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0049866; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0049868; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0049876; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0049882; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0049887; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0049889; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0049896; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0049899; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0049916; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0049944; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0049945; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0049949; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0049955; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0049983; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0049995; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0049998; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0049999; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050017; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050019; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050022; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050024; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050027; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050035; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050039; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050058; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050059; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050065; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050069; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050073; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050085; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050112; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050117; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050119; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050122; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050123; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050133; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050140; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050151; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050179; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050186; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050187; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050189; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050190; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050201; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050220; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050227; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050228; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050240; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050242; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050243; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050247; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050253; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050267; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050268; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050272; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050274; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050304; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050305; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050315; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050340; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050350; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050367; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050368; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050369; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050373; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050379; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050382; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050393; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050394; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050396; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050457; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050461; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050463; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050476; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050480; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050500; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050508; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050519; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050520; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050521; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050524; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050561; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050578; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050580; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050588; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050591; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050598; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050612; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050627; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050637; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050663; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050664; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050679; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050685; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049202; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049203; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049204; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049206; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049207; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049208; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049209; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049210; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049212; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049213; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049215; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049217; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049219; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049226; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049232; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049238; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049245; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049248; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049265; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049294; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049295; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049301; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049307; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049336; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049349; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049352; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049353; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049370; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049373; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049376; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049379; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049382; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049389; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049393; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049415; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049416; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049426; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049430; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049442; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049469; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049473; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049476; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049479; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049480; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049491; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049501; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049512; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049544; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049551; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049553; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049565; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049584; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049593; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049594; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049606; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049608; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049609; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049613; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049620; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049634; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049635; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049641; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049643; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049675; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049677; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049687; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049715; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049725; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049743; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049744; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049745; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049749; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049755; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049759; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049770; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049771; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049773; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049836; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049840; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049842; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049859; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049863; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049885; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049891; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049902; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049903; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049907; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049944; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049963; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049965; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049973; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049985; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050000; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050015; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050027; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050046; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050047; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050062; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050068; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0049027; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049030; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049031; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049032; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049033; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049035; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049036; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049037; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049038; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049039; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049041; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049042; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049044; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049046; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049048; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049055; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049061; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049066; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049075; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049078; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049095; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049123; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049124; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049129; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049135; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049163; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049175; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049178; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049179; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049195; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049197; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049200; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049202; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049205; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049213; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049217; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049236; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049237; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049246; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049249; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049261; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049288; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049293; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049295; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049298; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049299; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049309; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049315; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049326; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049354; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049361; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049362; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049364; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049365; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049375; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049394; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049403; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049404; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049416; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049418; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049419; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049423; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049429; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049443; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049444; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049450; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049452; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049482; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049483; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049492; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049520; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049530; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049548; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049549; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049550; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049557; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049563; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049567; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049578; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049579; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049581; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049643; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049647; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049649; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049663; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049667; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049687; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049693; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049704; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049705; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049706; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049709; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049748; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049766; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049768; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049776; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049786; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049799; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049814; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049824; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049848; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049849; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049864; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049870; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0049123; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049126; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049127; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049128; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049129; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049131; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049132; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049133; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049134; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049135; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049137; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049138; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049140; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049142; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049144; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049152; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049158; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049163; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049165; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049172; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049175; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049192; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049220; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049221; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049226; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049232; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049260; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049272; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049275; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049276; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049292; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049294; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049297; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049299; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049302; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049310; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049314; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049331; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049332; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049338; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049342; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049346; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049358; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049385; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049390; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049392; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049395; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049396; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049407; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049413; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049424; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049452; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049459; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049460; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049462; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049463; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049473; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049492; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049497; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049498; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049510; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049512; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049513; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049517; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049523; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049537; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049538; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049544; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049546; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049575; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049576; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049585; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049612; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049622; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049640; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049641; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049642; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049648; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049654; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049658; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049669; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049670; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049672; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049734; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049738; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049754; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049758; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049778; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049784; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049795; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049796; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049797; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049800; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049839; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049858; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049860; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049868; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049871; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049878; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049892; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049907; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049918; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049942; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049943; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049956; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049962; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0049098; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049101; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049103; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049105; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049106; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049107; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049108; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049109; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049111; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049112; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049114; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049116; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049118; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049126; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049132; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049137; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049139; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049146; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049149; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049167; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049196; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049201; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049207; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049234; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049246; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049249; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049250; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049266; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049268; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049271; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049273; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049276; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049284; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049288; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049307; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049308; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049314; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049318; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049322; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049334; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049361; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049366; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049368; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049371; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049372; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049382; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049389; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049400; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049428; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049435; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049436; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049437; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049438; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049449; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049468; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049475; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049476; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049487; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049489; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049490; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049494; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049500; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049514; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049515; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049521; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049523; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049553; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049554; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049563; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049585; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049595; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049613; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049614; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049615; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049622; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049628; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049631; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049642; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049643; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049645; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049707; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049711; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049713; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049726; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049730; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049750; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049756; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049767; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049768; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049769; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049772; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049812; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049829; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049831; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049839; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049842; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049849; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049863; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049878; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049889; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049911; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049912; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049927; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049933; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0049246; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0049249; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0049250; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0049251; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0049252; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0049254; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0049255; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0049256; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0049257; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0049258; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0049260; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0049261; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0049263; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0049265; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0049267; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0049275; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0049281; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0049286; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0049288; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0049295; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0049298; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0049315; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0049343; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0049350; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0049356; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0049384; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0049396; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0049399; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0049400; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0049416; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0049418; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0049421; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0049423; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0049426; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0049434; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0049438; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0049457; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0049458; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0049464; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0049468; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0049473; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0049485; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0049512; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0049517; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0049519; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0049522; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0049523; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0049533; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0049539; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0049550; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0049578; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0049585; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0049586; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0049587; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0049597; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0049616; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0049623; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0049624; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0049636; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0049638; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0049639; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0049643; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0049649; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0049663; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0049664; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0049673; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0049675; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0049679; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0049704; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0049705; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0049715; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0049741; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0049751; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0049768; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0049769; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0049770; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0049776; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0049782; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0049785; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0049796; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0049797; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0049799; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0049861; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0049865; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0049867; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0049880; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0049884; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0049904; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0049910; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0049921; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0049922; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0049923; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0049927; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0049966; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0049984; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0049986; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0049994; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0049997; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0050004; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0050018; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0050033; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0050044; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0050068; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0050069; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0050084; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0050090; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049100; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049103; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049106; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049108; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049109; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049110; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049111; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049112; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049114; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049115; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049116; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049118; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049120; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049128; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049134; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049139; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049141; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049148; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049151; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049167; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049192; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049195; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049196; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049202; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049208; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049236; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049248; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049251; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049252; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049268; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049270; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049273; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049275; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049278; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049284; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049288; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049307; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049308; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049314; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049318; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049321; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049333; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049359; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049364; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049366; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049369; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049370; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049380; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049386; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049397; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049425; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049432; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049433; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049444; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049463; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049470; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049471; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049483; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049485; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049486; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049490; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049495; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049509; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049510; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049516; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049518; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049548; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049549; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049558; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049584; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049594; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049612; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049613; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049614; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049623; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049629; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049632; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049643; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049644; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049646; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049708; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049712; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049714; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049730; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049734; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049754; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049760; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049771; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049772; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049773; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049776; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049814; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049830; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049832; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049840; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049843; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049850; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049864; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049879; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049890; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049914; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049915; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049930; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049936; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0061817; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0049957; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0049960; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0049961; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0049962; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0049963; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0049965; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0049966; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0049967; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0049968; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0049969; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0049971; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0049972; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0049974; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0049976; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0049978; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0049986; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0049992; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0049997; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0049999; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050006; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050009; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050025; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050055; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050058; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050059; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050064; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050070; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050098; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050110; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050113; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050114; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050130; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050132; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050135; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050138; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050141; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050149; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050153; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050173; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050174; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050180; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050184; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050189; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050202; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050229; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050235; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050237; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050240; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050241; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050252; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050258; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050269; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050297; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050304; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050305; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050307; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050308; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050318; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050337; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050344; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050345; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050357; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050359; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050360; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050364; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050369; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050383; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050384; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050390; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050392; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050422; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050423; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050432; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050458; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050468; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050485; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050486; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050487; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050492; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050498; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050501; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050512; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050513; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050515; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050577; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050581; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050583; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050596; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050600; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050620; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050628; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050639; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050640; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050641; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050644; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050684; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050702; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050704; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050712; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050715; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050722; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050736; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050751; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050762; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050781; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050782; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050797; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050803; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0048792; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0048797; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0048800; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0048801; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0048802; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0048804; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0048805; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0048806; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0048807; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0048808; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0048810; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0048811; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0048813; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0048815; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0048817; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0048824; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0048830; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0048836; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0048843; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0048846; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0048863; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0048892; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0048893; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0048899; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0048905; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0048933; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0048946; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0048949; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0048950; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0048967; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0048970; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0048973; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0048975; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0048978; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0048986; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0048990; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049012; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049013; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049026; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049038; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049065; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049070; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049073; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049076; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049077; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049092; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049102; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049113; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049145; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049152; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049155; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049165; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049184; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049191; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049192; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049204; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049206; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049207; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049211; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049218; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049233; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049239; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049241; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049274; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049275; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049285; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049310; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049320; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049337; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049338; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049339; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049345; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049352; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049354; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049365; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049366; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049368; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049431; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049435; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049437; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049453; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049457; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049479; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049485; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049496; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049497; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049498; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049501; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049539; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049557; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049559; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049567; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049570; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049578; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049593; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049608; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049619; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049639; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049640; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049655; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049661; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0048389; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0048392; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0048394; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0048396; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0048397; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0048398; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0048399; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0048400; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0048402; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0048403; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0048405; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0048407; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0048409; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0048417; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0048423; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0048428; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0048430; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0048437; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0048440; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0048457; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0048482; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0048485; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0048486; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0048492; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0048498; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0048526; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0048538; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0048541; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0048542; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0048558; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0048560; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0048563; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0048566; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0048569; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0048577; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0048581; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0048600; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0048601; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0048607; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0048611; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0048614; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0048625; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0048652; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0048656; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0048658; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0048661; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0048662; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0048672; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0048678; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0048689; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0048717; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0048724; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0048725; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0048727; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0048728; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0048739; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0048758; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0048765; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0048766; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0048778; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0048780; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0048781; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0048785; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0048791; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0048806; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0048812; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0048814; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0048844; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0048845; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0048854; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0048879; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0048889; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0048907; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0048908; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0048909; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0048913; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0048919; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0048922; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0048933; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0048934; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0048936; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0048998; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049002; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049004; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049020; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049024; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049044; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049050; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049061; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049062; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049063; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049066; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049106; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049124; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049126; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049134; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049137; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049142; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049156; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049171; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049184; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049211; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049212; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049227; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049233; mus_musculus_wsbeij.
DR   PubMed; 12040188.
XX
CC   On Sep 6, 2005 this sequence version replaced gi:70980452.
CC   This is the July 2001 combined whole genome shotgun assembly of Mus
CC   musculus. It contains 27 million Celera reads on four Mus musculus
CC   strains (129X1/SvJ, 129S1/SvImJ, DBA/2J and A/J), 13 million reads
CC   on C57BL/6J from the NCBI Trace Archive, 0.4 million BAC end
CC   sequences from TIGR, and unfinished and finished BACs pulled from
CC   NCBI (Nature 2002. 420:520-562). The assembly process relied on
CC   Celera's paired reads and BAC end reads for long range order and
CC   orientation. Its scaffolds were mapped to chromosomes using STS
CC   maps. For more detailed information about whole genome sequencing
CC   and Celera's assembly process, please refer to Venter, J.C. et al.
CC   Science 2001. 291:1304-1351.
CC   This version of genes, transcripts, and proteins was
CC   computationally created in November 2001 from the whole-genome
CC   mapping of transcript and protein sequences on the Celera mouse
CC   genome assembly by Celera Chromosome Team and Content Systems.  The
CC   data sets used by this annotation process were collected in 2001
CC   and include RefSeq (NM_ from mouse and human) sequences, GenBank
CC   mRNA and dbEST sequences, mammalian SwissProt sequences,  and NRAA
CC   sequences (all mouse unless noted otherwise).  The initial gene set
CC   was manually curated between 2002 and 2003. Subsequently, automated
CC   annotation updates were performed.  The CDS of each transcript was
CC   manually or computationally defined by either the longest
CC   ATG-to-Stop or the longest open reading frame. All CDSs
CC   corresponding to the longest open reading frames with no starting
CC   ATG were flagged as partial.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..49650983
FT                   /organism="Mus musculus"
FT                   /chromosome="18"
FT                   /strain="mixed"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   gene            7019..9823
FT                   /locus_tag="mCG_141302"
FT                   /note="gene_id=mCG141302.1"
FT   mRNA            7019..9823
FT                   /locus_tag="mCG_141302"
FT                   /product="mCG141302"
FT                   /note="gene_id=mCG141302.1 transcript_id=mCT174371.1
FT                   created on 23-APR-2004"
FT   CDS             7186..9585
FT                   /codon_start=1
FT                   /locus_tag="mCG_141302"
FT                   /product="mCG141302"
FT                   /note="gene_id=mCG141302.1 transcript_id=mCT174371.1
FT                   protein_id=mCP97287.1"
FT                   /protein_id="EDL10169.1"
FT                   /translation="MEAGEEMEQILKKRQVLLFFVLLGIAQAGSTIRRYSVEEEAENGV
FT                   FVANLLKDLGLEVEELAARGPRVISKGKKLNLEFNRQTGDLLLREKLDREELCGPAEPC
FT                   VVPFQVLLGNPLQIFQAELQIRDINDHSPVFLDKEITLKISESTASGTTFLIERAQDLD
FT                   VGSNGLQTYTINPNFYFHLNLQNSPDGTVLPQLVLDKVLDREERSEIRLILTALDGGNP
FT                   PRSGTVQILIEVLDINDNAPVFSKLRYEVQIPENSPVGSQVATVSARDLDIGDHGNIAY
FT                   AFSQASEDIRKTFRMNATSGEILLVKTLDFESIQAYTICVQATDGGGLSGGSVVIVQVM
FT                   DLNDNPPELTMSTFTNHIPENALETVIAVFSVADSDSGDNGKMVCSIQEDLPFILKPSF
FT                   ENFYTLMTNTALDRETRSQYNITIMVSDLGTPRLTAQHTIIVQVSDINDNAPAFTQTSY
FT                   TIFVRENNSPALHIGTISATDSDSGSNAHITYSLLPPQDPQLALHSLVSINADNGQLFA
FT                   LRALDYEDQQTFKFHVGATDGGSPALSSQTLVRVVVLDDNDNAPFVLYPLQNSSVPCTE
FT                   LLPRAAEPGYLVTKVVAVDRDSGQNAWLSFQLLKATEPGLFSVWAHNGEVRTTRLLSER
FT                   DAPKHRLLLLVKDNGDPPHSASVTLQVLVVDGFSQPYLPLPEVARDPAQDEDILTLYLV
FT                   IALASVSSLFLLSVLLFVGVRLCRRARATSLGGCSMPEGHFPAHLVDVGGAGTLSQSYQ
FT                   YEVCLTGDTGTPDFKFLKPIIPNFLLQSSETENDTNPSYRNSFEFS"
FT   gene            <13194..16191
FT                   /gene="Pcdhb3"
FT                   /locus_tag="mCG_141301"
FT                   /note="gene_id=mCG141301.0"
FT   mRNA            <13194..16191
FT                   /gene="Pcdhb3"
FT                   /locus_tag="mCG_141301"
FT                   /product="protocadherin beta 3"
FT                   /note="gene_id=mCG141301.0 transcript_id=mCT174370.0
FT                   created on 15-OCT-2002"
FT   CDS             13194..15548
FT                   /codon_start=1
FT                   /gene="Pcdhb3"
FT                   /locus_tag="mCG_141301"
FT                   /product="protocadherin beta 3"
FT                   /note="gene_id=mCG141301.0 transcript_id=mCT174370.0
FT                   protein_id=mCP97288.0"
FT                   /protein_id="EDL10168.1"
FT                   /translation="MEAREERFLKQRQVLLLFVFLGGSLAGSMSRRYSVAEEKEKGFVI
FT                   ANLATDLGLSIEELAERRAQAISKGNIQYFQLSHQTGDLLLVEKLDREELCGSTEPCVL
FT                   HFQILLHDPLQFITNELEVIDVNDHAPEFFEKAMQLKVLENFVPGTVIPLGNAVDLDVG
FT                   RNGLQNYTVSPTSHFHVHTRRRRDGRKYPELVLDRALDREEQSEISLTLTALDGGSPPR
FT                   SGTTQVHILVLDTNDNAPEFTQSLYEVQILEKSPIGSVITTVSASDLDTGNFGAISYVF
FT                   FHASEEILETFRLNSSTGNIQLLKGLDYEAINTYEVDVEAKDGGGLSGKCTVIVQILDV
FT                   NDNPPELTLSSVNSLIPENSAETVVAVFSVSDLDSGDNGRVTCSIQNDLPFILKPSVEN
FT                   FYTIASEWALDREIRAEYNITITVSDLGTPRLTTQHTITVQVSDLNDNAPAFTQTSYTM
FT                   SVRENNSPALHIGTISATDSDSGSNAHITYSLLPPHDPQLALDSLISINADNGQLFALR
FT                   ALDYEALQAFEFHVGATDGGSPALSSQALVRVVVLDDNDNAPFVLYPLQNASAPCTELL
FT                   PRAAEPGYLVTKVVAVDRDSGQNAWLSFQLLKSTEPGLFSVWAHNGEVRTARLLSERDM
FT                   LKQKLLLLVKDNGDPPRSASVTLNVLLVDGFSQPYLPLPEMARDSVQNDVDLLTLYLVI
FT                   ALASVSSLFLLSVLLFVGVRLCRRARAASMGGCSVPEGHFPGHLVDVSGMGTLSQSYQY
FT                   EVCLTGDAGTGEFKLLNPVIPNLFLEESERS"
FT   gene            19530..23289
FT                   /gene="Pcdhb4"
FT                   /locus_tag="mCG_141299"
FT                   /note="gene_id=mCG141299.1"
FT   mRNA            19530..23289
FT                   /gene="Pcdhb4"
FT                   /locus_tag="mCG_141299"
FT                   /product="protocadherin beta 4"
FT                   /note="gene_id=mCG141299.1 transcript_id=mCT174369.1
FT                   created on 23-APR-2004"
FT   CDS             19755..22109
FT                   /codon_start=1
FT                   /gene="Pcdhb4"
FT                   /locus_tag="mCG_141299"
FT                   /product="protocadherin beta 4"
FT                   /note="gene_id=mCG141299.1 transcript_id=mCT174369.1
FT                   protein_id=mCP97289.1"
FT                   /protein_id="EDL10167.1"
FT                   /translation="METALAKMSQQRQVVFLTMLLLLWVSGSEAIKYSMPEETESGYLV
FT                   ANLAQDLGIRVGELAAREARVHHRGNKDLLQLDAETGNLFLKEKLDREGLCGATEPCVL
FT                   HFQIILKNPVQFFQTELQLTDINDHSPEFPDTEMLLTIPESAQPGTVFPLKAAQDPDMG
FT                   SNAIQNYTVSPNLHFHVVTLSRSDGRKYPELVLDRALDREEQPELTLILTALDGGAPRR
FT                   SGMTTVHIEIMDINDNAPQFVQSLYEVQVPENFPLDALLVTVSARDLDAGIYGNVAYSL
FT                   FQGDGDSQPFVIDEITGEIRLSKKLDFEVTPYYNVEIAATDGGGLSGKCTVAVQVLDVN
FT                   DNAPELTVSTLSSPIPENSPETVVAVFGVFDPDSGDNGRMVCSIQNELPFLLKSTFENY
FT                   YTLATERPLDRESIAEYNITITVSDMGTPRLTTQHTIKVQVSDINDNAPAFTQTSYTLF
FT                   VHENNSPALHIGTISATDSDSGSNAHITYSLLPPQDPQLALSSLISINADNGQLFALRA
FT                   LDYEALQAFEFHVGATDGGSPALSSQTLVRVVVLDDNDNAPFVLYPLQNASAPYTELLP
FT                   RAAEPGYLVTKVVAVDRDSGQNAWLSFQLLKATEPGLFSVWAHNGEVRTTRLLSERDAP
FT                   KHRLLLLVKDNGEPLRSASVTMHVLVVDGFSQPYLPLPEVALDPTREEDNLTLYLVISL
FT                   ASVSSLFLLSVLLFVGARLCRRAREASLGGYSLPEGHFPGHLVDVSGAGTLSQSYQYEV
FT                   CLSGDSGITDFKFLKPSNPNSLIPDNYMLNS"
FT   gene            <32703..>35081
FT                   /locus_tag="mCG_141297"
FT                   /note="gene_id=mCG141297.0"
FT   mRNA            <32703..>35081
FT                   /locus_tag="mCG_141297"
FT                   /product="mCG141297"
FT                   /note="gene_id=mCG141297.0 transcript_id=mCT174366.0
FT                   created on 15-OCT-2002"
FT   CDS             32703..35081
FT                   /codon_start=1
FT                   /locus_tag="mCG_141297"
FT                   /product="mCG141297"
FT                   /note="gene_id=mCG141297.0 transcript_id=mCT174366.0
FT                   protein_id=mCP97290.0"
FT                   /protein_id="EDL10166.1"
FT                   /translation="MEKLERNHRNRQVIPFLFMLLWDEVLMVPTRYSVLEESESGSFVA
FT                   HLAKDLGLGAGELAARSARVVSDHDKQQLILDPETGDLLLREKLDREELCGSVDPCVLH
FT                   FQVFLEKPVQFFQGELLIQDINDNSPEFPDKELLLKIPENSQPGTRFSLKLAQDLDVGS
FT                   NGLQQYTVNPNSHFHVLTRNNSEGKKYPELVQDRALDREEQAELSLILTALDGGSPPRS
FT                   GTALVRILIMDINDNAPEFVNNPYEVQVLESSPPDSPVLTVFAQDADAGNFGRVSYGLF
FT                   QASDEIQKTFSINEFTGEIRLKTKLDFEKTKSYHVEIEATDGGGLSGKGSVVIEVLDVN
FT                   DNAPELTISSLTSSVPENSPETVVAIIRIRDRDAGENGKMICSISDHVPFILKPSYKNF
FT                   YTLVTESPLDRESRAEYNITITVSDLGTPRLTTQHTITVQVSDVNDNAPAFTRTSYTMF
FT                   VRENNSPALHIGTISATDSDSGSNAHITYSLLPPHDPQLALHSLISINADNGQLFALSA
FT                   LDYEALQGFEFYVGATDRGSPELSSRALVRVVVLDDNDNAPFVLYPLQNASAPCTELLP
FT                   RAAEPGYLVTKVVAVDRDSGQNAWLSFQLLKATEPGLFSVWAHNGEVRTTRLLSERDAP
FT                   KHRLLLLVKDNGEPQRSASVTLHVLLVDGFSQPYLPLPEVARDPAQDDTDVLTLYLVIA
FT                   LASVSSLFLLSVLMFVGVRLCRRAREPSLSGCSVPEGHFPGHLVDVSHAGTLSQSYQYD
FT                   VCLTGESGTGEFKFLKPIVPNLMVQDTGNLHCRDSFVFS"
FT   assembly_gap    37525..37544
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <48681..>50309
FT                   /locus_tag="mCG_141295"
FT                   /note="gene_id=mCG141295.0"
FT   mRNA            <48681..>50309
FT                   /locus_tag="mCG_141295"
FT                   /product="mCG141295"
FT                   /note="gene_id=mCG141295.0 transcript_id=mCT174376.0
FT                   created on 15-OCT-2002"
FT   CDS             48681..>50309
FT                   /codon_start=1
FT                   /locus_tag="mCG_141295"
FT                   /product="mCG141295"
FT                   /note="gene_id=mCG141295.0 transcript_id=mCT174376.0
FT                   protein_id=mCP97293.0"
FT                   /protein_id="EDL10165.1"
FT                   /translation="METTLAKTPEKRQVVFLAILLLLWEAGSEAIRYSIPEETESGYLV
FT                   AHLAKDLGFRVGELATRRARIHHRGNKELLQLDVETGNLLLKEKPDREALCGATEPCVL
FT                   HFQIILENPVQFFQTELQLTDINDHSPEFPDTEMLLKIQESTQPATVFLLKAAQDSDIG
FT                   SNAVQNYTVSPNLHFHVVTLSRSDGRKYPELVLDRALDREEQPELTLILTALDGGAPPK
FT                   SGTTTVRIEVVDINDNAPEFVQSLYSVEVPENSPLDALVVTVSARDLDAGIHGNVAYSL
FT                   FQGGGGPQPFVIDEITGEIRLKGALDFEATSYYTMEIVATDSGGLSGKCTVAIQVLDVN
FT                   DNAPKLTISSLTSSIPENAPEAVVAVFSVSDPDSGDNGRMVCSIQNELPFLLKPTFENY
FT                   YTLAAEGPLDREIREEYNITIIVSDLGTPRLTTQHTITVQVVDINDNAPAFTQTSYTMF
FT                   VHENNNPALHIGTISATDSDSGSNAHITYSLLPPHDLQLSLASLVSINADNGQLFALRA
FT                   MDYEALQAFEFHVGATDGGSPALSSQ"
FT   assembly_gap    50311..50330
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    55337..55356
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <60572..63469
FT                   /locus_tag="mCG_141294"
FT                   /note="gene_id=mCG141294.0"
FT   mRNA            <60572..63469
FT                   /locus_tag="mCG_141294"
FT                   /product="mCG141294"
FT                   /note="gene_id=mCG141294.0 transcript_id=mCT174364.0
FT                   created on 15-OCT-2002"
FT   CDS             60572..62968
FT                   /codon_start=1
FT                   /locus_tag="mCG_141294"
FT                   /product="mCG141294"
FT                   /note="gene_id=mCG141294.0 transcript_id=mCT174364.0
FT                   protein_id=mCP97291.0"
FT                   /db_xref="GOA:Q925M2"
FT                   /db_xref="InterPro:IPR002126"
FT                   /db_xref="InterPro:IPR013164"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR020894"
FT                   /db_xref="InterPro:IPR032455"
FT                   /db_xref="MGI:MGI:2136741"
FT                   /db_xref="UniProtKB/TrEMBL:Q925M2"
FT                   /protein_id="EDL10164.1"
FT                   /translation="MEKLEKAHPKRQVIAFIFMMVLVQVCSEPTTQYSILEETESGSFV
FT                   AHLAKDLGLGARELAARSARVVSDDYKQRLLLDPETGDLLLREKVDREEVCSTVDPCVL
FT                   HFQVTLEKPVQYFQGELLIQDINDHAPEFPEGEMLLNIPENSQPGTLLPLNLAQDLDVG
FT                   SNGLQQYTVSPNSHFHVLTRNNSEGKKYPELVQDRALDREEQAELSLTLIALDGGSPPR
FT                   SGTALVRILIMDINDNAPEFVNSPYEVQVLESSLPDSPVLTVFAQDADAGNFGRVSYGF
FT                   FQASDEIQRTFSINKVTGEIQLKKELDFEKIKFYHVKIEATDGGGLSGKGLVIVEVLDV
FT                   NDNAPELTISSLTSSVPENAPETIISIFRVGDRDSGENAKVVCSIPENLPFILKSTFKN
FT                   FYTLVTESPLDRESRAEYNITIMVSDLGTPRLTTWHTITVQVSDVNDNAPAFTRTSYTM
FT                   FVRENNSPALHIGTISATDSDSGSNAHITYSLLLPHDPELPLSSLISINADNGQLFALR
FT                   ALDYEVLQAFEFHVGATDRGSPALSSQALVRVVVLDDNDNAPFVLYPMQNTSAPCTELL
FT                   PRAAEPGYLVTKVVAVDRDSGQNAWLSFQLLKATEPGLFSVWAHNGEVRTSRLLSERDA
FT                   LKHRLLMLVKDNGEPPRSASVTLHVLLVDGFSQPYLSLPEVAPDPTQEVEDALTVYLVI
FT                   ALASVSSLFLLSVVLFVGVKLCRRAREPSLGGCSVPEELFPGHMVDVSGTGTLSHNYQY
FT                   EVCLTRDSGIGEFKFLKPMIPNLLVQDAGRELNENLHCRDSFVFS"
FT   gene            <73913..>76252
FT                   /locus_tag="mCG_141292"
FT                   /note="gene_id=mCG141292.0"
FT   mRNA            <73913..>76252
FT                   /locus_tag="mCG_141292"
FT                   /product="mCG141292"
FT                   /note="gene_id=mCG141292.0 transcript_id=mCT174363.0
FT                   created on 15-OCT-2002"
FT   CDS             73913..76252
FT                   /codon_start=1
FT                   /locus_tag="mCG_141292"
FT                   /product="mCG141292"
FT                   /note="gene_id=mCG141292.0 transcript_id=mCT174363.0
FT                   protein_id=mCP97292.0"
FT                   /db_xref="GOA:Q91XZ2"
FT                   /db_xref="InterPro:IPR002126"
FT                   /db_xref="InterPro:IPR013164"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR020894"
FT                   /db_xref="InterPro:IPR032455"
FT                   /db_xref="MGI:MGI:2136742"
FT                   /db_xref="PDB:5DZY"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q91XZ2"
FT                   /protein_id="EDL10163.1"
FT                   /translation="METALTKTPEKRQVIFLAILLLLWEASSEAISYSMPEETESGYLV
FT                   ANLAQDLGLRVGELTTRGARIHHNGNKELLQLDAERGNLLLKEKPDREALCGATEPCVL
FT                   HFQIILENPVQFFQTDLQFTDINDHFPEFPDTEMLLKIQEIAQPGTVFPLKAAQDPDIG
FT                   SNAVQNYTVSPNLHFHVVTLSRSDDRKYPELVLDRALDREEQPELTLILTALDGGAPPK
FT                   SGTTTVRIEVVDINDNAPQFLQSLYAVEVPENSPLNALVVTVSARDLDAGIHGNVAYSL
FT                   FQGGGGPQPFVIDEITGEIRLKGALDFEATSYYTMEIVATDSGGLSGKCTVAIQVLDVN
FT                   DNAPKLTISSLTSSIPENAPEAVVAVFSVSDPDSGDNGRMVCSIQNGLPFLLKPTFKNF
FT                   YTLVTERPLDRESNAEYNITITVSDLGTPRLTTQHTITVQVSDINDNAPAFTQTSYTLF
FT                   VHENNSPALHIGTISATDSDSGSNGLIIYSLLPPHDQQLGLASLISINSDNGQLFALRA
FT                   LDYEALQAFEFHVGATDRGSPALSSEALVRVVVLDDNDNAPFVLYPLQNASAPCTELLP
FT                   RAAEPGYLITKVVAVDRDSGQNAWLSFQLLKATEPGLFSVWAHNGEVRTTRLLSERDAP
FT                   KHRLLLLVKDNGEPLRSASVMLQVLVVDGFSQPYLPLPEVALNPTQEEDMLTLYLVIAL
FT                   ASVSSLFLLSVLLFVGVKLCKKAREASLADCSIPEGHFPSHLVDVSGAGTLSQSYHYEV
FT                   CLTEDSGTSDFKFMNPIIPSSLLQDS"
FT   assembly_gap    88456..88475
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <119252..>121633
FT                   /locus_tag="mCG_141289"
FT                   /note="gene_id=mCG141289.0"
FT   mRNA            <119252..>121633
FT                   /locus_tag="mCG_141289"
FT                   /product="mCG141289"
FT                   /note="gene_id=mCG141289.0 transcript_id=mCT174358.0
FT                   created on 15-OCT-2002"
FT   CDS             119252..121633
FT                   /codon_start=1
FT                   /locus_tag="mCG_141289"
FT                   /product="mCG141289"
FT                   /note="gene_id=mCG141289.0 transcript_id=mCT174358.0
FT                   protein_id=mCP97286.0"
FT                   /db_xref="GOA:Q91XZ1"
FT                   /db_xref="InterPro:IPR002126"
FT                   /db_xref="InterPro:IPR013164"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR020894"
FT                   /db_xref="InterPro:IPR032455"
FT                   /db_xref="MGI:MGI:2136744"
FT                   /db_xref="UniProtKB/TrEMBL:Q91XZ1"
FT                   /protein_id="EDL10162.1"
FT                   /translation="MEKLGRIHLNRQVMAFIFMMVLVQVCSEPTIRYSILEETESGSFV
FT                   AHLAKDLGLGARELAARSARVLSDDYKQRLLLDPETGDLLLREKVDREEVCSTVDPCVL
FT                   HFQVTLEKPVQYFQRELLIQDINDHAPEFPDRELLLRIPENSQQGTQFSLNLAQDLDVG
FT                   SNGLQQYTVSPNPYFHVLTQNNSKGKKYPELVQDRGLDREEQAELSLTLTALDGGSPPR
FT                   SGTALVRILIMDINDNAPEFVNSPYEVQVLESSPPDSPVLTVLARDADAGNFGRVSYGF
FT                   FQASDEIQQTFSINATSGDMRLKKKLDFEKIKSYHVEIEAIDGGGLSGKGSVTIEVVDV
FT                   NDNAPELTISSLTSSVPENAPETIISIFRVGDRDSGENGKMVCSIPENLPFILKSTFKN
FT                   FYTLVTESPLDRESRAEYNITIMVSDMGTPRLTTWHTIKVQVSDINDNTPAFTQTSYTM
FT                   FVRENNSPALHIGTISATDSDSGSNAHITYSLLPPHDPELALSSLISINADNGQLFALR
FT                   ALDYEALQVFEFHVGATDGGSPPLSSQALVRVVVLDDNDNAPFVLYPMQNASAPFTELL
FT                   PRAAEPGYLVTKVVAVDRDSGQNAWLSFQLLKATEPGLFSVWAHNGEVRTTRLLSERDV
FT                   PKHRLLLVVKDNGEPQRSASVTLQVLLVDGFSQSYLPLPEVARDPAHEDEDVLTLYLVI
FT                   ALASVSSLFLLSVLLFVGVRLCRRAREVSLGGCSMPGEHFPGHLVDVSGAGTLSQSYQY
FT                   EVCLRGDSGTGEFKFLKPMIPNAGIEIMESPHCRDSFVFN"
FT   gene            <130063..>132456
FT                   /gene="Pcdhb10"
FT                   /locus_tag="mCG_141287"
FT                   /note="gene_id=mCG141287.0"
FT   mRNA            <130063..>132456
FT                   /gene="Pcdhb10"
FT                   /locus_tag="mCG_141287"
FT                   /product="protocadherin beta 10"
FT                   /note="gene_id=mCG141287.0 transcript_id=mCT174359.0
FT                   created on 15-OCT-2002"
FT   CDS             130063..132456
FT                   /codon_start=1
FT                   /gene="Pcdhb10"
FT                   /locus_tag="mCG_141287"
FT                   /product="protocadherin beta 10"
FT                   /note="gene_id=mCG141287.0 transcript_id=mCT174359.0
FT                   protein_id=mCP97285.0"
FT                   /db_xref="GOA:Q91VE5"
FT                   /db_xref="InterPro:IPR002126"
FT                   /db_xref="InterPro:IPR013164"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR020894"
FT                   /db_xref="InterPro:IPR030730"
FT                   /db_xref="InterPro:IPR032455"
FT                   /db_xref="MGI:MGI:2136745"
FT                   /db_xref="UniProtKB/TrEMBL:Q91VE5"
FT                   /protein_id="EDL10161.1"
FT                   /translation="MEMTLAKTPENRQVLFFTILLLLWKSCADAIIYSIPEETESGYLV
FT                   ANLAKDLGLRVGELAIRGARIHYKGNKELLQLDAETGNLFLKEKPDREVLCRATEPCVL
FT                   HFQIILENPVQFFQTELQLTDINDHSPEFPDRKMLLKIPESAQPGTTFPLKAAQDPDIG
FT                   SNAVQNYTVSPNLHFHVVTLSRSDGRKYPELVLDRALDREEQPELTLILTALDGGAPPR
FT                   SGTTEVHIEVVDINDNAPQFIQSLYEVQILENSPLDALVATVSARDLDAGIYGKVAYSL
FT                   FQDDGISQPFVIDEITGEIRLKGALDFEATPYYNMEIVATDPGGFSGKCTVVIQVVDVN
FT                   DNAPKLTISSLNSSIPENAPETVVAVFSVSDPDSGENGRMVCSIQNELPFLLKSTFENY
FT                   YTLVTEGTLDRESKAEYNITISVTDLGTPRLTTQHTITVQVSDINDNAPTFTRTSYTMF
FT                   IRENNSPALHIGTISATDSDAGSNAHITYSLLPPHDPQLTLTSLVSINEDNGQLFALRA
FT                   LDYEALRAFEFHVRATDRGSPALSSQALVLVVVLDDNDNEPFVLYPLQNSSAPCKELVP
FT                   RAAEAGYLVTKVVAVDRDSGQNAWLSFQLLKATEPGLFSVWAHNGEVRTTRLLSERDAP
FT                   KHRLLLVVKDNGDPPRSASVTLHVLLVDGFSQPYLPLSEVVQDPAQEGDDALTLYLVIA
FT                   LASVSSLFLISVLLFVGMKLCKRARSPSLGVCSVPEGHFPGHLVDVSGTGTLSQSYQYE
FT                   VCLSGDSGTGEFKFLKPMISNLMVQDPEREVKESPHCRDSFVFS"
FT   gene            139587..142898
FT                   /locus_tag="mCG_141285"
FT                   /note="gene_id=mCG141285.1"
FT   mRNA            139587..142898
FT                   /locus_tag="mCG_141285"
FT                   /product="mCG141285"
FT                   /note="gene_id=mCG141285.1 transcript_id=mCT174372.1
FT                   created on 23-APR-2004"
FT   CDS             139790..142183
FT                   /codon_start=1
FT                   /locus_tag="mCG_141285"
FT                   /product="mCG141285"
FT                   /note="gene_id=mCG141285.1 transcript_id=mCT174372.1
FT                   protein_id=mCP97278.1"
FT                   /db_xref="GOA:Q91UZ8"
FT                   /db_xref="InterPro:IPR002126"
FT                   /db_xref="InterPro:IPR013164"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR020894"
FT                   /db_xref="InterPro:IPR032455"
FT                   /db_xref="MGI:MGI:2136746"
FT                   /db_xref="UniProtKB/TrEMBL:Q91UZ8"
FT                   /protein_id="EDL10160.1"
FT                   /translation="METALAKMPEQRQVFFLTILLLLWKSGSGATRYSMPEEKESGYLV
FT                   ANVAKDLGLRVGELATRGAQIHYKGNKELLQMDAETGNLFLKEKLDREALCGATEPCVL
FT                   HFQVILENPVQFFQTELQLTDINDHSPEFPDREMLLKIPENAQPGTVFPLKAAQDSDIG
FT                   SNAVQNYTVSPNIHFHVITHSRSDGRKYPELVLDRALDREEQPELTLILTALDGGAPPR
FT                   SGTTIVHIEVVDINDNAPQFIQSLYEVQILENSPIDTLVVTVSARDLDSGIYGNVAYSL
FT                   FQGDGLSQPFVIDEVTGEIRLSKELDFEGISHYNIEIAATDGGDLLGKCTVVIQVLDVN
FT                   DNAPELMIRKLTVPVPENSAETVVAVFSVSDSDSGDNGRIVCSIQNNIPFLLKPTFENY
FT                   YTLVTEGPLDRESRAEYNITITVWDLGTPRLTTQHTITVQVSDINDNAPAFTQTSYTLF
FT                   VQENNSPALQIGTISATDSDSGSNAHITYSLLLPQDPQLALASLISINPDNGQLFVLRA
FT                   LDYESLQAFEFRVGATDQGSPALSSQTLVRVVVLDDNDNAPFVLYPMQNASAPCTELLP
FT                   REAESGYLVTKVVAVDRDSGQNAWLSFQLLKATEPGLFSVWAHNGEVRTTRLLSERDVP
FT                   KHRLLLLVKDNGEPQLSASVTLQVLLVNSFSQPYLSLPEVAQDPIQEDGEMLTLYLVIA
FT                   LASVSSLFLLSVLMFVGMRLCRRAREASLGVCSVPEGHFPGHLMDVSGTGTLSHSYQYD
FT                   VCLSGDSRTGEFKFLKPMIPNVMVQEAGREVKENPPCRDSFVFS"
FT   gene            153807..156825
FT                   /locus_tag="mCG_141300"
FT                   /note="gene_id=mCG141300.1"
FT   mRNA            153807..156825
FT                   /locus_tag="mCG_141300"
FT                   /product="mCG141300"
FT                   /note="gene_id=mCG141300.1 transcript_id=mCT174373.1
FT                   created on 25-JUN-2004"
FT   CDS             153974..156343
FT                   /codon_start=1
FT                   /locus_tag="mCG_141300"
FT                   /product="mCG141300"
FT                   /note="gene_id=mCG141300.1 transcript_id=mCT174373.1
FT                   protein_id=mCP97277.1"
FT                   /db_xref="GOA:Q91Y07"
FT                   /db_xref="InterPro:IPR002126"
FT                   /db_xref="InterPro:IPR013164"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR020894"
FT                   /db_xref="InterPro:IPR032455"
FT                   /db_xref="MGI:MGI:2136747"
FT                   /db_xref="UniProtKB/TrEMBL:Q91Y07"
FT                   /protein_id="EDL10159.1"
FT                   /translation="MPGQRQVFFLTILLLFWKSDSEAIRYSMPEEKESGYLVANVAKDL
FT                   GLRVEELATRGAQIHYRGNKELLQMDAETGNLFLKEKLDREALCGATEPCVLHFQIILE
FT                   NPVQFFQTELQLTDINDHSPEFSDTEMLLTIPENAQPGTVFPLKAAHDSDIGSNAVQNY
FT                   TVNPNIHFHVVTLSRSDGRKYPELVLDRALDREEQPELTLTLTALDGGSPPRSGTTEVH
FT                   IEVVDINDNAPQFIQSLYEVQVPENSPLNALVVMVSATDLDAGIYGNVAYSLFQGDGLS
FT                   QPFVIDKITGEIRLTKELDFEVSHHYTIEIAATDGGGLSGKCTVVIQVLDVNDNAPELA
FT                   IRKLTVPVPENSAETVVAVFSVSDSDSGDNGRIVCSIQNNIPFLLKPTFENYYTLVTEG
FT                   PLDRESRAEYNITITVWDLGTPRLTTQHTITVQVADINDNAPAFTQTSYTLFVQENNSP
FT                   ALHIGTISATDSDSGSNAHITYSLLPPHDSQLALASLVSINSDNGQLFALRAMDYEMLQ
FT                   AFELHVDATDGGSPALSSQALVRVVVLDDNDNSPFVLYPMQNASAPCTELLPRAAEPGY
FT                   LITKVVAVDRDSGQNAWLSFQLLKATEPGLFSVWAHNGEVRTTRLLSERDAPKHKLLLL
FT                   VKDNGDPPRSASVTLHVLVVDGFSQPYLPLPEVARDSTQDDYDVLTLYLVVALASVSSL
FT                   FLLSVLLFVGVRLCRRARAASLGDYSVPEGHFPSHLVDVSRAGTLSQSYQYEVCLNGGT
FT                   GTNEFNFLKPLFPILPTQAAAEERENAVVRNSVEFY"
FT   gene            <160742..>163132
FT                   /gene="Pcdhb13"
FT                   /locus_tag="mCG_141298"
FT                   /note="gene_id=mCG141298.0"
FT   mRNA            <160742..>163132
FT                   /gene="Pcdhb13"
FT                   /locus_tag="mCG_141298"
FT                   /product="protocadherin beta 13"
FT                   /note="gene_id=mCG141298.0 transcript_id=mCT174375.0
FT                   created on 15-OCT-2002"
FT   CDS             160742..163132
FT                   /codon_start=1
FT                   /gene="Pcdhb13"
FT                   /locus_tag="mCG_141298"
FT                   /product="protocadherin beta 13"
FT                   /note="gene_id=mCG141298.0 transcript_id=mCT174375.0
FT                   protein_id=mCP97294.0"
FT                   /db_xref="GOA:Q91Y06"
FT                   /db_xref="InterPro:IPR002126"
FT                   /db_xref="InterPro:IPR013164"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR020894"
FT                   /db_xref="InterPro:IPR032455"
FT                   /db_xref="MGI:MGI:2136748"
FT                   /db_xref="UniProtKB/TrEMBL:Q91Y06"
FT                   /protein_id="EDL10158.1"
FT                   /translation="MSHAKMWCKTRQVMVLITSMLLWEVGSGSIQYAMLEETESGTFVA
FT                   NLTKHLGLRVGELAARDARVVFKGNRQYLQLDPQTQDLMLNENLDREELCGSTEPCVLS
FT                   FRVLLKNPLQFYQAELRVIDINDHAPEFPAREMLLKISEIAPPGKIFPLKMAQDLDTGS
FT                   HSIQSYTVSDNPHFHVLTRNRSDGKKFPELVLDKALDREKQDQLRLKLTAVDGGSPPRS
FT                   GTTEIQILVLDINDNTPEFAQELYEVQVPENSPIGSLLITVSARDLDAGPFGEVSYGLS
FT                   QDDDVNEPFEINTKTGEIRLKSTLDFEAFQSYHVDVEALDGGGLTGKCSLVVQVLDVND
FT                   NAPEVILSSLNSPIPENLPGIIVAVFSVSDADSGNNQQVMCSIDDNLPFLLRPSMENFY
FT                   TLETDGALDRESRSEYNITITVTDMGTPRLTTQHNITVQVSDINDNAPAFTQTSYTLFV
FT                   HENNSPALHIGTISATDSDSGSNAHITYSLLLPQDKQLTLTSLVSINADNGQLFALRAL
FT                   DYEALQAFEFRVDATDQGSPALSSQVLVRVVVLDDNDNAPFVLYPMQNASAPCTELLPR
FT                   AAEPGYLVTKVVAVDRDSGQNAWLSFQLFKATEPGLFSVWAHNGEVRTTRLLSERDVPK
FT                   HRLLLLVKDNGEPPRSASVTLHVLLVDGFSQPYLPLPEVAQDSTEDAEDALTLYLVIAL
FT                   ASVSSLFLLSVVLFVGVRLCKKFRAASLGGYSVPEGHFPGHLVDVSGAGTLSQSYQYEV
FT                   CLRGDTGTGEFKLRKAINPHFPSVPSERNTEESPTLRNSFLFI"
FT   gene            165826..169265
FT                   /gene="Pcdhb14"
FT                   /locus_tag="mCG_141296"
FT                   /note="gene_id=mCG141296.1"
FT   mRNA            165826..169265
FT                   /gene="Pcdhb14"
FT                   /locus_tag="mCG_141296"
FT                   /product="protocadherin beta 14"
FT                   /note="gene_id=mCG141296.1 transcript_id=mCT174374.1
FT                   created on 23-APR-2004"
FT   CDS             165978..168404
FT                   /codon_start=1
FT                   /gene="Pcdhb14"
FT                   /locus_tag="mCG_141296"
FT                   /product="protocadherin beta 14"
FT                   /note="gene_id=mCG141296.1 transcript_id=mCT174374.1
FT                   protein_id=mCP97295.1"
FT                   /protein_id="EDL10157.1"
FT                   /translation="MIICCIFWSRGTMETSLHKAPQKRQVTAIIFLLLLWEAGSATITY
FT                   SVLEETDRGSLVGNLAKDLGLSLRELITRGAQILSKGNKQLLQLEQKSGNLLLKEKLDR
FT                   EELCGSTNPCILHFQVLLKSPVQFIQGEIQLQDVNDHAPEFMEDEILLKILESSLPGAV
FT                   FPLKIAQDLDVGSNTVQNYTISTNAHFHLLTRNHSDGRKYPELVLDKALDREEQAQIRL
FT                   TLTAMDSGSPPKTGTTQVVIVVLDINDNAPEFAQGLYEVQVQENSPVGSLVLTVSARDL
FT                   DAGTHGELSYSLFQSSNQVLQAFEVNTDTGEIRVRKLLDFEEIQSYRMEIEASDGGGLS
FT                   GKCTVVIHVMDVNDNAPELTMSVLISEIPENSPETIVAIFGISDPDSGDNGKMVCSVQD
FT                   RLPFLLKPNEENFYTLVTERALDRESRAEYNITITVSDMGTPRLTTQHTITVQVSDIND
FT                   NAPAFTHTSYTMFVRENNSPALHIGTISATDSDSGSNAHITYSLLPPHDPQLALNSLIS
FT                   INADNGQLFALRALDYEALQAFEFHVGATDGGSPALSSQALVRVVVLDDNDNAPFVLYP
FT                   MQNASAPCTELLPRAAEPGYLVTKVVAVDRDSGQNAWLSFQLLKTTEPGLFSVWAHNGE
FT                   VRTTRLLSERDVPKHRLLLLVKDNGEPPHSASVTLHVLLVDGFSQPYLPLPEVARDPAQ
FT                   EDVLTLYLVIALASVSSLFLVSVLLFVGVRLCRKAGETSLGGCSVPEGHFPGHLVDVSG
FT                   TGTLSQSYQYEVCLTGGTGTNEFKFLKPVLPNFLNEGGYRNTEENSNFRDSLGFS"
FT   gene            191715..194510
FT                   /gene="Pcdhb15"
FT                   /locus_tag="mCG_141293"
FT                   /note="gene_id=mCG141293.1"
FT   mRNA            191715..194510
FT                   /gene="Pcdhb15"
FT                   /locus_tag="mCG_141293"
FT                   /product="protocadherin beta 15"
FT                   /note="gene_id=mCG141293.1 transcript_id=mCT174361.1
FT                   created on 23-APR-2004"
FT   CDS             191887..194247
FT                   /codon_start=1
FT                   /gene="Pcdhb15"
FT                   /locus_tag="mCG_141293"
FT                   /product="protocadherin beta 15"
FT                   /note="gene_id=mCG141293.1 transcript_id=mCT174361.1
FT                   protein_id=mCP97283.1"
FT                   /db_xref="GOA:Q91Y04"
FT                   /db_xref="InterPro:IPR002126"
FT                   /db_xref="InterPro:IPR013164"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR020894"
FT                   /db_xref="InterPro:IPR030741"
FT                   /db_xref="InterPro:IPR032455"
FT                   /db_xref="MGI:MGI:2136750"
FT                   /db_xref="UniProtKB/TrEMBL:Q91Y04"
FT                   /protein_id="EDL10156.1"
FT                   /translation="MEARLEQAVQKRQVLFLYVFLGASWASAEQLQYSVAEETERGTFL
FT                   ANLAKDLGLGLGELSAREARIVSDQNTRFLLLSPLTGELILNEKLDREELCGPTEPCVL
FT                   TFQLLLERPFQIYRAALHIKDINDNSPVFLDKEILLKISESTTPGATLLLERAQDADVG
FT                   TNSLSNYTISPNDYFHIHVHDGGEGPIIPELVLDKMLDREEIPEFTLTLTALDGGSPPR
FT                   SGTALVQILVLDINDNSPQFVQSLYKVQSPENTPVGSLVVAVSARDLDTGSYGQIDYTF
FT                   FYATERILQTFQINSTSGELYLKRELNYEAIQTYSITIQARDGGGLSGKCAVVVEVMDV
FT                   NDNPPEFLLSSLNSPIPENSQETVVAVFKIRDRDSGNNGKTLCSIANDLPFVLKPSVEN
FT                   FYTLVTEKPLDRESNTEYNITITVTDMGIPRLTTQHTITVQVSDINDNAPTFTQTSYTM
FT                   FVRENNSPALHIGTISATDSDSGSNAHITYSLRLPHDPQLALDSLISINADNGQLFALR
FT                   ALDYEALQAFEFHVGAIDQGSPALSSQALVRVVILDDNDNAPFVLYPMQNASAPYTELL
FT                   PRAAEPGYLVTKVVAVDRDSGQNAWLSFQLLKATEPGLFSVWAHNGEVRTTRLLSERDV
FT                   PKHKLLVVVKDNGEPPRSASVTLHVLLVDGFSQPFLILPEVARDPAQEDDELTLYLVIA
FT                   LASVSSLFLVSVLLFVGVRLCRRARAASPGVCFVPEEHFPGHLVDVSGAGTLSQNYQYE
FT                   VCLTGGSGITSEFKFLSPIASNFLTESTGREIE"
FT   gene            <196157..>198565
FT                   /locus_tag="mCG_141291"
FT                   /note="gene_id=mCG141291.0"
FT   mRNA            <196157..>198565
FT                   /locus_tag="mCG_141291"
FT                   /product="mCG141291"
FT                   /note="gene_id=mCG141291.0 transcript_id=mCT174360.0
FT                   created on 15-OCT-2002"
FT   CDS             196157..198565
FT                   /codon_start=1
FT                   /locus_tag="mCG_141291"
FT                   /product="mCG141291"
FT                   /note="gene_id=mCG141291.0 transcript_id=mCT174360.0
FT                   protein_id=mCP97284.0"
FT                   /db_xref="GOA:Q91Y03"
FT                   /db_xref="InterPro:IPR002126"
FT                   /db_xref="InterPro:IPR013164"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR020894"
FT                   /db_xref="InterPro:IPR032455"
FT                   /db_xref="MGI:MGI:2136752"
FT                   /db_xref="UniProtKB/TrEMBL:Q91Y03"
FT                   /protein_id="EDL10155.1"
FT                   /translation="MEASRKLICRQRQVLFFFLLLGFPLTTAGELRRYSVVEEKEGRSF
FT                   VTNLVKDLGLGQLELSRRGAKVISKGNKLHLQLDQETGDLLLNEKVDREKLCGHTEPCL
FT                   LSFQVLLDNPLDIFQAELEVTDINDHSPEFLDKEIMLKISESSLPGATFPLKNAQDMDV
FT                   GQNGIDKYLISSNSYFRVLTRKRSDGKKYPELVLDRALDREEEAELRLTLTAQDGGSLP
FT                   RSGTTEVHIEVLDINDNAPQFEQLFYKAQIPEDSPIGFLIITVSATDKDIGVNGQISYS
FT                   LFQVSDDISKTFSIHPLTGEVRLKEHLDFEKTQSYEINIEARDAGTFSGKCTILAQVLD
FT                   VNDHAPEIILSAFTNSILENLPETMVAVFSVSDLDSGENGKVSCSIQDDLPFFLKPSGE
FT                   NFYTLLSQKPLDRESVAEYNITITVADMGSPILKTQVNLTVQVSDINDNAPIFTQTSYT
FT                   MFIRENNSPALHIGTISATDSDSGSNAHITYSLLPPHDHQLALASFISINADNGQLFVL
FT                   RALDYEALQAFEFHVGATDGGSPALSSQALVRMVVLDDNDNAPFVLYPMQNASAPYTEL
FT                   LPRAAEPGYLVTKVVAVDRDSGQNAWLSFQLLKATEPGLFSVWAHNGEVHTSRLLSERD
FT                   VHKHRLILLVKDNGDPPRSASVTLHVLLVDGFSQPYLPLPEVARDPDHEDSELTLYLVI
FT                   ALASVSSLFLVSVLLFVGVRLCRRAREVSLGGCSVPEGHFPGHLVDVSGTGTLSQSYQY
FT                   EVCLTGDSGTGEFKYLKPILPNFQDHSFRPEMGENPNSRNDWSFGIQLK"
FT   gene            <203336..206466
FT                   /locus_tag="mCG_141290"
FT                   /note="gene_id=mCG141290.0"
FT   mRNA            <203336..206466
FT                   /locus_tag="mCG_141290"
FT                   /product="mCG141290"
FT                   /note="gene_id=mCG141290.0 transcript_id=mCT174362.0
FT                   created on 15-OCT-2002"
FT   CDS             203336..205735
FT                   /codon_start=1
FT                   /locus_tag="mCG_141290"
FT                   /product="mCG141290"
FT                   /note="gene_id=mCG141290.0 transcript_id=mCT174362.0
FT                   protein_id=mCP97282.0"
FT                   /db_xref="GOA:Q91VD8"
FT                   /db_xref="InterPro:IPR002126"
FT                   /db_xref="InterPro:IPR010221"
FT                   /db_xref="InterPro:IPR013164"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR020894"
FT                   /db_xref="InterPro:IPR032455"
FT                   /db_xref="MGI:MGI:2136754"
FT                   /db_xref="UniProtKB/TrEMBL:Q91VD8"
FT                   /protein_id="EDL10154.1"
FT                   /translation="METAWMCNLRQRQVLAFFVLLHVSGAGAELGPYSIEEETERGSFV
FT                   ANLGKDLGVDLAEISNRRARIISQENKEHLQLNLQSGDLLINEKLDREELCGPIEPCVL
FT                   HFQVLMENPLEVFQAELRVMDINDYSPVFSEREMILRILENSALGDTFPLNNALDSDVA
FT                   INNIQTYRLSSNSHFLVVTRNRSDGRKYPELVLEKELDREEEPELRLTLTALDGGAPPR
FT                   SGTAQVLIEVVDINDNAPKFQQPTYRVQIPENSPTGSLVLTVSANDLDSGDYGKVLYAL
FT                   SQPSEDISKTLEVNPVTGEIRLRKEVDFETIPSYEVDIKATDGGGLSGKCTLLLKVVDV
FT                   NDNAPEVMLSALTSPVPENSPDEVVAVFSVKDPDSANNGKMIASIEEDLPFLLKSSGKN
FT                   FYTLVTKRALDREEREKYNITITVSDLGTPRLTTQHTITVQVSDTNDNAPAFNQTSYTL
FT                   FVRENNSPAMHIGTISATDSDAGSNSHISYSLLPSHDPQLALDSLISINADNGQLFALR
FT                   ALDYEALQAFEFHVGAIDQGSPALSSQALVRVVVLDDNDNAPFVLYPMQNSSAPCTELL
FT                   PRAAEPGYLVTKVVAVDRDSGQNAWLSFQLLKATEPGLFSVWAHNGEVRTTRLLSERDV
FT                   PKHRLVLLVKDNGDPPRSASVTLHVLVVDGFSQPYLPLPEVARNPAHDEDALTLYLVIA
FT                   LASVSSLFLLSVLLFVGVRLCRRARSASLSGYSVPEGHIPGHLVDVRGVGTLSQSYQYD
FT                   VCLMGDSSGTSEFNFLKPVFPSSLDQCSGKEIEENSSLHNSFGFHH"
FT   gene            <207797..>210175
FT                   /gene="Pcdhb18"
FT                   /locus_tag="mCG_141288"
FT                   /note="gene_id=mCG141288.0"
FT   mRNA            <207797..>210175
FT                   /gene="Pcdhb18"
FT                   /locus_tag="mCG_141288"
FT                   /product="protocadherin beta 18"
FT                   /note="gene_id=mCG141288.0 transcript_id=mCT174365.0
FT                   created on 15-OCT-2002"
FT   CDS             207797..210175
FT                   /codon_start=1
FT                   /gene="Pcdhb18"
FT                   /locus_tag="mCG_141288"
FT                   /product="protocadherin beta 18"
FT                   /note="gene_id=mCG141288.0 transcript_id=mCT174365.0
FT                   protein_id=mCP97281.0"
FT                   /db_xref="GOA:Q91Y02"
FT                   /db_xref="InterPro:IPR002126"
FT                   /db_xref="InterPro:IPR013164"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR020894"
FT                   /db_xref="InterPro:IPR032455"
FT                   /db_xref="MGI:MGI:2136756"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q91Y02"
FT                   /protein_id="EDL10153.1"
FT                   /translation="MAARGSCVSRQRQVLFLFLLGGLCLAGSELGRYSVTEETERGSFV
FT                   ANLAKDLGLGVEALAAKRTRVVCDDNKQHLFLDSHTGDLLTNEKLDREKLCGPTEPCML
FT                   YFQILMDNPFQIYRAELRILDINDHSPIFQDKKMILKILENTAVGTTFRLERAQDSDGG
FT                   RNGIQNYTISPNTFFHITVHNSDEGMIYPELVLDKALDWEGQPEFSLTLTALDGGSPPR
FT                   SGTATIHILVLDINDNAPQFPQELYEIQAPENSPIGLVVIKVTGEDVDSGVNAEISYSF
FT                   FDASEDIRATFQINPFSGEITLKALLDYEFIKSYKLNVQAVDGGGLSARCTVLVRVLDV
FT                   NDNAPELIMSSLVNEVVENSPETVLAVFRINDRDSGENGKMVCHIQENLPFLLKPSVDN
FT                   FYILMTEGALDRESRAEYNITITVSDLGTPRLTTQHTIRVQVSDINDNAPAFNQTSYTL
FT                   FVRENNSPAMHIGTISATDSDAGSNAHITYSLLPTQDLQMTLTSLVSINADNGQLFAIK
FT                   ALDYEALQAFEFHVGATDRGSPELSSQALVRVVVLDDNDNAPFVLYPMQNASAPYTELL
FT                   PRTAEPGYLVTKVVAVDRDSGQNAWLSFQLLKATEPGLFSVWAHNGEVRTTRLLSERDV
FT                   PKHRLLLLVKDNGDPPRSASVTLQVLLVDGFSQPYLPLPEVAHNPTQGEEDVLTLYLVI
FT                   ALASVSSLFLLSVLLFVGVRLCRRARAASLGGCSVPEGHFPGHLVDVSGTGTLSQNYQY
FT                   EVCLMGGSSGTSDFKFLKSIYPEVHAYSSQDNSDGNPTF"
FT   gene            <215332..218011
FT                   /locus_tag="mCG_141286"
FT                   /note="gene_id=mCG141286.0"
FT   mRNA            <215332..218011
FT                   /locus_tag="mCG_141286"
FT                   /product="mCG141286"
FT                   /note="gene_id=mCG141286.0 transcript_id=mCT174368.0
FT                   created on 15-OCT-2002"
FT   CDS             215332..217737
FT                   /codon_start=1
FT                   /locus_tag="mCG_141286"
FT                   /product="mCG141286"
FT                   /note="gene_id=mCG141286.0 transcript_id=mCT174368.0
FT                   protein_id=mCP97279.0"
FT                   /db_xref="GOA:Q91Y01"
FT                   /db_xref="InterPro:IPR002126"
FT                   /db_xref="InterPro:IPR013164"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR020894"
FT                   /db_xref="InterPro:IPR030734"
FT                   /db_xref="InterPro:IPR032455"
FT                   /db_xref="MGI:MGI:2136757"
FT                   /db_xref="UniProtKB/TrEMBL:Q91Y01"
FT                   /protein_id="EDL10152.1"
FT                   /translation="MENQEGLYLQTRQVLLLFVFLGMSQAHSEAGRLSVVEEMLSGALV
FT                   GNLVKDLGLQVDELSAREAQVASSDNKLPLQLNINTGDLLLSEPLDREELCGSTEPCVL
FT                   HFQVLLKNPLKILQAELQVTDVNDNSPVFLEKEMVLEIPENSPVGAVFLLESAIDLDVG
FT                   INAVKSYEISQNSHFHVTMRVNPDGRKYPELVLDKALDYEEQHELRLILTALDGGTPPR
FT                   SGTALVRVEVIDINDNSPEFDHMFYEVTVPENSMLGSLLITASAWDLDSGINGEVSYAF
FT                   SHASEDIRKTFAINEHSGEIRLKGYLDFETTESYSIIIKATDRGGLFGKSTVRIQVMDV
FT                   NDNFPEIIVSSFISPIPENTAETLVMIFSIRDKDSGENGKMVCTIPEGLPFVLKSSIEN
FT                   YYHLETDGALDRESIAEYNITISVTDLGTPRLTTQHTIIVQVADINDNAPAFTQTSYTM
FT                   FFHENNSPALHIGTISATDSDAGSNAHITYSLMSAQDLQMALSSLISINADNGQLFALR
FT                   ALDYEVLQAFEFQVGATDRGSPALSSQALVRVVVLDDNDNAPFVLYPMQNASAPCTELL
FT                   PRAAEPGYLVTKVVAVDRDSGQNAWLSFQLLKATEPGLFSVWAHNGEVRTTRLLSERDA
FT                   PKHRLLLLVKDNGDPPRSASVTLHVLVVDGFSQPYLPLPEVARNPAHEEDALTLYLVTA
FT                   LASVSSLFLLSVMLFVGVRLCRRARAASLGGCTVPEGHFPDHLMGINSAGTLSQSYQYE
FT                   VCLMGGSGTNEFRFLKPVSPNLQPQFPGKEIEESSTLRNSFGLFRDCN"
FT   gene            <222447..226005
FT                   /locus_tag="mCG_141284"
FT                   /note="gene_id=mCG141284.1"
FT   mRNA            <222447..226005
FT                   /locus_tag="mCG_141284"
FT                   /product="mCG141284"
FT                   /note="gene_id=mCG141284.1 transcript_id=mCT174367.1
FT                   created on 23-APR-2004"
FT   CDS             <222586..225006
FT                   /codon_start=1
FT                   /locus_tag="mCG_141284"
FT                   /product="mCG141284"
FT                   /note="gene_id=mCG141284.1 transcript_id=mCT174367.1
FT                   protein_id=mCP97280.1"
FT                   /protein_id="EDL10151.1"
FT                   /translation="KKSPEGTMGRRRALILQKRQVLVFFVFLGLSQASAESLRYSVAEE
FT                   TEIGSFVANLAKDLGLGVAELSSREARVVSDDNKKHLLLNLLTGDMLLNERLDREELCG
FT                   STQPCVLPFQVVLENPLQFYRAELHVRDINDHSPTFLDKEITIKISESTTIGATFLIEN
FT                   AQDLDIGSNSLQDYSISPSSYFYVKIHDSGDGKIYPELVLDKALDHEEESELRLTLTAL
FT                   DGGSPPRSGTTLIVIKVLDINDNAPEFAQSFYEVQVPEDMPIGSSITAISAKDLDMGIY
FT                   GKISYSFLHASEDIRKTFEINPTSGEVNLRSLMDFEVIQSYSVNIQATDGGGLSAKCTL
FT                   SVKVLDINDNAPEVIMSSVTKAIPENASETLVALFSVRDQDSGDNGRILCSIQDDLPFI
FT                   LKPSFKNFFTLLSEKALDRERRAEYNITITASDMGTPRLTTQHTIRVQVSDINDNAPAF
FT                   TQTSYTMFIYENNSPALHIGTISATDKDSGSNAHITYSLLPAQDPELALASLISINADN
FT                   GQLFALRALDYEVLQAFEFQVGATDRGSPALSSQTLVRVVVLDDNDNAPFVLYPMQNAS
FT                   APCTELLPRVAEPGYLVTKVVAVDRDSGQNAWLSFQLLKATEPGLFSVWAHNGEVRTTR
FT                   LLSERDVPKHRLVLLVKDNGDPPRSASVTLHVLVVDGFSQPYLPLPEVARDPAQEEDVL
FT                   TLYLVIALASVSSLFLLSVLLFVGVRLCRRARAASLGGCSVPEGHFPGHLVDVTGTGTL
FT                   SQNYQYEVCFTGGTGTNEFKFLRPVMPSLQLHDPDSNMLEKENFRNSLGFNIQ"
FT   gene            <232014..234557
FT                   /locus_tag="mCG_1033322"
FT                   /note="gene_id=mCG1033322.1"
FT   mRNA            <232014..234557
FT                   /locus_tag="mCG_1033322"
FT                   /product="mCG1033322"
FT                   /note="gene_id=mCG1033322.1 transcript_id=mCT151026.1
FT                   created on 15-OCT-2002"
FT   CDS             232014..234338
FT                   /codon_start=1
FT                   /locus_tag="mCG_1033322"
FT                   /product="mCG1033322"
FT                   /note="gene_id=mCG1033322.1 transcript_id=mCT151026.1
FT                   protein_id=mCP77965.0"
FT                   /db_xref="GOA:Q91V48"
FT                   /db_xref="InterPro:IPR002126"
FT                   /db_xref="InterPro:IPR013164"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR020894"
FT                   /db_xref="InterPro:IPR032455"
FT                   /db_xref="MGI:MGI:2136759"
FT                   /db_xref="UniProtKB/TrEMBL:Q91V48"
FT                   /protein_id="EDL10150.1"
FT                   /translation="MEPGVGAAQHIRQVLLFFVFLEGSSVLATTWRYSVPEEMETGSSI
FT                   ANIIKDMDVGDLAARGARVIFDDYQPYLRLELETGNLLLNEKLDREALCSSSEPCILHF
FT                   QVLLENPLQFFQAELLIEDINDHTPTFLEKLIFLNISESATPGTSFQMDDAQDLDIGMN
FT                   GIQNYSISPNPYFYLKLKDSGKGRRYPELVLVRSLDREKEASISLILTAMDGGSLPRSG
FT                   TVLVQVVVLDVNDNAPEFERTLYEVQVPENSSVDSLVIKVSATDLDSGINGEISYSFSH
FT                   ISRDVQKTFEIHPTSGEVRLKRLLDFEVIQSYTINIQAIDGGGLSGKSAIIVQVTDVND
FT                   NPPEIVITSLMSSIPENGLSEMVVAVFSLRDQDSGENGRMMCSIEDKLPFLLKPTFKNF
FT                   YTLVTEHPLDRESRAEYNITVMISDLGTPRLTTQHTITVHISDINDNAPAFTQTTYTMF
FT                   VRENNSPALHIGTISATDSDLGSNAHITYSLLPPQDQRLALTSLISINADNGQLFALRA
FT                   LDYETLQAFEFRVGATDRGSPALSSQALVRVVVLDDNDNAPFVLYPMQNASAPCTELLP
FT                   RAAEPGYLVTKVVAVDRDSGQNAWLSFQLLKATEPGLFSVWAHNGEVRTTRLLSERDVP
FT                   KHRLLLLVKDNGDPPRSASVTLHLLVVDGFSQPYLPLPEVAHDSTQVDEEALTLYLVIA
FT                   LASVSSLFLLSVLLFVGVRLCRRARAASLSGYSEPDGHFSGHLVDVSGAGTLSQSYQYE
FT                   VCLTGMSDSNDIRFLKPVSQP"
FT   gene            236546..239613
FT                   /gene="Pcdhb22"
FT                   /locus_tag="mCG_1033321"
FT                   /note="gene_id=mCG1033321.2"
FT   mRNA            236546..239613
FT                   /gene="Pcdhb22"
FT                   /locus_tag="mCG_1033321"
FT                   /product="protocadherin beta 22"
FT                   /note="gene_id=mCG1033321.2 transcript_id=mCT151025.2
FT                   created on 23-APR-2004"
FT   CDS             236675..239059
FT                   /codon_start=1
FT                   /gene="Pcdhb22"
FT                   /locus_tag="mCG_1033321"
FT                   /product="protocadherin beta 22"
FT                   /note="gene_id=mCG1033321.2 transcript_id=mCT151025.2
FT                   protein_id=mCP77954.2"
FT                   /db_xref="GOA:Q91XZ8"
FT                   /db_xref="InterPro:IPR002126"
FT                   /db_xref="InterPro:IPR013164"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR020894"
FT                   /db_xref="InterPro:IPR030733"
FT                   /db_xref="InterPro:IPR032455"
FT                   /db_xref="MGI:MGI:2136760"
FT                   /db_xref="UniProtKB/TrEMBL:Q91XZ8"
FT                   /protein_id="EDL10149.1"
FT                   /translation="MKIGREHRKRQVLLIFLLLGVVGAGSEPRRYFVMEETPSGTVLAD
FT                   LVQDLGLGVAELAARGAQVVSEEKESRLQLDLQTGKLILNEKLDREELCGSTEPCVTHF
FT                   QVLLKKPLEIFQAELRVGDINDHSPEFPEREMAVKIIENSPVGTAFLLKTAQDLDVGNN
FT                   SVQNYKIGTNSHFHVSIRNRGDGRKYPELVLDKELDREVQAAFRLTLTALDGGSPPRTG
FT                   TSQIRIVVLDVNDNAPEFAQAFYRVQIPENSPSGSMVAKVSAKDLDTGTNGEVSYSLFH
FT                   SSQEMSKTFELNALSGEVRLIKTLDFETTPSYELDIEATDGGGLSGKCSVSIQVVDVND
FT                   NYPELIISSLTNPIPENSPETEVALFRIRDRDSGENGRTICSIQDGVPFTLEPSVENFY
FT                   RLVTDGALDREIRAEYNITISVTDLGIPKLTTQHTITVQVSDINDNAPAFTQVSYTMLV
FT                   HENNSPALHIGTISATDSDSGSNAHITYSLLPAQEPQLALNSLISINADNGQLFALRAL
FT                   DYEALQAFEFHVSATDRGSPALSSQALVRIVVLDDNDNAPFVLYPMQNASAPCTELLPR
FT                   AAEPGYLVTKVVAVDRDSGQNAWLSFQLLKATEPGLFSVWAHNGEVRTTRLLSERDVPK
FT                   HRLLLVVKDNGEPPRSASVTLQVLMVDGFSQPYLPLPEVVRDPSHQEGDVLTLYLVIAL
FT                   ASVSSLFLLSVLLFVGVRLCRRAREVSLGGCSVPEGHFPGHLVDVSGAGTLSQSYQYEV
FT                   CLTGDSQSNEFKFLKPVFSGIVDQNYGRQPDDQSFSSVLGM"
FT   assembly_gap    258241..258260
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    262894..262913
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    273762..273781
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    290931..290950
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    298009..298028
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    308209..308228
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            324973..325833
FT                   /locus_tag="mCG_147296"
FT                   /note="gene_id=mCG147296.0"
FT   mRNA            join(324973..325075,325454..325833)
FT                   /locus_tag="mCG_147296"
FT                   /product="mCG147296"
FT                   /note="gene_id=mCG147296.0 transcript_id=mCT187559.0
FT                   created on 13-JAN-2004"
FT   CDS             join(325027..325075,325454..325548)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147296"
FT                   /product="mCG147296"
FT                   /note="gene_id=mCG147296.0 transcript_id=mCT187559.0
FT                   protein_id=mCP109684.0"
FT                   /protein_id="EDL10148.1"
FT                   /translation="MEPIGEDDEPEPRGAIIIWEEEPLLRKCLLLITYRQVCETFSCGT
FT                   FS"
FT   assembly_gap    336288..336307
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(336738..337942)
FT                   /locus_tag="mCG_1033320"
FT                   /note="gene_id=mCG1033320.1"
FT   mRNA            complement(336738..337942)
FT                   /locus_tag="mCG_1033320"
FT                   /product="mCG1033320"
FT                   /note="gene_id=mCG1033320.1 transcript_id=mCT151024.1
FT                   created on 16-OCT-2002"
FT   CDS             complement(337038..337835)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1033320"
FT                   /product="mCG1033320"
FT                   /note="gene_id=mCG1033320.1 transcript_id=mCT151024.1
FT                   protein_id=mCP77942.1"
FT                   /db_xref="GOA:Q99ML6"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="MGI:MGI:2137907"
FT                   /db_xref="UniProtKB/TrEMBL:Q99ML6"
FT                   /protein_id="EDL10147.1"
FT                   /translation="MQTFPQLYKGLADCFLKTYNQVGIRGLYRGTSPALLAYVTQGSVL
FT                   FMCFGFCQQFVRKVARVEQNAELNDLETATAGSLASAFAALALCPTELVKCRLQTMYEM
FT                   KMSGKIAQSYNTIWSMVKSIFMKDGPLGFYRGLSTTLAQEIPGYFFYFGGYEISRSFFA
FT                   SGGSKDELGPVPLMLSGGFAGICLWLIIFPVDCIKSRIQVLSMFGKPAGLIETFISVVR
FT                   NEGISALYSGLKATLIRAIPSNAALFLVYEYSRKMMMNMVEEY"
FT   gene            complement(341383..343513)
FT                   /gene="Taf7"
FT                   /locus_tag="mCG_133387"
FT                   /note="gene_id=mCG133387.0"
FT   mRNA            complement(join(341383..342893,343306..343513))
FT                   /gene="Taf7"
FT                   /locus_tag="mCG_133387"
FT                   /product="TAF7 RNA polymerase II, TATA box binding protein
FT                   (TBP)-associated factor"
FT                   /note="gene_id=mCG133387.0 transcript_id=mCT134753.0
FT                   created on 15-OCT-2002"
FT   CDS             complement(341848..342873)
FT                   /codon_start=1
FT                   /gene="Taf7"
FT                   /locus_tag="mCG_133387"
FT                   /product="TAF7 RNA polymerase II, TATA box binding protein
FT                   (TBP)-associated factor"
FT                   /note="gene_id=mCG133387.0 transcript_id=mCT134753.0
FT                   protein_id=mCP77549.1"
FT                   /protein_id="EDL10146.1"
FT                   /translation="MSKNKDDAPHELESQFILRLPPEYAATVRRAVQSGHVNLKDKLSI
FT                   ELHPDGRHGIVRVDRVPLAAKLVDLPCVTESLKTIDKKTFYKTADISQMLVATVDGDLY
FT                   PPVEEAAATADPKANKKKDKDKEKKFVWNHGITLPLKNVRKRRFRKTAKKKYIESPDVE
FT                   KEVKRLLSTDAEAVSTRWEIIAEDETKETENQGLDISSPGMSGHRQGHDSLEHDELREI
FT                   FNDLSSSSEDEEDVNILDTEEDLERQLQDKLNESDEQHQENEGTNQLVMGIQKQIDNMK
FT                   GKLQETQDRAKRQEDLIMKVENLALKNRFQAVLDELKQKEDREKEQLSSLQEELESLLE
FT                   K"
FT   gene            complement(351749..352312)
FT                   /pseudo
FT                   /locus_tag="mCG_133389"
FT                   /note="gene_id=mCG133389.0"
FT   mRNA            complement(351749..352312)
FT                   /pseudo
FT                   /locus_tag="mCG_133389"
FT                   /note="gene_id=mCG133389.0 transcript_id=mCT134755.0
FT                   created on 15-OCT-2002"
FT   gene            <355263..358064
FT                   /locus_tag="mCG_145145"
FT                   /note="gene_id=mCG145145.0"
FT   mRNA            join(<355263..356001,356008..356624,356645..358064)
FT                   /locus_tag="mCG_145145"
FT                   /product="mCG145145"
FT                   /note="gene_id=mCG145145.0 transcript_id=mCT184569.0
FT                   created on 05-JUN-2003"
FT   CDS             <356811..357248
FT                   /codon_start=1
FT                   /locus_tag="mCG_145145"
FT                   /product="mCG145145"
FT                   /note="gene_id=mCG145145.0 transcript_id=mCT184569.0
FT                   protein_id=mCP106256.0"
FT                   /protein_id="EDL10145.1"
FT                   /translation="FLFLPDQVTLHQESATVLCQQGQTAAVFLETTWKLVLSLIIRVWL
FT                   AQCHPEPPYWGGWLTQNTRSMLCQHLHKIRHCSAHCGACLPRDQSIHQLEAQELTALSH
FT                   ISDQLMWFFNLGTHTAKYVQHCSVSESEPTRAYVVDSHHVV"
FT   gene            <361336..552225
FT                   /locus_tag="mCG_133388"
FT                   /note="gene_id=mCG133388.1"
FT   mRNA            join(<361336..363756,535369..535427,543604..543692,
FT                   550253..552222)
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, transcript variant mCT174342"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174342.0
FT                   created on 14-OCT-2002"
FT   CDS             join(361336..363756,535369..535427,543604..543692,
FT                   550253..550479)
FT                   /codon_start=1
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, isoform CRA_t"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174342.0
FT                   protein_id=mCP97268.0 isoform=CRA_t"
FT                   /db_xref="GOA:Q91XZ0"
FT                   /db_xref="InterPro:IPR002126"
FT                   /db_xref="InterPro:IPR013164"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR020894"
FT                   /db_xref="InterPro:IPR030736"
FT                   /db_xref="InterPro:IPR031904"
FT                   /db_xref="InterPro:IPR032455"
FT                   /db_xref="MGI:MGI:1935212"
FT                   /db_xref="PDB:4ZI9"
FT                   /db_xref="PDB:5SZL"
FT                   /db_xref="UniProtKB/TrEMBL:Q91XZ0"
FT                   /protein_id="EDL10137.1"
FT                   /translation="MAIPEKLTGWSLLVLVCLSLELLLEAGAGNIRYSVPEETDKGSFV
FT                   GSIAKDLGLETRELMERGIRIVSRGRSQLFSLNPRSGSLVTAGRIDREELCAQSTPCVV
FT                   SFNILMEDEMKLLPIEVEIIDINDNTPQFQLEELELKMSEITTPGTRIPLPLGQDLDVG
FT                   INSLQSYQLSANPHFSLDVQQGPEGPQQPEMVLQRPLDREKDAVHYLVLTASDGGSPIH
FT                   SGTLQIHVQVVDVNDNPPAFTKAEYHVSVPENVPLGTRLLKVNATDPDEGANGRVTYSF
FT                   HKVDHSVVRKFQLDAYTGELSNKEPLDFEEYKVYPMEIQAQDGAGLMARAKVLVTVLDV
FT                   NDNAPEVGITSVTNTVPENFPPGTTIALISVHDQDADNNGHITCSIPGNLPFKLEKLVD
FT                   NYYRLVTERTLDREQSSRHNITITATDQGTPPLSTQAHISLLVTDINDNPPVFEQDSYS
FT                   VYIPENNPRGASIFSVKAQDADHNENALVTYALVEDTIQGVPLSSYFSINSDTGVVYAL
FT                   QSFDYEQFRDLQLRVMAHDSGNPQLSSNVSLSLFMIDQNDNAPEILYPVLPTDGSTGVE
FT                   LAPRSAEPGYLVTKVVAVDKDSGQNSWLSYRLLKASEPGLFSVGLHTGEVRTARALLER
FT                   DALKQSLVVAVQDHGQPPLSTTVTFTIAVADSIPDLLADLGSMGTPADPQDSDLTLYLV
FT                   VAVAVVSCIFLAFVIVLLVLKLRHWYSSRLLQTEANGLTGLPASNFVGVDGVHAFLQTY
FT                   SREISLTADSRKSHLIFPQPNYADTLISHESCEKQEFLSAPQSLLEDKEEIFSQQAPPN
FT                   TDWRFSQAQRPGTSGSQNGDETGTWPNNQFDTEMLQAMILASASEAADGSSTLGGGAGT
FT                   MGLSARYGPQFTLQHVPDYRQNVYIPGSNATLTNAAGKRDGKAPAGGNGNKKKSGKKEK
FT                   K"
FT   mRNA            join(<368497..370917,535369..535427,543604..543692,
FT                   550253..552222)
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, transcript variant mCT174335"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174335.0
FT                   created on 14-OCT-2002"
FT   CDS             join(368497..370917,535369..535427,543604..543692,
FT                   550253..550479)
FT                   /codon_start=1
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, isoform CRA_c"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174335.0
FT                   protein_id=mCP97257.0 isoform=CRA_c"
FT                   /db_xref="GOA:Q91XY6"
FT                   /db_xref="InterPro:IPR002126"
FT                   /db_xref="InterPro:IPR013164"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR020894"
FT                   /db_xref="InterPro:IPR030725"
FT                   /db_xref="InterPro:IPR031904"
FT                   /db_xref="InterPro:IPR032455"
FT                   /db_xref="MGI:MGI:1935214"
FT                   /db_xref="UniProtKB/TrEMBL:Q91XY6"
FT                   /protein_id="EDL10120.1"
FT                   /translation="MATLQKLPQSRMLVLLCALWAALWEAKAGQIRYSVPEEIDKGSFV
FT                   GSIAKDLGLEPQALEERGVRIVSRGKSQLFALNPRSGSLVTAGRIDREELCAQSTPCLV
FT                   NFNLLLEDKLTIYSVEVEVTDVNDNAPRFGVEDPELKISETTTPGFRIPLKSAHDADVG
FT                   ENTLQKYKLNSNDHFSLDVRTGADGNKYPELVLERALDREEEAVHHLVLVASDGGNPVR
FT                   SGTCRIRVKVLDANDNAPAFTQAEYRVRVPENTPVGTRILTVTATDADEGYNAQVTYFQ
FT                   EHDPGETTDAFELKSTSGDITITKSLDYEKAKFHEIDIEAQDGPGLLTRTKVIVTVLDV
FT                   NDNAPEFYMTSATASVPEDAPLGTVIALFNVHDRDSGQNAVVTCSLPEMLPFKLERSVD
FT                   SYYRLVTTRALDREQFSFYNITVSAKDGGSPSLSTDAHLLLQVADINDNPPSFPRRVYS
FT                   AYIPENNPRGTSIFSVLASDPDSNDNAHVTYSLAEDSFQGAPLSSYVSINSDTGVLYAL
FT                   RSFDYEQFQDLQLWVIAADSGNPPLSSNVSLSLFLVDQNDNTPEILYPALPTDGSTGVE
FT                   LAPRSADPGYLVTKVVAVDKDSGQNAWLSYRLLKASEPGLFSVGLHTGEVRTARALLDR
FT                   DALKQSLVVAVQDHGQPPLSATVTLTIAIADNIPEVLADLGSIRTPANPDDSELTLYLV
FT                   VAVAVVSCVFLAFVIALLALRLRRWHLSRMLQASRDGLGGIPASHFVGVDGVRAFLQTY
FT                   SHEVSLTADSGKSHIIFPQPNYADTLISQESCEKTDFLSAPQSLLDDKREETPQQAPPN
FT                   TDWRFSQAQRPGTSGSQNGDETGTWPNNQFDTEMLQAMILASASEAADGSSTLGGGAGT
FT                   MGLSARYGPQFTLQHVPDYRQNVYIPGSNATLTNAAGKRDGKAPAGGNGNKKKSGKKEK
FT                   K"
FT   mRNA            join(<373886..374708,386834..387318,535369..535427,
FT                   543604..543692,550253..552222)
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, transcript variant mCT174345"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174345.0
FT                   created on 14-OCT-2002"
FT   CDS             373886..374389
FT                   /codon_start=1
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, isoform CRA_v"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174345.0
FT                   protein_id=mCP97263.0 isoform=CRA_v"
FT                   /protein_id="EDL10139.1"
FT                   /translation="MIRLGQGTAGALLCALLGTVCAAGFRQIRYSVPEELDKGSFVGNI
FT                   SKDLGLEPRELAVRGVRIISRGKSQLFSLDPRSGSLVTGGRIDREELCAQSAPCLVSFN
FT                   ILVEDKLKIFEVEVDITDINDNAPSFPTEELEIKIGELTDPGTRFPLKTAFDPGCGHER
FT                   PAEL"
FT   assembly_gap    374709..378048
FT                   /estimated_length=3340
FT                   /gap_type="unknown"
FT   assembly_gap    380058..380898
FT                   /estimated_length=841
FT                   /gap_type="unknown"
FT   mRNA            join(<380899..382770,535369..535427,543604..543692,
FT                   550253..552222)
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, transcript variant mCT174337"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174337.0
FT                   created on 14-OCT-2002"
FT   CDS             join(<380899..382770,535369..535427,543604..543692,
FT                   550253..550479)
FT                   /codon_start=1
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, isoform CRA_d"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174337.0
FT                   protein_id=mCP97254.0 isoform=CRA_d"
FT                   /protein_id="EDL10121.1"
FT                   /translation="KESPDGSKYPELLLENPLDREHQSSHHLILTAMDGGDPPLSSTTQ
FT                   VWIKVTDANDNAPVFSQDTYKVSLRENIPPGTLVLQVTATDQDESIHGEITYAFLNAPA
FT                   STNLVFNLNPNTGAITTNGTLDFEEKNRYTLGVEAKDGGVHTAHCNVQIEILDDNDNAP
FT                   EVTFMSFSNQVPEDSVLGTVIALIKVRDKDSGQNGLVACHIQEELPFKLQPTSKNYYKL
FT                   VIDKALNREQTPEYNVTITATDSGKPSLSSKTCVTVHITDINDNAPVFHQASYLVHVAE
FT                   NNPPGASIAQVSASDPDLGSNGLISYSIIASDLEPRALSSFVSVNQDSGVVFAQRAFDH
FT                   EQLRSFQLTLQARDHGSPTLSANVSMRVLVGDRNDNAPRVLYPTLEPDGSALFDMVPRA
FT                   AEPGYLVTKVVAVDADSGHNAWLSYHVLQASDPGLFSLGLRTGEVRTARALGDRDSARQ
FT                   RLLVAVRDGGQPPLSATATLHLIFADSLQEVLPDLSDDPLPSDPQSELQFYLVVALALI
FT                   SVLFLLSVILAIALRLRHSSRSAAWGCFQPGLSLKSQPVVPPNYSEGTLPYSYNLCVAS
FT                   HSMTMAGFNFHHVAPEVAPPQDLLCDDLSVVVCGNNEDPQVSDDSAFQQAPPNTDWRFS
FT                   QAQRPGTSGSQNGDETGTWPNNQFDTEMLQAMILASASEAADGSSTLGGGAGTMGLSAR
FT                   YGPQFTLQHVPDYRQNVYIPGSNATLTNAAGKRDGKAPAGGNGNKKKSGKKEKK"
FT   mRNA            join(<385331..387748,535369..535427,543604..543692,
FT                   550253..552222)
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, transcript variant mCT174339"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174339.0
FT                   created on 14-OCT-2002"
FT   CDS             join(385331..387748,535369..535427,543604..543692,
FT                   550253..550479)
FT                   /codon_start=1
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, isoform CRA_e"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174339.0
FT                   protein_id=mCP97276.0 isoform=CRA_e"
FT                   /protein_id="EDL10122.1"
FT                   /translation="MAAPYKSDRRGLIWICIFLGSLCDIRAEQIRYSVPEELERGSVVG
FT                   NLAADLGLEPGKLAERGVRIVSRGKTQLFALNPRSGSLVTAGRVDREGLCDRSPKCTAN
FT                   LEILLEDKVRILAIEVEIIDVNDNAPSFGAQQREIKVAESENPGTRFPLPEAFDLDIGV
FT                   NALQGYQLSSNDHFSLDVQSGPDGIKYPELVLENALDREEEAVHHLVLTAFDGGDPVRS
FT                   GTATIQVTLVDTNDNAPVFTQPEYHISVKENLPVGTRLLTIKATDPDEGANGEVTYSFR
FT                   NVREKISQLFQLNSLTGDITVLGELDYEDSGFYDVDVEAHDGPGLRARSKVLVTVLDVN
FT                   DNAPEVTVTSLTSSIQEASSPGTVIALFNVHDSDSGENGLVTCSIPDNLPFRLEKTYGN
FT                   YHRLLIHRTLDREEVSDYNITITATDQGTPPLSTETYISLQVVDINDNPPTFTHASYSA
FT                   YIPENNPRGASILSITAQDPDSGENAQVIYSLSEDTIQGAPLSSYVSINSNTGVLYALR
FT                   SFDYEQFQDLKLLVTARDSGTPPLSSNVSLSLFVLDQNDNIPEILYPTIPTDGSTGVEL
FT                   TPRSADPGYLVTKVVAVDKDSGQNAWLSYRLLKASEPGLFSVGLHTGEVRTARALLDRD
FT                   ALKQSLVVTVQDHGQPPLSATVTLTIAVSDNIPDILADLVNINAPIDQEDSDITLYLVV
FT                   AVAAVSCVFLAFVIVLLIHRLRRWHSTRLLQAAGNGLSSLPASHFVGVDGVHAFLQTYS
FT                   HEVSLTADSGKSHLIFPQPNYADTLISQESCGKSDPLLVSQDLLEIKGDSSLQQAPPNT
FT                   DWRFSQAQRPGTSGSQNGDETGTWPNNQFDTEMLQAMILASASEAADGSSTLGGGAGTM
FT                   GLSARYGPQFTLQHVPDYRQNVYIPGSNATLTNAAGKRDGKAPAGGNGNKKKSGKKEKK
FT                   "
FT   mRNA            join(<389903..392314,535369..535427,543604..543692,
FT                   550253..552222)
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, transcript variant mCT174340"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174340.0
FT                   created on 14-OCT-2002"
FT   CDS             join(389903..392314,535369..535427,543604..543692,
FT                   550253..550479)
FT                   /codon_start=1
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, isoform CRA_s"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174340.0
FT                   protein_id=mCP97272.0 isoform=CRA_s"
FT                   /protein_id="EDL10136.1"
FT                   /translation="MRRGSGSGPAWWLQVLSPFLLLLFHGALADQIRYSIPEELAKNSI
FT                   VGNLARDLGLSVQNLPTRKLRVSAEKDYFTVNPESGDLLVGDRIDREQVCGKQPQCVLE
FT                   FDIVAEKPLNIFHVAVILQDVNDNAPLFKQSEVDLNIGESARPGKAFPLDPALDLDAGS
FT                   NSLQKYYLTDNEYFEVTEKETPDGRKYPELILKRFLDREEHNFHQLVLTAVDGGDPPRS
FT                   GTTQIRIQVTDINDNPPMFSQDVFSVTLREDVPPGFSVLQVTATDQDEGVNAEITYAFH
FT                   NVDEQVERIFNLDKRTGEITTKDNLDFETAKSYTLNVEAKDPGDLASHCSIQVKILDEN
FT                   DCVPEVIVTSVFTPLPEDSPLGTVIALIKTRDRDSGENGDVYCHVLGNEGFVLKSSSKN
FT                   YYKLVTDRTLDREAIPEYNVTIVAADRGKPPLSSNVIITLHISDVNDNAPVFHQASYLV
FT                   HVAENNPPGTSIAQVSASDPDLGSNGLISYSIIASDLEPRALSSFVSVNQDSGVVFAQR
FT                   AFDHEQLRSFQLTLQARDHGSPTLSANVSMHVLVGDRNDNAPRVLYPTLEPDGSALFDM
FT                   VPRAAEPGYLVTKVVAVDADSGHNAWLSYHVLQASDPGLFSLGLRTGEVRTARALGDRD
FT                   SARQRLLVAVRDGGQPPLSATATLHLIFADSLQEVLPDLSDDPLPSDPQSELQFYLVVA
FT                   LALISVLFLLSVILAIALRLRHSSRSAAWGCFQPGLSSNLATGVLPNYNEGTLPYSYNV
FT                   CIASQSAKTEFNFLNVTPEVAPQDLLCGDDSWVPGTLGDTDVPFVSDSISKQAPPNTDW
FT                   RFSQAQRPGTSGSQNGDETGTWPNNQFDTEMLQAMILASASEAADGSSTLGGGAGTMGL
FT                   SARYGPQFTLQHVPDYRQNVYIPGSNATLTNAAGKRDGKAPAGGNGNKKKSGKKEKK"
FT   mRNA            join(<389945..392154,543604..543692,550253..552222)
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, transcript variant mCT174346"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174346.0
FT                   created on 14-OCT-2002"
FT   CDS             join(<389945..392154,543604)
FT                   /codon_start=1
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, isoform CRA_h"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174346.0
FT                   protein_id=mCP97273.0 isoform=CRA_h"
FT                   /protein_id="EDL10125.1"
FT                   /translation="VLSPFLLLLFHGALADQIRYSIPEELAKNSIVGNLARDLGLSVQN
FT                   LPTRKLRVSAEKDYFTVNPESGDLLVGDRIDREQVCGKQPQCVLEFDIVAEKPLNIFHV
FT                   AVILQDVNDNAPLFKQSEVDLNIGESARPGKAFPLDPALDLDAGSNSLQKYYLTDNEYF
FT                   EVTEKETPDGRKYPELILKRFLDREEHNFHQLVLTAVDGGDPPRSGTTQIRIQVTDIND
FT                   NPPMFSQDVFSVTLREDVPPGFSVLQVTATDQDEGVNAEITYAFHNVDEQVERIFNLDK
FT                   RTGEITTKDNLDFETAKSYTLNVEAKDPGDLASHCSIQVKILDENDCVPEVIVTSVFTP
FT                   LPEDSPLGTVIALIKTRDRDSGENGDVYCHVLGNEGFVLKSSSKNYYKLVTDRTLDREA
FT                   IPEYNVTIVAADRGKPPLSSNVIITLHISDVNDNAPVFHQASYLVHVAENNPPGTSIAQ
FT                   VSASDPDLGSNGLISYSIIASDLEPRALSSFVSVNQDSGVVFAQRAFDHEQLRSFQLTL
FT                   QARDHGSPTLSANVSMHVLVGDRNDNAPRVLYPTLEPDGSALFDMVPRAAEPGYLVTKV
FT                   VAVDADSGHNAWLSYHVLQASDPGLFSLGLRTGEVRTARALGDRDSARQRLLVAVRDGG
FT                   QPPLSATATLHLIFADSLQEVLPDLSDDPLPSDPQSELQFYLVVALALISVLFLLSVIL
FT                   AIALRLRHSSRSAAWGCFQPGLSSNLATGVLPNYNEGTLPYS"
FT   mRNA            join(<394439..396862,535369..535427,543604..543692,
FT                   550253..552222)
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, transcript variant mCT174350"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174350.0
FT                   created on 14-OCT-2002"
FT   CDS             join(394439..396862,535369..535427,543604..543692,
FT                   550253..550479)
FT                   /codon_start=1
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, isoform CRA_w"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174350.0
FT                   protein_id=mCP97267.0 isoform=CRA_w"
FT                   /db_xref="GOA:Q91XY3"
FT                   /db_xref="InterPro:IPR002126"
FT                   /db_xref="InterPro:IPR013164"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR020894"
FT                   /db_xref="InterPro:IPR031904"
FT                   /db_xref="InterPro:IPR032455"
FT                   /db_xref="MGI:MGI:1935217"
FT                   /db_xref="UniProtKB/TrEMBL:Q91XY3"
FT                   /protein_id="EDL10140.1"
FT                   /translation="MADPPRRWICNDLLTFFMLLGTLCAPGKGQIRYSVREELDKGSFV
FT                   GNISKDLGLEPRELAERGVRIISRGRSQLFSLNPRGGSLVTAGRIDREELCVQSSPCLV
FT                   SFNILVENKMKIYGVEVEILDINDNFPRFRDEELKVKVNENAAAGTRLVLPFARDGDVG
FT                   VNSLQGYKLSSNRHFSLDVKSGSDGQKHPELVLEQPLDREKESAHDLVLTALDGGNPVL
FT                   SSTVHISVTVLDANDNAPLFTQSEYRVSVPENTPVGTRLLTLTATDADEGINAKLTFSF
FT                   RNEEDKISETFQLDSNLGEISTIQSLDYEESRFYLMEVVAQDGGALLASAKVLVTVQDV
FT                   NDNAPEVILTSLTSSVSEDCLPGTIIALFSVHDADSGENGEISCSIPKNLPFKLEKSVD
FT                   NYYHLLTTRALDREETSDYNITVTVVDRGTPPLSTENHISLKVADINDNPPTFSRPFYS
FT                   TSISENNPRGVSIFSVYAYDADSGDNAQVTYSLAENTFQEVPVSSYVSINSDTGVLYAL
FT                   QSFDYEHLRDLQLLVTAKDSGTPPLSSNVSMSLFVLDQNDNIPEILYPTIPTDGSTGVE
FT                   LAPRSAEPGYLVTKVVAVDKDSGQNAWLSYRLLKASEPGLFSIGLHTGEVCTARALLDR
FT                   DVLKQSLVVAVQDHGQPPLSATVTLTIAVGDSIPDVLTDLGNHNTLAEPQDSDLTLYLV
FT                   VSVAVVSCVFLGFVTVLLALRLRHWHMSRLLQTSTGRLADMPASHFVGMDGVQAYLQTY
FT                   SHEISLTTDSKKSHLIFPQPNYADRLISEESCEKSEPLLIPHNIHTHKEEPGDAQQAPP
FT                   NTDWRFSQAQRPGTSGSQNGDETGTWPNNQFDTEMLQAMILASASEAADGSSTLGGGAG
FT                   TMGLSARYGPQFTLQHVPDYRQNVYIPGSNATLTNAAGKRDGKAPAGGNGNKKKSGKKE
FT                   KK"
FT   mRNA            join(<407171..409594,535369..535427,543604..543692,
FT                   550253..552222)
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, transcript variant mCT174351"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174351.0
FT                   created on 14-OCT-2002"
FT   CDS             join(407171..409594,535369..535427,543604..543692,
FT                   550253..550479)
FT                   /codon_start=1
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, isoform CRA_z"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174351.0
FT                   protein_id=mCP97260.0 isoform=CRA_z"
FT                   /protein_id="EDL10143.1"
FT                   /translation="MAALQRRPPCCELLLLLNLLWWLWGSEAGQLRYSIPEEVEKGSFV
FT                   GSIAKDLGLQPRELAERGIRIISRGRSQLFSLNQRSGSLVTAGRIDREELCAQSAPCLV
FT                   SFNILIEDKLNLYPVEVEIVDINDNAPRFLKEEMELKILENAALSSHFLLMDVYDPDVG
FT                   VNSIQGFKLSGSSHFSVHVQSQDHGPKYPELVLEHSLDREEEAVHHLVLVAMDGGDPVR
FT                   TGMARILVTVVDVNDNAPVFTQPIYRVSVPENLPVGTRVLTVNATDQDEGVHAEIRYSF
FT                   VRITEEISRIFCLDPFTGEISTSGTLDYENSRFYELDVEARDQPGLQDRAKVLITILDM
FT                   NDNAPEVVVTSGSRAIAENAPPGTIIALFQVYDKDSERNGLVICSISESLPFKLEESLD
FT                   NYFRLMTNTELDREQVSSYNITVTATDRGTPPLSTKIFISLDVADINDNPPVFSRSSYS
FT                   VYVSENNPKGVSIFSLNAVDPDSEENAEIIYSLAKETLQGTPLSSFLSINSITGVLYAL
FT                   CSFDYEQFRELNLLVTASDRGKPPLSSNVSLNLFVLDQNDNVPEILYPVLPTDGSTGVE
FT                   LAPRSAEPGYLVTKVVAVDKDSGQNAWLSYRLIKASEPGLFSVGLHTGEVRTARVLLDR
FT                   DALKQSLVVAVQDHGQPPLSATVTLTVAVASSIPDILADLGSLDLPHKSEDSSLTIYLV
FT                   VAVATVSCIFFAFVMGLLVLRLWHWHKSRLLKATRKGVSNMSTSHFVGIDGVQAFLQTY
FT                   SHEVSLTADSRKSHLIFPQPNYAHTLISQEGCEKNEPLLIQEDSAFCKEEDSLDQQAPP
FT                   NTDWRFSQAQRPGTSGSQNGDETGTWPNNQFDTEMLQAMILASASEAADGSSTLGGGAG
FT                   TMGLSARYGPQFTLQHVPDYRQNVYIPGSNATLTNAAGKRDGKAPAGGNGNKKKSGKKE
FT                   KK"
FT   mRNA            join(<414879..417311,535369..535427,543604..543692,
FT                   550253..552222)
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, transcript variant mCT174352"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174352.0
FT                   created on 14-OCT-2002"
FT   CDS             join(414879..417311,535369..535427,543604..543692,
FT                   550253..550479)
FT                   /codon_start=1
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, isoform CRA_l"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174352.0
FT                   protein_id=mCP97258.0 isoform=CRA_l"
FT                   /protein_id="EDL10129.1"
FT                   /translation="MAPEQRGWGSHYRGFVLLSILLGMRWEAWAGQILYSVSEETDKGS
FT                   FVGNITKDLGLQPRELAERGVRIITKGKTQLFSLNPRSGSLVTAGRIDREELCAQSPRC
FT                   LVSFNILIEDKMNLYPIEVEIMDVNDNAPRFLTEEINIKIMENAAPGVRFPLKEATDSD
FT                   VGKNSLQRYQLSPNHHFSLVVQSGDDGTKYPELVLEKALDREEEGLHHLVLTAYDGGDP
FT                   LRSGTASIRVTVVDVNDHMPVFSLPRYQATVPENVPVGTRLLTINAIDLDEGVNGEVTY
FT                   SFWKITPELLQIFHLSSLTGELSTLKGLDYEQSSYYELEVQAQDGAGSLTKAKVLITVL
FT                   DVNDNAPEVTVTSVSSPVPEDTPPGTVIALFYLQDKDSGKNGEVTCSLPENLPFKLEQS
FT                   IDNYYRLVTARNLDREKMSVYNITLKATDGGIPPLSTETRMSIHVSDTNDNPPTFSDSS
FT                   YSIYVPENNPRGASIFSVTAQDPDSDKNAQVTYALAEDTIQGVPVSSYVSINSDTGILY
FT                   ALGSFDYEQFRDLQLRVTARDSGDPPLSSNVSLKLFVLDKNDNAPEILYPALPTDGSTG
FT                   VELAPRSAEPGYLVTKVVAVDKDSGPNAWLSYRLLKASEPGLFSVGLHTGEVRTARALL
FT                   DRDALKQNLVVVVQDHGQPPLSATVTLTVAVANSIPDVLADLGSIRTPSEPDDSDITLY
FT                   LVVAVATVSCVFLVFVTVLLALRLWRWHKSHMLQASSGGGLEDVPASHFVGLDGVQAFL
FT                   QTYSHEVSLTADSRKSHIIFPQPNYVDTLISQDSCEKSDSLLTSIDFQECKGEAPSSQQ
FT                   APPNTDWRFSQAQRPGTSGSQNGDETGTWPNNQFDTEMLQAMILASASEAADGSSTLGG
FT                   GAGTMGLSARYGPQFTLQHVPDYRQNVYIPGSNATLTNAAGKRDGKAPAGGNGNKKKSG
FT                   KKEKK"
FT   mRNA            join(<420493..422856,535369..535427,543604..543692,
FT                   550253..552222)
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, transcript variant mCT174344"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174344.0
FT                   created on 14-OCT-2002"
FT   CDS             join(420493..422856,535369..535427,543604..543692,
FT                   550253..550479)
FT                   /codon_start=1
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, isoform CRA_u"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174344.0
FT                   protein_id=mCP97271.0 isoform=CRA_u"
FT                   /protein_id="EDL10138.1"
FT                   /translation="MREGTAERGRGQRRPMLLPFLLPLFCPTLSEQIRYKIPEEMPTGS
FT                   VVGNLAKDLGFSVQELPTRKLRISSEKPYFSVSSESGELLVSSRLDREQICGKKLVCAL
FT                   EFEAVAENPLNFYHLSVELEDINDHTPKFAHTSFELQISESSKPGTRFILGSAHDADIG
FT                   TNSLQNYQLSPNDHFSLVNKEKSDGSKYPEMILKTALDREKQKLYHLTLTALDFGHPPL
FT                   NSTAQIQVLVTDANDNPPVFSQDIYRVSLPENVYPGTTVLRVVATDQDEGVNSEITFSF
FT                   SEAGQVTQFNLDSNTGEITTLHTLDFEEVKEYSLVLEAKDGGGMIAQCTVEIEVLDEND
FT                   NVPEVLFQSLPDLIMEDAEPGTYIALLKTRDKDSGRNGEVICKLEGGAPFKILTSSGNT
FT                   YKLVTDGVLDREQNPEYNITIRATDKGDPPLSSSSSVTLHIGDVNDNAPVFTKVSYLVH
FT                   VAENNPPGASIAQVSASDPDLGANGQVTYYIIASDLEPESLWSYVTINAQSGVLFAQRA
FT                   FDHEQLRSFQLTLQARDHGSPTLSANVSMRLLVGDRNDNAPRVLYPTLEPDGSALFDMV
FT                   PRSAEPGYLVTKVVAVDADSGHNAWLSYHVLQASDPGLFSLGLRTGEVRTARALGDRDS
FT                   ARQRLLVAVRDGGQPPLSATATLHLIFADSLQEVLPDLSDDPLPPDPQSELQFYLVVAL
FT                   ALISVLFLLAVILAIALRLRHSSSRKAWGCFQSEVVVPPNYSEGTLPYSYNLCAAEFNS
FT                   LTCNDQLKSGQDLQFADSAGALFPLCNSNESTSHQQAPPNTDWRFSQAQRPGTSGSQNG
FT                   DETGTWPNNQFDTEMLQAMILASASEAADGSSTLGGGAGTMGLSARYGPQFTLQHVPDY
FT                   RQNVYIPGSNATLTNAAGKRDGKAPAGGNGNKKKSGKKEKK"
FT   mRNA            join(<425836..428259,535369..535427,543604..543692,
FT                   550253..552222)
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, transcript variant mCT174353"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174353.0
FT                   created on 14-OCT-2002"
FT   CDS             join(425836..428259,535369..535427,543604..543692,
FT                   550253..550479)
FT                   /codon_start=1
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, isoform CRA_m"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174353.0
FT                   protein_id=mCP97255.0 isoform=CRA_m"
FT                   /db_xref="GOA:Q91XY0"
FT                   /db_xref="InterPro:IPR002126"
FT                   /db_xref="InterPro:IPR013164"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR020894"
FT                   /db_xref="InterPro:IPR031904"
FT                   /db_xref="InterPro:IPR032455"
FT                   /db_xref="MGI:MGI:1935221"
FT                   /db_xref="PDB:4ZPS"
FT                   /db_xref="PDB:5SZM"
FT                   /db_xref="UniProtKB/TrEMBL:Q91XY0"
FT                   /protein_id="EDL10130.1"
FT                   /translation="MAASKNQHRHGRLVLLCTLMGTLCKISVGQIRYSVPEETDKGTVV
FT                   GNISKDLGLEPRELAERGVRIVSRGRSQLFSLNPRGGSLVTAGRIDREELCAQSTPCLV
FT                   NINILVEEKGKLFGVEIEITDINDNNPKFHVGDLEVKINEIAAPGARYPLPEAVDPDVG
FT                   INSLQSYQLSPNRHFSLHLQTGDDGTINPELVLERTLDREEEPTHHLVLTASDGGEPRR
FT                   SSTALIQITVLDTNDNAPVFDQPVYRVKVLENVAPGTLLLTVRASDPDEGVNGKVTYKF
FT                   RKINEKQSLLFHLHENTGEMTVAKNLDYEECSLYEMEIQAEDVGALLGRSKVIIMVEDV
FT                   NDNRPEVTITSLFNPVLENSLPGTVIAFLNVHDQDSGKNGQVVCYTHDNLPFKLEKSID
FT                   NYYRLVTWKYLDREKVSTYNITVIASDLGAPPLSTETYIALTVADTNDNPPRFSHTSYT
FT                   AYLPENNLRGASIFSLTAHDPDSQENAQVTYSVSEDTIQGVPLSSYISINSDTGILYAL
FT                   QSFDFEKIQDLQLLVIATDSGSPPLSSNVSLSLFVLDQNDNAPEILYPSFPTDGSTGVE
FT                   LAPRSAEPGYLVTKVVAVDKDSGQNAWLSYRLLKASEPGLFSVGLHTGEVRTARALLDR
FT                   DALKQNLVMAVQDHGQPPLSATVTLTVAVANSIPEVLADLSSIMTPEVPEDSDLTLHLV
FT                   VAVAVVSCVFLVFVIVLLALRLQRWQKSRQLQGSRSGLAPAPPSHFVGIDGVQAFLQTY
FT                   SHEVSLTSGSQTSHIIFPQPNYADMLINQESCEKNDSLLTSIDFHENKDEDACAPQAPP
FT                   NTDWRFSQAQRPGTSGSQNGDETGTWPNNQFDTEMLQAMILASASEAADGSSTLGGGAG
FT                   TMGLSARYGPQFTLQHVPDYRQNVYIPGSNATLTNAAGKRDGKAPAGGNGNKKKSGKKE
FT                   KK"
FT   mRNA            join(<431097..433502,535369..535427,543604..543692,
FT                   550253..552222)
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, transcript variant mCT174343"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174343.0
FT                   created on 14-OCT-2002"
FT   CDS             join(431097..433502,535369..535427,543604..543692,
FT                   550253..550479)
FT                   /codon_start=1
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, isoform CRA_g"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174343.0
FT                   protein_id=mCP97262.0 isoform=CRA_g"
FT                   /protein_id="EDL10124.1"
FT                   /translation="MWEGTAERGRGQRRPMLLPFLLPLFCPALSEQIRYKIPEEMPTGS
FT                   VVGNLAKDLGFSVQELPTRKLRISSKKPYFSVSSESGELLVSSRLDREQICGKKLMCAL
FT                   EFEAVAENPLNFYHLSVELEDINDHTPKFAHTSTELQISESAQPGTRFILEVAEDADVA
FT                   LNSLQNYKLSPSPVFSMVNKEKQDGRKYPELVLEKTLDREQQNYYRLVLTALDGGDPPL
FT                   SGTTELRIQVTDANDNPPVFNQEVYKVRLPENVPPGTTVLRVTATDKDEGVNSEISYSL
FT                   HRAGQVFGLNSKSGEITTQTTLDFEEIKEYSLVVEARDGGGLVAQCTVEINIQDENDNR
FT                   PEITVDSLLETILENAETGTLIALIKIHDGDSGENGEVNCRLDGEVPFKIISSSKNSYK
FT                   LVTDRALDRELTPEYNVTITATDRGKPPLSSSTKVTLHVGDVNDNAPLFHQASYLVYIA
FT                   ENNPPGASIAQVSASDLDLGSNGHVSYSIIASDLEPKSLWSYVTVNAQSGVVFAQRAFD
FT                   HEQLRSFQLTLQARDQGSPSLSANVSMRVLVGDRNDNAPRVLYPTLEPDGSALFDMVPR
FT                   AAEPGYLVTKVVAVDADSGHNAWLSYHVLQASDPGLFSLGLRTGEVRTARALGEKDAAR
FT                   QRLLVGVRDGGQPPLSATATLLLVFADSLQEALPDLSDRSLPPDPQAELQFYLVVALAL
FT                   VSVLFLLAVILAIALRLRHSSSPSVWNCFQPGFCSESKPVVFPNYSEGTLPYSYNLYGA
FT                   HAGKTECNFLKCSEPLSSGQGLLCPESSGALFPLCDSSEPTSHPEPLTPQAPPNTDWRF
FT                   SQAQRPGTSGSQNGDETGTWPNNQFDTEMLQAMILASASEAADGSSTLGGGAGTMGLSA
FT                   RYGPQFTLQHVPDYRQNVYIPGSNATLTNAAGKRDGKAPAGGNGNKKKSGKKEKK"
FT   mRNA            join(<437062..439485,535369..535427,543604..543692,
FT                   550253..552222)
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, transcript variant mCT174354"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174354.0
FT                   created on 14-OCT-2002"
FT   CDS             join(437062..439485,535369..535427,543604..543692,
FT                   550253..550479)
FT                   /codon_start=1
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, isoform CRA_x"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174354.0
FT                   protein_id=mCP97253.0 isoform=CRA_x"
FT                   /protein_id="EDL10141.1"
FT                   /translation="MAAAPARRPHCRELVVLCALLGMLWEARAGQIRYSVPEETEKGYI
FT                   VGNISKDLGLEPRELAERGVRIVSKGKTQLFSLSPRSGSLVTAGRIDREELCAQSAPCL
FT                   LSFKVLVEDRVKLYGVEVEVVDINDNAPKFEAKNLVVKISEIAAPGARYPLPEAVDPDV
FT                   GINSLQSYQLSPNHHFSLHLQTGDDGTINPELVLERTLDREEEPTHHLVLTAYDGGNPR
FT                   RSSTALIQVTVLDTNDNAPVFDQPVYRVKVLENVAPGTLLLTVRASDPDEGANGKVTYK
FT                   FRKINEKHSLLFHLHENTGEMTVAKNLDYEECSLYEMEIQAEDGGGLKGRTKVVVMVED
FT                   VNDNRPEVTITSLFSPVREDAPPGTVILLFNAHDQDSGKNGQVVCSIQENPSFKLENSV
FT                   DDYYRLLTAQILDREKASEYNITVTATDRGTPSMSTEVHITLYVADINDNPPAFSQTSY
FT                   SVYLPENNPRGTSIFSVSAHDPDDEENAKVTYSLVENTIQGAPLSSYVSINSDTGVLYA
FT                   LQSFDYEQFQNLQMQVKASDNGHPPLSSNVSLSVFLLDQNDNAPKILYPSLPTDGSTGV
FT                   ELAPRSAEAGYLVTKVVAVDKDSGQNAWLSYRLLKASEPGLFTVGLRSGEIRTARALLE
FT                   RDALKQSLVVAVQDHGQPPLSATITLTVAVADSIPDILADLGSINTPADPDSDITLYLV
FT                   VAVAVVSCIFLLFVLVLLALRLRRWHASHLLQDAMGGSTGVPTSHIVGVHGVQTFLQTY
FT                   SQEFSLTPDSGKSHLIFPQPNYADTLISQESCGKSEPLCSSVEPKFPIDDTPLVPQAPP
FT                   NTDWRFSQAQRPGTSGSQNGDETGTWPNNQFDTEMLQAMILASASEAADGSSTLGGGAG
FT                   TMGLSARYGPQFTLQHVPDYRQNVYIPGSNATLTNAAGKRDGKAPAGGNGNKKKSGKKE
FT                   KK"
FT   mRNA            join(<442183..444600,535369..535427,543604..543692,
FT                   550253..552222)
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, transcript variant mCT174355"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174355.0
FT                   created on 14-OCT-2002"
FT   CDS             join(442183..444600,535369..535427,543604..543692,
FT                   550253..550479)
FT                   /codon_start=1
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, isoform CRA_n"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174355.0
FT                   protein_id=mCP97274.0 isoform=CRA_n"
FT                   /db_xref="GOA:Q91XX4"
FT                   /db_xref="InterPro:IPR002126"
FT                   /db_xref="InterPro:IPR013164"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR020894"
FT                   /db_xref="InterPro:IPR031904"
FT                   /db_xref="InterPro:IPR032455"
FT                   /db_xref="MGI:MGI:1935197"
FT                   /db_xref="UniProtKB/TrEMBL:Q91XX4"
FT                   /protein_id="EDL10131.1"
FT                   /translation="MGGSSARRKRPDRPQVLFTLLLPLFCPALGQPVRYSIPEELDRGS
FT                   VVGKLAKDLGLSVLEVSSRKLRVSAEKLHFSVDSESGDLLVKDRIDREQICKGRRKCEL
FT                   QLEAVLENPLNIFHVVVGIEDVNDNAPQFEKKETRLEILETVAVGTRIPLEPATDPDIN
FT                   LNSVKDYQISSNPYFSLMVRVNPDGGKTPELSLEKLLDREEQRSHRLILTALDGGDPPR
FT                   SATTQIEISVKDNNDNPPVFSKEEYWVSVSENLSPGSSVLQVTATDEDEGVNAEILYYF
FT                   RSTAQSTRHVFSLDEKTGVIKNNQSLDFEDIERYTMEVEAKDGGGLSTRCKIIIEVLDE
FT                   NDNSPEITITSLSDHILENSPPGVVVVLFKTRDRDFGGNGEVTCDIGKDLPFKIQASSS
FT                   NYYKLVTDGALDREQNPQYNVTITATDKGKPALSSSTTIVLHITDINDNAPAFQKSSYI
FT                   VHVAENNPPGASIAQVSASDPDLGANGHVSYSIIASDLEPKSLWSYVTVNAQSGVVFAQ
FT                   RAFDHEQLRSFQLTLQARDQGKPSLSANVSMRVLVGDRNDNAPRVLYPALEPDGSALFD
FT                   MVPRAAEPGYLVTKVVAVDADSGHNAWLSYHVLQASDPGLFSLGLRTGEVRTARALGEK
FT                   DAARQRLLVGVRDGGQPPLSATATLLLVFADSLQEALPDLSDRSLPPDPQAELQFYLVV
FT                   ALALISVLFLLAVILAIALRLRHSSSPSVWGCFQSGLCSKARPGVSLNYSEGTLPYSYN
FT                   LCVGQTGKAELNFLKCSAPLPSSQEIVSGSSPGALIPLHLGDDLTTHPETLTPQAPPNT
FT                   DWRFSQAQRPGTSGSQNGDETGTWPNNQFDTEMLQAMILASASEAADGSSTLGGGAGTM
FT                   GLSARYGPQFTLQHVPDYRQNVYIPGSNATLTNAAGKRDGKAPAGGNGNKKKSGKKEKK
FT                   "
FT   mRNA            join(<447130..449547,535369..535427,543604..543692,
FT                   550253..552222)
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, transcript variant mCT174356"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174356.0
FT                   created on 14-OCT-2002"
FT   CDS             join(447130..449547,535369..535427,543604..543692,
FT                   550253..550479)
FT                   /codon_start=1
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, isoform CRA_o"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174356.0
FT                   protein_id=mCP97270.0 isoform=CRA_o"
FT                   /protein_id="EDL10132.1"
FT                   /translation="MAAQRNLSERTKLVLLFLWMPWESAARQIRYSVPEELEKGSFVGN
FT                   IAKDLGLEPRQLAERGVRIISRGRSQLFSLNPRGGSLVTAGRIDREELCAQSAPCLVSF
FT                   NILVEDRVKLFGIEIEVTDVNDNAPKFQAETLDVKINENVAPGMRFPLPEATDPDVGVN
FT                   SLQSYQLSSNKHFSLVVQSGAKGVKYPELVLEQALDREEEAIHHLVLVASDGGNPPRSG
FT                   TVLITVTVFDANDNAPVFTSTEYRVNIPENLPVGTQLLKVTATDKDEGANGEVTYAFRK
FT                   SLDTQLSKFQLDKHTGEIKISENLDYEEMSFYEIEIQAEDGGAYLATAKVLITVEDVND
FT                   NSPEVTITSLFSPVTEDSPVGTVIALLNVHDLDSGQNGEVACSISGNLPFKLEKSIDNY
FT                   YRLVTQRALDREQVPAYNITVTATDGGNPPLSTKADFTLQVADINDNPPTFSHPSYFTY
FT                   IPENNPRGASIFSVTALDPDSKENAQIVYSLAEDTIEGAPLSSYISINSDTGILYALWS
FT                   FDYEQFRELQVQVTASDSGKPPLHSNVSLTLFVLDQNDNSPEILYPTMPTDGSTGVELA
FT                   PRSAELGYLVTKVVAVDRDSGQNAWLSYRLLKASEPGLFTVGLHTGEVRTARALMERDA
FT                   LKQSLVVAVQDHGQPPLSATVTLTVAVADSIPDVLADLGNLEPPQDSEASNLTLYLVVA
FT                   VAAVSCVFLAFVIVLLALKLRRWHKSHVLQSSRDGLAGMPASHYVGVDGVRAFLQTYSH
FT                   EVSLTADSRKSHLIFPQPNYADTLISQESCEKKDPLSLLDDSKCPVEDAPLVPQAPPNT
FT                   DWRFSQAQRPGTSGSQNGDETGTWPNNQFDTEMLQAMILASASEAADGSSTLGGGAGTM
FT                   GLSARYGPQFTLQHVPDYRQNVYIPGSNATLTNAAGKRDGKAPAGGNGNKKKSGKKEKK
FT                   "
FT   assembly_gap    450673..450692
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            join(<452580..454994,535369..535427,543604..543692,
FT                   550253..552222)
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, transcript variant mCT174357"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174357.0
FT                   created on 14-OCT-2002"
FT   CDS             join(452580..454994,535369..535427,543604..543692,
FT                   550253..550479)
FT                   /codon_start=1
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, isoform CRA_y"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174357.0
FT                   protein_id=mCP97264.0 isoform=CRA_y"
FT                   /db_xref="GOA:Q91XX3"
FT                   /db_xref="InterPro:IPR002126"
FT                   /db_xref="InterPro:IPR013164"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR020894"
FT                   /db_xref="InterPro:IPR031904"
FT                   /db_xref="InterPro:IPR032455"
FT                   /db_xref="MGI:MGI:1935199"
FT                   /db_xref="PDB:5SZO"
FT                   /db_xref="PDB:5SZP"
FT                   /db_xref="PDB:5V5X"
FT                   /db_xref="UniProtKB/TrEMBL:Q91XX3"
FT                   /protein_id="EDL10142.1"
FT                   /translation="MGGSSARRKRPGRPQVLFILLLPLFCPALGQPVRYSIPEELDRGS
FT                   VVGKLAKDLGLSVLEVSARKLRVSAEKLHFSVDSESGDLLVKDRIDREQICKGRRKCEL
FT                   QLEAVLENPLNIFHVVVEIEDVNDHAPQFPKDEINLEISESDSPGARTILESAKDLDIG
FT                   MNSLSKYQLSPNDYFLLLVKDNPDGSKYPELELQKMLDREAESTHHLMLTAVDGGDPPR
FT                   TGTTQLRIRVVDANDNRPVFSQDVYRVRLPEDLPPGTTVLRLKAMDQDEGINAEFTYSF
FT                   LGVANKAQFSLDPITGDIVTRQSLDFEEVEQYTIDVEAKDRGSLSSQCKVIIEVLDEND
FT                   NRPEIIITSLSDQISEDSPSGTVVALFKVRDRDSGENAEVMCSLSGNNPFKIHSSSNNY
FT                   YKLVTDSILDREQTPGYNVTITATDRGKPPLSSSTTITLNVADVNDNAPVFQQQAYLIN
FT                   VAENNQPGTSITQVKAWDPDVGSNGLVSYSIIASDLEPKALSSFVSVNQDSGVVYAQRA
FT                   FDHEQIRSFQLTLQARDQGSPALSANVSMRVLVDDRNDNAPRVLYPTLEPDGSALFDMV
FT                   PRAAEPGYLVTKVVAVDADSGHNAWLSYHVLQASDPGLFSLGLRTGEVRTARALSDKDA
FT                   ARQRLLVAVRDGGQPPLSATATLLLVFADSLQEALPDLVDHPIPSDPQSELQFYLVVAL
FT                   ALISVLFLLAVIFAIALRLRQSSSPSSTGCFGSVLGSKSRPVLPPNYSEGTLPYAYNLC
FT                   VPGDQLKPEFNYFSSVGDCPAAQDILNKDSSSALLASILTPGVEADEKTFNQQAPPNTD
FT                   WRFSQAQRPGTSGSQNGDETGTWPNNQFDTEMLQAMILASASEAADGSSTLGGGAGTMG
FT                   LSARYGPQFTLQHVPDYRQNVYIPGSNATLTNAAGKRDGKAPAGGNGNKKKSGKKEKK"
FT   gene            complement(453071..>478777)
FT                   /locus_tag="mCG_145923"
FT                   /note="gene_id=mCG145923.0"
FT   mRNA            complement(join(453071..453699,456170..457917,
FT                   478469..>478777))
FT                   /locus_tag="mCG_145923"
FT                   /product="mCG145923"
FT                   /note="gene_id=mCG145923.0 transcript_id=mCT186031.0
FT                   created on 04-JUL-2003"
FT   CDS             complement(456359..>456754)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145923"
FT                   /product="mCG145923"
FT                   /note="gene_id=mCG145923.0 transcript_id=mCT186031.0
FT                   protein_id=mCP107756.0"
FT                   /protein_id="EDL10144.1"
FT                   /translation="FAMAGCERYSVRVLRRFNFYLFFRVSFCVYEVPGIPHPKHIPKRT
FT                   EVFLLPELRCVSIHPFRLCVLEIPEKYSIALSSRSPIGQQRRLEPNLIIATLIKTRCLL
FT                   RRKLSHSPFPWILTFVKPTTANNSYVM"
FT   mRNA            join(<456747..459173,535369..535427,543604..543692,
FT                   550253..552222)
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, transcript variant mCT174333"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174333.0
FT                   created on 14-OCT-2002"
FT   CDS             join(456747..459173,535369..535427,543604..543692,
FT                   550253..550479)
FT                   /codon_start=1
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, isoform CRA_b"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174333.0
FT                   protein_id=mCP97275.0 isoform=CRA_b"
FT                   /protein_id="EDL10119.1"
FT                   /translation="MANQSQRLDRRALIPLCIFLGTLLTFGTGQIRYSVPEETDKGFFV
FT                   GNISKDLGLEPWEVAERGVRIISRGQSQLFSLNPRGGSLVTAGRIDREELCDTMPSCML
FT                   NLEILVEETLKIYGVEVEVLDINDNAPSFREEEVEIKVSEHTSPGSRFPLPSARDPDAG
FT                   MNSLQSYQLSPSSYFSLQVRGGTDGDKNPELVLEEGLDREKEASHHLLLTALDGGDPVR
FT                   KGTVPIRVVVLDVNDHIPKFTQPVYRVSIPENLSSGTRVLVVNASDPDEGINGEVIYSF
FT                   RKMKSKASEIFQLNSQTGEVLVGKPLDFEKYRFYEMEIQGQDGGGLLSTTTLLITVEDV
FT                   NDNAPEITVTSASNSVSENSPSGTVIALLNVQDQDSGENGQVSCFIPSGLPFKLEKTYG
FT                   NYYKLITNSELDREQVESYNITLIAKDQGSPPLSTETHLLLKVADANDNPPVFSSSSYS
FT                   AYIPENNPRGSSIFSVTAIDRDSRENAQVTYSLAEYTIQGTPLSSYVSINSDTGVLYAL
FT                   QSFDYEQFQTLQLGVTASDNGDPPLSSNISLTLFVLDQNDNTPEILYPSLPTDGSTGVE
FT                   LAPRSAEPGYLVTKVVAVDRDSGQNAWLSYRLLKASEPGLFSVGLHTGEVRTARAMMDK
FT                   DALKQSLVVTVQDHGQPPLSATVKLTVAVADSIPEVLEDLVSLESPANPDESGLTLYLV
FT                   VAITAVSCIFLIFVMVLLALKLRRWHSLRLLQAASGLAGVPPSHFVGVDGMRAFLQTYS
FT                   HEVSLTADSRKSHLIFPQPNYADTLISQESCGKSEPLLITEDSTTVLGKCEPTDIQQAP
FT                   PNTDWRFSQAQRPGTSGSQNGDETGTWPNNQFDTEMLQAMILASASEAADGSSTLGGGA
FT                   GTMGLSARYGPQFTLQHVPDYRQNVYIPGSNATLTNAAGKRDGKAPAGGNGNKKKSGKK
FT                   EKK"
FT   mRNA            join(459099..459116,535369..535427,543604..543692,
FT                   550253..550790)
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, transcript variant mCT174349"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174349.0
FT                   created on 14-OCT-2002"
FT   assembly_gap    461056..462172
FT                   /estimated_length=1117
FT                   /gap_type="unknown"
FT   assembly_gap    463573..463592
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    465123..465142
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            join(<465793..468212,535369..535427,543604..543692,
FT                   550253..552222)
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, transcript variant mCT174334"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174334.0
FT                   created on 14-OCT-2002"
FT   CDS             465793..467271
FT                   /codon_start=1
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, isoform CRA_p"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174334.0
FT                   protein_id=mCP97269.0 isoform=CRA_p"
FT                   /protein_id="EDL10133.1"
FT                   /translation="MERSSVKLGSRTPWRQVLFPFLLPLFCTGLSEQVRYSIPEEMAMG
FT                   SVVGNLAEDLGLPVQDLLTRNLRVIAEKPYLSVNPENGNIVVSDRIDREFLCFQSPLCV
FT                   LPLEIVAENPLNVFHVSVVIEDINDNPPRFLQNSIVLQINELAIPGTRFGLESAIDADV
FT                   GLNSLQSYQLSLNEHFSLVVKDNTEGKDAPELVLEKPLDREKQSSQLLVLTAVDGGEPV
FT                   LTGTAQIQIEVTDANDNPPVFSQSTYKVSLREDMAAGTSVLTVIATDQDEGVNAEVTYS
FT                   FKSLGEDIRDKFILDHQSGEIKSKGPIDFETKRTYTMNIEAKDGGGMASECKVVVEILD
FT                   ENDNAPEVVFTSVSNSITEDAEPGTVVALFKTYDKDSEENGRVSCFVKETVPFRIESSA
FT                   SNYYKLVTDGILDREQTPEYNVTIIATDKGKPPLSSSTSVTLHVGDINDNAPVFHQTSY
FT                   LIQVAENNPPGASIAQVSAFDPDLGSMVSSPTPS"
FT   assembly_gap    470189..476293
FT                   /estimated_length=6105
FT                   /gap_type="unknown"
FT   mRNA            join(476555..479074,535369..535427,543604..543692,
FT                   550253..552225)
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, transcript variant mCT134754"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT134754.0
FT                   created on 14-OCT-2002"
FT   CDS             join(476660..479074,535369..535427,543604..543692,
FT                   550253..550479)
FT                   /codon_start=1
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, isoform CRA_a"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT134754.0
FT                   protein_id=mCP77563.1 isoform=CRA_a"
FT                   /protein_id="EDL10118.1"
FT                   /translation="MQRREDCKGLVFLGVLLGMLWKAGSTQIRYSVPEELEKGSRVGNI
FT                   SKDLGLKPRELAERGVRIVSRGRAQLFALNPRSGSLVTAGRIDREELCMGSIKCQLNLE
FT                   ILMEDIGKIYGVEIEVRDINDNAPYFRESELEIKMSENAAAGMRFPLPHAWDPDIGKNS
FT                   LQSYQLSPNAHFSLEVQNGADGNKYPELVLESSLDREEKAAHLLVLTASDAGDPVRTGT
FT                   ARIRVTVVDANDNAPAFARSEYRVSVRENVAVGTQLLLVNATDRDEGANAEVIYSFRYV
FT                   DDKAAKVFKLDSNLGTISTIGELNHEESGFYEMEVQATDNAGYSARAKVLVTVLDVNDN
FT                   APEVAITSLTNSVPENSPQGTLIALLNVNDQDSGENGQVICSIQENLPFKLEKSYGNYY
FT                   RLVTDAVLDREEVPSYNITVTATDRGSPPLTTETHLALDIADTNDNSPVFLQASYWAYI
FT                   PENNPRGASIASVTAHDPDSDKNAQVTYSLAEDTHQGVPLSSYVSINSDTGVLYALHSF
FT                   DYEQFPDLQLQVMARDSGDPPLSSNVSLSLFVLDQNDNVPEILYPTLPTDGSTGVELAP
FT                   RSAEPGYLVTKVVAVDRDSGQNAWLSYRLLKASEPGLFSVGLHTGEISTARALMDRDAL
FT                   KQNLVVSVQDHGQPPLSATVTLTVAIADSIPDVLADLDNLESPSTSETSGLTLYLVVAV
FT                   AAVSTVFLVFVLVLLALRLRRWHSLRLLRAGGPGLADVAASHFVGVDGVQAFLQTYSHE
FT                   VSLTAGSRKSHLIFPQPNYADTLISQESCEKTEPLLPSGDSVFSKDNHALNQQAPPNTD
FT                   WRFSQAQRPGTSGSQNGDETGTWPNNQFDTEMLQAMILASASEAADGSSTLGGGAGTMG
FT                   LSARYGPQFTLQHVPDYRQNVYIPGSNATLTNAAGKRDGKAPAGGNGNKKKSGKKEKK"
FT   assembly_gap    481576..482694
FT                   /estimated_length=1119
FT                   /gap_type="unknown"
FT   assembly_gap    484023..485005
FT                   /estimated_length=983
FT                   /gap_type="unknown"
FT   assembly_gap    486289..486986
FT                   /estimated_length=698
FT                   /gap_type="unknown"
FT   mRNA            join(<516886..519315,535369..535427,543604..543692,
FT                   550253..552222)
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, transcript variant mCT174336"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174336.0
FT                   created on 14-OCT-2002"
FT   CDS             join(516886..519315,535369..535427,543604..543692,
FT                   550253..550479)
FT                   /codon_start=1
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, isoform CRA_q"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174336.0
FT                   protein_id=mCP97261.0 isoform=CRA_q"
FT                   /protein_id="EDL10134.1"
FT                   /translation="MVAEARSSGLASPWRTVGVLLLLAALTEASTIIHYEILEERERGF
FT                   PVGNVVTDLGLDLGSLSARRLRVVSGASRRFFEVNWETGEMFVNDRLDREELCGTLPSC
FT                   TVTLELVVENPLELFSAEVVVQDINDNNPSFPTGEMKLEISEALAPGTRFPLESAHDPD
FT                   VGSNSLQTYELSHNEYFALRVQTREDGTKYAELVLERALDWEREPSVQLVLTALDGGTP
FT                   ARSATLPIRITVLDANDNAPAFNQSLYRARVREDAPPGTRVAQVLATDLDEGLNGEIVY
FT                   SFGSHNRAGVRELFALDLVTGVLTIKGRLDFEDTKLHEIYIQAKDKGANPEGAHCKVLV
FT                   EVVDVNDNAPEITVTSVYSPVPEDAPLGTVIALLSVTDLDAGENGLVTCEVPPGLPFSL
FT                   TSSLKNYFTLKTSAALDRETMPEYNLSITARDSGIPSLSALTTVKVQVSDINDNPPQSS
FT                   QSSYDVYVEENNLPGVPILNLSVWDPDAPPNARLSFFLLEPGAETGLVSRYFTINRDNG
FT                   VLTTLVPLDYEDQREFQLTAHINDGGTPVLATNISVNVFVTDRNDNAPQVLYPRPGQSS
FT                   VEMLPRGTAAGHVVSRVVGWDADAGHNAWLSYSLLGAPNQSLFAVGLHTGQISTARPIQ
FT                   DTDSPRQILTVLISDSGEPLLSTTATLTVSVTEESPEARAEFPSGSAPREQNKNLTFYL
FT                   LLSLILVSVGFAVTVLGVIIFKVYKWKRSRDLYRAPVSSLYRTPGPSLHADAVRGGLMP
FT                   PHLYHQVYLTTDSRRSDPLLKKPGAASPLASRQNTLRSCDPVFYRQVLGAESAPPGQQA
FT                   PPNTDWRFSQAQRPGTSGSQNGDETGTWPNNQFDTEMLQAMILASASEAADGSSTLGGG
FT                   AGTMGLSARYGPQFTLQHVPDYRQNVYIPGSNATLTNAAGKRDGKAPAGGNGNKKKSGK
FT                   KEKK"
FT   mRNA            join(<525881..528331,535369..535427,543604..543692,
FT                   550253..552222)
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, transcript variant mCT174338"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174338.0
FT                   created on 14-OCT-2002"
FT   CDS             join(525881..528331,535369..535427,543604..543692,
FT                   550253..550479)
FT                   /codon_start=1
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, isoform CRA_r"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174338.0
FT                   protein_id=mCP97259.0 isoform=CRA_r"
FT                   /db_xref="GOA:Q91XX0"
FT                   /db_xref="InterPro:IPR002126"
FT                   /db_xref="InterPro:IPR013164"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR020894"
FT                   /db_xref="InterPro:IPR031904"
FT                   /db_xref="MGI:MGI:1935203"
FT                   /db_xref="UniProtKB/TrEMBL:Q91XX0"
FT                   /protein_id="EDL10135.1"
FT                   /translation="MAAMPSTVRSWVEIWWGATLLFLFCHLGYVYGQIRYPVPEESQEG
FT                   TFVGNVAQDFLLDTESLSARRLQVAGEVNQRHFRVDLDSGALLIKNPIDREALCGLSAS
FT                   CIVPLEFVTEGPLEMYRAEVEIVDVNDHAPRFPRQQLDLEIGEAAPPGQRFPLEKAQDA
FT                   DVGSNSISSYRLSSNEHFALDVKKRSDGSLVPELLLEKPLDREKQSDYRLVLTAVDGGN
FT                   PPRSGTAELRVSVLDVNDNAPAFQQSSYRISVLESAPAGMVLIQLNASDPDLGPSGNVT
FT                   FSFSGHTPDRVRNLFSLHPTTGKLTLQGPLDFESENYYEFDVRARDGGSPAMEQHCSLR
FT                   VDLLDVNDNAPHITVTSELGTLPESAEPGTVVALISVQDPDSGSNGDVSLRIPDHLPFA
FT                   LKSAFRNQFSLVTAGPLDREARSSYDIMVTASDAGNPPLSTHRTIFLNISDVNDNPPSF
FT                   FQRSHEVFVPENNRPGDLLCSLAASDPDSGLNALISYSLLEPRNRDVSASSFISLNPQT
FT                   GAVHATRSFDYEQTQTLQFEVQARDRGSPPLSSTVTVRLFVLDLNDNAPAVLRPRARPG
FT                   SLCPQALPPSVGAGHLVTKVTAVDLDSGYNAWVSYQLLEAPDPSLFAVSRYAGEVRTAV
FT                   PIPADLPPQKLVIVVKDSGSPPLSTSVTLLVSLEEDTHPVVPDLRESSAPREGESRLTL
FT                   YLAVSLVAICFVSFGSFVALLSKCLRGAACGVTCFPAGTCACLTRSRRREGLPPSNGIL
FT                   RIQLGSEDPIKFVDVGGHSHGCTPLASAPTRSDSFMMVKSPSAPMAGEPVRPSCPPSDL
FT                   LYGLEQAPPNTDWRFSQAQRPGTSGSQNGDETGTWPNNQFDTEMLQAMILASASEAADG
FT                   SSTLGGGAGTMGLSARYGPQFTLQHVPDYRQNVYIPGSNATLTNAAGKRDGKAPAGGNG
FT                   NKKKSGKKEKK"
FT   mRNA            join(529914..530064,535373..535427,543604..543692,
FT                   550253..552225)
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, transcript variant mCT174348"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174348.0
FT                   created on 14-OCT-2002"
FT   mRNA            join(529999..535427,543604..543692,550253..552225)
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, transcript variant mCT174347"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174347.0
FT                   created on 14-OCT-2002"
FT   mRNA            join(<530023..532482,535369..535427,543604..543692,
FT                   550253..552222)
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, transcript variant mCT174341"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174341.0
FT                   created on 14-OCT-2002"
FT   CDS             join(530023..532482,535369..535427,543604..543692,
FT                   550253..550479)
FT                   /codon_start=1
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, isoform CRA_f"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174341.0
FT                   protein_id=mCP97266.0 isoform=CRA_f"
FT                   /db_xref="GOA:Q91XW9"
FT                   /db_xref="InterPro:IPR002126"
FT                   /db_xref="InterPro:IPR013164"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR020894"
FT                   /db_xref="InterPro:IPR031904"
FT                   /db_xref="InterPro:IPR032455"
FT                   /db_xref="MGI:MGI:1935205"
FT                   /db_xref="PDB:4ZPN"
FT                   /db_xref="PDB:4ZPO"
FT                   /db_xref="PDB:4ZPP"
FT                   /db_xref="PDB:4ZPQ"
FT                   /db_xref="UniProtKB/TrEMBL:Q91XW9"
FT                   /protein_id="EDL10123.1"
FT                   /translation="MRPMASPQVAGKWQVLCMLSLCCCGWVSGQLRYSVVEESEPGTLV
FT                   GNVAQDLGLKGTDLLSRRLRLGSEENGRYFSLSLVSGALAVSQKIDRESLCGASTSCLL
FT                   PVQVVTEHPLELTRVEVEILDLNDNSPSFATPDREMRISESAAPGARFPLDSAQDPDVG
FT                   TNTVSFYTLSPNSHFSLHVKTLKDGKLFPELVLEQQLDRETQARHQLVLTAVDGGTPAR
FT                   SGTSLISVIVLDVNDNAPTFQSSVLRVGLPENTPPGTLLLRLNATDPDEGTNGQLDYSF
FT                   GDHTSETVKNLFGLDPSSGAIHVLGPVDFEESNFYEIHARARDQGQPAMEGHCVIQVDV
FT                   GDANDNPPEVLLASLVNPVLESTPVGTVVGLFNVRDRDSGRNGEVSLKTSPNLPFQIKP
FT                   SENHYSLLTSQPLDREATSHYTIELLASDAGSPPLHTHLTLRLNISDVNDNAPHFTQQL
FT                   YTAYIPENRPPGSLLCTVAASDPDEGDNARLTYSIVGSQIQGAPASSFVYVNPEDGRIF
FT                   AQRTFDYELLQMLQIVVGVRDSGSPRLHANTSLHVFVLDQNDNAPAVLHPRPGREFSAP
FT                   QRLPRSAPPGSLVTKVTAVDADAGHNAWLSYSLLPQSTAPGLFLVSAHTGEVRTARALL
FT                   EDDSDTQQVVVLVRDNGDPSLSSTATVLLVLEDEDAEEMPKSSDFLTHPPERSDLTLYL
FT                   IVALAAVSLLSLVTFTFMSAKCLRRHEDGDRGGGHCCRGQDSPSREFYKQSSPNLQVSS
FT                   DGTLKYMEVTLRPTDSQSHCYRTCFSPASDGSDFTFLRPLSVQQPSALALEPEALRSRS
FT                   STLRERSQQAPPNTDWRFSQAQRPGTSGSQNGDETGTWPNNQFDTEMLQAMILASASEA
FT                   ADGSSTLGGGAGTMGLSARYGPQFTLQHVPDYRQNVYIPGSNATLTNAAGKRDGKAPAG
FT                   GNGNKKKSGKKEKK"
FT   CDS             530023..532638
FT                   /codon_start=1
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, isoform CRA_i"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174347.0
FT                   protein_id=mCP97265.0 isoform=CRA_i"
FT                   /db_xref="GOA:Q8K4A2"
FT                   /db_xref="InterPro:IPR002126"
FT                   /db_xref="InterPro:IPR013164"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR020894"
FT                   /db_xref="InterPro:IPR032455"
FT                   /db_xref="MGI:MGI:1935205"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K4A2"
FT                   /protein_id="EDL10126.1"
FT                   /translation="MRPMASPQVAGKWQVLCMLSLCCCGWVSGQLRYSVVEESEPGTLV
FT                   GNVAQDLGLKGTDLLSRRLRLGSEENGRYFSLSLVSGALAVSQKIDRESLCGASTSCLL
FT                   PVQVVTEHPLELTRVEVEILDLNDNSPSFATPDREMRISESAAPGARFPLDSAQDPDVG
FT                   TNTVSFYTLSPNSHFSLHVKTLKDGKLFPELVLEQQLDRETQARHQLVLTAVDGGTPAR
FT                   SGTSLISVIVLDVNDNAPTFQSSVLRVGLPENTPPGTLLLRLNATDPDEGTNGQLDYSF
FT                   GDHTSETVKNLFGLDPSSGAIHVLGPVDFEESNFYEIHARARDQGQPAMEGHCVIQVDV
FT                   GDANDNPPEVLLASLVNPVLESTPVGTVVGLFNVRDRDSGRNGEVSLKTSPNLPFQIKP
FT                   SENHYSLLTSQPLDREATSHYTIELLASDAGSPPLHTHLTLRLNISDVNDNAPHFTQQL
FT                   YTAYIPENRPPGSLLCTVAASDPDEGDNARLTYSIVGSQIQGAPASSFVYVNPEDGRIF
FT                   AQRTFDYELLQMLQIVVGVRDSGSPRLHANTSLHVFVLDQNDNAPAVLHPRPGREFSAP
FT                   QRLPRSAPPGSLVTKVTAVDADAGHNAWLSYSLLPQSTAPGLFLVSAHTGEVRTARALL
FT                   EDDSDTQQVVVLVRDNGDPSLSSTATVLLVLEDEDAEEMPKSSDFLTHPPERSDLTLYL
FT                   IVALAAVSLLSLVTFTFMSAKCLRRHEDGDRGGGHCCRGQDSPSREFYKQSSPNLQVSS
FT                   DGTLKYMEVTLRPTDSQSHCYRTCFSPASDGSDFTFLRPLSVQQPSALALEPEALRSRS
FT                   STLRERSQVRAGSRHATPGRARWRSCPVHLRGVCSCTLFLFVPSWHTCWMRLKVDNQSG
FT                   "
FT   CDS             join(530058..530064,535373..535427,543604..543692,
FT                   550253..550479)
FT                   /codon_start=1
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, isoform CRA_j"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174348.0
FT                   protein_id=mCP97256.0 isoform=CRA_j"
FT                   /protein_id="EDL10127.1"
FT                   /translation="MATPPNTDWRFSQAQRPGTSGSQNGDETGTWPNNQFDTEMLQAMI
FT                   LASASEAADGSSTLGGGAGTMGLSARYGPQFTLQHVPDYRQNVYIPGSNATLTNAAGKR
FT                   DGKAPAGGNGNKKKSGKKEKK"
FT   CDS             join(543659..543692,550253..550479)
FT                   /codon_start=1
FT                   /locus_tag="mCG_133388"
FT                   /product="mCG133388, isoform CRA_k"
FT                   /note="gene_id=mCG133388.1 transcript_id=mCT174349.0
FT                   protein_id=mCP97252.0 isoform=CRA_k"
FT                   /protein_id="EDL10128.1"
FT                   /translation="MLQAMILASASEAADGSSTLGGGAGTMGLSARYGPQFTLQHVPDY
FT                   RQNVYIPGSNATLTNAAGKRDGKAPAGGNGNKKKSGKKEKK"
FT   gene            complement(555176..645609)
FT                   /gene="Diap1"
FT                   /locus_tag="mCG_18335"
FT                   /note="gene_id=mCG18335.1"
FT   mRNA            complement(join(555176..555850,561886..561972,
FT                   563638..563773,563879..564041,564813..564939,
FT                   565809..565938,566048..566287,566509..566610,
FT                   566788..566882,570750..570848,600039..600153,
FT                   600818..601510,602134..602313,603690..603754,
FT                   604434..604549,605522..605638,606455..606573,
FT                   606721..606831,607854..607962,610839..610978,
FT                   612287..612350,613266..613352,613529..613659,
FT                   613958..614059,615206..615361,645400..645609))
FT                   /gene="Diap1"
FT                   /locus_tag="mCG_18335"
FT                   /product="diaphanous homolog 1 (Drosophila), transcript
FT                   variant mCT12972"
FT                   /note="gene_id=mCG18335.1 transcript_id=mCT12972.2 created
FT                   on 14-OCT-2002"
FT   mRNA            complement(join(555383..555850,561886..561972,
FT                   563638..563773,563879..564041,564813..564939,
FT                   565809..565938,566048..566482))
FT                   /gene="Diap1"
FT                   /locus_tag="mCG_18335"
FT                   /product="diaphanous homolog 1 (Drosophila), transcript
FT                   variant mCT174389"
FT                   /note="gene_id=mCG18335.1 transcript_id=mCT174389.0 created
FT                   on 14-OCT-2002"
FT   CDS             complement(join(555693..555850,561886..561972,
FT                   563638..563773,563879..564041,564813..564939,
FT                   565809..565938,566048..566287,566509..566610,
FT                   566788..566882,570750..570848,600039..600153,
FT                   600818..601510,602134..602313,603690..603754,
FT                   604434..604549,605522..605638,606455..606573,
FT                   606721..606831,607854..607962,610839..610978,
FT                   612287..612350,613266..613352,613529..613659,
FT                   613958..614059,615206..615361,645400..645516))
FT                   /codon_start=1
FT                   /gene="Diap1"
FT                   /locus_tag="mCG_18335"
FT                   /product="diaphanous homolog 1 (Drosophila), isoform CRA_a"
FT                   /note="gene_id=mCG18335.1 transcript_id=mCT12972.2
FT                   protein_id=mCP8309.2 isoform=CRA_a"
FT                   /protein_id="EDL10115.1"
FT                   /translation="MEPSGGGLGPGRGTRDKKKGRSPDELPATGGDGGKHKKFLERFTS
FT                   MRIKKEKEKPNSAHRNSSASYGDDPTAQSLQDISDEQVLVLFEQMLVDMNLNEEKQQPL
FT                   REKDIVIKREMVSQYLHTSKAGMNQKESSRSAMMYIQELRSGLRDMHLLSCLESLRVSL
FT                   NNNPVSWVQTFGAEGLASLLDILKRLHDEKEETSGNYDSRNQHEIIRCLKAFMNNKFGI
FT                   KTMLETEEGILLLVRAMDPAVPNMMIDAAKLLSALCILPQPEDMNERVLEAMTERAEMD
FT                   EVERFQPLLDGLKSGTSIALKVGCLQLINALITPAEELDFRVHIRSELMRLGLHQVLQE
FT                   LREIENEDMKVQLCVFDEQGDEDFFDLKGRLDDIRMEMDDFGEVFQIILNTVKDSKAEP
FT                   HFLSILQHLLLVRNDYEARPQYYKLIEECVSQIVLHKNGTDPDFKCRHLQIDIERLVDQ
FT                   MIDKTKVEKSEAKATELEKKLDSELTARHELQVEMKKMENDFEQKLQDLQGEKDALDSE
FT                   KQQITAQKQDLEAEVSKLTGEVAKLSKELEDAKNEMASLSAVVVAPSVSSSAAVPPAPP
FT                   LPGDSGTVIPPPPPPPPLPGGVVPPSPPLPPGTCIPPPPPLPGGACIPPPPQLPGSAAI
FT                   PPPPPLPGVASIPPPPPLPGATAIPPPPPLPGATAIPPPPPLPGGTGIPPPPPPLPGSV
FT                   GVPPPPPLPGGPGLPPPPPPFPGAPGIPPPPPGMGVPPPPPFGFGVPAAPVLPFGLTPK
FT                   KVYKPEVQLRRPNWSKFVAEDLSQDCFWTKVKEDRFENNELFAKLTLAFSAQTKTKKDQ
FT                   EGGEEKKSVQKKKVKELKVLDSKTAQNLSIFLGSFRMPYQEIKNVILEVNEAVLTESMI
FT                   QNLIKQMPEPEQLKMLSELKEEYDDLAESEQFGVVMGTVPRLRPRLNAILFKLQFSEQV
FT                   ENIKPEIVSVTAACEELRKSENFSSLLELTLLVGNYMNAGSRNAGAFGFNISFLCKLRD
FT                   TKSADQKMTLLHFLAELCENDHPEVLKFPDELAHVEKASRVSAENLQKSLDQMKKQIAD
FT                   VERDVQNFPAATDEKDKFVEKMTIFVKDAQEQYNKLRMMHSNMETLYKELGDYFVFDPK
FT                   KLSVEEFFMDLHNFRNMFLQAVKENQKRRETEEKMRRAKLAKEKAEKERLEKQQKREQL
FT                   IDMNAEGDETGVMDSLLEALQSGAAFRRKRGPRQVNRKAGCAVTSLLASELTKDDAMAP
FT                   GPVKVPKKSEGVPTILEEAKELVGRAS"
FT   CDS             complement(join(555693..555850,561886..561972,
FT                   563638..563773,563879..564041,564813..564939,
FT                   565809..565938,566048..566287))
FT                   /codon_start=1
FT                   /gene="Diap1"
FT                   /locus_tag="mCG_18335"
FT                   /product="diaphanous homolog 1 (Drosophila), isoform CRA_b"
FT                   /note="gene_id=mCG18335.1 transcript_id=mCT174389.0
FT                   protein_id=mCP97308.0 isoform=CRA_b"
FT                   /protein_id="EDL10116.1"
FT                   /translation="MGTVPRLRPRLNAILFKLQFSEQVENIKPEIVSVTAACEELRKSE
FT                   NFSSLLELTLLVGNYMNAGSRNAGAFGFNISFLCKLRDTKSADQKMTLLHFLAELCEND
FT                   HPEVLKFPDELAHVEKASRVSAENLQKSLDQMKKQIADVERDVQNFPAATDEKDKFVEK
FT                   MTIFVKDAQEQYNKLRMMHSNMETLYKELGDYFVFDPKKLSVEEFFMDLHNFRNMFLQA
FT                   VKENQKRRETEEKMRRAKLAKEKAEKERLEKQQKREQLIDMNAEGDETGVMDSLLEALQ
FT                   SGAAFRRKRGPRQVNRKAGCAVTSLLASELTKDDAMAPGPVKVPKKSEGVPTILEEAKE
FT                   LVGRAS"
FT   mRNA            complement(join(606214..606573,606721..606831,
FT                   607854..608027))
FT                   /gene="Diap1"
FT                   /locus_tag="mCG_18335"
FT                   /product="diaphanous homolog 1 (Drosophila), transcript
FT                   variant mCT174390"
FT                   /note="gene_id=mCG18335.1 transcript_id=mCT174390.0 created
FT                   on 14-OCT-2002"
FT   CDS             complement(join(606430..606573,606721..606831,
FT                   607854..608012))
FT                   /codon_start=1
FT                   /gene="Diap1"
FT                   /locus_tag="mCG_18335"
FT                   /product="diaphanous homolog 1 (Drosophila), isoform CRA_c"
FT                   /note="gene_id=mCG18335.1 transcript_id=mCT174390.0
FT                   protein_id=mCP97309.0 isoform=CRA_c"
FT                   /protein_id="EDL10117.1"
FT                   /translation="MSVSVHLGNSLSVFLGRNERVLEAMTERAEMDEVERFQPLLDGLK
FT                   SGTSIALKVGCLQLINALITPAEELDFRVHIRSELMRLGLHQVLQELREIENEDMKVQL
FT                   CVFDEQGDEDFFDLKGRLDDIRMEMEYPFMTDD"
FT   gene            complement(647176..665162)
FT                   /gene="Hdac3"
FT                   /locus_tag="mCG_128932"
FT                   /note="gene_id=mCG128932.1"
FT   mRNA            complement(join(647176..647880,651151..651308,
FT                   651576..651655,651905..651963,652075..652164,
FT                   653651..653715,653873..653946,654324..654404,
FT                   655083..655216,655531..655586,655702..655758,
FT                   655885..655966,662662..662804,664869..664951,
FT                   665046..665162))
FT                   /gene="Hdac3"
FT                   /locus_tag="mCG_128932"
FT                   /product="histone deacetylase 3, transcript variant
FT                   mCT130237"
FT                   /note="gene_id=mCG128932.1 transcript_id=mCT130237.1
FT                   created on 14-OCT-2002"
FT   mRNA            complement(join(647176..647880,651151..651308,
FT                   651576..651963,652075..652164,653651..653715,
FT                   653873..653946,654324..654404,655083..655216,
FT                   655531..655586,655702..655758,655885..655966,
FT                   662662..662804,664869..664951,665046..665137))
FT                   /gene="Hdac3"
FT                   /locus_tag="mCG_128932"
FT                   /product="histone deacetylase 3, transcript variant
FT                   mCT174331"
FT                   /note="gene_id=mCG128932.1 transcript_id=mCT174331.0
FT                   created on 14-OCT-2002"
FT   mRNA            complement(join(647176..647880,651151..651308,
FT                   651576..651655,651905..651963,652075..652164,
FT                   653651..653703,662739..662804,664869..664951,
FT                   665046..665122))
FT                   /gene="Hdac3"
FT                   /locus_tag="mCG_128932"
FT                   /product="histone deacetylase 3, transcript variant
FT                   mCT174330"
FT                   /note="gene_id=mCG128932.1 transcript_id=mCT174330.0
FT                   created on 14-OCT-2002"
FT   mRNA            complement(join(647276..647880,651151..651308,
FT                   651576..651655,651905..651963,652075..652164,
FT                   653651..653715,653873..653946,654324..654404,
FT                   655083..655216,655531..655586,655702..655758,
FT                   655885..655966,664869..664951,665046..665161))
FT                   /gene="Hdac3"
FT                   /locus_tag="mCG_128932"
FT                   /product="histone deacetylase 3, transcript variant
FT                   mCT174329"
FT                   /note="gene_id=mCG128932.1 transcript_id=mCT174329.0
FT                   created on 14-OCT-2002"
FT   CDS             complement(join(647811..647880,651151..651308,
FT                   651576..651655,651905..651963,652075..652164,
FT                   653651..653703,662739..662804,664869..664951,
FT                   665046..665100))
FT                   /codon_start=1
FT                   /gene="Hdac3"
FT                   /locus_tag="mCG_128932"
FT                   /product="histone deacetylase 3, isoform CRA_b"
FT                   /note="gene_id=mCG128932.1 transcript_id=mCT174330.0
FT                   protein_id=mCP97250.0 isoform=CRA_b"
FT                   /db_xref="GOA:G3X9M4"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR003084"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="MGI:MGI:1343091"
FT                   /db_xref="UniProtKB/TrEMBL:G3X9M4"
FT                   /protein_id="EDL10111.1"
FT                   /translation="MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKM
FT                   IVFKPYQASQHDMCRFHSEDYIDSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGG
FT                   GGYTVRNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQY
FT                   LDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEF
FT                   YDGDHDNDKESDVEI"
FT   CDS             complement(join(647811..647880,651151..651308,
FT                   651576..651655,651905..651963,652075..652164,
FT                   653651..653715,653873..653946,654324..654404,
FT                   655083..655216,655531..655586,655702..655758,
FT                   655885..655966,662662..662804,664869..664951,
FT                   665046..665100))
FT                   /codon_start=1
FT                   /gene="Hdac3"
FT                   /locus_tag="mCG_128932"
FT                   /product="histone deacetylase 3, isoform CRA_a"
FT                   /note="gene_id=mCG128932.1 transcript_id=mCT130237.1
FT                   protein_id=mCP77967.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q3UM33"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR003084"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="MGI:MGI:1343091"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UM33"
FT                   /protein_id="EDL10110.1"
FT                   /translation="MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKM
FT                   IVFKPYQASQHDMCRFHSEDYIDFLQRVSPTNMQGFTKSLNAFNVGDDCPVFPGLFEFC
FT                   SRYTGASLQGATQLNNKICDIAINWAGGLHHAKKFEASGFCYVNDIVIGILELLKYHPR
FT                   VLYIDIDIHHGDGVQEAFYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVP
FT                   LRDGIDDQSYKHLFQPVISQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVE
FT                   YVKSFNIPLLVLGGGGYTVRNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHP
FT                   DVSTRIENQNSRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERG
FT                   PEENYSRPEAPNEFYDGDHDNDKESDVEI"
FT   CDS             complement(join(647811..647880,651151..651308,
FT                   651576..651655,651905..651963,652075..652164,
FT                   653651..653715,653873..653946,654324..654404,
FT                   655083..655131))
FT                   /codon_start=1
FT                   /gene="Hdac3"
FT                   /locus_tag="mCG_128932"
FT                   /product="histone deacetylase 3, isoform CRA_d"
FT                   /note="gene_id=mCG128932.1 transcript_id=mCT174329.0
FT                   protein_id=mCP97251.0 isoform=CRA_d"
FT                   /protein_id="EDL10113.1"
FT                   /translation="MTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSY
FT                   KHLFQPVISQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLL
FT                   VLGGGGYTVRNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQN
FT                   SRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEA
FT                   PNEFYDGDHDNDKESDVEI"
FT   CDS             complement(join(651798..651963,652075..652164,
FT                   653651..653715,653873..653946,654324..654404,
FT                   655083..655216,655531..655586,655702..655758,
FT                   655885..655966,662662..662804,664869..664951,
FT                   665046..665100))
FT                   /codon_start=1
FT                   /gene="Hdac3"
FT                   /locus_tag="mCG_128932"
FT                   /product="histone deacetylase 3, isoform CRA_c"
FT                   /note="gene_id=mCG128932.1 transcript_id=mCT174331.0
FT                   protein_id=mCP97248.0 isoform=CRA_c"
FT                   /protein_id="EDL10112.1"
FT                   /translation="MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKM
FT                   IVFKPYQASQHDMCRFHSEDYIDFLQRVSPTNMQGFTKSLNAFNVGDDCPVFPGLFEFC
FT                   SRYTGASLQGATQLNNKICDIAINWAGGLHHAKKFEASGFCYVNDIVIGILELLKYHPR
FT                   VLYIDIDIHHGDGVQEAFYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVP
FT                   LRDGIDDQSYKHLFQPVISQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVE
FT                   YVKSFNIPLLVLGGGGYTVRNVARCWTYETSLLVEEAISEELPYSGKIHFMMPPQGDTI
FT                   LTSPQNDLVWREIAPSGSSAD"
FT   mRNA            complement(join(651907..651963,652075..652153,
FT                   653641..653715,653873..654404,655083..655216,
FT                   655531..655586,655702..655758,655885..655966,
FT                   662662..662804,664869..664951,665046..665155))
FT                   /gene="Hdac3"
FT                   /locus_tag="mCG_128932"
FT                   /product="histone deacetylase 3, transcript variant
FT                   mCT174332"
FT                   /note="gene_id=mCG128932.1 transcript_id=mCT174332.0
FT                   created on 14-OCT-2002"
FT   CDS             complement(join(654313..654404,655083..655216,
FT                   655531..655586,655702..655758,655885..655966,
FT                   662662..662804,664869..664951,665046..665100))
FT                   /codon_start=1
FT                   /gene="Hdac3"
FT                   /locus_tag="mCG_128932"
FT                   /product="histone deacetylase 3, isoform CRA_e"
FT                   /note="gene_id=mCG128932.1 transcript_id=mCT174332.0
FT                   protein_id=mCP97249.0 isoform=CRA_e"
FT                   /protein_id="EDL10114.1"
FT                   /translation="MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKM
FT                   IVFKPYQASQHDMCRFHSEDYIDFLQRVSPTNMQGFTKSLNAFNVGDDCPVFPGLFEFC
FT                   SRYTGASLQGATQLNNKICDIAINWAGGLHHAKKFEASGFCYVNDIVIGILELLKYHPR
FT                   VLYIDIDIHHGDGVQEAFYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVP
FT                   LRDGIDDQSKF"
FT   gene            665783..669422
FT                   /gene="4631403P03Rik"
FT                   /locus_tag="mCG_18336"
FT                   /note="gene_id=mCG18336.3"
FT   mRNA            join(665783..665862,665934..666166,666585..666824,
FT                   667186..667251,667346..667412,667846..668031,
FT                   668271..668646,668769..668828,669016..669422)
FT                   /gene="4631403P03Rik"
FT                   /locus_tag="mCG_18336"
FT                   /product="RIKEN cDNA 4631403P03, transcript variant
FT                   mCT174391"
FT                   /note="gene_id=mCG18336.3 transcript_id=mCT174391.1 created
FT                   on 13-JUN-2003"
FT   mRNA            join(665783..665862,665934..666166,666585..666824,
FT                   667186..667251,667346..667412,667846..668031,
FT                   668271..669419)
FT                   /gene="4631403P03Rik"
FT                   /locus_tag="mCG_18336"
FT                   /product="RIKEN cDNA 4631403P03, transcript variant
FT                   mCT12934"
FT                   /note="gene_id=mCG18336.3 transcript_id=mCT12934.3 created
FT                   on 13-JUN-2003"
FT   mRNA            join(665783..665862,665934..666166,667186..667251,
FT                   667346..667412,667846..668031,668271..669419)
FT                   /gene="4631403P03Rik"
FT                   /locus_tag="mCG_18336"
FT                   /product="RIKEN cDNA 4631403P03, transcript variant
FT                   mCT174392"
FT                   /note="gene_id=mCG18336.3 transcript_id=mCT174392.1 created
FT                   on 13-JUN-2003"
FT   assembly_gap    665913..665932
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(666641..666824,667186..667251,667346..667412,
FT                   667846..668031,668271..668646,668769..668801)
FT                   /codon_start=1
FT                   /gene="4631403P03Rik"
FT                   /locus_tag="mCG_18336"
FT                   /product="RIKEN cDNA 4631403P03, isoform CRA_a"
FT                   /note="gene_id=mCG18336.3 transcript_id=mCT174391.1
FT                   protein_id=mCP97311.0 isoform=CRA_a"
FT                   /protein_id="EDL10107.1"
FT                   /translation="MSEPQPDLEPPQHGLYMLFLLVLVFFLMGLVGFMICHVLKKKGYR
FT                   CRTSRGSEPDDAQLQPPEDDDVNEDTVERIVRCIIQNEANAEALKEMLGDSEGEGTVQL
FT                   SSVDATSSLQDGAPSHHHTVHLGSAAPCIHCSRSKRPPLVRQGRSKEGKSRPRPGETTV
FT                   FSVGRFRVTHIEKRYGLHEHRDGSPTDRSWGSGGGQEPGGSQAAGGGQPRTGTAAIERL
FT                   LPEPPPSQAAATHSVQNGRLQDASLVPCTLEGTPGTSAELNLGPRGRDPSPGLSSQEAN
FT                   GQPTKLDTSGQQESLPPEAGGM"
FT   CDS             join(666641..666824,667186..667251,667346..667412,
FT                   667846..668031,668271..668652)
FT                   /codon_start=1
FT                   /gene="4631403P03Rik"
FT                   /locus_tag="mCG_18336"
FT                   /product="RIKEN cDNA 4631403P03, isoform CRA_c"
FT                   /note="gene_id=mCG18336.3 transcript_id=mCT12934.3
FT                   protein_id=mCP8358.2 isoform=CRA_c"
FT                   /db_xref="GOA:Q8CFT0"
FT                   /db_xref="InterPro:IPR022248"
FT                   /db_xref="MGI:MGI:1918044"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CFT0"
FT                   /protein_id="EDL10109.1"
FT                   /translation="MSEPQPDLEPPQHGLYMLFLLVLVFFLMGLVGFMICHVLKKKGYR
FT                   CRTSRGSEPDDAQLQPPEDDDVNEDTVERIVRCIIQNEANAEALKEMLGDSEGEGTVQL
FT                   SSVDATSSLQDGAPSHHHTVHLGSAAPCIHCSRSKRPPLVRQGRSKEGKSRPRPGETTV
FT                   FSVGRFRVTHIEKRYGLHEHRDGSPTDRSWGSGGGQEPGGSQAAGGGQPRTGTAAIERL
FT                   LPEPPPSQAAATHSVQNGRLQDASLVPCTLEGTPGTSAELNLGPRGRDPSPGLSSQEAN
FT                   GQPTKLDTSGQQV"
FT   CDS             join(667369..667412,667846..668031,668271..668652)
FT                   /codon_start=1
FT                   /gene="4631403P03Rik"
FT                   /locus_tag="mCG_18336"
FT                   /product="RIKEN cDNA 4631403P03, isoform CRA_b"
FT                   /note="gene_id=mCG18336.3 transcript_id=mCT174392.1
FT                   protein_id=mCP97310.0 isoform=CRA_b"
FT                   /protein_id="EDL10108.1"
FT                   /translation="MLGDSEGEGTVQLSSVDATSSLQDGAPSHHHTVHLGSAAPCIHCS
FT                   RSKRPPLVRQGRSKEGKSRPRPGETTVFSVGRFRVTHIEKRYGLHEHRDGSPTDRSWGS
FT                   GGGQEPGGSQAAGGGQPRTGTAAIERLLPEPPPSQAAATHSVQNGRLQDASLVPCTLEG
FT                   TPGTSAELNLGPRGRDPSPGLSSQEANGQPTKLDTSGQQV"
FT   gene            complement(667689..680025)
FT                   /gene="Fchsd1"
FT                   /locus_tag="mCG_18338"
FT                   /note="gene_id=mCG18338.2"
FT   mRNA            complement(join(667689..669911,670035..670090,
FT                   671502..671589,672828..673048,673175..673292,
FT                   673383..673466,673548..673676,674263..674424,
FT                   674569..674673,675046..675165,675906..676001,
FT                   676154..676276,676696..676824,677618..678008))
FT                   /gene="Fchsd1"
FT                   /locus_tag="mCG_18338"
FT                   /product="FCH and double SH3 domains 1, transcript variant
FT                   mCT174396"
FT                   /note="gene_id=mCG18338.2 transcript_id=mCT174396.0 created
FT                   on 14-OCT-2002"
FT   mRNA            complement(join(667689..669911,670035..670726))
FT                   /gene="Fchsd1"
FT                   /locus_tag="mCG_18338"
FT                   /product="FCH and double SH3 domains 1, transcript variant
FT                   mCT174397"
FT                   /note="gene_id=mCG18338.2 transcript_id=mCT174397.0 created
FT                   on 14-OCT-2002"
FT   mRNA            complement(join(668933..669911,670035..670090,
FT                   671502..671589,672828..673048,673175..673292,
FT                   673383..673466,673548..673676,674263..674424,
FT                   674569..674673,675046..675165,675906..676001,
FT                   676154..676276,676696..676824,677618..677681,
FT                   677793..677929,678015..678156,678469..678536,
FT                   679005..679050,679610..679707,679961..680025))
FT                   /gene="Fchsd1"
FT                   /locus_tag="mCG_18338"
FT                   /product="FCH and double SH3 domains 1, transcript variant
FT                   mCT12416"
FT                   /note="gene_id=mCG18338.2 transcript_id=mCT12416.2 created
FT                   on 14-OCT-2002"
FT   mRNA            complement(join(669382..669911,670035..670090,
FT                   671502..671589,672828..673048,673175..673292,
FT                   673383..673466,673548..673676,674263..674424,
FT                   674569..674673,675046..675165,675906..676001,
FT                   676154..676276,676696..676824,677618..677681,
FT                   677793..677929,678015..678150,678469..678536,
FT                   679005..679050,679610..679707,679961..>680005))
FT                   /gene="Fchsd1"
FT                   /locus_tag="mCG_18338"
FT                   /product="FCH and double SH3 domains 1, transcript variant
FT                   mCT190268"
FT                   /note="gene_id=mCG18338.2 transcript_id=mCT190268.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(669846..669911,670035..670090,
FT                   671502..671589,672828..673048,673175..673292,
FT                   673383..673466,673548..673676,674263..674424,
FT                   674569..674673,675046..675165,675906..676001,
FT                   676154..676276,676696..676824,677618..677681,
FT                   677793..677929,678015..678150,678469..678536,
FT                   679005..679050,679610..679707,679961..>680005))
FT                   /codon_start=1
FT                   /gene="Fchsd1"
FT                   /locus_tag="mCG_18338"
FT                   /product="FCH and double SH3 domains 1, isoform CRA_f"
FT                   /note="gene_id=mCG18338.2 transcript_id=mCT190268.0
FT                   protein_id=mCP111279.0 isoform=CRA_f"
FT                   /protein_id="EDL10106.1"
FT                   /translation="LAAFAGAAMQPPPRKVKPAQEVKLRFLEQLSILQTRQQREADLLE
FT                   DIRSYSKQRAAIEREYGQALQKLAGPFLKREGQRSGEADSRTVFGAWRCLLDATVAGGQ
FT                   TRLQASDRYRDLAGGTGRSAKEQVLRKGTESLQQAQAEVLQSVRELSRSRKLYGQRQRV
FT                   WALAQEKAADVQARLNRSDHGIFHSRTSLQKLSTKLSAQSAQYSQQLRAARNEYLLNLV
FT                   ATNAHLAHYYQEELPALLKVLVSELSEYLRDPLTLLGHTELEAAEMILEHARHGGKATS
FT                   QVNWEQDVKLFLQGPGVFSPTPPQQFQPAGADQVCGLEWGAGGMAGESGLEKEVQRWTS
FT                   RAARDYKIQHHGHRVLQRLEQRRQQAPGREAPGVEQRLQEVRENIRRAQVSQVKGAARL
FT                   ALLQEAGLDVQRWLKPAMTQAQDEVEQERRLSEARLSQRDLSPTAEDAELSDFDECEEA
FT                   GELFEEPAPPALATRPLPCPAHVVFGYQAGREDELTITEGEWLEVIEEGDADEWVKARN
FT                   QHGEAGFVPERYLNFPDLSLPESCHGIDNPSGGEPTAFLARALYSYTGQSEEELSFPEG
FT                   ALIRLLPRAQDGVDDGFWRGEFGGHVGVFPSLLVEELLGPPGPPELSDPEQMLPSPSPP
FT                   SFSPPAPTCALDGSTAPALPSDKVLDCPGPLDMMVPRLRPMRPPPPPPAKAPDPGHPDP
FT                   LT"
FT   CDS             complement(join(669846..669911,670035..670090,
FT                   671502..671589,672828..673048,673175..673292,
FT                   673383..673466,673548..673676,674263..674424,
FT                   674569..674673,675046..675165,675906..676001,
FT                   676154..676276,676696..676824,677618..677681,
FT                   677793..677929,678015..678156,678469..678536,
FT                   679005..679050,679610..679707,679961..679981))
FT                   /codon_start=1
FT                   /gene="Fchsd1"
FT                   /locus_tag="mCG_18338"
FT                   /product="FCH and double SH3 domains 1, isoform CRA_a"
FT                   /note="gene_id=mCG18338.2 transcript_id=mCT12416.2
FT                   protein_id=mCP8376.2 isoform=CRA_a"
FT                   /protein_id="EDL10101.1"
FT                   /translation="MQPPPRKVKPAQEVKLRFLEQLSILQTRQQREADLLEDIRSYSKQ
FT                   RAAIEREYGQALQKLAGPFLKREGQRSGEADSRGRTVFGAWRCLLDATVAGGQTRLQAS
FT                   DRYRDLAGGTGRSAKEQVLRKGTESLQQAQAEVLQSVRELSRSRKLYGQRQRVWALAQE
FT                   KAADVQARLNRSDHGIFHSRTSLQKLSTKLSAQSAQYSQQLRAARNEYLLNLVATNAHL
FT                   AHYYQEELPALLKVLVSELSEYLRDPLTLLGHTELEAAEMILEHARHGGKATSQVNWEQ
FT                   DVKLFLQGPGVFSPTPPQQFQPAGADQVCGLEWGAGGMAGESGLEKEVQRWTSRAARDY
FT                   KIQHHGHRVLQRLEQRRQQAPGREAPGVEQRLQEVRENIRRAQVSQVKGAARLALLQEA
FT                   GLDVQRWLKPAMTQAQDEVEQERRLSEARLSQRDLSPTAEDAELSDFDECEEAGELFEE
FT                   PAPPALATRPLPCPAHVVFGYQAGREDELTITEGEWLEVIEEGDADEWVKARNQHGEAG
FT                   FVPERYLNFPDLSLPESCHGIDNPSGGEPTAFLARALYSYTGQSEEELSFPEGALIRLL
FT                   PRAQDGVDDGFWRGEFGGHVGVFPSLLVEELLGPPGPPELSDPEQMLPSPSPPSFSPPA
FT                   PTCALDGSTAPALPSDKVLDCPGPLDMMVPRLRPMRPPPPPPAKAPDPGHPDPLT"
FT   CDS             complement(join(669846..669911,670035..670090,
FT                   671502..671589,672828..673048,673175..673292,
FT                   673383..673466,673548..673676,674263..674424,
FT                   674569..674673,675046..675165,675906..676001,
FT                   676154..676198))
FT                   /codon_start=1
FT                   /gene="Fchsd1"
FT                   /locus_tag="mCG_18338"
FT                   /product="FCH and double SH3 domains 1, isoform CRA_c"
FT                   /note="gene_id=mCG18338.2 transcript_id=mCT174396.0
FT                   protein_id=mCP97314.0 isoform=CRA_c"
FT                   /protein_id="EDL10103.1"
FT                   /translation="MILEHARHGGKATSQVNWEQDVKLFLQGPGVFSPTPPQQFQPAGA
FT                   DQVCGLEWGAGGMAGESGLEKEVQRWTSRAARDYKIQHHGHRVLQRLEQRRQQAPGREA
FT                   PGVEQRLQEVRENIRRAQVSQVKGAARLALLQEAGLDVQRWLKPAMTQAQDEVEQERRL
FT                   SEARLSQRDLSPTAEDAELSDFDECEEAGELFEEPAPPALATRPLPCPAHVVFGYQAGR
FT                   EDELTITEGEWLEVIEEGDADEWVKARNQHGEAGFVPERYLNFPDLSLPESCHGIDNPS
FT                   GGEPTAFLARALYSYTGQSEEELSFPEGALIRLLPRAQDGVDDGFWRGEFGGHVGVFPS
FT                   LLVEELLGPPGPPELSDPEQMLPSPSPPSFSPPAPTCALDGSTAPALPSDKVLDCPGPL
FT                   DMMVPRLRPMRPPPPPPAKAPDPGHPDPLT"
FT   CDS             complement(join(669846..669911,670035..670145))
FT                   /codon_start=1
FT                   /gene="Fchsd1"
FT                   /locus_tag="mCG_18338"
FT                   /product="FCH and double SH3 domains 1, isoform CRA_d"
FT                   /note="gene_id=mCG18338.2 transcript_id=mCT174397.0
FT                   protein_id=mCP97315.0 isoform=CRA_d"
FT                   /protein_id="EDL10104.1"
FT                   /translation="MQYGADQSLRIDFWFLFLDKVLDCPGPLDMMVPRLRPMRPPPPPP
FT                   AKAPDPGHPDPLT"
FT   mRNA            complement(join(673219..673292,673383..673676,
FT                   674263..674424,674569..674673,675046..675165,
FT                   675906..676001,676154..676276,676696..676824,
FT                   677618..677681,677793..677929,678015..678156,
FT                   678469..678536,679005..679050,679610..679707,
FT                   679961..680025))
FT                   /gene="Fchsd1"
FT                   /locus_tag="mCG_18338"
FT                   /product="FCH and double SH3 domains 1, transcript variant
FT                   mCT174395"
FT                   /note="gene_id=mCG18338.2 transcript_id=mCT174395.0 created
FT                   on 14-OCT-2002"
FT   CDS             complement(join(673542..673676,674263..674424,
FT                   674569..674673,675046..675165,675906..676001,
FT                   676154..676276,676696..676824,677618..677681,
FT                   677793..677929,678015..678156,678469..678536,
FT                   679005..679050,679610..679707,679961..679981))
FT                   /codon_start=1
FT                   /gene="Fchsd1"
FT                   /locus_tag="mCG_18338"
FT                   /product="FCH and double SH3 domains 1, isoform CRA_b"
FT                   /note="gene_id=mCG18338.2 transcript_id=mCT174395.0
FT                   protein_id=mCP97317.0 isoform=CRA_b"
FT                   /protein_id="EDL10102.1"
FT                   /translation="MQPPPRKVKPAQEVKLRFLEQLSILQTRQQREADLLEDIRSYSKQ
FT                   RAAIEREYGQALQKLAGPFLKREGQRSGEADSRGRTVFGAWRCLLDATVAGGQTRLQAS
FT                   DRYRDLAGGTGRSAKEQVLRKGTESLQQAQAEVLQSVRELSRSRKLYGQRQRVWALAQE
FT                   KAADVQARLNRSDHGIFHSRTSLQKLSTKLSAQSAQYSQQLRAARNEYLLNLVATNAHL
FT                   AHYYQEELPALLKVLVSELSEYLRDPLTLLGHTELEAAEMILEHARHGGKATSQVNWEQ
FT                   DVKLFLQGPGVFSPTPPQQFQPAGADQVCGLEWGAGGMAGESGLEKEVQRWTSRAARDY
FT                   KIQHHGHRVLQRLEQRRQQAPGREAPGVEQRLQEVRENIRRAQVSQVKGAARLALLQEA
FT                   GLDVQRWLKPAMTQAQDEVEQERRLSEARLSQRDLSPTAEDAELSDFDECEEAGELFEE
FT                   PAPPALATRPLPCPAHVVFGYQV"
FT   mRNA            complement(join(677895..678156,678469..678536,
FT                   679005..679050,679610..679707,679961..680014))
FT                   /gene="Fchsd1"
FT                   /locus_tag="mCG_18338"
FT                   /product="FCH and double SH3 domains 1, transcript variant
FT                   mCT174398"
FT                   /note="gene_id=mCG18338.2 transcript_id=mCT174398.0 created
FT                   on 14-OCT-2002"
FT   CDS             complement(join(677970..678156,678469..678536,
FT                   679005..679050,679610..679707,679961..679981))
FT                   /codon_start=1
FT                   /gene="Fchsd1"
FT                   /locus_tag="mCG_18338"
FT                   /product="FCH and double SH3 domains 1, isoform CRA_e"
FT                   /note="gene_id=mCG18338.2 transcript_id=mCT174398.0
FT                   protein_id=mCP97316.0 isoform=CRA_e"
FT                   /protein_id="EDL10105.1"
FT                   /translation="MQPPPRKVKPAQEVKLRFLEQLSILQTRQQREADLLEDIRSYSKQ
FT                   RAAIEREYGQALQKLAGPFLKREGQRSGEADSRGRTVFGAWRCLLDATVAGGQTRLQAS
FT                   DRYRDLAGGTGRSAKEQVLRKVCVRGWGRGTSSSD"
FT   gene            complement(682880..>707352)
FT                   /gene="Centd3"
FT                   /locus_tag="mCG_128930"
FT                   /note="gene_id=mCG128930.1"
FT   mRNA            complement(join(682880..683906,684357..684395,
FT                   684620..684757,684873..684936,685642..685677,
FT                   685771..685853,686078..686211,686295..686423,
FT                   688607..688721,688804..688878,690091..690159,
FT                   690441..690588,691568..691673,692220..692432,
FT                   694505..694668,694860..694923,695584..695803,
FT                   697826..697928,698025..698172,698586..698699,
FT                   699330..699465,699634..699816,699957..700042,
FT                   700147..700346,700783..700889,700973..701157,
FT                   701239..701359,701599..701668,701810..702001,
FT                   706446..706557,706656..706717,706823..>707352))
FT                   /gene="Centd3"
FT                   /locus_tag="mCG_128930"
FT                   /product="centaurin, delta 3, transcript variant mCT130235"
FT                   /note="gene_id=mCG128930.1 transcript_id=mCT130235.1
FT                   created on 14-OCT-2002"
FT   CDS             complement(join(683427..683906,684357..684395,
FT                   684620..684757,684873..684936,685642..685677,
FT                   685771..685853,686078..686211,686295..686423,
FT                   688607..688721,688804..688878,690091..690159,
FT                   690441..690588,691568..691673,692220..692432,
FT                   694505..694668,694860..694923,695584..695803,
FT                   697826..697928,698025..698172,698586..698699,
FT                   699330..699465,699634..699816,699957..700042,
FT                   700147..700346,700783..700889,700973..701157,
FT                   701239..701359,701599..701668,701810..702001,
FT                   706446..706557,706656..706717,706823..>707349))
FT                   /codon_start=1
FT                   /gene="Centd3"
FT                   /locus_tag="mCG_128930"
FT                   /product="centaurin, delta 3, isoform CRA_b"
FT                   /note="gene_id=mCG128930.1 transcript_id=mCT130235.1
FT                   protein_id=mCP77625.1 isoform=CRA_b"
FT                   /protein_id="EDL10100.1"
FT                   /translation="KPMAAPQDLDIAVWLALVHLEQYADTFRRHGLATAGAAQHLGHEE
FT                   LRHLGISATGHRKRILRLLRAGSAEGFLDSHLDNTMEPTPSPAPDAQPPKPVPKPRTVF
FT                   GLSNPATAQRPGLSPIFWDPEVSRNSECTQRSSPLLPSSSEQPSVPNTMEMMPNAIYFG
FT                   LDLRGQAQAAQDVTPDSSQATVPTPAFRPTTGTVHIMDPGCLYYGVQPVGIPGASDRRD
FT                   GRGVCQERAEHRQDLETREDAGYASLELPGDSILSLPTQDAETSDDLISPYASFSSTAD
FT                   RPVPLLSGWLDKLSPQGNYVFQRRFVQFNGRSLMYFGSDKDPFPKGVIPLTAIEMTRSS
FT                   KDNKFQVITGQRVFVFRTESEAQRDLWCSTLQSCLKEQRLLGHPRPPHPPRPLRTGTLE
FT                   LRGHKAKVFAALIPGELALYKSEQAFSLGIGICFIELQGCSVRETKSRSFDLLTPHRCF
FT                   SFTAESGGARQSWAAALQEAVTETLSDYEVAEKVWSNPANRHCADCRASRPDWAAVNLG
FT                   VVICKQCAGQHRALGSGISKVQSLKLDTSVWSNEIVQLFIVLGNDRANCFWAGALPPGE
FT                   GLHPDSAPGPRGEFISRKYKLGLFRKPHPRHPDHSQLLQALCAAMAGPNLLKNMAQLLC
FT                   VETSEGEEPLSPSALNGSLLSLLPSDSPGVYNEVVVPATYRGFLYCGSISNKAGAPPLR
FT                   RGRDAPPRLWCVLGAALEMFASESSPEPLSLLQPQDIVCLGVSPPPADPGDLDRFPFSF
FT                   ELILTGGRIQHFATDGADSLEAWISAVGKWFSPLSCHQLLGPGLLRMGRLWLRSPSHAG
FT                   LAPGLWLSGFGLLRGDHLFLCPAPGPGPPAPEDMVHLRRLQEISVVSAADTPDKKEHLV
FT                   LVETGRTLYLQGEGRLDFAAWNTAIGGAAGGGGTGLQEQQMSRGDIPIIVDACISFVTQ
FT                   HGLRLEGVYRKGGARARSLRLLAEFRRDARSVKLRPREHFVEDVTDTLKRFFRELDDPV
FT                   TSARLLPRWREAAELSQKNQRLEKYKEVISCLPRVNRRTLATLIGHLYRVQKCASLNQM
FT                   CTRNLALLFAPSVFQTDGRGEHEVRVLQELIDGYISVFDIDSDQAAQIDLEVSLITTWK
FT                   DVQLSQAGDLIMEVYIEQQLPDNCVTLKVSPTLTAEELTNQVLEMRGAASGTDLWVTFE
FT                   ILEHGELERPLHPKEKVLEQALQWCQLPEPCSASLLLRKVSMAHAGCLFTGVRRESPRV
FT                   GLLRCREEPPRLLGNRFQERFFLVRGRCLLLLKEKKSSKPEREWSLEGAKVYLGIRKKL
FT                   KPPTLWGFTLILEKMHLCLSCMDEEEMWDWTTSILKAQHDDQQSVVLRRRSSSDLARQK
FT                   FGTMPLLPIRGDDSGATLLSANQTLRRLHNRRTLSMFFPMKSPQGSVEEQDELEEPVYE
FT                   EPVYEEVGAFPELTKDTTFSSTWEWSAKSDPSLTSQRSFDQPPLSKASMLGHEERIPDP
FT                   PPGPPSKSSSQARGSLEEQLLQELNNLILRKGEPASCPESSSQPTSPQAPSPTSLPTPT
FT                   PSLPTQPPCTSNPPSSQPLT"
FT   mRNA            complement(join(693067..693428,694505..694668,
FT                   694860..694923,695584..695803,697826..697928,
FT                   698025..698172,698586..698699,699330..699465,
FT                   699634..699816,699957..700042,700147..700346,
FT                   700783..700889,700973..701157,701239..701359,
FT                   701599..701668,701810..702001,706446..706557,
FT                   706656..706717,706823..707352))
FT                   /gene="Centd3"
FT                   /locus_tag="mCG_128930"
FT                   /product="centaurin, delta 3, transcript variant mCT174328"
FT                   /note="gene_id=mCG128930.1 transcript_id=mCT174328.0
FT                   created on 14-OCT-2002"
FT   CDS             complement(join(693409..693428,694505..694668,
FT                   694860..694923,695584..695803,697826..697928,
FT                   698025..698172,698586..698699,699330..699465,
FT                   699634..699816,699957..700042,700147..700346,
FT                   700783..700889,700973..701157,701239..701359,
FT                   701599..701668,701810..702001,706446..706557,
FT                   706656..706717,706823..707343))
FT                   /codon_start=1
FT                   /gene="Centd3"
FT                   /locus_tag="mCG_128930"
FT                   /product="centaurin, delta 3, isoform CRA_a"
FT                   /note="gene_id=mCG128930.1 transcript_id=mCT174328.0
FT                   protein_id=mCP97247.0 isoform=CRA_a"
FT                   /protein_id="EDL10099.1"
FT                   /translation="MAAPQDLDIAVWLALVHLEQYADTFRRHGLATAGAAQHLGHEELR
FT                   HLGISATGHRKRILRLLRAGSAEGFLDSHLDNTMEPTPSPAPDAQPPKPVPKPRTVFGL
FT                   SNPATAQRPGLSPIFWDPEVSRNSECTQRSSPLLPSSSEQPSVPNTMEMMPNAIYFGLD
FT                   LRGQAQAAQDVTPDSSQATVPTPAFRPTTGTVHIMDPGCLYYGVQPVGIPGASDRRDGR
FT                   GVCQERAEHRQDLETREDAGYASLELPGDSILSLPTQDAETSDDLISPYASFSSTADRP
FT                   VPLLSGWLDKLSPQGNYVFQRRFVQFNGRSLMYFGSDKDPFPKGVIPLTAIEMTRSSKD
FT                   NKFQVITGQRVFVFRTESEAQRDLWCSTLQSCLKEQRLLGHPRPPHPPRPLRTGTLELR
FT                   GHKAKVFAALIPGELALYKSEQAFSLGIGICFIELQGCSVRETKSRSFDLLTPHRCFSF
FT                   TAESGGARQSWAAALQEAVTETLSDYEVAEKVWSNPANRHCADCRASRPDWAAVNLGVV
FT                   ICKQCAGQHRALGSGISKVQSLKLDTSVWSNEIVQLFIVLGNDRANCFWAGALPPGEGL
FT                   HPDSAPGPRGEFISRKYKLGLFRKPHPRHPDHSQLLQALCAAMAGPNLLKNMAQLLCVE
FT                   TSEGEEPLSPSALNGSLLSLLPSDSPGVYNEVVVPATYRGFLYCGSISNKAGAPPLRRG
FT                   RDAPPRLWCVLGAALEMFASESSPEPLSLLQPQDIVCLGVSPPPADPGDLDRFPFSFEL
FT                   ILTGGRIQHFATDGADSLEAWISAVGKWFSPLSCHQLLGPGLLRMGRLWLRSPSHAGLA
FT                   PGLWLSGFGLLRGDHLFLCPAPGPGPPAPEDMVHLRRLQEISVVSAADTPDKKEHLVLV
FT                   ETGRTLYLQGEGRLDFAAWNTAIGGAAGGGGTGLQEQQMSRGDIPIIVDACISFVTQHA
FT                   SLAFI"
FT   assembly_gap    703192..703211
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    708883..709223
FT                   /estimated_length=341
FT                   /gap_type="unknown"
FT   assembly_gap    716778..716797
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    727524..727800
FT                   /estimated_length=277
FT                   /gap_type="unknown"
FT   assembly_gap    739549..739568
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    745505..745524
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    747263..747282
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    762843..763154
FT                   /estimated_length=312
FT                   /gap_type="unknown"
FT   assembly_gap    773285..773304
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    788404..788636
FT                   /estimated_length=233
FT                   /gap_type="unknown"
FT   assembly_gap    794232..794251
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    841514..841752
FT                   /estimated_length=239
FT                   /gap_type="unknown"
FT   assembly_gap    848863..850449
FT                   /estimated_length=1587
FT                   /gap_type="unknown"
FT   assembly_gap    852253..852402
FT                   /estimated_length=150
FT                   /gap_type="unknown"
FT   assembly_gap    876925..876987
FT                   /estimated_length=63
FT                   /gap_type="unknown"
FT   assembly_gap    878633..878652
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    886297..886383
FT                   /estimated_length=87
FT                   /gap_type="unknown"
FT   assembly_gap    892775..893488
FT                   /estimated_length=714
FT                   /gap_type="unknown"
FT   assembly_gap    897213..897377
FT                   /estimated_length=165
FT                   /gap_type="unknown"
FT   gene            complement(907823..920891)
FT                   /gene="Pcdh1"
FT                   /locus_tag="mCG_142244"
FT                   /note="gene_id=mCG142244.0"
FT   mRNA            complement(join(907823..910656,913876..914738,
FT                   920688..920891))
FT                   /gene="Pcdh1"
FT                   /locus_tag="mCG_142244"
FT                   /product="protocadherin 1"
FT                   /note="gene_id=mCG142244.0 transcript_id=mCT179463.0
FT                   created on 06-FEB-2003"
FT   CDS             complement(join(908377..910656,913876..914712))
FT                   /codon_start=1
FT                   /gene="Pcdh1"
FT                   /locus_tag="mCG_142244"
FT                   /product="protocadherin 1"
FT                   /note="gene_id=mCG142244.0 transcript_id=mCT179463.0
FT                   protein_id=mCP102385.0 partial"
FT                   /protein_id="EDL10098.1"
FT                   /translation="MGPLRPSPGXXXXXXXSPPLLLALLLLLAPSASHTTQVVYKVPEE
FT                   QPPNTLIGSLAADYGLPDVGHLYKLEVGAPYLRVDGKTGDIFTTETSIDREGLRECQNQ
FT                   IPGNPCILEFEVSITDLVQNGSPRLLEGQIEVQDINDNTPNFASPVITLAIPENTNIGS
FT                   LFPIPLATDRDAGPNGVASYELQAGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWD
FT                   SYDLTIKVQDGGNPPRASSALLRVTVLDTNDNAPKFERPTYEAELSENSPIGHSVIQVK
FT                   ANDSDQGANAEIDYTFHQAPEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDR
FT                   GATPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSD
FT                   RDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVD
FT                   SGNPPLSSTNSLKVQVVDVNDNAPVFTQSITEVAFPENNKPGEVVAEVTASDADSGSNA
FT                   ELVYSLEPEPAAQGLFTISPENGEIRVKTSLDREQRDSYELKVVAADRGSPSLQGTATV
FT                   LVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENARVQLSVEQDNGD
FT                   FVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPFIT
FT                   APSNTSHRLLTPQTRLGETVSQVTAEDIDSGINAELTYSIAGGNPYGLFQIGSHSGAIT
FT                   LEKEIERRHHGLHRLVVKVSDRGKPPRYGTALVHLYVNETLANRTLLETLLVHSLDTPL
FT                   DIDIAGDPEYERSKQRGNILFGVVAGVVAVALLIALAVLVRYCRQREAKSGYQAGKKET
FT                   KDLYAPKPSGKAAKGSKSKGKKSKSPKPVKPVEDEDDTGLQKSLKFNLMSDAPGDSPRI
FT                   HLPLNYPPGSPDLGRHYRSNSPLPSIQLQPQSPSASKKHQVVQDLPPANTFVGTGDTTS
FT                   TGSEQYSDYSYRTNPPKYPSKQVGQPFRLSTPQPPPHPYHGAIWTEVWE"
FT   assembly_gap    914667..914686
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    923162..923313
FT                   /estimated_length=152
FT                   /gap_type="unknown"
FT   assembly_gap    934013..934205
FT                   /estimated_length=193
FT                   /gap_type="unknown"
FT   gene            complement(<950031..>961393)
FT                   /locus_tag="mCG_145146"
FT                   /note="gene_id=mCG145146.0"
FT   mRNA            complement(join(<950031..950162,950546..950724,
FT                   951812..951926,960934..>961393))
FT                   /locus_tag="mCG_145146"
FT                   /product="mCG145146"
FT                   /note="gene_id=mCG145146.0 transcript_id=mCT184570.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(<950031..950162,950546..>950639))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145146"
FT                   /product="mCG145146"
FT                   /note="gene_id=mCG145146.0 transcript_id=mCT184570.0
FT                   protein_id=mCP106250.0"
FT                   /protein_id="EDL10097.1"
FT                   /translation="IQTSGLSTFPTKIPLWSSQRTKCKRATISTAARKRGKATPRIHSK
FT                   RKTKRRRGSSQMLMFCFFDINLRTHMGVFI"
FT   gene            961457..973732
FT                   /gene="0610009O20Rik"
FT                   /locus_tag="mCG_18332"
FT                   /note="gene_id=mCG18332.2"
FT   mRNA            join(961457..961619,962306..962420,962503..962620,
FT                   964039..964183,965122..965283,965494..965582,
FT                   965684..965780,968484..968626,969254..969412,
FT                   969496..969588,971117..971276,972284..972505,
FT                   972986..973732)
FT                   /gene="0610009O20Rik"
FT                   /locus_tag="mCG_18332"
FT                   /product="RIKEN cDNA 0610009O20, transcript variant
FT                   mCT174387"
FT                   /note="gene_id=mCG18332.2 transcript_id=mCT174387.0 created
FT                   on 13-JUN-2003"
FT   mRNA            join(961457..961619,962306..962420,962503..962620,
FT                   964039..964183,965122..965283,965494..965582,
FT                   965684..966776)
FT                   /gene="0610009O20Rik"
FT                   /locus_tag="mCG_18332"
FT                   /product="RIKEN cDNA 0610009O20, transcript variant
FT                   mCT12932"
FT                   /note="gene_id=mCG18332.2 transcript_id=mCT12932.2 created
FT                   on 13-JUN-2003"
FT   mRNA            join(961457..961619,962306..962420,962503..962620,
FT                   964039..964427)
FT                   /gene="0610009O20Rik"
FT                   /locus_tag="mCG_18332"
FT                   /product="RIKEN cDNA 0610009O20, transcript variant
FT                   mCT174388"
FT                   /note="gene_id=mCG18332.2 transcript_id=mCT174388.1 created
FT                   on 13-JUN-2003"
FT   mRNA            join(961457..961619,962306..962420,962503..963070)
FT                   /gene="0610009O20Rik"
FT                   /locus_tag="mCG_18332"
FT                   /product="RIKEN cDNA 0610009O20, transcript variant
FT                   mCT174386"
FT                   /note="gene_id=mCG18332.2 transcript_id=mCT174386.1 created
FT                   on 13-JUN-2003"
FT   CDS             join(961589..961619,962306..962420,962503..962620,
FT                   964039..964183,965122..965283,965494..965582,
FT                   965684..965780,968484..968626,969254..969412,
FT                   969496..969588,971117..971276,972284..972504)
FT                   /codon_start=1
FT                   /gene="0610009O20Rik"
FT                   /locus_tag="mCG_18332"
FT                   /product="RIKEN cDNA 0610009O20, isoform CRA_c"
FT                   /note="gene_id=mCG18332.2 transcript_id=mCT174387.0
FT                   protein_id=mCP97305.0 isoform=CRA_c"
FT                   /protein_id="EDL10095.1"
FT                   /translation="MWRLTGILGRALPRLLGPGFRGITPKPTSSDGSQTTSPTLPLTRL
FT                   SFDRSGSHGSKRSRDPKCCGWKDAFHWMSAHVSPNTLRDAISWGTLAVLALHLARQIHF
FT                   HAPLVAGPQPAERSWHSPLYRFLSSSWWHPHSSLRRHVLPRPDCPAPRNTGLREPRQGQ
FT                   EDHPSAPSQCLPSDSSLRSGLLNLPEEEPSDFDFLHASRDFASQAKAAEAHPPGGKNEQ
FT                   DKAKALPLEEAVTSIQQLFQLSVAITFNFLGTENIKTGDYTAAFSYFQKAADRGYSKAQ
FT                   YNVGLCLEHGRGTPRDLSKAILFYHLAAVQGHSLAQYRYARCLLQSPGSLSDPERERAV
FT                   SLLKQAADSGLTEAQAFLGVLFTKEPHLDEQRAVKYLWLAASNGDSQSRFHLGICYEKG
FT                   LGAQRNLGEAVKCYQQAAAMGNEPARERLRTLFNVEAAGPSHLATTGLKSFSSPSLCSL
FT                   NTLLAGASGLPHASSTGNLGLLCRSGHLGASHGAPSRTIPSLERSLVRLGFG"
FT   CDS             join(961589..961619,962306..962420,962503..962620,
FT                   964039..964183,965122..965283,965494..965582,
FT                   965684..965962)
FT                   /codon_start=1
FT                   /gene="0610009O20Rik"
FT                   /locus_tag="mCG_18332"
FT                   /product="RIKEN cDNA 0610009O20, isoform CRA_a"
FT                   /note="gene_id=mCG18332.2 transcript_id=mCT12932.2
FT                   protein_id=mCP8390.1 isoform=CRA_a"
FT                   /db_xref="MGI:MGI:1914089"
FT                   /db_xref="UniProtKB/TrEMBL:Q99M18"
FT                   /protein_id="EDL10093.1"
FT                   /translation="MWRLTGILGRALPRLLGPGFRGITPKPTSSDGSQTTSPTLPLTRL
FT                   SFDRSGSHGSKRSRDPKCCGWKDAFHWMSAHVSPNTLRDAISWGTLAVLALHLARQIHF
FT                   HAPLVAGPQPAERSWHSPLYRFLSSSWWHPHSSLRRHVLPRPDCPAPRNTGLREPRQGQ
FT                   EDHPSAPSQCLPSDSSLRSGLLNLPEEEPSDFDFLHASRDFASQAKAAEAHPPGGKNEQ
FT                   DKAKALPLEEAVTSIQQLFQLSVAITFNFLGTCFLPRGRGMRIEKGGWDAVRVESGLNE
FT                   RFLFSWVGRPDVAWWFSGVRDPSLLIKVQPI"
FT   CDS             join(961589..961619,962306..962420,962503..962620,
FT                   964039..964419)
FT                   /codon_start=1
FT                   /gene="0610009O20Rik"
FT                   /locus_tag="mCG_18332"
FT                   /product="RIKEN cDNA 0610009O20, isoform CRA_d"
FT                   /note="gene_id=mCG18332.2 transcript_id=mCT174388.1
FT                   protein_id=mCP97306.0 isoform=CRA_d"
FT                   /db_xref="MGI:MGI:1914089"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CBJ7"
FT                   /protein_id="EDL10096.1"
FT                   /translation="MWRLTGILGRALPRLLGPGFRGITPKPTSSDGSQTTSPTLPLTRL
FT                   SFDRSGSHGSKRSRDPKCCGWKDAFHWMSAHVSPNTLRDAISWGTLAVLALHLARQIHF
FT                   HAPLVAGPQPAERSWHSPLYRFLSSSWWHPHSCEFSVLKGQLGQAGSFLWARKYLWLHL
FT                   RKKAISGCLRFLSKVRGREVGKCCPHWVWALPPLSVPQCPSVTSQRGSPKT"
FT   CDS             join(961589..961619,962306..962420,962503..962641)
FT                   /codon_start=1
FT                   /gene="0610009O20Rik"
FT                   /locus_tag="mCG_18332"
FT                   /product="RIKEN cDNA 0610009O20, isoform CRA_b"
FT                   /note="gene_id=mCG18332.2 transcript_id=mCT174386.1
FT                   protein_id=mCP97307.0 isoform=CRA_b"
FT                   /protein_id="EDL10094.1"
FT                   /translation="MWRLTGILGRALPRLLGPGFRGITPKPTSSDGSQTTSPTLPLTRL
FT                   SFDRSGSHGSKRSRDPKCCGWKDAFHWMSAHVSPNTLRDAISWVRLPQA"
FT   assembly_gap    975344..975396
FT                   /estimated_length=53
FT                   /gap_type="unknown"
FT   gene            complement(978288..995311)
FT                   /gene="Pcdh12"
FT                   /locus_tag="mCG_18330"
FT                   /note="gene_id=mCG18330.2"
FT   mRNA            complement(join(978288..980388,986235..986389,
FT                   988739..988839,994987..995311))
FT                   /gene="Pcdh12"
FT                   /locus_tag="mCG_18330"
FT                   /product="protocadherin 12, transcript variant mCT174385"
FT                   /note="gene_id=mCG18330.2 transcript_id=mCT174385.0 created
FT                   on 14-MAR-2003"
FT   mRNA            complement(join(978288..980388,986235..986389,
FT                   988739..988839,992101..995267))
FT                   /gene="Pcdh12"
FT                   /locus_tag="mCG_18330"
FT                   /product="protocadherin 12, transcript variant mCT12931"
FT                   /note="gene_id=mCG18330.2 transcript_id=mCT12931.1 created
FT                   on 14-MAR-2003"
FT   CDS             complement(join(979982..980388,986235..986389,
FT                   988739..988839,992101..994980))
FT                   /codon_start=1
FT                   /gene="Pcdh12"
FT                   /locus_tag="mCG_18330"
FT                   /product="protocadherin 12, isoform CRA_a"
FT                   /note="gene_id=mCG18330.2 transcript_id=mCT12931.1
FT                   protein_id=mCP8380.1 isoform=CRA_a"
FT                   /db_xref="GOA:O55134"
FT                   /db_xref="InterPro:IPR002126"
FT                   /db_xref="InterPro:IPR013164"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR020894"
FT                   /db_xref="InterPro:IPR030720"
FT                   /db_xref="MGI:MGI:1855700"
FT                   /db_xref="UniProtKB/Swiss-Prot:O55134"
FT                   /protein_id="EDL10091.1"
FT                   /translation="MMLLLPFLLGLLGPGSYLFISGDCQEVATVMVKFQVTEEVPSGTV
FT                   IGKLSQELRVEERRGKAGDAFQILQLPQALPVQMNSEDGLLSTSSRLDREKLCRQEDPC
FT                   LVSFDVLATGASALIHVEIQVLDINDHQPQFPKDEQELEISESASLHTRIPLDRALDQD
FT                   TGPNSLYSYSLSPSEHFALDVIVGPDETKHAELVVVKELDRELHSYFDLVLTAYDNGNP
FT                   PKSGISVVKVNVLDSNDNSPVFAESSLALEIPEDTVPGTLLINLTATDPDQGPNGEVEF
FT                   FFGKHVSPEVMNTFGIDAKTGQIILRQALDYEKNPAYEVDVQARDLGPNSIPGHCKVLI
FT                   KVLDVNDNAPSILITWASQTSLVSEDLPRDSFIALVSANDLDSGNNGLVHCWLNQELGH
FT                   FRLKRTNGNTYMLLTNATLDREQWPIYTLTVFAQDQGPQPLSAEKELQIQVSDVNDNAP
FT                   VFEKSRYEVSTWENNPPSLHLITLKAHDADLGSNGKVSYRIKDSPVSHLVIIDFETGEV
FT                   TAQRSLDYEQMAGFEFQVIAEDRGQPQLASSISVWVSLLDANDNAPEVIQPVLSEGKAT
FT                   LSVLVNASTGHLLLPIENPSGMDPAGTGIPPKATHSPWSFLLLTIVARDADSGANGELF
FT                   YSIQSGNDAHLFFLSPSLGQLFINVTNASSLIGSQWDLGIVVEDQGSPSLQTQVSLKVV
FT                   FVTSVDHLRDSAHEPGVLSTPALALICLAVLLAIFGLLLALFVSICRTERKDNRAYNCR
FT                   EAESSYRHQPKRPQKHIQKADIHLVPVLRAHENETDEVRPSHKDTSKETLMEAGWDSCL
FT                   QAPFHLTPTLYRTLRNQGNQGELAESQEVLQDTFNFLFNHPRQRNASRENLNLPESPPA
FT                   VRQPLLRPLKVPGSPIARATGDQDKEEAPQSPPASSATLRRQRNFNGKVSPRGESGPHQ
FT                   ILRSLVRLSVAAFAERNPVEEPAGDSPPVQQISQLLSLLHQGQFQPKPNHRGNKYLAKP
FT                   GGSSRGTIPDTEGLVGLKPSGQAEPDLEEGPPSPEEDLSVKRLLEEELSSLLDPNTGLA
FT                   LDKLSPPDPAWMARLSLPLTTNYRDNLSSPDATTSEEPRTFQTFGKTVGPGPELSPTGT
FT                   RLASTFVSEMSSLLEMLLGQHTVPVEAASAALRRLSVCGRTLSLDLATSGASASEAQGR
FT                   KKAAESRLGCGRNL"
FT   CDS             complement(979982..980347)
FT                   /codon_start=1
FT                   /gene="Pcdh12"
FT                   /locus_tag="mCG_18330"
FT                   /product="protocadherin 12, isoform CRA_b"
FT                   /note="gene_id=mCG18330.2 transcript_id=mCT174385.0
FT                   protein_id=mCP97304.0 isoform=CRA_b"
FT                   /db_xref="GOA:A0JNZ2"
FT                   /db_xref="InterPro:IPR030720"
FT                   /db_xref="MGI:MGI:1855700"
FT                   /db_xref="UniProtKB/TrEMBL:A0JNZ2"
FT                   /protein_id="EDL10092.1"
FT                   /translation="MARLSLPLTTNYRDNLSSPDATTSEEPRTFQTFGKTVGPGPELSP
FT                   TGTRLASTFVSEMSSLLEMLLGQHTVPVEAASAALRRLSVCGRTLSLDLATSGASASEA
FT                   QGRKKAAESRLGCGRNL"
FT   assembly_gap    985674..985693
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1004540..1004713
FT                   /estimated_length=174
FT                   /gap_type="unknown"
FT   gene            1007425..1028648
FT                   /gene="Rnf14"
FT                   /locus_tag="mCG_18329"
FT                   /note="gene_id=mCG18329.2"
FT   mRNA            join(1007425..1007546,1010502..1010674,1011177..1011338,
FT                   1018613..1019143,1020233..1020461,1023961..1024133,
FT                   1025422..1025552,1027274..1028648)
FT                   /gene="Rnf14"
FT                   /locus_tag="mCG_18329"
FT                   /product="ring finger protein 14, transcript variant
FT                   mCT174377"
FT                   /note="gene_id=mCG18329.2 transcript_id=mCT174377.0 created
FT                   on 14-OCT-2002"
FT   mRNA            join(1007425..1007546,1010502..1010674,1011177..1011338,
FT                   1012404..1012555,1014840..1014977)
FT                   /gene="Rnf14"
FT                   /locus_tag="mCG_18329"
FT                   /product="ring finger protein 14, transcript variant
FT                   mCT174379"
FT                   /note="gene_id=mCG18329.2 transcript_id=mCT174379.0 created
FT                   on 14-OCT-2002"
FT   mRNA            join(1007437..1007546,1010502..1010674,1011177..1011232,
FT                   1018613..1019143,1020233..1020461,1023961..1024133,
FT                   1025422..1025552,1027274..1028648)
FT                   /gene="Rnf14"
FT                   /locus_tag="mCG_18329"
FT                   /product="ring finger protein 14, transcript variant
FT                   mCT174383"
FT                   /note="gene_id=mCG18329.2 transcript_id=mCT174383.0 created
FT                   on 14-OCT-2002"
FT   mRNA            join(1007437..1007546,1010502..1010674,1011177..1011338,
FT                   1012404..1012555,1018613..1019143,1020233..1020461,
FT                   1023961..1024133,1025422..1025552,1027274..1028552)
FT                   /gene="Rnf14"
FT                   /locus_tag="mCG_18329"
FT                   /product="ring finger protein 14, transcript variant
FT                   mCT12240"
FT                   /note="gene_id=mCG18329.2 transcript_id=mCT12240.0 created
FT                   on 14-OCT-2002"
FT   mRNA            join(1007458..1007546,1008248..1008323,1010502..1010674,
FT                   1011177..1011338,1012404..1012555,1018613..1019143,
FT                   1020233..1020461,1023961..1024133,1025422..1025552,
FT                   1027274..1027935)
FT                   /gene="Rnf14"
FT                   /locus_tag="mCG_18329"
FT                   /product="ring finger protein 14, transcript variant
FT                   mCT174378"
FT                   /note="gene_id=mCG18329.2 transcript_id=mCT174378.0 created
FT                   on 14-OCT-2002"
FT   mRNA            join(1007474..1007546,1008248..1008323,1009057..1009143,
FT                   1010502..1010674,1011177..1011338,1012404..1012555,
FT                   1018613..1019143,1020233..1020461,1023961..1024133,
FT                   1025422..1025552,1027274..1028590)
FT                   /gene="Rnf14"
FT                   /locus_tag="mCG_18329"
FT                   /product="ring finger protein 14, transcript variant
FT                   mCT174381"
FT                   /note="gene_id=mCG18329.2 transcript_id=mCT174381.0 created
FT                   on 14-OCT-2002"
FT   mRNA            join(1007501..1007546,1010502..1010674,1011177..1011205,
FT                   1018842..1019143,1020233..1020461,1023961..1024133,
FT                   1025422..1025552,1027274..1028648)
FT                   /gene="Rnf14"
FT                   /locus_tag="mCG_18329"
FT                   /product="ring finger protein 14, transcript variant
FT                   mCT174384"
FT                   /note="gene_id=mCG18329.2 transcript_id=mCT174384.0 created
FT                   on 14-OCT-2002"
FT   mRNA            join(<1007553..1007953,1008248..1008323,1010502..1010674,
FT                   1011177..1011338,1012404..1012555,1018613..1019143,
FT                   1020233..1020461,1023961..1024133,1025422..1025552,
FT                   1027274..1028584)
FT                   /gene="Rnf14"
FT                   /locus_tag="mCG_18329"
FT                   /product="ring finger protein 14, transcript variant
FT                   mCT190286"
FT                   /note="gene_id=mCG18329.2 transcript_id=mCT190286.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(1007779..1007963,1008214..1008323,1009057..1009143,
FT                   1010502..1010674,1011177..1011338,1012404..1012555,
FT                   1018613..1019143,1020233..1020461,1023961..1024133,
FT                   1025422..1025552,1027274..1028648)
FT                   /gene="Rnf14"
FT                   /locus_tag="mCG_18329"
FT                   /product="ring finger protein 14, transcript variant
FT                   mCT174380"
FT                   /note="gene_id=mCG18329.2 transcript_id=mCT174380.0 created
FT                   on 14-OCT-2002"
FT   mRNA            join(1008214..1008323,1010502..1010674,1011177..1011338,
FT                   1012404..1012555,1018613..1019143,1020233..1020461,
FT                   1023961..1024133,1025422..1025552,1027274..1027642)
FT                   /gene="Rnf14"
FT                   /locus_tag="mCG_18329"
FT                   /product="ring finger protein 14, transcript variant
FT                   mCT174382"
FT                   /note="gene_id=mCG18329.2 transcript_id=mCT174382.0 created
FT                   on 14-OCT-2002"
FT   CDS             join(<1010623..1010674,1011177..1011338,1012404..1012555,
FT                   1018613..1019143,1020233..1020461,1023961..1024133,
FT                   1025422..1025552,1027274..1027361)
FT                   /codon_start=1
FT                   /gene="Rnf14"
FT                   /locus_tag="mCG_18329"
FT                   /product="ring finger protein 14, isoform CRA_c"
FT                   /note="gene_id=mCG18329.2 transcript_id=mCT190286.0
FT                   protein_id=mCP111277.0 isoform=CRA_c"
FT                   /protein_id="EDL10086.1"
FT                   /translation="NTDCSSINILFSWLLLTASSMSAEDLEAQEDELLALASIYDADEF
FT                   RKAESVQGGETRIYLDLPQNFKIFVSGNSNESLQNSGFEYTICFLPPLVLNFELPPDYP
FT                   SSSPPSFTLSGKWLSPTQLSALCKHLDNLWEEHRGRVVLFAWMQFLKEETLTYLNIVSP
FT                   FELKMGSQKKVQRRATAQASSSTELGVGGAAAADVDQEETVDERAVQDVESLSSLIQEI
FT                   LDFNQARQTKCFNSKLFLCSICFCEKLGSDCMYFLECKHVYCKACLKDYFEIQIKDGQV
FT                   KCLNCPEPQCPSVATPGQVKELVEADLFARYDRLLLQSTLDLMADVVYCPRPCCQLPVM
FT                   QEPGGTMAICSSCNFAFCTLCRLTYHGLSPCKVTAEKLIDLRNEYLQADEATKRFLEQR
FT                   YGKRVIQKALEEMESKDWLEKNSKSCPCCGTPIQKLDGCNKMTCTGCMQYFCWICMGSL
FT                   SRANPYRHFTDSESPCFNRLFHAVDINGDMWEDEIEEDDDDEDDDDD"
FT   CDS             join(1011185..1011338,1012404..1012555,1018613..1019143,
FT                   1020233..1020461,1023961..1024133,1025422..1025552,
FT                   1027274..1027361)
FT                   /codon_start=1
FT                   /gene="Rnf14"
FT                   /locus_tag="mCG_18329"
FT                   /product="ring finger protein 14, isoform CRA_a"
FT                   /note="gene_id=mCG18329.2 transcript_id=mCT174378.0
FT                   protein_id=mCP97298.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q9JI90"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR002867"
FT                   /db_xref="InterPro:IPR006575"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="InterPro:IPR031127"
FT                   /db_xref="MGI:MGI:1929668"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JI90"
FT                   /protein_id="EDL10081.1"
FT                   /translation="MSAEDLEAQEDELLALASIYDADEFRKAESVQGGETRIYLDLPQN
FT                   FKIFVSGNSNESLQNSGFEYTICFLPPLVLNFELPPDYPSSSPPSFTLSGKWLSPTQLS
FT                   ALCKHLDNLWEEHRGRVVLFAWMQFLKEETLTYLNIVSPFELKMGSQKKVQRRATAQAS
FT                   SSTELGVGGAAAADVDQEETVDERAVQDVESLSSLIQEILDFNQARQTKCFNSKLFLCS
FT                   ICFCEKLGSDCMYFLECKHVYCKACLKDYFEIQIKDGQVKCLNCPEPQCPSVATPGQVK
FT                   ELVEADLFARYDRLLLQSTLDLMADVVYCPRPCCQLPVMQEPGGTMAICSSCNFAFCTL
FT                   CRLTYHGLSPCKVTAEKLIDLRNEYLQADEATKRFLEQRYGKRVIQKALEEMESKDWLE
FT                   KNSKSCPCCGTPIQKLDGCNKMTCTGCMQYFCWICMGSLSRANPYRHFTDSESPCFNRL
FT                   FHAVDINGDMWEDEIEEDDDDEDDDDD"
FT   CDS             join(1011185..1011338,1012404..1012555,1018613..1019143,
FT                   1020233..1020461,1023961..1024133,1025422..1025552,
FT                   1027274..1027361)
FT                   /codon_start=1
FT                   /gene="Rnf14"
FT                   /locus_tag="mCG_18329"
FT                   /product="ring finger protein 14, isoform CRA_a"
FT                   /note="gene_id=mCG18329.2 transcript_id=mCT174380.0
FT                   protein_id=mCP97297.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q9JI90"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR002867"
FT                   /db_xref="InterPro:IPR006575"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="InterPro:IPR031127"
FT                   /db_xref="MGI:MGI:1929668"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JI90"
FT                   /protein_id="EDL10082.1"
FT                   /translation="MSAEDLEAQEDELLALASIYDADEFRKAESVQGGETRIYLDLPQN
FT                   FKIFVSGNSNESLQNSGFEYTICFLPPLVLNFELPPDYPSSSPPSFTLSGKWLSPTQLS
FT                   ALCKHLDNLWEEHRGRVVLFAWMQFLKEETLTYLNIVSPFELKMGSQKKVQRRATAQAS
FT                   SSTELGVGGAAAADVDQEETVDERAVQDVESLSSLIQEILDFNQARQTKCFNSKLFLCS
FT                   ICFCEKLGSDCMYFLECKHVYCKACLKDYFEIQIKDGQVKCLNCPEPQCPSVATPGQVK
FT                   ELVEADLFARYDRLLLQSTLDLMADVVYCPRPCCQLPVMQEPGGTMAICSSCNFAFCTL
FT                   CRLTYHGLSPCKVTAEKLIDLRNEYLQADEATKRFLEQRYGKRVIQKALEEMESKDWLE
FT                   KNSKSCPCCGTPIQKLDGCNKMTCTGCMQYFCWICMGSLSRANPYRHFTDSESPCFNRL
FT                   FHAVDINGDMWEDEIEEDDDDEDDDDD"
FT   CDS             join(1011185..1011338,1012404..1012555,1018613..1019143,
FT                   1020233..1020461,1023961..1024133,1025422..1025552,
FT                   1027274..1027361)
FT                   /codon_start=1
FT                   /gene="Rnf14"
FT                   /locus_tag="mCG_18329"
FT                   /product="ring finger protein 14, isoform CRA_a"
FT                   /note="gene_id=mCG18329.2 transcript_id=mCT174381.0
FT                   protein_id=mCP97303.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q9JI90"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR002867"
FT                   /db_xref="InterPro:IPR006575"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="InterPro:IPR031127"
FT                   /db_xref="MGI:MGI:1929668"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JI90"
FT                   /protein_id="EDL10083.1"
FT                   /translation="MSAEDLEAQEDELLALASIYDADEFRKAESVQGGETRIYLDLPQN
FT                   FKIFVSGNSNESLQNSGFEYTICFLPPLVLNFELPPDYPSSSPPSFTLSGKWLSPTQLS
FT                   ALCKHLDNLWEEHRGRVVLFAWMQFLKEETLTYLNIVSPFELKMGSQKKVQRRATAQAS
FT                   SSTELGVGGAAAADVDQEETVDERAVQDVESLSSLIQEILDFNQARQTKCFNSKLFLCS
FT                   ICFCEKLGSDCMYFLECKHVYCKACLKDYFEIQIKDGQVKCLNCPEPQCPSVATPGQVK
FT                   ELVEADLFARYDRLLLQSTLDLMADVVYCPRPCCQLPVMQEPGGTMAICSSCNFAFCTL
FT                   CRLTYHGLSPCKVTAEKLIDLRNEYLQADEATKRFLEQRYGKRVIQKALEEMESKDWLE
FT                   KNSKSCPCCGTPIQKLDGCNKMTCTGCMQYFCWICMGSLSRANPYRHFTDSESPCFNRL
FT                   FHAVDINGDMWEDEIEEDDDDEDDDDD"
FT   CDS             join(1011185..1011338,1012404..1012555,1018613..1019143,
FT                   1020233..1020461,1023961..1024133,1025422..1025552,
FT                   1027274..1027361)
FT                   /codon_start=1
FT                   /gene="Rnf14"
FT                   /locus_tag="mCG_18329"
FT                   /product="ring finger protein 14, isoform CRA_a"
FT                   /note="gene_id=mCG18329.2 transcript_id=mCT174382.0
FT                   protein_id=mCP97300.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q9JI90"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR002867"
FT                   /db_xref="InterPro:IPR006575"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="InterPro:IPR031127"
FT                   /db_xref="MGI:MGI:1929668"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JI90"
FT                   /protein_id="EDL10084.1"
FT                   /translation="MSAEDLEAQEDELLALASIYDADEFRKAESVQGGETRIYLDLPQN
FT                   FKIFVSGNSNESLQNSGFEYTICFLPPLVLNFELPPDYPSSSPPSFTLSGKWLSPTQLS
FT                   ALCKHLDNLWEEHRGRVVLFAWMQFLKEETLTYLNIVSPFELKMGSQKKVQRRATAQAS
FT                   SSTELGVGGAAAADVDQEETVDERAVQDVESLSSLIQEILDFNQARQTKCFNSKLFLCS
FT                   ICFCEKLGSDCMYFLECKHVYCKACLKDYFEIQIKDGQVKCLNCPEPQCPSVATPGQVK
FT                   ELVEADLFARYDRLLLQSTLDLMADVVYCPRPCCQLPVMQEPGGTMAICSSCNFAFCTL
FT                   CRLTYHGLSPCKVTAEKLIDLRNEYLQADEATKRFLEQRYGKRVIQKALEEMESKDWLE
FT                   KNSKSCPCCGTPIQKLDGCNKMTCTGCMQYFCWICMGSLSRANPYRHFTDSESPCFNRL
FT                   FHAVDINGDMWEDEIEEDDDDEDDDDD"
FT   CDS             join(1011185..1011338,1012404..1012555,1018613..1019143,
FT                   1020233..1020461,1023961..1024133,1025422..1025552,
FT                   1027274..1027361)
FT                   /codon_start=1
FT                   /gene="Rnf14"
FT                   /locus_tag="mCG_18329"
FT                   /product="ring finger protein 14, isoform CRA_a"
FT                   /note="gene_id=mCG18329.2 transcript_id=mCT12240.0
FT                   protein_id=mCP8368.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q9JI90"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR002867"
FT                   /db_xref="InterPro:IPR006575"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="InterPro:IPR031127"
FT                   /db_xref="MGI:MGI:1929668"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JI90"
FT                   /protein_id="EDL10087.1"
FT                   /translation="MSAEDLEAQEDELLALASIYDADEFRKAESVQGGETRIYLDLPQN
FT                   FKIFVSGNSNESLQNSGFEYTICFLPPLVLNFELPPDYPSSSPPSFTLSGKWLSPTQLS
FT                   ALCKHLDNLWEEHRGRVVLFAWMQFLKEETLTYLNIVSPFELKMGSQKKVQRRATAQAS
FT                   SSTELGVGGAAAADVDQEETVDERAVQDVESLSSLIQEILDFNQARQTKCFNSKLFLCS
FT                   ICFCEKLGSDCMYFLECKHVYCKACLKDYFEIQIKDGQVKCLNCPEPQCPSVATPGQVK
FT                   ELVEADLFARYDRLLLQSTLDLMADVVYCPRPCCQLPVMQEPGGTMAICSSCNFAFCTL
FT                   CRLTYHGLSPCKVTAEKLIDLRNEYLQADEATKRFLEQRYGKRVIQKALEEMESKDWLE
FT                   KNSKSCPCCGTPIQKLDGCNKMTCTGCMQYFCWICMGSLSRANPYRHFTDSESPCFNRL
FT                   FHAVDINGDMWEDEIEEDDDDEDDDDD"
FT   CDS             join(1011185..1011232,1018613..1019143,1020233..1020461,
FT                   1023961..1024133,1025422..1025552,1027274..1027361)
FT                   /codon_start=1
FT                   /gene="Rnf14"
FT                   /locus_tag="mCG_18329"
FT                   /product="ring finger protein 14, isoform CRA_f"
FT                   /note="gene_id=mCG18329.2 transcript_id=mCT174383.0
FT                   protein_id=mCP97299.0 isoform=CRA_f"
FT                   /protein_id="EDL10090.1"
FT                   /translation="MSAEDLEAQEDELLALLSALCKHLDNLWEEHRGRVVLFAWMQFLK
FT                   EETLTYLNIVSPFELKMGSQKKVQRRATAQASSSTELGVGGAAAADVDQEETVDERAVQ
FT                   DVESLSSLIQEILDFNQARQTKCFNSKLFLCSICFCEKLGSDCMYFLECKHVYCKACLK
FT                   DYFEIQIKDGQVKCLNCPEPQCPSVATPGQVKELVEADLFARYDRLLLQSTLDLMADVV
FT                   YCPRPCCQLPVMQEPGGTMAICSSCNFAFCTLCRLTYHGLSPCKVTAEKLIDLRNEYLQ
FT                   ADEATKRFLEQRYGKRVIQKALEEMESKDWLEKNSKSCPCCGTPIQKLDGCNKMTCTGC
FT                   MQYFCWICMGSLSRANPYRHFTDSESPCFNRLFHAVDINGDMWEDEIEEDDDDEDDDDD
FT                   "
FT   CDS             join(1011185..1011338,1012404..1012555,1014840..1014854)
FT                   /codon_start=1
FT                   /gene="Rnf14"
FT                   /locus_tag="mCG_18329"
FT                   /product="ring finger protein 14, isoform CRA_e"
FT                   /note="gene_id=mCG18329.2 transcript_id=mCT174379.0
FT                   protein_id=mCP97302.0 isoform=CRA_e"
FT                   /protein_id="EDL10089.1"
FT                   /translation="MSAEDLEAQEDELLALASIYDADEFRKAESVQGGETRIYLDLPQN
FT                   FKIFVSGNSNESLQNSGFEYTICFLPPLVLNFELPPDYPSSSPPSFTLSGKWLSPTQGT
FT                   LV"
FT   CDS             join(1018685..1019143,1020233..1020461,1023961..1024133,
FT                   1025422..1025552,1027274..1027361)
FT                   /codon_start=1
FT                   /gene="Rnf14"
FT                   /locus_tag="mCG_18329"
FT                   /product="ring finger protein 14, isoform CRA_d"
FT                   /note="gene_id=mCG18329.2 transcript_id=mCT174377.0
FT                   protein_id=mCP97301.0 isoform=CRA_d"
FT                   /db_xref="GOA:G3XA54"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR002867"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="InterPro:IPR031127"
FT                   /db_xref="MGI:MGI:1929668"
FT                   /db_xref="UniProtKB/TrEMBL:G3XA54"
FT                   /protein_id="EDL10088.1"
FT                   /translation="MQFLKEETLTYLNIVSPFELKMGSQKKVQRRATAQASSSTELGVG
FT                   GAAAADVDQEETVDERAVQDVESLSSLIQEILDFNQARQTKCFNSKLFLCSICFCEKLG
FT                   SDCMYFLECKHVYCKACLKDYFEIQIKDGQVKCLNCPEPQCPSVATPGQVKELVEADLF
FT                   ARYDRLLLQSTLDLMADVVYCPRPCCQLPVMQEPGGTMAICSSCNFAFCTLCRLTYHGL
FT                   SPCKVTAEKLIDLRNEYLQADEATKRFLEQRYGKRVIQKALEEMESKDWLEKNSKSCPC
FT                   CGTPIQKLDGCNKMTCTGCMQYFCWICMGSLSRANPYRHFTDSESPCFNRLFHAVDING
FT                   DMWEDEIEEDDDDEDDDDD"
FT   CDS             join(1019006..1019143,1020233..1020461,1023961..1024133,
FT                   1025422..1025552,1027274..1027361)
FT                   /codon_start=1
FT                   /gene="Rnf14"
FT                   /locus_tag="mCG_18329"
FT                   /product="ring finger protein 14, isoform CRA_b"
FT                   /note="gene_id=mCG18329.2 transcript_id=mCT174384.0
FT                   protein_id=mCP97296.0 isoform=CRA_b"
FT                   /protein_id="EDL10085.1"
FT                   /translation="MYFLECKHVYCKACLKDYFEIQIKDGQVKCLNCPEPQCPSVATPG
FT                   QVKELVEADLFARYDRLLLQSTLDLMADVVYCPRPCCQLPVMQEPGGTMAICSSCNFAF
FT                   CTLCRLTYHGLSPCKVTAEKLIDLRNEYLQADEATKRFLEQRYGKRVIQKALEEMESKD
FT                   WLEKNSKSCPCCGTPIQKLDGCNKMTCTGCMQYFCWICMGSLSRANPYRHFTDSESPCF
FT                   NRLFHAVDINGDMWEDEIEEDDDDEDDDDD"
FT   assembly_gap    1035769..1035788
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1037897..1037962
FT                   /estimated_length=66
FT                   /gap_type="unknown"
FT   gene            complement(1038325..1049718)
FT                   /gene="Gnpda1"
FT                   /locus_tag="mCG_18341"
FT                   /note="gene_id=mCG18341.1"
FT   mRNA            complement(join(1038325..1039740,1041253..1041427,
FT                   1042735..1042919,1043921..1044103,1045783..1045884,
FT                   1048858..1048989,1049675..1049718))
FT                   /gene="Gnpda1"
FT                   /locus_tag="mCG_18341"
FT                   /product="glucosamine-6-phosphate deaminase 1, transcript
FT                   variant mCT11744"
FT                   /note="gene_id=mCG18341.1 transcript_id=mCT11744.1 created
FT                   on 14-OCT-2002"
FT   mRNA            complement(join(1039301..1039740,1042735..1042919,
FT                   1043921..1044103,1045783..1045884,1048858..1048989,
FT                   1049675..1049701))
FT                   /gene="Gnpda1"
FT                   /locus_tag="mCG_18341"
FT                   /product="glucosamine-6-phosphate deaminase 1, transcript
FT                   variant mCT174400"
FT                   /note="gene_id=mCG18341.1 transcript_id=mCT174400.0 created
FT                   on 14-OCT-2002"
FT   CDS             complement(join(1039640..1039740,1041253..1041427,
FT                   1042735..1042919,1043921..1044103,1045783..1045884,
FT                   1048858..1048981))
FT                   /codon_start=1
FT                   /gene="Gnpda1"
FT                   /locus_tag="mCG_18341"
FT                   /product="glucosamine-6-phosphate deaminase 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG18341.1 transcript_id=mCT11744.1
FT                   protein_id=mCP8367.1 isoform=CRA_a"
FT                   /db_xref="GOA:O88958"
FT                   /db_xref="InterPro:IPR004547"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="InterPro:IPR018321"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="MGI:MGI:1347054"
FT                   /db_xref="UniProtKB/Swiss-Prot:O88958"
FT                   /protein_id="EDL10078.1"
FT                   /translation="MKLIILEHYSQASEWAAKYIRNRIIQFNPGPDKYFTLGLPTGSTP
FT                   LGCYQKLIEYYKNGDLSFQYVKTFNMDEYVGLPRDHPESYHSFMWNNFFKHIDIHPENT
FT                   HILDGNAADLQAECDAFEEKIQAAGGIELFVGGIGPDGHIAFNEPGSSLVSRTRVKTLA
FT                   MDTILANARFFDGDLAKVPTMALTVGVGTVMDAKEVMILITGAHKAFALYKAIEEGVNH
FT                   MWTVSAFQQHPRTVFVCDEDATLELKVKTVKYFKGLMLVHNKLVDPLYSIKEKEIQKSQ
FT                   SAKKPYSD"
FT   CDS             complement(join(1039735..1039740,1042735..1042919,
FT                   1043921..1044103,1045783..1045884,1048858..1048981))
FT                   /codon_start=1
FT                   /gene="Gnpda1"
FT                   /locus_tag="mCG_18341"
FT                   /product="glucosamine-6-phosphate deaminase 1, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG18341.1 transcript_id=mCT174400.0
FT                   protein_id=mCP97319.0 isoform=CRA_c"
FT                   /protein_id="EDL10080.1"
FT                   /translation="MKLIILEHYSQASEWAAKYIRNRIIQFNPGPDKYFTLGLPTGSTP
FT                   LGCYQKLIEYYKNGDLSFQYVKTFNMDEYVGLPRDHPESYHSFMWNNFFKHIDIHPENT
FT                   HILDGNAADLQAECDAFEEKIQAAGGIELFVGGIGPDGHIAFNEPGSSLVSRTRVKTLA
FT                   MDTILANARFFDGDLAKVPTMALTVGVGTVMDAKEV"
FT   mRNA            complement(join(1043806..1044103,1045783..1045884,
FT                   1048858..1048989,1049675..1049701))
FT                   /gene="Gnpda1"
FT                   /locus_tag="mCG_18341"
FT                   /product="glucosamine-6-phosphate deaminase 1, transcript
FT                   variant mCT174399"
FT                   /note="gene_id=mCG18341.1 transcript_id=mCT174399.0 created
FT                   on 14-OCT-2002"
FT   CDS             complement(join(1043871..1044103,1045783..1045884,
FT                   1048858..1048981))
FT                   /codon_start=1
FT                   /gene="Gnpda1"
FT                   /locus_tag="mCG_18341"
FT                   /product="glucosamine-6-phosphate deaminase 1, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG18341.1 transcript_id=mCT174399.0
FT                   protein_id=mCP97318.0 isoform=CRA_b"
FT                   /protein_id="EDL10079.1"
FT                   /translation="MKLIILEHYSQASEWAAKYIRNRIIQFNPGPDKYFTLGLPTGSTP
FT                   LGCYQKLIEYYKNGDLSFQYVKTFNMDEYVGLPRDHPESYHSFMWNNFFKHIDIHPENT
FT                   HILDGNAADLQAECDAFEEKIQAAGGIELFVGGKHGTFHGVYPGPCLE"
FT   assembly_gap    1052892..1052922
FT                   /estimated_length=31
FT                   /gap_type="unknown"
FT   assembly_gap    1064632..1064741
FT                   /estimated_length=110
FT                   /gap_type="unknown"
FT   gene            complement(1070175..1071478)
FT                   /pseudo
FT                   /locus_tag="mCG_50627"
FT                   /note="gene_id=mCG50627.2"
FT   mRNA            complement(1070175..1071478)
FT                   /pseudo
FT                   /locus_tag="mCG_50627"
FT                   /note="gene_id=mCG50627.2 transcript_id=mCT50810.2 created
FT                   on 16-OCT-2002"
FT   assembly_gap    1071479..1071498
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1076228..1076247
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1081594..1081666
FT                   /estimated_length=73
FT                   /gap_type="unknown"
FT   assembly_gap    1128078..1128332
FT                   /estimated_length=255
FT                   /gap_type="unknown"
FT   gene            <1128333..1174473
FT                   /locus_tag="mCG_18343"
FT                   /note="gene_id=mCG18343.2"
FT   mRNA            join(<1128333..1128445,1152186..1152273,1156960..1157090,
FT                   1160824..1160911,1161574..1161698,1165324..1165390,
FT                   1169814..1169919,1173531..1174109)
FT                   /locus_tag="mCG_18343"
FT                   /product="mCG18343, transcript variant mCT190283"
FT                   /note="gene_id=mCG18343.2 transcript_id=mCT190283.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(<1128333..1128445,1152186..1152215,1173634..1173954)
FT                   /locus_tag="mCG_18343"
FT                   /product="mCG18343, transcript variant mCT174401"
FT                   /note="gene_id=mCG18343.2 transcript_id=mCT174401.0 created
FT                   on 10-FEB-2003"
FT   CDS             join(<1128333..1128445,1152186..1152215,1173634..1173652)
FT                   /codon_start=1
FT                   /locus_tag="mCG_18343"
FT                   /product="mCG18343, isoform CRA_b"
FT                   /note="gene_id=mCG18343.2 transcript_id=mCT174401.0
FT                   protein_id=mCP97320.0 isoform=CRA_b"
FT                   /protein_id="EDL10074.1"
FT                   /translation="RPISSLARPPSLRPAAPWPWRWRRWRPWSRPAAAGTSSCRMKRSL
FT                   GNLNSHLL"
FT   mRNA            join(<1128333..1128445,1152186..1152273,1156960..1157090,
FT                   1160824..1160911,1165324..1165399)
FT                   /locus_tag="mCG_18343"
FT                   /product="mCG18343, transcript variant mCT179955"
FT                   /note="gene_id=mCG18343.2 transcript_id=mCT179955.0 created
FT                   on 10-FEB-2003"
FT   mRNA            join(<1128334..1128445,1152186..1152273,1156960..1157090,
FT                   1160824..1160911,1161574..1161698,1165324..1165390,
FT                   1169814..1169919,1173547..1174473)
FT                   /locus_tag="mCG_18343"
FT                   /product="mCG18343, transcript variant mCT12974"
FT                   /note="gene_id=mCG18343.2 transcript_id=mCT12974.2 created
FT                   on 10-FEB-2003"
FT   CDS             join(<1128335..1128445,1152186..1152273,1156960..1157090,
FT                   1160824..1160911,1161574..1161698,1165324..1165390,
FT                   1169814..1169917)
FT                   /codon_start=1
FT                   /locus_tag="mCG_18343"
FT                   /product="mCG18343, isoform CRA_a"
FT                   /note="gene_id=mCG18343.2 transcript_id=mCT12974.2
FT                   protein_id=mCP8384.2 isoform=CRA_a"
FT                   /protein_id="EDL10073.1"
FT                   /translation="PDQLSRSPSFPEARCAMALALAALAAVEPACGSGYQQLQNEEEPG
FT                   EPEQTAGDAPPPYSSITAESAAYFDYKDESGFPKPPSYNVATTLPSYDEAERTKTEATI
FT                   PLVPGRDEDFVGRDDFDDTDQLRIGNDGIFMLTFFMAFLFNWIGFFLSFCLTTSAAGRY
FT                   GAISGFGLSLIKWILIVRFSTYFPGYFDGQYWLWWVFLVLGFLLFLRGFINYAKVRKMP
FT                   ETFSNLPRTRVLFIY"
FT   CDS             join(<1128335..1128445,1152186..1152273,1156960..1157090,
FT                   1160824..1160911,1161574..1161698,1165324..1165390,
FT                   1169814..1169917)
FT                   /codon_start=1
FT                   /locus_tag="mCG_18343"
FT                   /product="mCG18343, isoform CRA_a"
FT                   /note="gene_id=mCG18343.2 transcript_id=mCT190283.0
FT                   protein_id=mCP111280.0 isoform=CRA_a"
FT                   /protein_id="EDL10076.1"
FT                   /translation="PDQLSRSPSFPEARCAMALALAALAAVEPACGSGYQQLQNEEEPG
FT                   EPEQTAGDAPPPYSSITAESAAYFDYKDESGFPKPPSYNVATTLPSYDEAERTKTEATI
FT                   PLVPGRDEDFVGRDDFDDTDQLRIGNDGIFMLTFFMAFLFNWIGFFLSFCLTTSAAGRY
FT                   GAISGFGLSLIKWILIVRFSTYFPGYFDGQYWLWWVFLVLGFLLFLRGFINYAKVRKMP
FT                   ETFSNLPRTRVLFIY"
FT   CDS             join(<1128335..1128445,1152186..1152273,1156960..1157090,
FT                   1160824..1160911,1165324..1165352)
FT                   /codon_start=1
FT                   /locus_tag="mCG_18343"
FT                   /product="mCG18343, isoform CRA_d"
FT                   /note="gene_id=mCG18343.2 transcript_id=mCT179955.0
FT                   protein_id=mCP102877.0 isoform=CRA_d"
FT                   /protein_id="EDL10077.1"
FT                   /translation="PDQLSRSPSFPEARCAMALALAALAAVEPACGSGYQQLQNEEEPG
FT                   EPEQTAGDAPPPYSSITAESAAYFDYKDESGFPKPPSYNVATTLPSYDEAERTKTEATI
FT                   PLVPGRDEDFVGRDDFDDTDQLRIGNDGIFMLTFFIFHLFPWIL"
FT   mRNA            join(<1132361..1132377,1161609..1161698,1165324..1165390,
FT                   1169814..1169919,1173547..1174024)
FT                   /locus_tag="mCG_18343"
FT                   /product="mCG18343, transcript variant mCT174402"
FT                   /note="gene_id=mCG18343.2 transcript_id=mCT174402.0 created
FT                   on 10-FEB-2003"
FT   CDS             join(<1132366..1132377,1161609..1161698,1165324..1165390,
FT                   1169814..1169917)
FT                   /codon_start=1
FT                   /locus_tag="mCG_18343"
FT                   /product="mCG18343, isoform CRA_c"
FT                   /note="gene_id=mCG18343.2 transcript_id=mCT174402.0
FT                   protein_id=mCP97321.0 isoform=CRA_c"
FT                   /protein_id="EDL10075.1"
FT                   /translation="AFFFSFCLTTSAAGRYGAISGFGLSLIKWILIVRFSTYFPGYFDG
FT                   QYWLWWVFLVLGFLLFLRGFINYAKVRKMPETFSNLPRTRVLFIY"
FT   assembly_gap    1182543..1182710
FT                   /estimated_length=168
FT                   /gap_type="unknown"
FT   assembly_gap    1199128..1199443
FT                   /estimated_length=316
FT                   /gap_type="unknown"
FT   assembly_gap    1202686..1202705
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1270104..1270438
FT                   /estimated_length=335
FT                   /gap_type="unknown"
FT   assembly_gap    1272773..1272792
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1291707..1291751
FT                   /estimated_length=45
FT                   /gap_type="unknown"
FT   gene            complement(1295766..1310894)
FT                   /gene="Spry4"
FT                   /locus_tag="mCG_18339"
FT                   /note="gene_id=mCG18339.2"
FT   mRNA            complement(join(1295766..1300241,1310645..1310894))
FT                   /gene="Spry4"
FT                   /locus_tag="mCG_18339"
FT                   /product="sprouty homolog 4 (Drosophila)"
FT                   /note="gene_id=mCG18339.2 transcript_id=mCT12417.1 created
FT                   on 14-OCT-2002"
FT   CDS             complement(1299292..1300194)
FT                   /codon_start=1
FT                   /gene="Spry4"
FT                   /locus_tag="mCG_18339"
FT                   /product="sprouty homolog 4 (Drosophila)"
FT                   /note="gene_id=mCG18339.2 transcript_id=mCT12417.1
FT                   protein_id=mCP8353.1"
FT                   /db_xref="GOA:Q9WTP2"
FT                   /db_xref="InterPro:IPR007875"
FT                   /db_xref="InterPro:IPR030790"
FT                   /db_xref="MGI:MGI:1345144"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9WTP2"
FT                   /protein_id="EDL10072.1"
FT                   /translation="MEPPVPQSSVPVNPSSVMVQPLLDSRAPHSRLQHPLTILPIDQMK
FT                   TSHVENDYIDNPSLAPATGPKRPRGGPPELAPTPARCDQDITHHWISFSGRPSSVSSSS
FT                   STSSDQRLLDHMAPPPVAEQASPRAVRLQPKVVHCKPLDLKGPTAPPELDKHFLLCEAC
FT                   GKCKCKECASPRTLPSCWVCNQECLCSAQTLVNYGTCMCLVQGIFYHCTNEDDEGSCAD
FT                   HPCSCSGSNCCARWSFMGALSVVLPCLLCYLPATGCVKLAQRGYDRLRRPGCRCKHTNS
FT                   VICKAASGDTKTSRSDKPF"
FT   assembly_gap    1315914..1315951
FT                   /estimated_length=38
FT                   /gap_type="unknown"
FT   assembly_gap    1319099..1319118
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1321864..1321883
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1330430..1330449
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1353906..1354202
FT                   /estimated_length=297
FT                   /gap_type="unknown"
FT   assembly_gap    1371472..1371491
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1373899..1374245
FT                   /estimated_length=347
FT                   /gap_type="unknown"
FT   assembly_gap    1375487..1375506
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1378679..1378698
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1393459..1393541
FT                   /estimated_length=83
FT                   /gap_type="unknown"
FT   assembly_gap    1401684..1401703
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1415590..1415936
FT                   /estimated_length=347
FT                   /gap_type="unknown"
FT   gene            1428977..1509803
FT                   /pseudo
FT                   /locus_tag="mCG_49017"
FT                   /note="gene_id=mCG49017.2"
FT   mRNA            join(1428977..1429416,1509770..1509803)
FT                   /pseudo
FT                   /locus_tag="mCG_49017"
FT                   /note="gene_id=mCG49017.2 transcript_id=mCT49200.1 created
FT                   on 10-MAR-2003"
FT   assembly_gap    1435416..1435616
FT                   /estimated_length=201
FT                   /gap_type="unknown"
FT   assembly_gap    1438646..1438895
FT                   /estimated_length=250
FT                   /gap_type="unknown"
FT   assembly_gap    1472597..1472616
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1478946..1479048
FT                   /estimated_length=103
FT                   /gap_type="unknown"
FT   assembly_gap    1487538..1487597
FT                   /estimated_length=60
FT                   /gap_type="unknown"
FT   assembly_gap    1488355..1488623
FT                   /estimated_length=269
FT                   /gap_type="unknown"
FT   assembly_gap    1510152..1510256
FT                   /estimated_length=105
FT                   /gap_type="unknown"
FT   assembly_gap    1513234..1513310
FT                   /estimated_length=77
FT                   /gap_type="unknown"
FT   assembly_gap    1522364..1522458
FT                   /estimated_length=95
FT                   /gap_type="unknown"
FT   assembly_gap    1529427..1529577
FT                   /estimated_length=151
FT                   /gap_type="unknown"
FT   assembly_gap    1552516..1552535
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1554220..1643466)
FT                   /gene="Fgf1"
FT                   /locus_tag="mCG_18337"
FT                   /note="gene_id=mCG18337.3"
FT   mRNA            complement(join(1554220..1557195,1562121..1562224,
FT                   1569195..1569284,1572787..1572989,1643325..1643466))
FT                   /gene="Fgf1"
FT                   /locus_tag="mCG_18337"
FT                   /product="fibroblast growth factor 1, transcript variant
FT                   mCT181042"
FT                   /note="gene_id=mCG18337.3 transcript_id=mCT181042.1 created
FT                   on 13-JUN-2003"
FT   mRNA            complement(join(1554220..1557195,1562121..1562224,
FT                   1572787..1572989,1632623..1632773,1643165..1643412))
FT                   /gene="Fgf1"
FT                   /locus_tag="mCG_18337"
FT                   /product="fibroblast growth factor 1, transcript variant
FT                   mCT174393"
FT                   /note="gene_id=mCG18337.3 transcript_id=mCT174393.1 created
FT                   on 13-JUN-2003"
FT   mRNA            complement(join(1554220..1557195,1562121..1562224,
FT                   1572787..1572989,1632623..1632849))
FT                   /gene="Fgf1"
FT                   /locus_tag="mCG_18337"
FT                   /product="fibroblast growth factor 1, transcript variant
FT                   mCT12973"
FT                   /note="gene_id=mCG18337.3 transcript_id=mCT12973.3 created
FT                   on 13-JUN-2003"
FT   mRNA            complement(join(1554220..1554546,1554582..1557195,
FT                   1562121..1562224,1572787..1572989,1632623..>1632776))
FT                   /gene="Fgf1"
FT                   /locus_tag="mCG_18337"
FT                   /product="fibroblast growth factor 1, transcript variant
FT                   mCT190265"
FT                   /note="gene_id=mCG18337.3 transcript_id=mCT190265.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(1554220..1557195,1562121..1562224,
FT                   1572787..1572989,1580932..1581063))
FT                   /gene="Fgf1"
FT                   /locus_tag="mCG_18337"
FT                   /product="fibroblast growth factor 1, transcript variant
FT                   mCT181041"
FT                   /note="gene_id=mCG18337.3 transcript_id=mCT181041.1 created
FT                   on 13-JUN-2003"
FT   mRNA            complement(join(1554220..1557195,1562121..1562224,
FT                   1572787..1572989,1580648..1580799))
FT                   /gene="Fgf1"
FT                   /locus_tag="mCG_18337"
FT                   /product="fibroblast growth factor 1, transcript variant
FT                   mCT174394"
FT                   /note="gene_id=mCG18337.3 transcript_id=mCT174394.1 created
FT                   on 13-JUN-2003"
FT   assembly_gap    1554551..1554570
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             complement(join(1557001..1557195,1562121..1562224,
FT                   1572787..1572989,1632623..>1632756))
FT                   /codon_start=1
FT                   /gene="Fgf1"
FT                   /locus_tag="mCG_18337"
FT                   /product="fibroblast growth factor 1, isoform CRA_c"
FT                   /note="gene_id=mCG18337.3 transcript_id=mCT190265.0
FT                   protein_id=mCP111278.0 isoform=CRA_c"
FT                   /protein_id="EDL10070.1"
FT                   /translation="GSESRLERQLQPRHPVTAQRLPSGLHSRLVIKWSEESPPACQFFS
FT                   AEPTTAACCRAMAEGEITTFAALTERFNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDG
FT                   TRDRSDQHIQLQLSAESAGEVYIKGTETGQYLAMDTEGLLYGSQTPNEECLFLERLEEN
FT                   HYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD"
FT   CDS             complement(join(1557001..1557195,1562121..1562224,
FT                   1572787..1572955))
FT                   /codon_start=1
FT                   /gene="Fgf1"
FT                   /locus_tag="mCG_18337"
FT                   /product="fibroblast growth factor 1, isoform CRA_a"
FT                   /note="gene_id=mCG18337.3 transcript_id=mCT12973.3
FT                   protein_id=mCP8351.3 isoform=CRA_a partial"
FT                   /db_xref="GOA:Q6ZWS1"
FT                   /db_xref="InterPro:IPR002209"
FT                   /db_xref="InterPro:IPR008996"
FT                   /db_xref="InterPro:IPR028210"
FT                   /db_xref="MGI:MGI:95515"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ZWS1"
FT                   /protein_id="EDL10065.1"
FT                   /translation="MAEGEITTFAALTERFNLPLGNYKKPKLLYCSNGGHFLRILPDGT
FT                   VDGTRDRSDQHIQLQLSAESAGEVYIKGTETGQYLAMDTEGLLYGSQTPNEECLFLERL
FT                   EENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD"
FT   CDS             complement(join(1557001..1557195,1562121..1562224,
FT                   1572787..1572955))
FT                   /codon_start=1
FT                   /gene="Fgf1"
FT                   /locus_tag="mCG_18337"
FT                   /product="fibroblast growth factor 1, isoform CRA_a"
FT                   /note="gene_id=mCG18337.3 transcript_id=mCT174393.1
FT                   protein_id=mCP97313.1 isoform=CRA_a partial"
FT                   /db_xref="GOA:Q6ZWS1"
FT                   /db_xref="InterPro:IPR002209"
FT                   /db_xref="InterPro:IPR008996"
FT                   /db_xref="InterPro:IPR028210"
FT                   /db_xref="MGI:MGI:95515"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ZWS1"
FT                   /protein_id="EDL10066.1"
FT                   /translation="MAEGEITTFAALTERFNLPLGNYKKPKLLYCSNGGHFLRILPDGT
FT                   VDGTRDRSDQHIQLQLSAESAGEVYIKGTETGQYLAMDTEGLLYGSQTPNEECLFLERL
FT                   EENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD"
FT   CDS             complement(join(1557001..1557195,1562121..1562224,
FT                   1572787..1572955))
FT                   /codon_start=1
FT                   /gene="Fgf1"
FT                   /locus_tag="mCG_18337"
FT                   /product="fibroblast growth factor 1, isoform CRA_a"
FT                   /note="gene_id=mCG18337.3 transcript_id=mCT174394.1
FT                   protein_id=mCP97312.1 isoform=CRA_a partial"
FT                   /db_xref="GOA:Q6ZWS1"
FT                   /db_xref="InterPro:IPR002209"
FT                   /db_xref="InterPro:IPR008996"
FT                   /db_xref="InterPro:IPR028210"
FT                   /db_xref="MGI:MGI:95515"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ZWS1"
FT                   /protein_id="EDL10067.1"
FT                   /translation="MAEGEITTFAALTERFNLPLGNYKKPKLLYCSNGGHFLRILPDGT
FT                   VDGTRDRSDQHIQLQLSAESAGEVYIKGTETGQYLAMDTEGLLYGSQTPNEECLFLERL
FT                   EENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD"
FT   CDS             complement(join(1557001..1557195,1562121..1562224,
FT                   1572787..1572955))
FT                   /codon_start=1
FT                   /gene="Fgf1"
FT                   /locus_tag="mCG_18337"
FT                   /product="fibroblast growth factor 1, isoform CRA_a"
FT                   /note="gene_id=mCG18337.3 transcript_id=mCT181041.1
FT                   protein_id=mCP103965.1 isoform=CRA_a partial"
FT                   /db_xref="GOA:Q6ZWS1"
FT                   /db_xref="InterPro:IPR002209"
FT                   /db_xref="InterPro:IPR008996"
FT                   /db_xref="InterPro:IPR028210"
FT                   /db_xref="MGI:MGI:95515"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ZWS1"
FT                   /protein_id="EDL10068.1"
FT                   /translation="MAEGEITTFAALTERFNLPLGNYKKPKLLYCSNGGHFLRILPDGT
FT                   VDGTRDRSDQHIQLQLSAESAGEVYIKGTETGQYLAMDTEGLLYGSQTPNEECLFLERL
FT                   EENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD"
FT   mRNA            complement(join(1562121..1562219,1572780..1572989,
FT                   1643165..1643412))
FT                   /gene="Fgf1"
FT                   /locus_tag="mCG_18337"
FT                   /product="fibroblast growth factor 1, transcript variant
FT                   mCT181043"
FT                   /note="gene_id=mCG18337.3 transcript_id=mCT181043.1 created
FT                   on 13-JUN-2003"
FT   CDS             complement(join(1562180..1562219,1572780..1572955))
FT                   /codon_start=1
FT                   /gene="Fgf1"
FT                   /locus_tag="mCG_18337"
FT                   /product="fibroblast growth factor 1, isoform CRA_b"
FT                   /note="gene_id=mCG18337.3 transcript_id=mCT181043.1
FT                   protein_id=mCP103964.1 isoform=CRA_b"
FT                   /protein_id="EDL10069.1"
FT                   /translation="MAEGEITTFAALTERFNLPLGNYKKPKLLYCSNGGHFLRILPDGT
FT                   VDGTRDRSDQHSKHCSSVRKVRAKCI"
FT   assembly_gap    1568437..1568456
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             complement(join(1569217..1569284,1572787..1572955))
FT                   /codon_start=1
FT                   /gene="Fgf1"
FT                   /locus_tag="mCG_18337"
FT                   /product="fibroblast growth factor 1, isoform CRA_d"
FT                   /note="gene_id=mCG18337.3 transcript_id=mCT181042.1
FT                   protein_id=mCP103963.1 isoform=CRA_d"
FT                   /db_xref="GOA:D6RCX9"
FT                   /db_xref="InterPro:IPR002209"
FT                   /db_xref="InterPro:IPR008996"
FT                   /db_xref="InterPro:IPR028210"
FT                   /db_xref="MGI:MGI:95515"
FT                   /db_xref="UniProtKB/TrEMBL:D6RCX9"
FT                   /protein_id="EDL10071.1"
FT                   /translation="MAEGEITTFAALTERFNLPLGNYKKPKLLYCSNGGHFLRILPDGT
FT                   VDGTRDRSDQHRPPEYKDSGSLCSALQLLCPAY"
FT   assembly_gap    1579351..1579392
FT                   /estimated_length=42
FT                   /gap_type="unknown"
FT   assembly_gap    1608107..1608191
FT                   /estimated_length=85
FT                   /gap_type="unknown"
FT   assembly_gap    1617707..1617826
FT                   /estimated_length=120
FT                   /gap_type="unknown"
FT   assembly_gap    1658841..1659420
FT                   /estimated_length=580
FT                   /gap_type="unknown"
FT   assembly_gap    1662339..1662445
FT                   /estimated_length=107
FT                   /gap_type="unknown"
FT   gene            complement(1665854..1666459)
FT                   /locus_tag="mCG_13633"
FT                   /note="gene_id=mCG13633.0"
FT   mRNA            complement(1665854..1666459)
FT                   /locus_tag="mCG_13633"
FT                   /product="mCG13633"
FT                   /note="gene_id=mCG13633.0 transcript_id=mCT16038.0 created
FT                   on 14-OCT-2002"
FT   CDS             complement(1666083..1666391)
FT                   /codon_start=1
FT                   /locus_tag="mCG_13633"
FT                   /product="mCG13633"
FT                   /note="gene_id=mCG13633.0 transcript_id=mCT16038.0
FT                   protein_id=mCP12698.1"
FT                   /protein_id="EDL10064.1"
FT                   /translation="MGSKMASATRVVQVVKPHAPLIKFPSRRDKPKLSASEALGSAVLP
FT                   SHSSAISQHSKGSTSPDLLMHQGPPDTAEIIKSLPQKYRRKPMSQEEMEFIQRGGPE"
FT   assembly_gap    1669460..1669479
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1676537..1676556
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1694339..1694358
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            1709706..2087271
FT                   /gene="Arhgap26"
FT                   /locus_tag="mCG_13636"
FT                   /note="gene_id=mCG13636.2"
FT   mRNA            join(1709706..1710184,1814211..1814306,1816153..1816214,
FT                   1818751..1818822,1827012..1827113,1828358..1828468,
FT                   1836736..1836840,1838391..1838520,1843441..1843541,
FT                   1848657..1848751,1866650..1866728,1922003..1922039,
FT                   1944064..1944129,1946591..1946665,1960240..1960327,
FT                   1961923..1961981,1963459..1963564,2003530..2003689,
FT                   2013806..2013944,2023727..2023877,2077768..2077878,
FT                   2078014..2078043,2083322..2083413,2087082..2087271)
FT                   /gene="Arhgap26"
FT                   /locus_tag="mCG_13636"
FT                   /product="Rho GTPase activating protein 26"
FT                   /note="gene_id=mCG13636.2 transcript_id=mCT16287.2 created
FT                   on 14-OCT-2002"
FT   CDS             join(1710031..1710184,1814211..1814306,1816153..1816214,
FT                   1818751..1818822,1827012..1827113,1828358..1828468,
FT                   1836736..1836840,1838391..1838520,1843441..1843541,
FT                   1848657..1848751,1866650..1866728,1922003..1922039,
FT                   1944064..1944129,1946591..1946665,1960240..1960327,
FT                   1961923..1961981,1963459..1963564,2003530..2003689,
FT                   2013806..2013944,2023727..2023877,2077768..2077878,
FT                   2078014..2078043,2083322..2083413,2087082..2087146)
FT                   /codon_start=1
FT                   /gene="Arhgap26"
FT                   /locus_tag="mCG_13636"
FT                   /product="Rho GTPase activating protein 26"
FT                   /note="gene_id=mCG13636.2 transcript_id=mCT16287.2
FT                   protein_id=mCP12701.1"
FT                   /protein_id="EDL10063.1"
FT                   /translation="MGLPALEFSDCCLDSPHFRETLKSHEAELDKTNKFIKELIKDGKS
FT                   LISALKNLSSAKRKFADSLNEFKFQCIGDAETDDEMCIARSLQEFAAVLRNLEDERSRM
FT                   IENASEVLITPLEKFRKEQIGAAREAKKKYDKETEKYCGTLEKHLNLSSKKKESQLQEA
FT                   DSQVDLVRQHFYEVSLEYVFKVQEVQERKMFEFVEPLLAFLQGLFTFYHHGYELAKDFG
FT                   DFKTQLTISIQNTRNRFEGTRSEVESLMKKMKENPLEHKTISPYTMEGYLYVQEKRHFG
FT                   TSWVKHYCTYQRDSKQITMVPFDQKSGGKGGEDESVTLKSCTRRKTDSIEKRFCFDVEA
FT                   VDRPGVITMQALSEEDRRLWMEAMDGREPVYNSNRDSQSEGTAQLDSIGFSIIRKCIHA
FT                   VETRGINEQGLYRIVGVNSRVQKLLSVLMDPKAASETETDICAEWEIKTVTSALKTYLR
FT                   MLPGPLMMYQFQRSFIKAAKLENQETRVSEIHSLVHRLPEKNRQMLQLLMNHLANVANN
FT                   HKQNLMTVANLGVVFGPTLLRPQEETVAAIMDIKFQNIVIEILIENHEKIFNTVPDVPL
FT                   TNAQLHLSRKKSSDSKPPSCSERPLTLFHAVPSTEKQEQRNSIINSSLESVSSSANSIL
FT                   NSSSSLQPNLNSSDSNLDVVKPSRPSSLPPNPSPTSPLSPSWPMFSAPSSPMPTSSTSS
FT                   DSSPIRPEEAVREDSSTPFRKAKALYACQAEHDSELSFTAGTVFDNDSMGDPVSRNKVE
FT                   SDQGRHQY"
FT   assembly_gap    1749780..1749799
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1834320..1834339
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1891659..1892286
FT                   /estimated_length=628
FT                   /gap_type="unknown"
FT   assembly_gap    1953219..1953238
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1957507..1957526
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1975116..1975135
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2038940..2041805
FT                   /estimated_length=2866
FT                   /gap_type="unknown"
FT   assembly_gap    2107341..2115792
FT                   /estimated_length=8452
FT                   /gap_type="unknown"
FT   gene            complement(2128294..2208330)
FT                   /gene="Nr3c1"
FT                   /locus_tag="mCG_13634"
FT                   /note="gene_id=mCG13634.2"
FT   mRNA            complement(join(2128294..2132367,2133429..2133586,
FT                   2138302..2138432,2139133..2139277,2140214..2140489,
FT                   2142109..2142225,2146326..2146489,2203679..2204899,
FT                   2208222..2208330))
FT                   /gene="Nr3c1"
FT                   /locus_tag="mCG_13634"
FT                   /product="nuclear receptor subfamily 3, group C, member 1,
FT                   transcript variant mCT16039"
FT                   /note="gene_id=mCG13634.2 transcript_id=mCT16039.1 created
FT                   on 14-OCT-2002"
FT   CDS             complement(join(2132215..2132367,2133429..2133586,
FT                   2138302..2138432,2139133..2139277,2140214..2140489,
FT                   2142109..2142225,2146326..2146489,2203679..2204886))
FT                   /codon_start=1
FT                   /gene="Nr3c1"
FT                   /locus_tag="mCG_13634"
FT                   /product="nuclear receptor subfamily 3, group C, member 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG13634.2 transcript_id=mCT16039.1
FT                   protein_id=mCP12699.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q3U2M7"
FT                   /db_xref="InterPro:IPR000536"
FT                   /db_xref="InterPro:IPR001409"
FT                   /db_xref="InterPro:IPR001628"
FT                   /db_xref="InterPro:IPR001723"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="InterPro:IPR035500"
FT                   /db_xref="MGI:MGI:95824"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U2M7"
FT                   /protein_id="EDL10061.1"
FT                   /translation="MDSKESLAPPGRDEVPSSLLGRGRGSVMDLYKTLRGGATVKVSAS
FT                   SPSVAAASQADSKQQRILLDFSKGSASNAQQQQQQQQPQPDLSKAVSLSMGLYMGETET
FT                   KVMGNDLGYPQQGQLGLSSGETDFRLLEESIANLNRSTSRPENPKSSTPAAGCATPTEK
FT                   EFPQTHSDPSSEQQNRKSQPGTNGGSVKLYTTDQSTFDILQDLEFSAGSPGKETNESPW
FT                   RSDLLIDENLLSPLAGEDDPFLLEGDVNEDCKPLILPDTKPKIQDTGDTILSSPSSVAL
FT                   PQVKTEKDDFIELCTPGVIKQEKLGPVYCQASFSGTNIIGNKMSAISVHGVSTSGGQMY
FT                   HYDMNTASLSQQQDQKPVFNVIPPIPVGSENWNRCQGSGEDNLTSLGAMNFAGRSVFSN
FT                   GYSSPGMRPDVSSPPSSSSTATGPPPKLCLVCSDEASGCHYGVLTCGSCKVFFKRAVEG
FT                   QHNYLCAGRNDCIIDKIRRKNCPACRYRKCLQAGMNLEARKTKKKIKGIQQATAGVSQD
FT                   TSENANKTIVPAALPQLTPTLVSLLEVIEPEVLYAGYDSSVPDSAWRIMTTLNMLGGRQ
FT                   VIAAVKWAKAIPGFRNLHLDDQMTLLQYSWMFLMAFALGWRSYRQASGNLLCFAPDLII
FT                   NEQRMTLPCMYDQCKHMLFISTELQRLQVSYEEYLCMKTLLLLSSVPKEGLKSQELFDE
FT                   IRMTYIKELGKAIVKREGNSSQNWQRFYQLTKLLDSMHDVVENLLSYCFQTFLDKSMSI
FT                   EFPEMLAEIITNQIPKYSNGNIKKLLFHQK"
FT   mRNA            complement(join(<2132302..2132367,2133429..2133586,
FT                   2138302..2138432,2139133..2139277,2140214..2140489,
FT                   2142109..2142225,2146323..2146489,2203679..>2204886))
FT                   /gene="Nr3c1"
FT                   /locus_tag="mCG_13634"
FT                   /product="nuclear receptor subfamily 3, group C, member 1,
FT                   transcript variant mCT190276"
FT                   /note="gene_id=mCG13634.2 transcript_id=mCT190276.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(<2132302..2132367,2133429..2133586,
FT                   2138302..2138432,2139133..2139277,2140214..2140489,
FT                   2142109..2142225,2146323..2146489,2203679..2204886))
FT                   /codon_start=1
FT                   /gene="Nr3c1"
FT                   /locus_tag="mCG_13634"
FT                   /product="nuclear receptor subfamily 3, group C, member 1,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG13634.2 transcript_id=mCT190276.0
FT                   protein_id=mCP111266.0 isoform=CRA_b"
FT                   /protein_id="EDL10062.1"
FT                   /translation="MDSKESLAPPGRDEVPSSLLGRGRGSVMDLYKTLRGGATVKVSAS
FT                   SPSVAAASQADSKQQRILLDFSKGSASNAQQQQQQQQPQPDLSKAVSLSMGLYMGETET
FT                   KVMGNDLGYPQQGQLGLSSGETDFRLLEESIANLNRSTSRPENPKSSTPAAGCATPTEK
FT                   EFPQTHSDPSSEQQNRKSQPGTNGGSVKLYTTDQSTFDILQDLEFSAGSPGKETNESPW
FT                   RSDLLIDENLLSPLAGEDDPFLLEGDVNEDCKPLILPDTKPKIQDTGDTILSSPSSVAL
FT                   PQVKTEKDDFIELCTPGVIKQEKLGPVYCQASFSGTNIIGNKMSAISVHGVSTSGGQMY
FT                   HYDMNTASLSQQQDQKPVFNVIPPIPVGSENWNRCQGSGEDNLTSLGAMNFAGRSVFSN
FT                   GYSSPGMRPDVSSPPSSSSTATGPPPKLCLVCSDEASGCHYGVLTCGSCKVFFKRAVEG
FT                   RQHNYLCAGRNDCIIDKIRRKNCPACRYRKCLQAGMNLEARKTKKKIKGIQQATAGVSQ
FT                   DTSENANKTIVPAALPQLTPTLVSLLEVIEPEVLYAGYDSSVPDSAWRIMTTLNMLGGR
FT                   QVIAAVKWAKAIPGFRNLHLDDQMTLLQYSWMFLMAFALGWRSYRQASGNLLCFAPDLI
FT                   INEQRMTLPCMYDQCKHMLFISTELQRLQVSYEEYLCMKTLLLLSSVPKEGLKSQELFD
FT                   EIRMTYIKELGKAIVKREGNSSQNWQRFYQLTKLLDSMHDVVENLLSYCFQTFLDKSMS
FT                   IEF"
FT   assembly_gap    2208357..2208376
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2236376..2236395
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2237769..2237788
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2246568..2246703
FT                   /estimated_length=136
FT                   /gap_type="unknown"
FT   assembly_gap    2267770..2267832
FT                   /estimated_length=63
FT                   /gap_type="unknown"
FT   assembly_gap    2297277..2297296
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2300632..2300651
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2301777..2301796
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2305226..2305245
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2320666..2321412
FT                   /estimated_length=747
FT                   /gap_type="unknown"
FT   assembly_gap    2333389..2333519
FT                   /estimated_length=131
FT                   /gap_type="unknown"
FT   assembly_gap    2337881..2337900
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2349383..2349402
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2439806..2440735
FT                   /estimated_length=930
FT                   /gap_type="unknown"
FT   assembly_gap    2472031..2472050
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2480733..2481031
FT                   /estimated_length=299
FT                   /gap_type="unknown"
FT   gene            2492275..2494412
FT                   /gene="Pabpc2"
FT                   /locus_tag="mCG_13635"
FT                   /note="gene_id=mCG13635.0"
FT   mRNA            2492275..2494412
FT                   /gene="Pabpc2"
FT                   /locus_tag="mCG_13635"
FT                   /product="poly A binding protein, cytoplasmic 2"
FT                   /note="gene_id=mCG13635.0 transcript_id=mCT16040.0 created
FT                   on 14-OCT-2002"
FT   CDS             2492441..2494327
FT                   /codon_start=1
FT                   /gene="Pabpc2"
FT                   /locus_tag="mCG_13635"
FT                   /product="poly A binding protein, cytoplasmic 2"
FT                   /note="gene_id=mCG13635.0 transcript_id=mCT16040.0
FT                   protein_id=mCP12700.1"
FT                   /db_xref="GOA:Q62029"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR002004"
FT                   /db_xref="InterPro:IPR003954"
FT                   /db_xref="InterPro:IPR006515"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="InterPro:IPR036053"
FT                   /db_xref="MGI:MGI:1349723"
FT                   /db_xref="UniProtKB/TrEMBL:Q62029"
FT                   /protein_id="EDL10060.1"
FT                   /translation="MNSSDPGCPMASLYVGDLHPDVTEAMLYEKFSSAGPILSIRVYRD
FT                   VITRRSLGYASVNFEQPADAERALDTMNFDVIKGKPVRIMWSQRDPSLRRSGVGNVFIK
FT                   NLNKTIDNKALYDTFSAFGNILSCKVVSDENGSKGHGFVHFETEEAAERAIEKMNGMLL
FT                   NDRKVFVGRFKSQKEREAELGTGTKEFTNVYIKNFGDRMDDETLNGLFGRFGQILSVKV
FT                   MTDEGGKSKGFGFVSFERHEDAQKAVDEMNGKELNGKHIYVGRAQKKDDRHTELKHKFE
FT                   QVTQDKSIRYQGINLYVKNLDDGIDDERLQKEFSPFGTITSTKVMTEGGRSKGFGFVCF
FT                   SSPEEATKAVSEMNGRIVATKPLYVALAQRKEERQAHLTNQYIQRMASVRSGPNPVNPY
FT                   QPASSSYSVAAVPQTQNCVPCCPSQIAQPRPSARWIAQGSRPHPFPNVPGAIHPAAPRS
FT                   SLTTVRPSSSHVQVTTAHRITNTSAQITGQRPAPASSATATPVHSIPQYKYAAGVQNSQ
FT                   QHLNAQLAQQPAVCIQGQEPWTASMLVTAPQEPKQMLGERLFPLIQAMHPTLAGKITGM
FT                   LLDIDNSEPLRMLESPVSRCSRAEEAVATLQAHQVKEAAQKAVGSTSGVPTV"
FT   assembly_gap    2583631..2583714
FT                   /estimated_length=84
FT                   /gap_type="unknown"
FT   assembly_gap    2587229..2587248
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2588929..2588948
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2604482..2604501
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2622715..2622734
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2631603..2631656
FT                   /estimated_length=54
FT                   /gap_type="unknown"
FT   assembly_gap    2646594..2646613
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2653325..2653788
FT                   /estimated_length=464
FT                   /gap_type="unknown"
FT   assembly_gap    2668281..2668503
FT                   /estimated_length=223
FT                   /gap_type="unknown"
FT   assembly_gap    2670159..2670226
FT                   /estimated_length=68
FT                   /gap_type="unknown"
FT   assembly_gap    2720262..2720281
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2756121..2756140
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2765170..2765189
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2814521..2814631
FT                   /estimated_length=111
FT                   /gap_type="unknown"
FT   assembly_gap    2816500..2817683
FT                   /estimated_length=1184
FT                   /gap_type="unknown"
FT   assembly_gap    2833745..2834272
FT                   /estimated_length=528
FT                   /gap_type="unknown"
FT   assembly_gap    2837841..2837910
FT                   /estimated_length=70
FT                   /gap_type="unknown"
FT   assembly_gap    2883618..2889625
FT                   /estimated_length=6008
FT                   /gap_type="unknown"
FT   assembly_gap    2895716..2895735
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2904538..2904653
FT                   /estimated_length=116
FT                   /gap_type="unknown"
FT   gene            complement(2923492..2938915)
FT                   /gene="Yipf5"
FT                   /locus_tag="mCG_10357"
FT                   /note="gene_id=mCG10357.2"
FT   mRNA            complement(join(2923492..2925953,2927242..2927423,
FT                   2930303..2930448,2931598..2931770,2938301..2938420,
FT                   2938783..2938915))
FT                   /gene="Yipf5"
FT                   /locus_tag="mCG_10357"
FT                   /product="Yip1 domain family, member 5, transcript variant
FT                   mCT179470"
FT                   /note="gene_id=mCG10357.2 transcript_id=mCT179470.0 created
FT                   on 05-FEB-2003"
FT   mRNA            complement(join(2923492..2925955,2927242..2927423,
FT                   2930303..2930448,2931598..2931766,2938301..2938420,
FT                   2938783..2938890))
FT                   /gene="Yipf5"
FT                   /locus_tag="mCG_10357"
FT                   /product="Yip1 domain family, member 5, transcript variant
FT                   mCT174314"
FT                   /note="gene_id=mCG10357.2 transcript_id=mCT174314.0 created
FT                   on 05-FEB-2003"
FT   mRNA            complement(join(2924420..2925955,2927242..2927423,
FT                   2930303..2930448,2931598..2931770,2938301..2938420,
FT                   2938783..2938915))
FT                   /gene="Yipf5"
FT                   /locus_tag="mCG_10357"
FT                   /product="Yip1 domain family, member 5, transcript variant
FT                   mCT10371"
FT                   /note="gene_id=mCG10357.2 transcript_id=mCT10371.1 created
FT                   on 05-FEB-2003"
FT   mRNA            complement(join(2924420..2925955,2927242..2927423,
FT                   2930303..2930448,2931598..2931770,2938301..2938420,
FT                   2938788..2938900))
FT                   /gene="Yipf5"
FT                   /locus_tag="mCG_10357"
FT                   /product="Yip1 domain family, member 5, transcript variant
FT                   mCT179472"
FT                   /note="gene_id=mCG10357.2 transcript_id=mCT179472.0 created
FT                   on 05-FEB-2003"
FT   mRNA            complement(join(2924420..2925955,2927242..2927423,
FT                   2930303..2930448,2931598..2931770,2938459..2938784))
FT                   /gene="Yipf5"
FT                   /locus_tag="mCG_10357"
FT                   /product="Yip1 domain family, member 5, transcript variant
FT                   mCT179471"
FT                   /note="gene_id=mCG10357.2 transcript_id=mCT179471.0 created
FT                   on 05-FEB-2003"
FT   CDS             complement(join(2925793..2925955,2927242..2927423,
FT                   2930303..2930448,2931598..2931770,2938301..2938410))
FT                   /codon_start=1
FT                   /gene="Yipf5"
FT                   /locus_tag="mCG_10357"
FT                   /product="Yip1 domain family, member 5, isoform CRA_c"
FT                   /note="gene_id=mCG10357.2 transcript_id=mCT10371.1
FT                   protein_id=mCP12703.0 isoform=CRA_c"
FT                   /protein_id="EDL10058.1"
FT                   /translation="MSGFDNLNSGFYQTSYSIDEQSQQSYDYGGSGGPYSKQYAGCDYS
FT                   QQGRFVPPDMMQPQQTYTGQIYQPTQAYPPTTPQPFYGDSFEEEPPLLEELGINFDHIW
FT                   QKTLTVLHPLRAADGSIMNETDLAGPVVFCLAFGATLLLAGKIQFGYVYGISAIGCLGM
FT                   FCLLNLMSMTGVSFGCVASVLGYCLLPMILLSSFAVVFSLQGMVGILLTATIIGWCSFS
FT                   ASKIFISALAMDGQQLLVAYPCALLYGVFALISVF"
FT   CDS             complement(join(2925793..2925955,2927242..2927423,
FT                   2930303..2930448,2931598..2931770,2938301..2938410))
FT                   /codon_start=1
FT                   /gene="Yipf5"
FT                   /locus_tag="mCG_10357"
FT                   /product="Yip1 domain family, member 5, isoform CRA_c"
FT                   /note="gene_id=mCG10357.2 transcript_id=mCT179472.0
FT                   protein_id=mCP102393.0 isoform=CRA_c"
FT                   /protein_id="EDL10059.1"
FT                   /translation="MSGFDNLNSGFYQTSYSIDEQSQQSYDYGGSGGPYSKQYAGCDYS
FT                   QQGRFVPPDMMQPQQTYTGQIYQPTQAYPPTTPQPFYGDSFEEEPPLLEELGINFDHIW
FT                   QKTLTVLHPLRAADGSIMNETDLAGPVVFCLAFGATLLLAGKIQFGYVYGISAIGCLGM
FT                   FCLLNLMSMTGVSFGCVASVLGYCLLPMILLSSFAVVFSLQGMVGILLTATIIGWCSFS
FT                   ASKIFISALAMDGQQLLVAYPCALLYGVFALISVF"
FT   CDS             complement(join(2925793..2925955,2927242..2927423,
FT                   2930303..2930448,2931598..2931718))
FT                   /codon_start=1
FT                   /gene="Yipf5"
FT                   /locus_tag="mCG_10357"
FT                   /product="Yip1 domain family, member 5, isoform CRA_a"
FT                   /note="gene_id=mCG10357.2 transcript_id=mCT174314.0
FT                   protein_id=mCP97233.0 isoform=CRA_a"
FT                   /protein_id="EDL10055.1"
FT                   /translation="MMQPQQTYTGQIYQPTQAYPPTTPQPFYGDSFEEEPPLLEELGIN
FT                   FDHIWQKTLTVLHPLRAADGSIMNETDLAGPVVFCLAFGATLLLAGKIQFGYVYGISAI
FT                   GCLGMFCLLNLMSMTGVSFGCVASVLGYCLLPMILLSSFAVVFSLQGMVGILLTATIIG
FT                   WCSFSASKIFISALAMDGQQLLVAYPCALLYGVFALISVF"
FT   CDS             complement(join(2925793..2925955,2927242..2927423,
FT                   2930303..2930448,2931598..2931718))
FT                   /codon_start=1
FT                   /gene="Yipf5"
FT                   /locus_tag="mCG_10357"
FT                   /product="Yip1 domain family, member 5, isoform CRA_a"
FT                   /note="gene_id=mCG10357.2 transcript_id=mCT179471.0
FT                   protein_id=mCP102392.0 isoform=CRA_a"
FT                   /protein_id="EDL10057.1"
FT                   /translation="MMQPQQTYTGQIYQPTQAYPPTTPQPFYGDSFEEEPPLLEELGIN
FT                   FDHIWQKTLTVLHPLRAADGSIMNETDLAGPVVFCLAFGATLLLAGKIQFGYVYGISAI
FT                   GCLGMFCLLNLMSMTGVSFGCVASVLGYCLLPMILLSSFAVVFSLQGMVGILLTATIIG
FT                   WCSFSASKIFISALAMDGQQLLVAYPCALLYGVFALISVF"
FT   CDS             complement(join(2925908..2925953,2927242..2927423,
FT                   2930303..2930448,2931598..2931770,2938301..2938410))
FT                   /codon_start=1
FT                   /gene="Yipf5"
FT                   /locus_tag="mCG_10357"
FT                   /product="Yip1 domain family, member 5, isoform CRA_b"
FT                   /note="gene_id=mCG10357.2 transcript_id=mCT179470.0
FT                   protein_id=mCP102394.0 isoform=CRA_b"
FT                   /protein_id="EDL10056.1"
FT                   /translation="MSGFDNLNSGFYQTSYSIDEQSQQSYDYGGSGGPYSKQYAGCDYS
FT                   QQGRFVPPDMMQPQQTYTGQIYQPTQAYPPTTPQPFYGDSFEEEPPLLEELGINFDHIW
FT                   QKTLTVLHPLRAADGSIMNETDLAGPVVFCLAFGATLLLAGKIQFGYVYGISAIGCLGM
FT                   FCLLNLMSMTGVSFGCVASVLGYCLLPMILLSSFAVVFSLQNGRNSSHCHNYWMV"
FT   assembly_gap    2951673..2951848
FT                   /estimated_length=176
FT                   /gap_type="unknown"
FT   gene            complement(2962427..>2977866)
FT                   /locus_tag="mCG_146101"
FT                   /note="gene_id=mCG146101.0"
FT   mRNA            complement(join(2962427..2962567,2964888..2965016,
FT                   2976911..2977053,2977650..>2977866))
FT                   /locus_tag="mCG_146101"
FT                   /product="mCG146101"
FT                   /note="gene_id=mCG146101.0 transcript_id=mCT186204.0
FT                   created on 14-JUL-2003"
FT   CDS             complement(join(2962545..2962567,2964888..2965016,
FT                   2976911..>2977010))
FT                   /codon_start=1
FT                   /locus_tag="mCG_146101"
FT                   /product="mCG146101"
FT                   /note="gene_id=mCG146101.0 transcript_id=mCT186204.0
FT                   protein_id=mCP107761.0"
FT                   /protein_id="EDL10053.1"
FT                   /translation="VLETQFLRRNNLFQSNQKPQPHTEPGRLVKSQTAKQWDTMIKGVS
FT                   FEIRQCELHHLPHVSHLCSNSCFYLYCGVRTSSGGARL"
FT   assembly_gap    2974482..2976290
FT                   /estimated_length=1809
FT                   /gap_type="unknown"
FT   gene            2976335..2977059
FT                   /locus_tag="mCG_49005"
FT                   /note="gene_id=mCG49005.2"
FT   mRNA            2976335..2977059
FT                   /locus_tag="mCG_49005"
FT                   /product="mCG49005"
FT                   /note="gene_id=mCG49005.2 transcript_id=mCT49188.2 created
FT                   on 16-OCT-2002"
FT   CDS             2976350..2976784
FT                   /codon_start=1
FT                   /locus_tag="mCG_49005"
FT                   /product="mCG49005"
FT                   /note="gene_id=mCG49005.2 transcript_id=mCT49188.2
FT                   protein_id=mCP34259.2"
FT                   /protein_id="EDL10054.1"
FT                   /translation="MVSCLHCSHNSIRTAPGTVGPLSFGAQAPQASLAFPAAFPSHLAG
FT                   TWASLCPCLQVGWLLQPWGAHLSVALPLGSLNASKSRYLLQLFQVQRIYLFYKVWISFF
FT                   LFFLRKLWLNIYIFFPLLHFFDSASSRFNFFPPRFVLARD"
FT   assembly_gap    2980567..2980586
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3017480..3017499
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3028555..3028755
FT                   /estimated_length=201
FT                   /gap_type="unknown"
FT   assembly_gap    3074948..3074967
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3084656..3084675
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(3089714..3104473)
FT                   /locus_tag="mCG_147316"
FT                   /note="gene_id=mCG147316.0"
FT   mRNA            complement(join(3089714..3090003,3104319..3104473))
FT                   /locus_tag="mCG_147316"
FT                   /product="mCG147316"
FT                   /note="gene_id=mCG147316.0 transcript_id=mCT187579.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(3089815..3089955)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147316"
FT                   /product="mCG147316"
FT                   /note="gene_id=mCG147316.0 transcript_id=mCT187579.0
FT                   protein_id=mCP109704.0"
FT                   /protein_id="EDL10052.1"
FT                   /translation="MATLVYGSSHHPHPKDVTSTSWDDWLGGVEPMTQLRHQRISPANL
FT                   G"
FT   assembly_gap    3098596..3098615
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3102711..3102810
FT                   /estimated_length=100
FT                   /gap_type="unknown"
FT   assembly_gap    3138483..3139056
FT                   /estimated_length=574
FT                   /gap_type="unknown"
FT   assembly_gap    3153562..3153581
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(3155941..>3158875)
FT                   /locus_tag="mCG_145137"
FT                   /note="gene_id=mCG145137.0"
FT   mRNA            complement(join(3155941..3156555,3157041..3157305,
FT                   3158762..>3158875))
FT                   /locus_tag="mCG_145137"
FT                   /product="mCG145137"
FT                   /note="gene_id=mCG145137.0 transcript_id=mCT184561.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(3156351..3156555,3157041..>3157108))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145137"
FT                   /product="mCG145137"
FT                   /note="gene_id=mCG145137.0 transcript_id=mCT184561.0
FT                   protein_id=mCP106247.0"
FT                   /protein_id="EDL10051.1"
FT                   /translation="PTGEKYAHLGYTKVRQNFLATPKYFHMLEDSKSHVYRKSNYGCSL
FT                   KKIIQIGFVVTTMFGSLVYVTVPKIVSCQKPLNIVLGQKLRIINN"
FT   assembly_gap    3184265..3184284
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3213916..3213935
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3216542..3216561
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3218060..3220163
FT                   /estimated_length=2104
FT                   /gap_type="unknown"
FT   assembly_gap    3223368..3223387
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3230848..3230990
FT                   /estimated_length=143
FT                   /gap_type="unknown"
FT   gene            <3235183..3254291
FT                   /locus_tag="mCG_51668"
FT                   /note="gene_id=mCG51668.2"
FT   mRNA            join(3235183..3235354,3241077..3241136,3253046..3254291)
FT                   /locus_tag="mCG_51668"
FT                   /product="mCG51668, transcript variant mCT174422"
FT                   /note="gene_id=mCG51668.2 transcript_id=mCT174422.0 created
FT                   on 06-FEB-2003"
FT   mRNA            join(<3235183..3235350,3253046..3254291)
FT                   /locus_tag="mCG_51668"
FT                   /product="mCG51668, transcript variant mCT179600"
FT                   /note="gene_id=mCG51668.2 transcript_id=mCT179600.0 created
FT                   on 06-FEB-2003"
FT   mRNA            join(3235184..3235354,3253046..3254291)
FT                   /locus_tag="mCG_51668"
FT                   /product="mCG51668, transcript variant mCT51851"
FT                   /note="gene_id=mCG51668.2 transcript_id=mCT51851.2 created
FT                   on 06-FEB-2003"
FT   CDS             join(<3235266..3235350,3253046..3253497)
FT                   /codon_start=1
FT                   /locus_tag="mCG_51668"
FT                   /product="mCG51668, isoform CRA_a"
FT                   /note="gene_id=mCG51668.2 transcript_id=mCT179600.0
FT                   protein_id=mCP102522.0 isoform=CRA_a"
FT                   /protein_id="EDL10048.1"
FT                   /translation="QFIGSLYLAVARLVTLNLQSQSGEVDAGGEPSRWSSSHCDCCCKN
FT                   GKGDKGESGTSCNDLSTSSCDSQSEASSPQETVICGPVTRQSNIQTLDRPIKKGPVQLI
FT                   QQSEMRRKSDLLRTLTSGSRESNISSKKKAAKEKLSIEEELEKCIQDFLKIKIPDRFPE
FT                   RKHPWQSELLRKYHL"
FT   CDS             join(3235342..3235354,3241077..3241136,3253046..3253497)
FT                   /codon_start=1
FT                   /locus_tag="mCG_51668"
FT                   /product="mCG51668, isoform CRA_c"
FT                   /note="gene_id=mCG51668.2 transcript_id=mCT174422.0
FT                   protein_id=mCP97341.0 isoform=CRA_c"
FT                   /protein_id="EDL10050.1"
FT                   /translation="MLEVSHLSNYLKECLSELSKEGMVGEPSRWSSSHCDCCCKNGKGD
FT                   KGESGTSCNDLSTSSCDSQSEASSPQETVICGPVTRQSNIQTLDRPIKKGPVQLIQQSE
FT                   MRRKSDLLRTLTSGSRESNISSKKKAAKEKLSIEEELEKCIQDFLKIKIPDRFPERKHP
FT                   WQSELLRKYHL"
FT   CDS             join(3235342..3235354,3253046..3253497)
FT                   /codon_start=1
FT                   /locus_tag="mCG_51668"
FT                   /product="mCG51668, isoform CRA_b"
FT                   /note="gene_id=mCG51668.2 transcript_id=mCT51851.2
FT                   protein_id=mCP34273.2 isoform=CRA_b"
FT                   /protein_id="EDL10049.1"
FT                   /translation="MLEVCEPSRWSSSHCDCCCKNGKGDKGESGTSCNDLSTSSCDSQS
FT                   EASSPQETVICGPVTRQSNIQTLDRPIKKGPVQLIQQSEMRRKSDLLRTLTSGSRESNI
FT                   SSKKKAAKEKLSIEEELEKCIQDFLKIKIPDRFPERKHPWQSELLRKYHL"
FT   assembly_gap    3239761..3239996
FT                   /estimated_length=236
FT                   /gap_type="unknown"
FT   assembly_gap    3243038..3243366
FT                   /estimated_length=329
FT                   /gap_type="unknown"
FT   assembly_gap    3326865..3328163
FT                   /estimated_length=1299
FT                   /gap_type="unknown"
FT   assembly_gap    3335467..3336061
FT                   /estimated_length=595
FT                   /gap_type="unknown"
FT   assembly_gap    3338083..3338102
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3357052..3357771
FT                   /estimated_length=720
FT                   /gap_type="unknown"
FT   assembly_gap    3375032..3377247
FT                   /estimated_length=2216
FT                   /gap_type="unknown"
FT   assembly_gap    3381577..3381596
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3385368..3385550
FT                   /estimated_length=183
FT                   /gap_type="unknown"
FT   assembly_gap    3409291..3409310
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3436288..3436307
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3448006..3448049
FT                   /estimated_length=44
FT                   /gap_type="unknown"
FT   assembly_gap    3490418..3490463
FT                   /estimated_length=46
FT                   /gap_type="unknown"
FT   assembly_gap    3490864..3490883
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3499672..3499801
FT                   /estimated_length=130
FT                   /gap_type="unknown"
FT   assembly_gap    3513334..3513353
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3521683..3521970
FT                   /estimated_length=288
FT                   /gap_type="unknown"
FT   assembly_gap    3533649..3533741
FT                   /estimated_length=93
FT                   /gap_type="unknown"
FT   assembly_gap    3546998..3547017
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3550528..3550547
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3572957..3573436
FT                   /estimated_length=480
FT                   /gap_type="unknown"
FT   assembly_gap    3574241..3574667
FT                   /estimated_length=427
FT                   /gap_type="unknown"
FT   assembly_gap    3580773..3580869
FT                   /estimated_length=97
FT                   /gap_type="unknown"
FT   assembly_gap    3616227..3616248
FT                   /estimated_length=22
FT                   /gap_type="unknown"
FT   assembly_gap    3627910..3627929
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3808269..3808288
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3813387..3813449
FT                   /estimated_length=63
FT                   /gap_type="unknown"
FT   assembly_gap    3814350..3814369
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3831660..3831750
FT                   /estimated_length=91
FT                   /gap_type="unknown"
FT   assembly_gap    3840465..3840484
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3847299..3853145
FT                   /estimated_length=5847
FT                   /gap_type="unknown"
FT   assembly_gap    3854437..3854800
FT                   /estimated_length=364
FT                   /gap_type="unknown"
FT   assembly_gap    3857758..3858158
FT                   /estimated_length=401
FT                   /gap_type="unknown"
FT   assembly_gap    3933305..3933324
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3952274..3952293
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3958891..3958910
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3976628..3976656
FT                   /estimated_length=29
FT                   /gap_type="unknown"
FT   assembly_gap    3980364..3982403
FT                   /estimated_length=2040
FT                   /gap_type="unknown"
FT   assembly_gap    3983589..3983743
FT                   /estimated_length=155
FT                   /gap_type="unknown"
FT   assembly_gap    3990556..3990575
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3993290..3993309
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4033023..4033042
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4049992..4050011
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4073857..4073876
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4075202..4075221
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4115215..4115234
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4119575..4119594
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4124324..4124491
FT                   /estimated_length=168
FT                   /gap_type="unknown"
FT   assembly_gap    4143998..4144490
FT                   /estimated_length=493
FT                   /gap_type="unknown"
FT   assembly_gap    4152530..4154719
FT                   /estimated_length=2190
FT                   /gap_type="unknown"
FT   assembly_gap    4156756..4156775
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4158356..4158375
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4175537..4175556
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4185185..4185421
FT                   /estimated_length=237
FT                   /gap_type="unknown"
FT   assembly_gap    4199995..4200014
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4204785..4204862
FT                   /estimated_length=78
FT                   /gap_type="unknown"
FT   assembly_gap    4238456..4242118
FT                   /estimated_length=3663
FT                   /gap_type="unknown"
FT   assembly_gap    4270097..4270116
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4280351..4280370
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4309419..4309902
FT                   /estimated_length=484
FT                   /gap_type="unknown"
FT   assembly_gap    4323099..4323123
FT                   /estimated_length=25
FT                   /gap_type="unknown"
FT   assembly_gap    4358004..4358146
FT                   /estimated_length=143
FT                   /gap_type="unknown"
FT   assembly_gap    4364345..4366174
FT                   /estimated_length=1830
FT                   /gap_type="unknown"
FT   assembly_gap    4371673..4371692
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4415319..4415525
FT                   /estimated_length=207
FT                   /gap_type="unknown"
FT   assembly_gap    4416236..4416255
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4419977..4420106
FT                   /estimated_length=130
FT                   /gap_type="unknown"
FT   assembly_gap    4461490..4461565
FT                   /estimated_length=76
FT                   /gap_type="unknown"
FT   assembly_gap    4467621..4467772
FT                   /estimated_length=152
FT                   /gap_type="unknown"
FT   assembly_gap    4469591..4469622
FT                   /estimated_length=32
FT                   /gap_type="unknown"
FT   assembly_gap    4482611..4482783
FT                   /estimated_length=173
FT                   /gap_type="unknown"
FT   assembly_gap    4487402..4487421
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4545190..4547470
FT                   /estimated_length=2281
FT                   /gap_type="unknown"
FT   assembly_gap    4555695..4555765
FT                   /estimated_length=71
FT                   /gap_type="unknown"
FT   assembly_gap    4562102..4562121
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4563609..4568970
FT                   /estimated_length=5362
FT                   /gap_type="unknown"
FT   assembly_gap    4573610..4574325
FT                   /estimated_length=716
FT                   /gap_type="unknown"
FT   assembly_gap    4600589..4601870
FT                   /estimated_length=1282
FT                   /gap_type="unknown"
FT   gene            complement(4605106..4680651)
FT                   /locus_tag="mCG_140804"
FT                   /note="gene_id=mCG140804.0"
FT   mRNA            complement(join(4605106..4605358,4610717..4610789,
FT                   4641825..4641930,4662054..4662214,4664621..4664694,
FT                   4667087..4667144,4680530..4680651))
FT                   /locus_tag="mCG_140804"
FT                   /product="mCG140804"
FT                   /note="gene_id=mCG140804.0 transcript_id=mCT171602.0
FT                   created on 06-AUG-2002"
FT   CDS             complement(join(4610730..4610789,4641825..4641930,
FT                   4662054..4662214,4664621..4664694,4667087..4667144,
FT                   4680530..4680604))
FT                   /codon_start=1
FT                   /locus_tag="mCG_140804"
FT                   /product="mCG140804"
FT                   /note="gene_id=mCG140804.0 transcript_id=mCT171602.0
FT                   protein_id=mCP94521.0"
FT                   /protein_id="EDL10047.1"
FT                   /translation="MGVTVDVHQVFQYPFEQVVACFLRKYPNPMDKNVISVKTVEEKKD
FT                   ESTGLIYRKRIAICQNVVPEILRKVSILKVPDIQLEEESWLSLQKRNMAIRSHCLTWTQ
FT                   YASMREESVFRESVENPNWTEFIQTGRISITGAGFLNCILETFASTFLRQGAQKGIRIM
FT                   EMLLKEQCGSPLVE"
FT   assembly_gap    4623803..4623841
FT                   /estimated_length=39
FT                   /gap_type="unknown"
FT   assembly_gap    4626847..4627208
FT                   /estimated_length=362
FT                   /gap_type="unknown"
FT   assembly_gap    4628643..4628662
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4646200..4646304
FT                   /estimated_length=105
FT                   /gap_type="unknown"
FT   assembly_gap    4649298..4649392
FT                   /estimated_length=95
FT                   /gap_type="unknown"
FT   assembly_gap    4675262..4675494
FT                   /estimated_length=233
FT                   /gap_type="unknown"
FT   assembly_gap    4684867..4685068
FT                   /estimated_length=202
FT                   /gap_type="unknown"
FT   assembly_gap    4698367..4698386
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4702506..4702609
FT                   /estimated_length=104
FT                   /gap_type="unknown"
FT   assembly_gap    4718467..4718486
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4719688..4719707
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4720735..4720754
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4732273..4737840
FT                   /estimated_length=5568
FT                   /gap_type="unknown"
FT   assembly_gap    4740417..4740436
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4742198..4742217
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4745449..4745468
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4746815..4746834
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4757635..4757837
FT                   /estimated_length=203
FT                   /gap_type="unknown"
FT   assembly_gap    4759873..4760539
FT                   /estimated_length=667
FT                   /gap_type="unknown"
FT   assembly_gap    4763882..4763901
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4772140..4772159
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4779624..4779706
FT                   /estimated_length=83
FT                   /gap_type="unknown"
FT   gene            <4782161..4886780
FT                   /gene="Sh3rf2"
FT                   /locus_tag="mCG_13025"
FT                   /note="gene_id=mCG13025.3"
FT   mRNA            join(<4782161..4782690,4829987..4830256,4832517..4832612,
FT                   4839572..4839892,4867792..4867883,4869202..4869372,
FT                   4877866..4878110,4881268..4881626,4884203..4886107)
FT                   /gene="Sh3rf2"
FT                   /locus_tag="mCG_13025"
FT                   /product="SH3 domain containing ring finger 2, transcript
FT                   variant mCT190285"
FT                   /note="gene_id=mCG13025.3 transcript_id=mCT190285.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(4782165..4782690,4829987..4830256,4832517..4832612,
FT                   4839572..4839892,4867792..4867883,4869202..4869384,
FT                   4877866..4878110,4881268..4881626,4884203..4886780)
FT                   /gene="Sh3rf2"
FT                   /locus_tag="mCG_13025"
FT                   /product="SH3 domain containing ring finger 2, transcript
FT                   variant mCT13770"
FT                   /note="gene_id=mCG13025.3 transcript_id=mCT13770.2 created
FT                   on 14-OCT-2002"
FT   mRNA            join(<4782204..4782690,4829987..4830256,4839572..4839892,
FT                   4867792..4867883,4869202..4869372,4877866..4878110,
FT                   4881268..4881626,4884203..4886703)
FT                   /gene="Sh3rf2"
FT                   /locus_tag="mCG_13025"
FT                   /product="SH3 domain containing ring finger 2, transcript
FT                   variant mCT190284"
FT                   /note="gene_id=mCG13025.3 transcript_id=mCT190284.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<4782307..4782690,4829987..4830256,4832517..4832612,
FT                   4839572..4839892,4867792..4867883,4869202..4869372,
FT                   4877866..4878110,4881268..4881626,4884203..4884478)
FT                   /codon_start=1
FT                   /gene="Sh3rf2"
FT                   /locus_tag="mCG_13025"
FT                   /product="SH3 domain containing ring finger 2, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG13025.3 transcript_id=mCT190285.0
FT                   protein_id=mCP111263.0 isoform=CRA_c"
FT                   /protein_id="EDL10046.1"
FT                   /translation="NKMDDLTLLDLLECPVCFEKLDVTAKVLPCQHTFCKPCLQRIFKA
FT                   HKELRCPECRTLVFCSIEALPANLLLVRLLDGVRSGQSSWKGGSFRRPRILTLQDNRKA
FT                   KSSPRSLQASPFRLVPSVRIHMDGVPRAKALCNYRGKNPGDLKFNKGDVILLRRQLDEN
FT                   WYQGEINGVSGIFPASSVEVIKQLPQPPPLCRALYNFDLRDKDKSENQDCLTFLKDDVI
FT                   TVISRVDENWAEGKLGDKVGIFPILFVEPNVSARHLLENKGHQLSRTRHLSLMSSPSRG
FT                   KATNTSSLRKSPGSRRKGSGQFSMTTALNTLNRTVHSPEGHQMVEISTPMLISSNSPSV
FT                   LTQHGDKADFPTSSTGQVSSSQPAPASPGHSTAMVSVPSSQQHLSNNMFVALHTYSAHR
FT                   PEELDLQKGEGIRVLGKYQDGWLKGLSLLTGRTGIFPSDYVIPVFSSTARKTSSFPDSR
FT                   SPTVCTTWALSTSSVSSQGSFAEGDPRQSGPFKSVFVPTAVVNPSRSTPGPGSSGQGSL
FT                   RKVRSSMRKNGSLQRPVQSGIPTFMVGSLRCSPTMVIRPQRFQFYPPQGMTPSPTPIMV
FT                   EMGSKSIYTGEPALTCINRGSKTRIHSAGNSIIMEGKETPIKSEPPPKPPASAPPSILV
FT                   KPENSKNGTEKQVKTVRFQNYSPPPTKHSASSPTSGKHDHPATLKGSQHEAVSSGGEMT
FT                   ILFAHRSGCHSGQQTDLRRKSAFGKTMPLLSTASATQTLFPSK"
FT   CDS             join(<4782307..4782690,4829987..4830256,4839572..4839892,
FT                   4867792..4867883,4869202..4869372,4877866..4878110,
FT                   4881268..4881626,4884203..4884478)
FT                   /codon_start=1
FT                   /gene="Sh3rf2"
FT                   /locus_tag="mCG_13025"
FT                   /product="SH3 domain containing ring finger 2, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG13025.3 transcript_id=mCT190284.0
FT                   protein_id=mCP111262.0 isoform=CRA_b"
FT                   /protein_id="EDL10045.1"
FT                   /translation="NKMDDLTLLDLLECPVCFEKLDVTAKVLPCQHTFCKPCLQRIFKA
FT                   HKELRCPECRTLVFCSIEALPANLLLVRLLDGVRSGQSSWKGGSFRRPRILTLQDNRKA
FT                   KSSPRSLQASPFRLVPSVRIHMDGVPRAKALCNYRGKNPGDLKFNKGDVILLRRQLDEN
FT                   WYQGEINGVSGIFPASSVEVIKQLPQPPPLCRALYNFDLRDKDKSENQDCLTFLKPNVS
FT                   ARHLLENKGHQLSRTRHLSLMSSPSRGKATNTSSLRKSPGSRRKGSGQFSMTTALNTLN
FT                   RTVHSPEGHQMVEISTPMLISSNSPSVLTQHGDKADFPTSSTGQVSSSQPAPASPGHST
FT                   AMVSVPSSQQHLSNNMFVALHTYSAHRPEELDLQKGEGIRVLGKYQDGWLKGLSLLTGR
FT                   TGIFPSDYVIPVFSSTARKTSSFPDSRSPTVCTTWALSTSSVSSQGSFAEGDPRQSGPF
FT                   KSVFVPTAVVNPSRSTPGPGSSGQGSLRKVRSSMRKNGSLQRPVQSGIPTFMVGSLRCS
FT                   PTMVIRPQRFQFYPPQGMTPSPTPIMVEMGSKSIYTGEPALTCINRGSKTRIHSAGNSI
FT                   IMEGKETPIKSEPPPKPPASAPPSILVKPENSKNGTEKQVKTVRFQNYSPPPTKHSASS
FT                   PTSGKHDHPATLKGSQHEAVSSGGEMTILFAHRSGCHSGQQTDLRRKSAFGKTMPLLST
FT                   ASATQTLFPSK"
FT   CDS             join(4782313..4782690,4829987..4830256,4832517..4832612,
FT                   4839572..4839892,4867792..4867883,4869202..4869384,
FT                   4877866..4878110,4881268..4881626,4884203..4884478)
FT                   /codon_start=1
FT                   /gene="Sh3rf2"
FT                   /locus_tag="mCG_13025"
FT                   /product="SH3 domain containing ring finger 2, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG13025.3 transcript_id=mCT13770.2
FT                   protein_id=mCP22540.2 isoform=CRA_a"
FT                   /protein_id="EDL10044.1"
FT                   /translation="MDDLTLLDLLECPVCFEKLDVTAKVLPCQHTFCKPCLQRIFKAHK
FT                   ELRCPECRTLVFCSIEALPANLLLVRLLDGVRSGQSSWKGGSFRRPRILTLQDNRKAKS
FT                   SPRSLQASPFRLVPSVRIHMDGVPRAKALCNYRGKNPGDLKFNKGDVILLRRQLDENWY
FT                   QGEINGVSGIFPASSVEVIKQLPQPPPLCRALYNFDLRDKDKSENQDCLTFLKDDVITV
FT                   ISRVDENWAEGKLGDKVGIFPILFVEPNVSARHLLENKGHQLSRTRHLSLMSSPSRGKA
FT                   TNTSSLRKSPGSRRKGSGQFSMTTALNTLNRTVHSPEGHQMVEISTPMLISSNSPSVLT
FT                   QHGDKADFPTSSTGQVSSSQPAPASPGHSTAMVSVPSSQQHLSNNMFVALHTYSAHRPE
FT                   ELDLQKGEGIRVLGKYQDGWLKGLSLLTGRTGIFPSDYVIPVFRYVSSSTARKTSSFPD
FT                   SRSPTVCTTWALSTSSVSSQGSFAEGDPRQSGPFKSVFVPTAVVNPSRSTPGPGSSGQG
FT                   SLRKVRSSMRKNGSLQRPVQSGIPTFMVGSLRCSPTMVIRPQRFQFYPPQGMTPSPTPI
FT                   MVEMGSKSIYTGEPALTCINRGSKTRIHSAGNSIIMEGKETPIKSEPPPKPPASAPPSI
FT                   LVKPENSKNGTEKQVKTVRFQNYSPPPTKHSASSPTSGKHDHPATLKGSQHEAVSSGGE
FT                   MTILFAHRSGCHSGQQTDLRRKSAFGKTMPLLSTASATQTLFPSK"
FT   assembly_gap    4795842..4795897
FT                   /estimated_length=56
FT                   /gap_type="unknown"
FT   assembly_gap    4844823..4844983
FT                   /estimated_length=161
FT                   /gap_type="unknown"
FT   assembly_gap    4847443..4847534
FT                   /estimated_length=92
FT                   /gap_type="unknown"
FT   assembly_gap    4852392..4852411
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4856117..4856136
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4895938..4895957
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(4906938..>4924918)
FT                   /locus_tag="mCG_144591"
FT                   /note="gene_id=mCG144591.0"
FT   mRNA            complement(join(4906938..4907214,4908530..4908666,
FT                   4920828..4920964,4924737..>4924918))
FT                   /locus_tag="mCG_144591"
FT                   /product="mCG144591"
FT                   /note="gene_id=mCG144591.0 transcript_id=mCT184015.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(4907074..4907214,4908530..4908666,
FT                   4920828..4920964,4924737..>4924882))
FT                   /codon_start=1
FT                   /locus_tag="mCG_144591"
FT                   /product="mCG144591"
FT                   /note="gene_id=mCG144591.0 transcript_id=mCT184015.0
FT                   protein_id=mCP106234.0"
FT                   /protein_id="EDL10042.1"
FT                   /translation="PGGKKTLLTMSWMGHHFSRWCKDISVLSSHLPLFSPMPSEDEHLI
FT                   SNLRSHVPARVVVKQPIRGAIGRTTVAAIVQTGGDWSTGLFSVCRDRKICFWGLLCPMC
FT                   LECDIARHYGECLCWPLLPGSTFALRIGTRERHRIQGTLCEDCVVVHCCWPFSICQVAR
FT                   ELKMRTSQLYEICEVPELKNTLV"
FT   gene            4912250..4914358
FT                   /locus_tag="mCG_63350"
FT                   /note="gene_id=mCG63350.2"
FT   mRNA            join(4912250..4912644,4912845..4914214,4914326..4914358)
FT                   /locus_tag="mCG_63350"
FT                   /product="mCG63350"
FT                   /note="gene_id=mCG63350.2 transcript_id=mCT63533.2 created
FT                   on 16-OCT-2002"
FT   CDS             join(4912601..4912644,4912845..4913169)
FT                   /codon_start=1
FT                   /locus_tag="mCG_63350"
FT                   /product="mCG63350"
FT                   /note="gene_id=mCG63350.2 transcript_id=mCT63533.2
FT                   protein_id=mCP42475.2"
FT                   /protein_id="EDL10043.1"
FT                   /translation="MPPQQPSMGRPSVRSENLTLILTPQMDTQVIEVMVSLPRGIVSIS
FT                   PGDRQDQVLTWARGSVCVFPQDQTEPLWVPERLVRRCKNEAPDPVAPVDVVDGPTNTND
FT                   GAKMGDPFSVPEADTSST"
FT   assembly_gap    4927124..4927294
FT                   /estimated_length=171
FT                   /gap_type="unknown"
FT   gene            4928895..4929689
FT                   /pseudo
FT                   /locus_tag="mCG_49696"
FT                   /note="gene_id=mCG49696.2"
FT   mRNA            4928895..4929689
FT                   /pseudo
FT                   /locus_tag="mCG_49696"
FT                   /note="gene_id=mCG49696.2 transcript_id=mCT49879.2 created
FT                   on 17-OCT-2002"
FT   gene            complement(4930578..4990399)
FT                   /locus_tag="mCG_127948"
FT                   /note="gene_id=mCG127948.0"
FT   mRNA            complement(join(4930578..4930961,4938243..4938375,
FT                   4939386..4939481,4940735..4940839,4943017..4943127,
FT                   4945107..4945217,4945723..4945863,4946759..4946899,
FT                   4948113..4948203,4949732..4949915,4954007..4954070,
FT                   4955489..4955546,4956259..4956471,4956911..4957049,
FT                   4957882..4957964,4958044..4958109,4958195..4958280,
FT                   4962134..4962211,4962915..4963055,4963819..4963872,
FT                   4964917..4964993,4965073..4965160,4970231..4970456,
FT                   4971023..4971090,4971286..4971349,4972096..4972208,
FT                   4973068..4973229,4974265..4974402,4979148..4979228,
FT                   4979612..4979699,4985303..4985427,4990231..4990399))
FT                   /locus_tag="mCG_127948"
FT                   /product="mCG127948"
FT                   /note="gene_id=mCG127948.0 transcript_id=mCT129240.1
FT                   created on 14-OCT-2002"
FT   CDS             complement(join(4930756..4930961,4938243..4938375,
FT                   4939386..4939481,4940735..4940839,4943017..4943127,
FT                   4945107..4945217,4945723..4945863,4946759..4946899,
FT                   4948113..4948203,4949732..4949915,4954007..4954070,
FT                   4955489..4955546,4956259..4956471,4956911..4957049,
FT                   4957882..4957964,4958044..4958109,4958195..4958280,
FT                   4962134..4962211,4962915..4963055,4963819..4963872,
FT                   4964917..4964993,4965073..4965160,4970231..4970456,
FT                   4971023..4971090,4971286..4971349,4972096..4972208,
FT                   4973068..4973229,4974265..4974402,4979148..4979228,
FT                   4979612..4979699,4985303..4985427,4990231..4990236))
FT                   /codon_start=1
FT                   /locus_tag="mCG_127948"
FT                   /product="mCG127948"
FT                   /note="gene_id=mCG127948.0 transcript_id=mCT129240.1
FT                   protein_id=mCP77816.1"
FT                   /db_xref="GOA:Q7TSZ3"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR004493"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="MGI:MGI:1913808"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TSZ3"
FT                   /protein_id="EDL10039.1"
FT                   /translation="MAGRKGTAKVDFLKEIEKEAQQKWEAEKVFEVSASRLEKQKQSSK
FT                   GKYFVTFPYPYMNGRLHLGHTFSLSKCEFAVGYQRLKGKSCLFPFGLHCTGMPIKACAD
FT                   KLKREIELYGCPPDFPEEEEEEEESSAKPGDIVVRDKAKGKKSKAAAKAGSSKYQWDIM
FT                   KSLGLSDDDIVKFSEAEHWLDYFPPLAVQDLKTIGLKVDWRRSFITTDVNPYYDSFVRW
FT                   QFLTLRERNKIKFGKRYTIYSPKDGQPCMDHDRQTGEGVGPQEYTLVKLKVLEPYPSKL
FT                   SGLKGKNIFLVAATLRPETMFGQTNCWVRPDMKYIGFETANGDIFICTQRAARNMSYQG
FT                   FTKHNGVVPVVKELMGEEILGASLSAPLTCYKVVYVLPMLTIKEDKGTGVVTSVPSDSP
FT                   DDLAALRDLKKKQALRTKFGIRDDMVLPFEPVPVLEIPGIGNLPAVTVCDELKIQSQND
FT                   REKLAEAKEKLYLRGFYDGVMLVDGFKGQKIQHVKKTIQKNMIDAGDALIYMEPEKQVM
FT                   SRSADECVVALCDQWYLDYGDENWKKQTFQCLKNMETFCEESRKNFEASLDWLQEHACS
FT                   RTYGLGTRLPWDEQWLIESLSDSTIYMAFYTVAHLLQGGDLNGQAESPLGIRPQQMTKD
FT                   VWDYVFFKDAPFPKTQIPKEKLDQLKQEFEFWYPVDLRASGKDLIPNHLSYYIYNHVAM
FT                   WPEQSDKWPVSVRANGHLLLNSEKMSKSTGNFLTLSQAVDKFSADGMRLALADAGDTVE
FT                   DANFVEAMADAGILRLYTWVEWVKEMLASCSSLRSGPADSFNDRVFASEMNAGIIKTDQ
FT                   NYEKMMFKEALKTGFFEFQAAKDKYRELATEGMHRELVFRFIEVQTILLTPFCPHLCEH
FT                   IWTLLGKPDSIMHASWPVAGPVDESLIRSSQYLMEVAHDLRLRLKNYMMPAKGKKTDKQ
FT                   PAQRPSHCTIYVAKNYPVWQHITLTTLRSHFEANNGKLPDNKVIASELGSLPELKKYMK
FT                   KVMPFVAMIKENMEKKGPRVLDLELEFDEQAVLMENIVYLTNSLELEHIEVKFASEAED
FT                   KVREECCPGKPLNVFRTEPGVPVSLVNPQPSSGHFSTKIDIRQGDSCESIIRRLMKTDR
FT                   GIKDLSKVKLMRFDDPLLGPRRVPVLGREHSEKTLISENAVFHVDLVSKKVHLTENGLR
FT                   TDIGDTMVYLVH"
FT   gene            <4958797..4961523
FT                   /locus_tag="mCG_145134"
FT                   /note="gene_id=mCG145134.0"
FT   mRNA            join(<4958797..4959127,4959169..4959183,4959211..4961523)
FT                   /locus_tag="mCG_145134"
FT                   /product="mCG145134"
FT                   /note="gene_id=mCG145134.0 transcript_id=mCT184558.0
FT                   created on 05-JUN-2003"
FT   CDS             <4960232..4960564
FT                   /codon_start=1
FT                   /locus_tag="mCG_145134"
FT                   /product="mCG145134"
FT                   /note="gene_id=mCG145134.0 transcript_id=mCT184558.0
FT                   protein_id=mCP106244.0"
FT                   /protein_id="EDL10041.1"
FT                   /translation="VGETERSHRIKARRTDLRSREIYNGQEISAPAEQQQPIQRTCCSG
FT                   WECILRCNQSHTETRDKLRKMQGCNFWDDMLRAWQVLILGKNKNWIRKYSLHTTVRLAM
FT                   SQKYKQ"
FT   assembly_gap    4976800..4977793
FT                   /estimated_length=994
FT                   /gap_type="unknown"
FT   gene            4980695..4981190
FT                   /locus_tag="mCG_11587"
FT                   /note="gene_id=mCG11587.0"
FT   mRNA            4980695..4981190
FT                   /locus_tag="mCG_11587"
FT                   /product="mCG11587"
FT                   /note="gene_id=mCG11587.0 transcript_id=mCT11906.0 created
FT                   on 14-OCT-2002"
FT   CDS             4980718..4981155
FT                   /codon_start=1
FT                   /locus_tag="mCG_11587"
FT                   /product="mCG11587"
FT                   /note="gene_id=mCG11587.0 transcript_id=mCT11906.0
FT                   protein_id=mCP22519.1"
FT                   /protein_id="EDL10040.1"
FT                   /translation="MPGVTVKDVNQQEFTRALAAFLKKSGKLKVPEWVDTVKLAKHKEL
FT                   APYDENWFYTRAASTAWHVYLRGGAGVGSMTKIYGGRQRNGVRPSHFSRGSKSVARQVL
FT                   QALEGLKMVEKDQDGGRKLTPQGQRDLDRIAGQVAAANKKH"
FT   assembly_gap    4999470..4999548
FT                   /estimated_length=79
FT                   /gap_type="unknown"
FT   gene            complement(5002732..5003536)
FT                   /locus_tag="mCG_1033463"
FT                   /note="gene_id=mCG1033463.0"
FT   mRNA            complement(join(5002732..5002893,5003300..5003536))
FT                   /locus_tag="mCG_1033463"
FT                   /product="mCG1033463"
FT                   /note="gene_id=mCG1033463.0 transcript_id=mCT151167.0
FT                   created on 10-MAR-2003"
FT   CDS             complement(join(5002806..5002893,5003300..5003346))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1033463"
FT                   /product="mCG1033463"
FT                   /note="gene_id=mCG1033463.0 transcript_id=mCT151167.0
FT                   protein_id=mCP77690.1"
FT                   /protein_id="EDL10038.1"
FT                   /translation="MSRNDSAVVNLQHNVRRNFHQQTSFKRKLMAKMGHWETMGEGGD"
FT   gene            5003736..5068451
FT                   /locus_tag="mCG_11586"
FT                   /note="gene_id=mCG11586.2"
FT   mRNA            join(5003736..5003868,5030251..5030430,5034094..5034228,
FT                   5042391..5042555,5046021..5046170,5048224..5048368,
FT                   5049186..5049339,5050334..5050630,5052477..5052620,
FT                   5054327..5054446,5055586..5055660,5055776..5055940,
FT                   5061126..5061230,5061555..5061743,5065309..5065419,
FT                   5066738..5067363)
FT                   /locus_tag="mCG_11586"
FT                   /product="mCG11586, transcript variant mCT174315"
FT                   /note="gene_id=mCG11586.2 transcript_id=mCT174315.0 created
FT                   on 14-OCT-2002"
FT   assembly_gap    5006896..5007223
FT                   /estimated_length=328
FT                   /gap_type="unknown"
FT   mRNA            join(5027525..5027750,5028664..5028924,5030137..5030430,
FT                   5034094..5034228,5042391..5042555,5046021..5046170,
FT                   5048224..5048368,5049186..5049339,5050334..5050630,
FT                   5052477..5052620,5054327..5054446,5055586..5055660,
FT                   5055776..5055940,5061126..5061230,5061555..5061743,
FT                   5065309..5065419,5066738..5068451)
FT                   /locus_tag="mCG_11586"
FT                   /product="mCG11586, transcript variant mCT11907"
FT                   /note="gene_id=mCG11586.2 transcript_id=mCT11907.2 created
FT                   on 14-OCT-2002"
FT   CDS             join(5027531..5027750,5028664..5028924,5030137..5030430,
FT                   5034094..5034228,5042391..5042555,5046021..5046170,
FT                   5048224..5048368,5049186..5049339,5050334..5050630,
FT                   5052477..5052620,5054327..5054446,5055586..5055660,
FT                   5055776..5055940,5061126..5061230,5061555..5061743,
FT                   5065309..5065419,5066738..5066821)
FT                   /codon_start=1
FT                   /locus_tag="mCG_11586"
FT                   /product="mCG11586, isoform CRA_b"
FT                   /note="gene_id=mCG11586.2 transcript_id=mCT11907.2
FT                   protein_id=mCP22518.2 isoform=CRA_b"
FT                   /protein_id="EDL10037.1"
FT                   /translation="MAFISVYYRTREKKREDGKWRDYERYYERNELYREKYDWRRGRSK
FT                   SRSKSRGLSRSRSRSRGRSKDRDPNRNVEHRERSKFKSERNDLESSYVPVSAPPPSSSE
FT                   QYSSGAQSIPSTVTVIAPAHHSENTTESWSNYYNNHSSSNSFGRNPPPKRRCRDYDERG
FT                   FCVLGDLCQFDHGNDPLVVDEVALPSMIPFPPPPPGLPPPPPPGMLMPPMPGPGPGPGP
FT                   GPGPGPGPGPGPGHSMRLPVPQGHGQPPPSVVLPIPRPPISQSSLINSRDQPGTSAVPN
FT                   LAPVGARLPPPLPQNLLYTVSERQPMYSREHGAAASERLQLGTPPPLLAARLVPPRNLM
FT                   GSSIGYHTSVSSPTPLVPDTYEPDGYNPEAPSITSSGRSQYRQFFSRAQTQRPNLIGLT
FT                   SGDMDANPRAANIVIQTEPPVPVSVNSNVTRVVLEPESRKRAISGLEGPLTKKPWLGKQ
FT                   GNNNQSKPGFLRKNHYTNTKLEVKKIPQELNNITKLNEHFSKFGTIVNIQVAFKGDPEA
FT                   ALIQYLTNEEARKAISSTEAVLNNRFIRVLWHRENNEQPALQSSAQILLQQQHTLSHLS
FT                   QQHHSLPQHLHPQQVMVTQSSPSSVHGGIQKMMGKPQTSGAYVLNKVPVKHRLGHASTN
FT                   QSDTSHLLNQTGGSSGEDCPVFSTPGHPKTIYSSSNLKAPSKLCSGSKSHDVQEVLKKK
FT                   QEAMKLQQDMRKKKQEMLEKQIECQKMLISKLEKNKNMKPEERANIMKTLKELGEKISQ
FT                   LKDELKTSSTVSTPSKVKTKTEAQKELLDTELDLHKRLSSGEDTTELRKKLSQLQVEAA
FT                   RLGILPVGRGKTISSQGRGRGRGRGRGRGSLNHMVVDHRPKALPGGGFIEEEKDELLQH
FT                   FSATNQASKFKDRRLQISWHKPKVPSISTETEEEEVKEEETETSDLFLHDDDDEDEDEY
FT                   ESRSWRR"
FT   CDS             join(5030277..5030430,5034094..5034228,5042391..5042555,
FT                   5046021..5046170,5048224..5048368,5049186..5049339,
FT                   5050334..5050630,5052477..5052620,5054327..5054446,
FT                   5055586..5055660,5055776..5055940,5061126..5061230,
FT                   5061555..5061743,5065309..5065419,5066738..5066821)
FT                   /codon_start=1
FT                   /locus_tag="mCG_11586"
FT                   /product="mCG11586, isoform CRA_a"
FT                   /note="gene_id=mCG11586.2 transcript_id=mCT174315.0
FT                   protein_id=mCP97234.0 isoform=CRA_a"
FT                   /protein_id="EDL10036.1"
FT                   /translation="MLMPPMPGPGPGPGPGPGPGPGPGPGPGHSMRLPVPQGHGQPPPS
FT                   VVLPIPRPPISQSSLINSRDQPGTSAVPNLAPVGARLPPPLPQNLLYTVSERQPMYSRE
FT                   HGAAASERLQLGTPPPLLAARLVPPRNLMGSSIGYHTSVSSPTPLVPDTYEPDGYNPEA
FT                   PSITSSGRSQYRQFFSRAQTQRPNLIGLTSGDMDANPRAANIVIQTEPPVPVSVNSNVT
FT                   RVVLEPESRKRAISGLEGPLTKKPWLGKQGNNNQSKPGFLRKNHYTNTKLEVKKIPQEL
FT                   NNITKLNEHFSKFGTIVNIQVAFKGDPEAALIQYLTNEEARKAISSTEAVLNNRFIRVL
FT                   WHRENNEQPALQSSAQILLQQQHTLSHLSQQHHSLPQHLHPQQVMVTQSSPSSVHGGIQ
FT                   KMMGKPQTSGAYVLNKVPVKHRLGHASTNQSDTSHLLNQTGGSSGEDCPVFSTPGHPKT
FT                   IYSSSNLKAPSKLCSGSKSHDVQEVLKKKQEAMKLQQDMRKKKQEMLEKQIECQKMLIS
FT                   KLEKNKNMKPEERANIMKTLKELGEKISQLKDELKTSSTVSTPSKVKTKTEAQKELLDT
FT                   ELDLHKRLSSGEDTTELRKKLSQLQVEAARLGILPVGRGKTISSQGRGRGRGRGRGRGS
FT                   LNHMVVDHRPKALPGGGFIEEEKDELLQHFSATN