spacer

EBI Dbfetch

ID   CH466527; SV 2; linear; genomic DNA; CON; MUS; 51681067 BP.
XX
AC   CH466527;
XX
PR   Project:PRJNA11785;
XX
DT   04-AUG-2005 (Rel. 84, Created)
DT   10-JUN-2007 (Rel. 92, Last updated, Version 8)
XX
DE   Mus musculus 232000009812440 genomic scaffold, whole genome shotgun
DE   sequence.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-51681067
RX   DOI; 10.1126/science.1069193.
RX   PUBMED; 12040188.
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Miklos G.L., Wides R.,
RA   Halpern A., Li P.W., Sutton G.G., Nadeau J., Salzberg S.L., Holt R.A.,
RA   Kodira C.D., Lu F., Chen L., Deng Z., Evangelista C.C., Gan W.,
RA   Heiman T.J., Li J., Li Z., Merkulov G.V., Milshina N.V., Naik A.K., Qi R.,
RA   Shue B.C., Wang A., Wang J., Wang X., Yan X., Ye J., Yooseph S., Zhao Q.,
RA   Zheng L., Zhu S.C., Biddick K., Bolanos R., Delcher A.L., Dew I.M.,
RA   Fasulo D., Flanigan M.J., Huson D.H., Kravitz S.A., Miller J.R.,
RA   Mobarry C.M., Reinert K., Remington K.A., Zhang Q., Zheng X.H.,
RA   Nusskern D.R., Lai Z., Lei Y., Zhong W., Yao A., Guan P., Ji R.R., Gu Z.,
RA   Wang Z.Y., Zhong F., Xiao C., Chiang C.C., Yandell M., Wortman J.R.,
RA   Amanatides P.G., Hladun S.L., Pratts E.C., Johnson J.E., Dodson K.L.,
RA   Woodford K.J., Evans C.A., Gropman B., Rusch D.B., Venter E., Wang M.,
RA   Smith T.J., Houck J.T., Tompkins D.E., Haynes C., Jacob D., Chin S.H.,
RA   Allen D.R., Dahlke C.E., Sanders R., Li K., Liu X., Levitsky A.A.,
RA   Majoros W.H., Chen Q., Xia A.C., Lopez J.R., Donnelly M.T., Newman M.H.,
RA   Glodek A., Kraft C.L., Nodell M., Ali F., An H.J., Baldwin-Pitts D.,
RA   Beeson K.Y., Cai S., Carnes M., Carver A., Caulk P.M., Center A.,
RA   Chen Y.H., Cheng M.L., Coyne M.D., Crowder M., Danaher S., Davenport L.B.,
RA   Desilets R., Dietz S.M., Doup L., Dullaghan P., Ferriera S., Fosler C.R.,
RA   Gire H.C., Gluecksmann A., Gocayne J.D., Gray J., Hart B., Haynes J.,
RA   Hoover J., Howland T., Ibegwam C., Jalali M., Johns D., Kline L., Ma D.S.,
RA   MacCawley S., Magoon A., Mann F., May D., McIntosh T.C., Mehta S., Moy L.,
RA   Moy M.C., Murphy B.J., Murphy S.D., Nelson K.A., Nuri Z., Parker K.A.,
RA   Prudhomme A.C., Puri V.N., Qureshi H., Raley J.C., Reardon M.S.,
RA   Regier M.A., Rogers Y.H., Romblad D.L., Schutz J., Scott J.L., Scott R.,
RA   Sitter C.D., Smallwood M., Sprague A.C., Stewart E., Strong R.V., Suh E.,
RA   Sylvester K., Thomas R., Tint N.N., Tsonis C., Wang G., Wang G.,
RA   Williams M.S., Williams S.M., Windsor S.M., Wolfe K., Wu M.M., Zaveri J.,
RA   Chaturvedi K., Gabrielian A.E., Ke Z., Sun J., Subramanian G., Venter J.C.,
RA   Pfannkoch C.M., Barnstead M., Stephenson L.D.;
RT   "A comparison of whole-genome shotgun-derived mouse chromosome 16 and the
RT   human genome";
RL   Science 296(5573):1661-1671(2002).
XX
RN   [2]
RP   1-51681067
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (05-JUL-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
RN   [3]
RP   1-51681067
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (02-SEP-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
DR   MD5; 1a39eac305dd46901655ef161ea23852.
DR   ENA; AAHY010000000; SET.
DR   ENA; AAHY000000000; SET.
DR   ENA-CON; CM000212.
DR   Ensembl-Gn; ENSMUSG00000003411; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000005994; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000006386; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000008489; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000008575; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000008932; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000010517; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028358; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028359; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028362; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028392; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028396; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028492; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028495; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028519; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028523; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028525; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028530; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028553; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028557; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028559; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028568; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028571; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028577; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028600; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028607; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028609; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000034557; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000034853; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000034919; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038172; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038330; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039005; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039105; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039270; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000048747; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000048806; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000051675; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000052520; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000052914; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000057722; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000058046; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000059810; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000063172; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000063800; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000063851; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000066090; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000066148; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000066152; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000066154; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000070904; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000073802; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000076432; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000078354; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000078355; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000078625; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000094618; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000095498; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000095896; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000096011; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000096682; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000097078; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000101252; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000003502; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000006151; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000006687; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000008633; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030043; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030047; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030088; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030101; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030205; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030216; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030248; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030280; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030284; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030299; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030303; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030305; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030345; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030348; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000035301; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000044248; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000046558; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000047922; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000048096; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000049531; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000050850; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000053304; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000055671; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000062145; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000064770; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000065870; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000079213; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000079420; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000084524; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000084530; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000084531; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000094972; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000094973; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000094992; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000097981; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102724; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102739; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102740; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102741; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102742; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102762; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102781; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102798; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102804; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102808; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102809; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102814; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102831; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000103002; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105146; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105147; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105148; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106650; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106657; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106713; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106830; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106869; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106908; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106914; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106915; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106921; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107068; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107107; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107359; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107366; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107472; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107488; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000116317; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000162787; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000169211; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000181601; mus_musculus.
XX
CC   On Sep 6, 2005 this sequence version replaced gi:70980453.
CC   This is the July 2001 combined whole genome shotgun assembly of Mus
CC   musculus. It contains 27 million Celera reads on four Mus musculus
CC   strains (129X1/SvJ, 129S1/SvImJ, DBA/2J and A/J), 13 million reads
CC   on C57BL/6J from the NCBI Trace Archive, 0.4 million BAC end
CC   sequences from TIGR, and unfinished and finished BACs pulled from
CC   NCBI (Nature 2002. 420:520-562). The assembly process relied on
CC   Celera's paired reads and BAC end reads for long range order and
CC   orientation. Its scaffolds were mapped to chromosomes using STS
CC   maps. For more detailed information about whole genome sequencing
CC   and Celera's assembly process, please refer to Venter, J.C. et al.
CC   Science 2001. 291:1304-1351.
CC   This version of genes, transcripts, and proteins was
CC   computationally created in November 2001 from the whole-genome
CC   mapping of transcript and protein sequences on the Celera mouse
CC   genome assembly by Celera Chromosome Team and Content Systems.  The
CC   data sets used by this annotation process were collected in 2001
CC   and include RefSeq (NM_ from mouse and human) sequences, GenBank
CC   mRNA and dbEST sequences, mammalian SwissProt sequences,  and NRAA
CC   sequences (all mouse unless noted otherwise).  The initial gene set
CC   was manually curated between 2002 and 2003. Subsequently, automated
CC   annotation updates were performed.  The CDS of each transcript was
CC   manually or computationally defined by either the longest
CC   ATG-to-Stop or the longest open reading frame. All CDSs
CC   corresponding to the longest open reading frames with no starting
CC   ATG were flagged as partial.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..51681067
FT                   /organism="Mus musculus"
FT                   /chromosome="4"
FT                   /strain="mixed"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   assembly_gap    1100..1119
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1291..4106)
FT                   /locus_tag="mCG_148051"
FT                   /note="gene_id=mCG148051.1"
FT   mRNA            complement(join(1291..1336,1501..1602,1945..2055,
FT                   2635..2708,3481..3614,3953..4106))
FT                   /locus_tag="mCG_148051"
FT                   /product="mCG148051"
FT                   /note="gene_id=mCG148051.1 transcript_id=mCT188314.1
FT                   created on 29-NOV-2004"
FT   CDS             complement(join(1311..1336,1501..1602,1945..2055,
FT                   2635..2708,3481..3614,3953..4048))
FT                   /codon_start=1
FT                   /locus_tag="mCG_148051"
FT                   /product="mCG148051"
FT                   /note="gene_id=mCG148051.1 transcript_id=mCT188314.1
FT                   protein_id=mCP109393.1"
FT                   /db_xref="GOA:A2RSZ7"
FT                   /db_xref="InterPro:IPR000566"
FT                   /db_xref="InterPro:IPR002345"
FT                   /db_xref="InterPro:IPR002971"
FT                   /db_xref="InterPro:IPR011038"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR022272"
FT                   /db_xref="MGI:MGI:104974"
FT                   /db_xref="UniProtKB/TrEMBL:A2RSZ7"
FT                   /protein_id="EDL31167.1"
FT                   /translation="MKLLLLLCLELTLVCVHAEEASSERQNFNVEKINGKWFSILLASD
FT                   KREKIEEHGTMRVFVEHIDVLENSLAFKFHTVIDEECTEIYLVADKTEKAGEYSVTYDG
FT                   FNTFTILKTDYDNYIMFHLINKKDEENFQLMELFGREPDLSSDIKEKFAKLCEEHGIVR
FT                   ENIIDLSNANRCLQARE"
FT   assembly_gap    6064..6094
FT                   /estimated_length=31
FT                   /gap_type="unknown"
FT   assembly_gap    12468..12487
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    98590..118640
FT                   /estimated_length=20051
FT                   /gap_type="unknown"
FT   assembly_gap    160426..162106
FT                   /estimated_length=1681
FT                   /gap_type="unknown"
FT   assembly_gap    196403..213239
FT                   /estimated_length=16837
FT                   /gap_type="unknown"
FT   gene            complement(245692..249555)
FT                   /locus_tag="mCG_15829"
FT                   /note="gene_id=mCG15829.2"
FT   mRNA            complement(join(245692..245940,246761..246806,
FT                   246972..247073,247417..247527,248144..248217,
FT                   248985..249118,249309..249555))
FT                   /locus_tag="mCG_15829"
FT                   /product="mCG15829, transcript variant mCT178488"
FT                   /note="gene_id=mCG15829.2 transcript_id=mCT178488.1 created
FT                   on 29-NOV-2004"
FT   mRNA            complement(join(245692..245940,246730..246806,
FT                   246972..247073,247417..247527,248144..248217,
FT                   248985..249118,249309..249555))
FT                   /locus_tag="mCG_15829"
FT                   /product="mCG15829, transcript variant mCT13879"
FT                   /note="gene_id=mCG15829.2 transcript_id=mCT13879.3 created
FT                   on 29-NOV-2004"
FT   mRNA            complement(join(245692..245940,246724..246806,
FT                   246972..247073,247417..247527,248144..248217,
FT                   248985..249118,249309..249555))
FT                   /locus_tag="mCG_15829"
FT                   /product="mCG15829, transcript variant mCT178489"
FT                   /note="gene_id=mCG15829.2 transcript_id=mCT178489.1 created
FT                   on 29-NOV-2004"
FT   mRNA            complement(join(245692..245940,246630..246806,
FT                   246972..247073,247417..247527,248144..248217,
FT                   248985..249118,249309..249555))
FT                   /locus_tag="mCG_15829"
FT                   /product="mCG15829, transcript variant mCT194656"
FT                   /note="gene_id=mCG15829.2 transcript_id=mCT194656.0 created
FT                   on 29-NOV-2004"
FT   CDS             complement(join(246781..246806,246972..247073,
FT                   247417..247527,248144..248217,248985..249118,
FT                   249309..249416))
FT                   /codon_start=1
FT                   /locus_tag="mCG_15829"
FT                   /product="mCG15829, isoform CRA_a"
FT                   /note="gene_id=mCG15829.2 transcript_id=mCT13879.3
FT                   protein_id=mCP2757.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q3KQQ2"
FT                   /db_xref="InterPro:IPR000566"
FT                   /db_xref="InterPro:IPR002345"
FT                   /db_xref="InterPro:IPR002971"
FT                   /db_xref="InterPro:IPR011038"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR022272"
FT                   /db_xref="MGI:MGI:97235"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KQQ2"
FT                   /protein_id="EDL31163.1"
FT                   /translation="MKLLLPLLLLLCLELTLVCIHAEESSSMERNFNVEQISGYWFSIA
FT                   EASDEREKIEEHGSMRAFVENITVLENSLVFKFHLIVNEECTEMTAIGEQTEKAGIYYM
FT                   NYDGFNTFSILKTDYDNYIMIHLINKKDGKTFQLMELYGREPDLSLDIKEKFAKLCEEH
FT                   GIIRENIIDLTNVNRCLEARE"
FT   CDS             complement(join(246781..246806,246972..247073,
FT                   247417..247527,248144..248217,248985..249118,
FT                   249309..249416))
FT                   /codon_start=1
FT                   /locus_tag="mCG_15829"
FT                   /product="mCG15829, isoform CRA_a"
FT                   /note="gene_id=mCG15829.2 transcript_id=mCT178489.1
FT                   protein_id=mCP101410.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q3KQQ2"
FT                   /db_xref="InterPro:IPR000566"
FT                   /db_xref="InterPro:IPR002345"
FT                   /db_xref="InterPro:IPR002971"
FT                   /db_xref="InterPro:IPR011038"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR022272"
FT                   /db_xref="MGI:MGI:97235"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KQQ2"
FT                   /protein_id="EDL31164.1"
FT                   /translation="MKLLLPLLLLLCLELTLVCIHAEESSSMERNFNVEQISGYWFSIA
FT                   EASDEREKIEEHGSMRAFVENITVLENSLVFKFHLIVNEECTEMTAIGEQTEKAGIYYM
FT                   NYDGFNTFSILKTDYDNYIMIHLINKKDGKTFQLMELYGREPDLSLDIKEKFAKLCEEH
FT                   GIIRENIIDLTNVNRCLEARE"
FT   CDS             complement(join(246781..246806,246972..247073,
FT                   247417..247527,248144..248217,248985..249118,
FT                   249309..249416))
FT                   /codon_start=1
FT                   /locus_tag="mCG_15829"
FT                   /product="mCG15829, isoform CRA_a"
FT                   /note="gene_id=mCG15829.2 transcript_id=mCT178488.1
FT                   protein_id=mCP101411.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q3KQQ2"
FT                   /db_xref="InterPro:IPR000566"
FT                   /db_xref="InterPro:IPR002345"
FT                   /db_xref="InterPro:IPR002971"
FT                   /db_xref="InterPro:IPR011038"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR022272"
FT                   /db_xref="MGI:MGI:97235"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KQQ2"
FT                   /protein_id="EDL31165.1"
FT                   /translation="MKLLLPLLLLLCLELTLVCIHAEESSSMERNFNVEQISGYWFSIA
FT                   EASDEREKIEEHGSMRAFVENITVLENSLVFKFHLIVNEECTEMTAIGEQTEKAGIYYM
FT                   NYDGFNTFSILKTDYDNYIMIHLINKKDGKTFQLMELYGREPDLSLDIKEKFAKLCEEH
FT                   GIIRENIIDLTNVNRCLEARE"
FT   CDS             complement(join(246781..246806,246972..247073,
FT                   247417..247527,248144..248217,248985..249118,
FT                   249309..249416))
FT                   /codon_start=1
FT                   /locus_tag="mCG_15829"
FT                   /product="mCG15829, isoform CRA_a"
FT                   /note="gene_id=mCG15829.2 transcript_id=mCT194656.0
FT                   protein_id=mCP115685.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q3KQQ2"
FT                   /db_xref="InterPro:IPR000566"
FT                   /db_xref="InterPro:IPR002345"
FT                   /db_xref="InterPro:IPR002971"
FT                   /db_xref="InterPro:IPR011038"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR022272"
FT                   /db_xref="MGI:MGI:97235"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KQQ2"
FT                   /protein_id="EDL31166.1"
FT                   /translation="MKLLLPLLLLLCLELTLVCIHAEESSSMERNFNVEQISGYWFSIA
FT                   EASDEREKIEEHGSMRAFVENITVLENSLVFKFHLIVNEECTEMTAIGEQTEKAGIYYM
FT                   NYDGFNTFSILKTDYDNYIMIHLINKKDGKTFQLMELYGREPDLSLDIKEKFAKLCEEH
FT                   GIIRENIIDLTNVNRCLEARE"
FT   assembly_gap    265867..265886
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    281587..281914
FT                   /estimated_length=328
FT                   /gap_type="unknown"
FT   gene            complement(307388..310391)
FT                   /locus_tag="mCG_132777"
FT                   /note="gene_id=mCG132777.1"
FT   mRNA            complement(join(307388..307539,307704..307805,
FT                   308146..308256,308939..309012,309780..309913,
FT                   310239..310391))
FT                   /locus_tag="mCG_132777"
FT                   /product="mCG132777"
FT                   /note="gene_id=mCG132777.1 transcript_id=mCT134136.1
FT                   created on 09-JAN-2003"
FT   CDS             complement(join(307514..307539,307704..307805,
FT                   308146..308256,308939..309012,309780..309913,
FT                   310239..310337))
FT                   /codon_start=1
FT                   /locus_tag="mCG_132777"
FT                   /product="mCG132777"
FT                   /note="gene_id=mCG132777.1 transcript_id=mCT134136.1
FT                   protein_id=mCP76067.1"
FT                   /db_xref="GOA:A9R9V7"
FT                   /db_xref="InterPro:IPR000566"
FT                   /db_xref="InterPro:IPR002345"
FT                   /db_xref="InterPro:IPR002971"
FT                   /db_xref="InterPro:IPR011038"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR022272"
FT                   /db_xref="MGI:MGI:3650630"
FT                   /db_xref="UniProtKB/TrEMBL:A9R9V7"
FT                   /protein_id="EDL31162.1"
FT                   /translation="MKLLLLLLCLGLTIVCIQAEEYSSMGRNFNVEQISGYWFSIAEAS
FT                   DEREKIEEHGSMRAFVENITVLENSLVFKFHFIVNEECTEMTLIGEETEKAGIYYLNYD
FT                   GFNTFTILKTDYDNYIMIYLINEKDGETFQLMELYGREPDLSLDIKEKFAKLCEEHGII
FT                   RENIIDLTNVNRCLEARE"
FT   assembly_gap    316288..317508
FT                   /estimated_length=1221
FT                   /gap_type="unknown"
FT   assembly_gap    322027..327554
FT                   /estimated_length=5528
FT                   /gap_type="unknown"
FT   gene            complement(352509..371430)
FT                   /gene="Zfp37"
FT                   /locus_tag="mCG_15828"
FT                   /note="gene_id=mCG15828.1"
FT   mRNA            complement(join(352509..355638,367464..367595,
FT                   367969..368050,371313..371430))
FT                   /gene="Zfp37"
FT                   /locus_tag="mCG_15828"
FT                   /product="zinc finger protein 37, transcript variant
FT                   mCT13881"
FT                   /note="gene_id=mCG15828.1 transcript_id=mCT13881.1 created
FT                   on 10-OCT-2002"
FT   mRNA            complement(join(353946..355638,367464..367595,
FT                   367969..368050,370901..>370917))
FT                   /gene="Zfp37"
FT                   /locus_tag="mCG_15828"
FT                   /product="zinc finger protein 37, transcript variant
FT                   mCT192825"
FT                   /note="gene_id=mCG15828.1 transcript_id=mCT192825.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(<354113..355251,367969..368053,
FT                   371313..371412))
FT                   /gene="Zfp37"
FT                   /locus_tag="mCG_15828"
FT                   /product="zinc finger protein 37, transcript variant
FT                   mCT174248"
FT                   /note="gene_id=mCG15828.1 transcript_id=mCT174248.0 created
FT                   on 10-OCT-2002"
FT   mRNA            complement(join(<354113..355149,367870..368053,
FT                   371313..371409))
FT                   /gene="Zfp37"
FT                   /locus_tag="mCG_15828"
FT                   /product="zinc finger protein 37, transcript variant
FT                   mCT174249"
FT                   /note="gene_id=mCG15828.1 transcript_id=mCT174249.0 created
FT                   on 10-OCT-2002"
FT   CDS             complement(join(354113..355638,367464..367595,
FT                   367969..368050,371313..371345))
FT                   /codon_start=1
FT                   /gene="Zfp37"
FT                   /locus_tag="mCG_15828"
FT                   /product="zinc finger protein 37, isoform CRA_a"
FT                   /note="gene_id=mCG15828.1 transcript_id=mCT13881.1
FT                   protein_id=mCP2755.1 isoform=CRA_a"
FT                   /protein_id="EDL31158.1"
FT                   /translation="MATSEPAESDAEWEQLEPVQRDVYKDTKLENCSNPASMGNQDPKQ
FT                   DIVSVLEEEEPSSGKGKKASPSSLKKIARPKTAGTSAKLQQDDEHREEKQKSQSKLTKE
FT                   VTLRKKSSNSKKSSEYGLLENKSLHSKHTPSEKKLLKSSSRGKNSNQNSDSLKKKPDTA
FT                   NEHRKSLSHSASDVNKDEIPTRKKCDKLPNNKLSDKGDKNQTSKKCEKVCRHSASHTKE
FT                   DKIQTGEKRKSHCRTPSKPEKAPGSGKPYECNHCGKVLSHKQGLLDHQRTHTGEKPYEC
FT                   NECGIAFSQKSHLVVHQRTHTGEKPYECEQCGKAHGHKHALTDHLRIHTGEKPYKCNEC
FT                   GKTFRHSSNLMQHLRSHTGEKPYECKECGKSFRYNSSLTEHVRTHTGEIPYECNECGKA
FT                   FKYGSSLTKHMRIHTGEKPFECNECGKTFSKKSHLVIHQRTHTKEKPYKCDECGKAFGH
FT                   SSSLTYHMRTHTGDCPFECNQCGKAFKQIEGLTQHQRVHTGEKPYECVECGKAFSQKSH
FT                   LIVHQRTHTGEKPFECYECGKAFNAKSQLVIHQRSHTGEKPYECIECGKAFKQNASLTK
FT                   HMKIHSEEQSEEED"
FT   CDS             complement(join(354113..355251,367969..368053,
FT                   371313..371345))
FT                   /codon_start=1
FT                   /gene="Zfp37"
FT                   /locus_tag="mCG_15828"
FT                   /product="zinc finger protein 37, isoform CRA_b"
FT                   /note="gene_id=mCG15828.1 transcript_id=mCT174248.0
FT                   protein_id=mCP97168.0 isoform=CRA_b"
FT                   /protein_id="EDL31159.1"
FT                   /translation="MATSEPAESDAKEWEQLEPVQRDVYKDTKLENCSNPASMVCRHSA
FT                   SHTKEDKIQTGEKRKSHCRTPSKPEKAPGSGKPYECNHCGKVLSHKQGLLDHQRTHTGE
FT                   KPYECNECGIAFSQKSHLVVHQRTHTGEKPYECEQCGKAHGHKHALTDHLRIHTGEKPY
FT                   KCNECGKTFRHSSNLMQHLRSHTGEKPYECKECGKSFRYNSSLTEHVRTHTGEIPYECN
FT                   ECGKAFKYGSSLTKHMRIHTGEKPFECNECGKTFSKKSHLVIHQRTHTKEKPYKCDECG
FT                   KAFGHSSSLTYHMRTHTGDCPFECNQCGKAFKQIEGLTQHQRVHTGEKPYECVECGKAF
FT                   SQKSHLIVHQRTHTGEKPFECYECGKAFNAKSQLVIHQRSHTGEKPYECIECGKAFKQN
FT                   ASLTKHMKIHSEEQSEEED"
FT   CDS             complement(join(354113..355149,367870..368053,
FT                   371313..371345))
FT                   /codon_start=1
FT                   /gene="Zfp37"
FT                   /locus_tag="mCG_15828"
FT                   /product="zinc finger protein 37, isoform CRA_c"
FT                   /note="gene_id=mCG15828.1 transcript_id=mCT174249.0
FT                   protein_id=mCP97167.0 isoform=CRA_c"
FT                   /protein_id="EDL31160.1"
FT                   /translation="MATSEPAESDAKEWEQLEPVQRDVYKDTKLENCSNPASMGKDSSP
FT                   PPRTCSLQSLLSQVLDVFLFCLILFYFGSGKPYECNHCGKVLSHKQGLLDHQRTHTGEK
FT                   PYECNECGIAFSQKSHLVVHQRTHTGEKPYECEQCGKAHGHKHALTDHLRIHTGEKPYK
FT                   CNECGKTFRHSSNLMQHLRSHTGEKPYECKECGKSFRYNSSLTEHVRTHTGEIPYECNE
FT                   CGKAFKYGSSLTKHMRIHTGEKPFECNECGKTFSKKSHLVIHQRTHTKEKPYKCDECGK
FT                   AFGHSSSLTYHMRTHTGDCPFECNQCGKAFKQIEGLTQHQRVHTGEKPYECVECGKAFS
FT                   QKSHLIVHQRTHTGEKPFECYECGKAFNAKSQLVIHQRSHTGEKPYECIECGKAFKQNA
FT                   SLTKHMKIHSEEQSEEED"
FT   CDS             complement(join(354113..355638,367464..367595,
FT                   367969..>368050))
FT                   /codon_start=1
FT                   /gene="Zfp37"
FT                   /locus_tag="mCG_15828"
FT                   /product="zinc finger protein 37, isoform CRA_d"
FT                   /note="gene_id=mCG15828.1 transcript_id=mCT192825.0
FT                   protein_id=mCP113797.0 isoform=CRA_d"
FT                   /protein_id="EDL31161.1"
FT                   /translation="EWEQLEPVQRDVYKDTKLENCSNPASMGNQDPKQDIVSVLEEEEP
FT                   SSGKGKKASPSSLKKIARPKTAGTSAKLQQDDEHREEKQKSQSKLTKEVTLRKKSSNSK
FT                   KSSEYGLLENKSLHSKHTPSEKKLLKSSSRGKNSNQNSDSLKKKPDTANEHRKSLSHSA
FT                   SDVNKDEIPTRKKCDKLPNNKLSDKGDKNQTSKKCEKVCRHSASHTKEDKIQTGEKRKS
FT                   HCRTPSKPEKAPGSGKPYECNHCGKVLSHKQGLLDHQRTHTGEKPYECNECGIAFSQKS
FT                   HLVVHQRTHTGEKPYECEQCGKAHGHKHALTDHLRIHTGEKPYKCNECGKTFRHSSNLM
FT                   QHLRSHTGEKPYECKECGKSFRYNSSLTEHVRTHTGEIPYECNECGKAFKYGSSLTKHM
FT                   RIHTGEKPFECNECGKTFSKKSHLVIHQRTHTKEKPYKCDECGKAFGHSSSLTYHMRTH
FT                   TGDCPFECNQCGKAFKQIEGLTQHQRVHTGEKPYECVECGKAFSQKSHLIVHQRTHTGE
FT                   KPFECYECGKAFNAKSQLVIHQRSHTGEKPYECIECGKAFKQNASLTKHMKIHSEEQSE
FT                   EED"
FT   assembly_gap    369976..369995
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    373607..373626
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    385241..387916
FT                   /estimated_length=2676
FT                   /gap_type="unknown"
FT   assembly_gap    394052..395840
FT                   /estimated_length=1789
FT                   /gap_type="unknown"
FT   assembly_gap    448359..448533
FT                   /estimated_length=175
FT                   /gap_type="unknown"
FT   gene            448544..460510
FT                   /gene="Slc31a2"
FT                   /locus_tag="mCG_15830"
FT                   /note="gene_id=mCG15830.1"
FT   mRNA            join(448544..448673,454731..454797,457986..458175,
FT                   459074..460510)
FT                   /gene="Slc31a2"
FT                   /locus_tag="mCG_15830"
FT                   /product="solute carrier family 31, member 2, transcript
FT                   variant mCT13882"
FT                   /note="gene_id=mCG15830.1 transcript_id=mCT13882.1 created
FT                   on 10-OCT-2002"
FT   mRNA            join(448544..448673,454731..454797,459074..460510)
FT                   /gene="Slc31a2"
FT                   /locus_tag="mCG_15830"
FT                   /product="solute carrier family 31, member 2, transcript
FT                   variant mCT174250"
FT                   /note="gene_id=mCG15830.1 transcript_id=mCT174250.0 created
FT                   on 10-OCT-2002"
FT   CDS             join(448668..448673,454731..454797,457986..458175,
FT                   459074..459242)
FT                   /codon_start=1
FT                   /gene="Slc31a2"
FT                   /locus_tag="mCG_15830"
FT                   /product="solute carrier family 31, member 2, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG15830.1 transcript_id=mCT13882.1
FT                   protein_id=mCP2756.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q4KL43"
FT                   /db_xref="InterPro:IPR007274"
FT                   /db_xref="MGI:MGI:1333844"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KL43"
FT                   /protein_id="EDL31156.1"
FT                   /translation="MPMHFIFSDEAVLLFDFWRVHSPTGMALSVLVVLLLAVLYEGIKV
FT                   GKAKLLHKTLESLPATNSQQFILGPDQDSTGSRSTSDNRTRLRWFLCYFGQSLVHVIQV
FT                   VIGYFVMLAVMSYNTWIFLGVVLGSAVGYYLAYPLLNMT"
FT   CDS             join(448668..448673,454731..454797,459074..459105)
FT                   /codon_start=1
FT                   /gene="Slc31a2"
FT                   /locus_tag="mCG_15830"
FT                   /product="solute carrier family 31, member 2, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG15830.1 transcript_id=mCT174250.0
FT                   protein_id=mCP97169.0 isoform=CRA_b"
FT                   /protein_id="EDL31157.1"
FT                   /translation="MPMHFIFSDEAVLLFDFWRVHSPTGGFCVTLASP"
FT   gene            complement(462442..522645)
FT                   /locus_tag="mCG_15824"
FT                   /note="gene_id=mCG15824.3"
FT   mRNA            complement(join(462442..463089,465260..465356,
FT                   466290..467005,467222..467329,468009..468128,
FT                   468994..469146,470038..470193,474360..474496,
FT                   476356..476527,483061..483163,484285..484379,
FT                   485299..485406,486214..486323,488161..488275,
FT                   489915..490021,491450..491552,494293..494400,
FT                   495785..495842,496223..496362,498503..498649,
FT                   499159..499227,500588..500737,502336..502434,
FT                   502724..502798,507610..507679,508159..508243,
FT                   514535..514647,522472..>522564))
FT                   /locus_tag="mCG_15824"
FT                   /product="mCG15824, transcript variant mCT192884"
FT                   /note="gene_id=mCG15824.3 transcript_id=mCT192884.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(462995..463089,465260..465356,
FT                   466290..467005,467222..467329,468009..468128,
FT                   468994..469146,470038..470193,474360..474496,
FT                   476356..476527,483061..483163,484285..484379,
FT                   485299..485406,486214..486323,488161..488275,
FT                   489915..490021,491450..491552,494293..494400,
FT                   495785..495842,496223..496362,498503..498649,
FT                   500588..500737,502336..502434,502724..502798,
FT                   507610..507679,508159..508243,514535..514647,
FT                   522472..522645))
FT                   /locus_tag="mCG_15824"
FT                   /product="mCG15824, transcript variant mCT13876"
FT                   /note="gene_id=mCG15824.3 transcript_id=mCT13876.2 created
FT                   on 08-JAN-2003"
FT   CDS             complement(join(463006..463089,465260..465356,
FT                   466290..467005,467222..467329,468009..468128,
FT                   468994..469146,470038..470193,474360..474496,
FT                   476356..476527,483061..483163,484285..484379,
FT                   485299..485406,486214..486323,488161..488275,
FT                   489915..490021,491450..491552,494293..494400,
FT                   495785..495842,496223..496362,498503..498649,
FT                   499159..499227,500588..500737,502336..502434,
FT                   502724..502798,507610..507679,508159..508243,
FT                   514535..514647,522472..>522563))
FT                   /codon_start=1
FT                   /locus_tag="mCG_15824"
FT                   /product="mCG15824, isoform CRA_b"
FT                   /note="gene_id=mCG15824.3 transcript_id=mCT192884.0
FT                   protein_id=mCP113837.0 isoform=CRA_b"
FT                   /protein_id="EDL31154.1"
FT                   /translation="QLPPPFSWAKADVMFGAGDEDDTDFLSPSGGAKLASLFGLDQATM
FT                   GHGNEFFQYTAPKQPKKGQGTAAGNQTAPKPAPATTGTSSVLFATAVHAYRYINGQYAK
FT                   QGKFGAAVLGNHTSREYRILLYISQQQPVTVATIHLNFELMVRPNNYSTFYDDQRQNWS
FT                   IMFESEKAAVSFNKQVCVAKCNSISSLDAVLCQDLVAAEGPAVETGDSLEVAYTGWLLQ
FT                   NHVLGQVFDSTANKDKPLRLKLGSGKVVKGLEDGLLGMKKGGKRLIITPSACAAGSEGV
FT                   IGWTQPTDSILVFEVEVRRVKFARDSGSDGHSVSSRDSAAPSPIPASDSLSADPVVTPL
FT                   PLPLKPGEPGLRSKSNSLSEQLTVNSNPDTVKAKLISRMAKMGQPMLPILPPQLDSNDS
FT                   ETEDATVLRGAGQSLVTPSIQPSLQPAHPVLPQMASQAPQPSGSGLQTPSAALMQAVSL
FT                   DSHSAVSGNAQNFQPYAGVQAYAYPQTPSVTSQLQPVRPLYPAPLSQAPHFQGSGDMMS
FT                   FLMTEARQHNTEIRMAVNKVADKMDHLMTKVEELQKHSSGNSMLLPSMSVTMETSMIMS
FT                   NIQRIIQENERLKQELLEKSSRIEEQNDKISDLIERNQRYVEQSNLMMEKRNNSLQTAT
FT                   ENTQARILHAEQEKAKVTEELAAATAQVSHLQLKMTAHQKKETELQLQLTDNLKETDLL
FT                   RGHVTRLQADLSELREASEQTQTKFKSEKQSRRQLELKVTSLEEELTDLRAEKTSLEKN
FT                   LSERKKKSAQERCQAEAEMDEIRKSHQEELDRLRQLLKKARVSTDQAAAEQLTLAQAEL
FT                   QSQWEAKCEQLLASARDEHLQQYREVCAQRDAHQQKLALLQDECLALQAQIAAFTEQKE
FT                   HMQRLEKTKSQAPAGRAAADPSEKVKKIMNQVFQSLRGEFELEESYDGGTILRTIMHTI
FT                   KMVTLQLLNHQEEEEEEEEEEEEEKKPLRPSLEQPGPATPGMPPAPPSGETQEAPEVLP
FT                   EQVVGETTPLPLQALPTPENGAQTRKGEPAEAEVPSEIKDSSLPPQPAGIPAHRVLGPP
FT                   TSIPPKPPGPVTMDSESEEMLAADQRTVQPNGLLGEEHVREVATDGLLQGNSRRLSLTP
FT                   DPEKGEPPALDPESQGGEAQPPECKQAEDVSSSGPRETLLDTELASAAAGTSLRHNQDS
FT                   QHCSLSGDEEDELFKGATLKVPRPTAQPEEEDEDEVSMKGRPPPTPLFGDDDDDDDDDI
FT                   GWLG"
FT   CDS             complement(join(463006..463089,465260..465356,
FT                   466290..467005,467222..467329,468009..468128,
FT                   468994..469146,470038..470193,474360..474496,
FT                   476356..476527,483061..483163,484285..484379,
FT                   485299..485406,486214..486323,488161..488275,
FT                   489915..490021,491450..491552,494293..494400,
FT                   495785..495842,496223..496362,498503..498649,
FT                   500588..500737,502336..502434,502724..502798,
FT                   507610..507679,508159..508243,514535..514647,
FT                   522472..522524))
FT                   /codon_start=1
FT                   /locus_tag="mCG_15824"
FT                   /product="mCG15824, isoform CRA_a"
FT                   /note="gene_id=mCG15824.3 transcript_id=mCT13876.2
FT                   protein_id=mCP2754.2 isoform=CRA_a"
FT                   /protein_id="EDL31153.1"
FT                   /translation="MFGAGDEDDTDFLSPSGGAKLASLFGLDQATMGHGNEFFQYTAPK
FT                   QPKKGQGTAAGNQTAPKPAPATTGTSSVLFATAVHAYRYINGQYAKQGKFGAAVLGNHT
FT                   SREYRILLYISQQQPVTVATIHLNFELMVRPNNYSTFYDDQRQNWSIMFESEKAAVSFN
FT                   KQVCVAKCNSISSLDAVLCQDLVAAEGPAVETGDSLEVAYTGWLLQNHVLGQGLEDGLL
FT                   GMKKGGKRLIITPSACAAGSEGVIGWTQPTDSILVFEVEVRRVKFARDSGSDGHSVSSR
FT                   DSAAPSPIPASDSLSADPVVTPLPLPLKPGEPGLRSKSNSLSEQLTVNSNPDTVKAKLI
FT                   SRMAKMGQPMLPILPPQLDSNDSETEDATVLRGAGQSLVTPSIQPSLQPAHPVLPQMAS
FT                   QAPQPSGSGLQTPSAALMQAVSLDSHSAVSGNAQNFQPYAGVQAYAYPQTPSVTSQLQP
FT                   VRPLYPAPLSQAPHFQGSGDMMSFLMTEARQHNTEIRMAVNKVADKMDHLMTKVEELQK
FT                   HSSGNSMLLPSMSVTMETSMIMSNIQRIIQENERLKQELLEKSSRIEEQNDKISDLIER
FT                   NQRYVEQSNLMMEKRNNSLQTATENTQARILHAEQEKAKVTEELAAATAQVSHLQLKMT
FT                   AHQKKETELQLQLTDNLKETDLLRGHVTRLQADLSELREASEQTQTKFKSEKQSRRQLE
FT                   LKVTSLEEELTDLRAEKTSLEKNLSERKKKSAQERCQAEAEMDEIRKSHQEELDRLRQL
FT                   LKKARVSTDQAAAEQLTLAQAELQSQWEAKCEQLLASARDEHLQQYREVCAQRDAHQQK
FT                   LALLQDECLALQAQIAAFTEQKEHMQRLEKTKSQAPAGRAAADPSEKVKKIMNQVFQSL
FT                   RGEFELEESYDGGTILRTIMHTIKMVTLQLLNHQEEEEEEEEEEEEEKKPLRPSLEQPG
FT                   PATPGMPPAPPSGETQEAPEVLPEQVVGETTPLPLQALPTPENGAQTRKGEPAEAEVPS
FT                   EIKDSSLPPQPAGIPAHRVLGPPTSIPPKPPGPVTMDSESEEMLAADQRTVQPNGLLGE
FT                   EHVREVATDGLLQGNSRRLSLTPDPEKGEPPALDPESQGGEAQPPECKQAEDVSSSGPR
FT                   ETLLDTELASAAAGTSLRHNQDSQHCSLSGDEEDELFKGATLKVPRPTAQPEEEDEDEV
FT                   SMKGRPPPTPLFGDDDDDDDDDIGWLG"
FT   mRNA            complement(join(473303..474496,476356..476527,
FT                   483061..483163,484285..484379,485299..485406,
FT                   486214..486323,488161..488275,489915..490021,
FT                   491450..491552,494293..494400,495785..495842,
FT                   496223..496362,498503..498649,499159..499227,
FT                   500588..500737,502336..502434,502724..502798,
FT                   507610..507679,508159..508243,514535..514647,
FT                   522472..>522595))
FT                   /locus_tag="mCG_15824"
FT                   /product="mCG15824, transcript variant mCT192885"
FT                   /note="gene_id=mCG15824.3 transcript_id=mCT192885.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(474306..474496,476356..476527,
FT                   483061..483163,484285..484379,485299..485406,
FT                   486214..486323,488161..488275,489915..490021,
FT                   491450..491552,494293..494400,495785..495842,
FT                   496223..496362,498503..498649,499159..499227,
FT                   500588..500737,502336..502434,502724..502798,
FT                   507610..507679,508159..508243,514535..514647,
FT                   522472..>522593))
FT                   /codon_start=1
FT                   /locus_tag="mCG_15824"
FT                   /product="mCG15824, isoform CRA_c"
FT                   /note="gene_id=mCG15824.3 transcript_id=mCT192885.0
FT                   protein_id=mCP113838.0 isoform=CRA_c"
FT                   /protein_id="EDL31155.1"
FT                   /translation="LPAVTGPGNIQLPPPFSWAKADVMFGAGDEDDTDFLSPSGGAKLA
FT                   SLFGLDQATMGHGNEFFQYTAPKQPKKGQGTAAGNQTAPKPAPATTGTSSVLFATAVHA
FT                   YRYINGQYAKQGKFGAAVLGNHTSREYRILLYISQQQPVTVATIHLNFELMVRPNNYST
FT                   FYDDQRQNWSIMFESEKAAVSFNKQVCVAKCNSISSLDAVLCQDLVAAEGPAVETGDSL
FT                   EVAYTGWLLQNHVLGQVFDSTANKDKPLRLKLGSGKVVKGLEDGLLGMKKGGKRLIITP
FT                   SACAAGSEGVIGWTQPTDSILVFEVEVRRVKFARDSGSDGHSVSSRDSAAPSPIPASDS
FT                   LSADPVVTPLPLPLKPGEPGLRSKSNSLSEQLTVNSNPDTVKAKLISRMAKMGQPMLPI
FT                   LPPQLDSNDSETEDATVLRGAGQSLVTPSIQPSLQPAHPVLPQMASQAPQPSGSGLQTP
FT                   SAALMQAVSLDSHSAVSGNAQNFQPYAGVQAYAYPQTPSVTSQLQPVRPLYPAPLSQAP
FT                   HFQGSGDMMSFLMTEARQHNTEIRMAVNKVADKMDHLMTKVEELQKHSSGNSMLLPSMS
FT                   VTMETSMIMSNIQRIIQENERLKQELLEKSSRIEEQNDKISDLIERNQRYVEQSNLMME
FT                   KRNNSLQTATENTQARILHAEQEKAKVTEELAAATAQVSHLQLKMTAHQKKETELQLQL
FT                   TDNLKETDLLRGHVTRLQADLSELREASEQTQTKFKSEKQSRRQLELKVTSLEEELTDL
FT                   RAEKTSLEKVNSKANFLLAPSAGVAD"
FT   gene            522832..553867
FT                   /gene="Slc31a1"
FT                   /locus_tag="mCG_15826"
FT                   /note="gene_id=mCG15826.1"
FT   mRNA            join(522832..522945,547594..547780,548193..548265,
FT                   549969..550137,550700..553867)
FT                   /gene="Slc31a1"
FT                   /locus_tag="mCG_15826"
FT                   /product="solute carrier family 31, member 1, transcript
FT                   variant mCT13880"
FT                   /note="gene_id=mCG15826.1 transcript_id=mCT13880.1 created
FT                   on 30-OCT-2002"
FT   mRNA            join(522854..522939,547592..547780,548193..548265,
FT                   549969..550137,550700..550976)
FT                   /gene="Slc31a1"
FT                   /locus_tag="mCG_15826"
FT                   /product="solute carrier family 31, member 1, transcript
FT                   variant mCT175176"
FT                   /note="gene_id=mCG15826.1 transcript_id=mCT175176.0 created
FT                   on 30-OCT-2002"
FT   gene            complement(545756..568540)
FT                   /locus_tag="mCG_15832"
FT                   /note="gene_id=mCG15832.2"
FT   mRNA            complement(join(545756..546640,554063..557124,
FT                   564827..565018,566560..566656,568466..568540))
FT                   /locus_tag="mCG_15832"
FT                   /product="mCG15832, transcript variant mCT13884"
FT                   /note="gene_id=mCG15832.2 transcript_id=mCT13884.2 created
FT                   on 03-MAR-2003"
FT   mRNA            complement(join(545756..546640,554063..557124,
FT                   564827..565018,568466..568526))
FT                   /locus_tag="mCG_15832"
FT                   /product="mCG15832, transcript variant mCT180954"
FT                   /note="gene_id=mCG15832.2 transcript_id=mCT180954.0 created
FT                   on 03-MAR-2003"
FT   CDS             join(547634..547780,548193..548265,549969..550137,
FT                   550700..550901)
FT                   /codon_start=1
FT                   /gene="Slc31a1"
FT                   /locus_tag="mCG_15826"
FT                   /product="solute carrier family 31, member 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG15826.1 transcript_id=mCT13880.1
FT                   protein_id=mCP2751.1 isoform=CRA_a"
FT                   /protein_id="EDL31151.1"
FT                   /translation="MNHMGMNHMEMHHHMGMNHTDDNITMPPHHHPTTSASHSHGGGDS
FT                   MMMMPMTFYFDFKNVNLLFSGLVINTPGEMAGAFVAVFLLAMFYEGLKIAREGLLRKSQ
FT                   VSIRYNSMPVPGPNGTILMETHKTVGQQMLSFPHLLQTVLHIIQVVISYFLMLIFMTYN
FT                   GYLCIAVAAGAGTGYFLFSWKKAVVVDITEHCH"
FT   CDS             join(547634..547780,548193..548265,549969..550137,
FT                   550700..550901)
FT                   /codon_start=1
FT                   /gene="Slc31a1"
FT                   /locus_tag="mCG_15826"
FT                   /product="solute carrier family 31, member 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG15826.1 transcript_id=mCT175176.0
FT                   protein_id=mCP98095.0 isoform=CRA_a"
FT                   /protein_id="EDL31152.1"
FT                   /translation="MNHMGMNHMEMHHHMGMNHTDDNITMPPHHHPTTSASHSHGGGDS
FT                   MMMMPMTFYFDFKNVNLLFSGLVINTPGEMAGAFVAVFLLAMFYEGLKIAREGLLRKSQ
FT                   VSIRYNSMPVPGPNGTILMETHKTVGQQMLSFPHLLQTVLHIIQVVISYFLMLIFMTYN
FT                   GYLCIAVAAGAGTGYFLFSWKKAVVVDITEHCH"
FT   CDS             complement(join(556948..557124,564827..564907))
FT                   /codon_start=1
FT                   /locus_tag="mCG_15832"
FT                   /product="mCG15832, isoform CRA_a"
FT                   /note="gene_id=mCG15832.2 transcript_id=mCT13884.2
FT                   protein_id=mCP2761.2 isoform=CRA_a"
FT                   /protein_id="EDL31149.1"
FT                   /translation="MLRRKPTRLELKLDDIEEFESIRKDLEARKKQKEDVEGVGTSDGE
FT                   GAAGLSSDPKSREQMINDRIGYKPQLKSNNRTSQFGNFEF"
FT   CDS             complement(join(556948..557124,564827..564907))
FT                   /codon_start=1
FT                   /locus_tag="mCG_15832"
FT                   /product="mCG15832, isoform CRA_a"
FT                   /note="gene_id=mCG15832.2 transcript_id=mCT180954.0
FT                   protein_id=mCP103876.0 isoform=CRA_a"
FT                   /protein_id="EDL31150.1"
FT                   /translation="MLRRKPTRLELKLDDIEEFESIRKDLEARKKQKEDVEGVGTSDGE
FT                   GAAGLSSDPKSREQMINDRIGYKPQLKSNNRTSQFGNFEF"
FT   assembly_gap    567164..567183
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            568713..584434
FT                   /gene="Prpf4"
FT                   /locus_tag="mCG_15833"
FT                   /note="gene_id=mCG15833.1"
FT   mRNA            join(568713..568815,569489..569666,571610..571796,
FT                   574457..574544,575089..575168,575316..575409,
FT                   575878..575972,576566..576624,577760..577883,
FT                   579190..579279,582092..582214,582329..582436,
FT                   582517..582635,583132..584434)
FT                   /gene="Prpf4"
FT                   /locus_tag="mCG_15833"
FT                   /product="PRP4 pre-mRNA processing factor 4 homolog
FT                   (yeast)"
FT                   /note="gene_id=mCG15833.1 transcript_id=mCT13885.2 created
FT                   on 30-OCT-2002"
FT   CDS             join(568789..568815,569489..569666,571610..571796,
FT                   574457..574544,575089..575168,575316..575409,
FT                   575878..575972,576566..576624,577760..577883,
FT                   579190..579279,582092..582214,582329..582436,
FT                   582517..582635,583132..583325)
FT                   /codon_start=1
FT                   /gene="Prpf4"
FT                   /locus_tag="mCG_15833"
FT                   /product="PRP4 pre-mRNA processing factor 4 homolog
FT                   (yeast)"
FT                   /note="gene_id=mCG15833.1 transcript_id=mCT13885.2
FT                   protein_id=mCP2752.2"
FT                   /db_xref="GOA:Q059T9"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR003648"
FT                   /db_xref="InterPro:IPR014906"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR027106"
FT                   /db_xref="MGI:MGI:1917302"
FT                   /db_xref="UniProtKB/TrEMBL:Q059T9"
FT                   /protein_id="EDL31148.1"
FT                   /translation="MASSRASSTTTKTKAPDDLVAPVVKKPHIYYGSLEEKERERLAKG
FT                   ESGILGKEGLKAGIEAGNINITSGEVFEIEEHISERQAEVLAEFERRKRARQINVSTDD
FT                   SEVKACLRALGEPITLFGEGPAERRERLRNILSVVGTDALKKTKKDDEKSKKSKEEYQQ
FT                   TWYHEGPNSLKVARLWIANYSLPRAMKRLEEARLHKEIPETTRTSQMQELHKSLRSLNN
FT                   FCSQIGDDRPISYCHFSPNSKMLATACWSGLCKLWSVPDCSLLHTLRGHNTNVGAIVFH
FT                   PKSTVSLDQKDVNLASCAADGSVKLWSLDSDEPVADIEGHTVRVARVMWHPSGRFLGTT
FT                   CYDRSWRLWDLEAQEEILHQEGHSMGVYDIAFHQDGSLAGTGGLDAFGRVWDLRTGRCI
FT                   MFLEGHLKEIYGINFSPNGYHIATGSGDNTCKVWDLRQRRCVYTIPAHQNLVTGVKFEP
FT                   IHGDFLLTGAYDNTAKIWTHPGWSPLKTLAGHEGKVMGLDISSDGQLIATCSYDRTFKL
FT                   WMAE"
FT   gene            complement(587456..595166)
FT                   /gene="Rnf183"
FT                   /locus_tag="mCG_15822"
FT                   /note="gene_id=mCG15822.2"
FT   mRNA            complement(join(587456..588515,590392..590476,
FT                   594379..594548,595052..595166))
FT                   /gene="Rnf183"
FT                   /locus_tag="mCG_15822"
FT                   /product="ring finger protein 183, transcript variant
FT                   mCT13874"
FT                   /note="gene_id=mCG15822.2 transcript_id=mCT13874.2 created
FT                   on 24-FEB-2003"
FT   mRNA            complement(join(587456..588515,590392..590473,
FT                   594379..594642))
FT                   /gene="Rnf183"
FT                   /locus_tag="mCG_15822"
FT                   /product="ring finger protein 183, transcript variant
FT                   mCT180732"
FT                   /note="gene_id=mCG15822.2 transcript_id=mCT180732.0 created
FT                   on 24-FEB-2003"
FT   CDS             complement(587901..588473)
FT                   /codon_start=1
FT                   /gene="Rnf183"
FT                   /locus_tag="mCG_15822"
FT                   /product="ring finger protein 183, isoform CRA_a"
FT                   /note="gene_id=mCG15822.2 transcript_id=mCT13874.2
FT                   protein_id=mCP2758.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q8QZS5"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="MGI:MGI:1923322"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8QZS5"
FT                   /protein_id="EDL31146.1"
FT                   /translation="MSEPQGQELRAECPVCWNPFNNTFHTPKVLDCCHSFCVECLAHLS
FT                   LVTPARRRLLCPLCRQPTVLASGQPVTDLPTDTAMLTLLRLEPHHVILEGHQLCLKDQP
FT                   KSRYFLRQPRVYTLDLGAEPGSQTGLPQDTAPDTRPVPIPSHYSLRECVRNPHFRIFAY
FT                   LMAVILSVTLLLIFSIFWTKQFFWGMG"
FT   CDS             complement(587901..588473)
FT                   /codon_start=1
FT                   /gene="Rnf183"
FT                   /locus_tag="mCG_15822"
FT                   /product="ring finger protein 183, isoform CRA_a"
FT                   /note="gene_id=mCG15822.2 transcript_id=mCT180732.0
FT                   protein_id=mCP103654.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q8QZS5"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="MGI:MGI:1923322"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8QZS5"
FT                   /protein_id="EDL31147.1"
FT                   /translation="MSEPQGQELRAECPVCWNPFNNTFHTPKVLDCCHSFCVECLAHLS
FT                   LVTPARRRLLCPLCRQPTVLASGQPVTDLPTDTAMLTLLRLEPHHVILEGHQLCLKDQP
FT                   KSRYFLRQPRVYTLDLGAEPGSQTGLPQDTAPDTRPVPIPSHYSLRECVRNPHFRIFAY
FT                   LMAVILSVTLLLIFSIFWTKQFFWGMG"
FT   assembly_gap    604861..605243
FT                   /estimated_length=383
FT                   /gap_type="unknown"
FT   gene            complement(613845..630939)
FT                   /gene="Wdr31"
FT                   /locus_tag="mCG_15831"
FT                   /note="gene_id=mCG15831.2"
FT   mRNA            complement(join(613845..614048,615922..616084,
FT                   617551..617692,618927..618994,620433..620533,
FT                   620631..620775,622252..622326,623455..623584,
FT                   624038..624180,628887..628983,630869..630939))
FT                   /gene="Wdr31"
FT                   /locus_tag="mCG_15831"
FT                   /product="WD repeat domain 31, transcript variant
FT                   mCT180733"
FT                   /note="gene_id=mCG15831.2 transcript_id=mCT180733.0 created
FT                   on 24-FEB-2003"
FT   mRNA            complement(join(613845..614048,615922..616084,
FT                   617551..617692,618927..618994,620631..620775,
FT                   622252..622326,623455..623587,624038..624180,
FT                   628887..628983,630869..630922))
FT                   /gene="Wdr31"
FT                   /locus_tag="mCG_15831"
FT                   /product="WD repeat domain 31, transcript variant
FT                   mCT174251"
FT                   /note="gene_id=mCG15831.2 transcript_id=mCT174251.0 created
FT                   on 24-FEB-2003"
FT   mRNA            complement(join(613845..614048,617551..617692,
FT                   618927..618994,620433..620533,620631..620775,
FT                   622252..622326,623455..623587,624038..624180,
FT                   628887..628983,630869..630922))
FT                   /gene="Wdr31"
FT                   /locus_tag="mCG_15831"
FT                   /product="WD repeat domain 31, transcript variant
FT                   mCT174252"
FT                   /note="gene_id=mCG15831.2 transcript_id=mCT174252.0 created
FT                   on 24-FEB-2003"
FT   mRNA            complement(join(613845..614048,615922..616084,
FT                   617551..617692,618927..618994,620433..620533,
FT                   620631..620775,622252..622326,623455..623587,
FT                   624038..624180,628887..628983,630869..630922))
FT                   /gene="Wdr31"
FT                   /locus_tag="mCG_15831"
FT                   /product="WD repeat domain 31, transcript variant mCT13883"
FT                   /note="gene_id=mCG15831.2 transcript_id=mCT13883.1 created
FT                   on 24-FEB-2003"
FT   CDS             complement(join(613888..614048,615922..616084,
FT                   617551..617692,618927..618994,620433..620533,
FT                   620631..620775,622252..622326,623455..623584,
FT                   624038..624153))
FT                   /codon_start=1
FT                   /gene="Wdr31"
FT                   /locus_tag="mCG_15831"
FT                   /product="WD repeat domain 31, isoform CRA_c"
FT                   /note="gene_id=mCG15831.2 transcript_id=mCT180733.0
FT                   protein_id=mCP103655.0 isoform=CRA_c"
FT                   /protein_id="EDL31144.1"
FT                   /translation="MLLLDGQLKPALPQKVFCRLWAVMGKLQSKLRHSTYLYRPDGIIE
FT                   ERVQTKAPQEYIPVHVDTVSVIATLNSDLCISGGKDKTAVAYNWKTGRMVKRFTGHERE
FT                   ITKIACIPKANQFFSASRDKTVLMWDLQGSSHPRQQLSGHAMVVTGLAVSPDSSQLCTG
FT                   SRDNSLLLWDVGTGQCVERASVSRNLVTHLCWVPSEPYIVQTSEDKTIRLWDSRGLQMA
FT                   HMFPTKQHIQTHCEVSVDGHTCISCSSGFGGEGCEATLWDLRQTRDRMCEYKGHFQTVA
FT                   SCVFLPKSTALMPMIATSAHDSKVKIWNQDTGACLSTLSLDGSGPLTSLAVGDISSLLC
FT                   ASFYRGVHLLRVDHSQGLELQEVAAF"
FT   CDS             complement(join(613888..614048,615922..616084,
FT                   617551..617692,618927..618994,620433..620533,
FT                   620631..620775,622252..622326,623455..623587,
FT                   624038..624153))
FT                   /codon_start=1
FT                   /gene="Wdr31"
FT                   /locus_tag="mCG_15831"
FT                   /product="WD repeat domain 31, isoform CRA_d"
FT                   /note="gene_id=mCG15831.2 transcript_id=mCT13883.1
FT                   protein_id=mCP2759.1 isoform=CRA_d"
FT                   /protein_id="EDL31145.1"
FT                   /translation="MLLLDGQLKPALPQKVFCRLWAVMGKLQSKLRHSTYLYSRPDGII
FT                   EERVQTKAPQEYIPVHVDTVSVIATLNSDLCISGGKDKTAVAYNWKTGRMVKRFTGHER
FT                   EITKIACIPKANQFFSASRDKTVLMWDLQGSSHPRQQLSGHAMVVTGLAVSPDSSQLCT
FT                   GSRDNSLLLWDVGTGQCVERASVSRNLVTHLCWVPSEPYIVQTSEDKTIRLWDSRGLQM
FT                   AHMFPTKQHIQTHCEVSVDGHTCISCSSGFGGEGCEATLWDLRQTRDRMCEYKGHFQTV
FT                   ASCVFLPKSTALMPMIATSAHDSKVKIWNQDTGACLSTLSLDGSGPLTSLAVGDISSLL
FT                   CASFYRGVHLLRVDHSQGLELQEVAAF"
FT   CDS             complement(join(614007..614048,617551..617692,
FT                   618927..618994,620433..620533,620631..620775,
FT                   622252..622326,623455..623587,624038..624153))
FT                   /codon_start=1
FT                   /gene="Wdr31"
FT                   /locus_tag="mCG_15831"
FT                   /product="WD repeat domain 31, isoform CRA_b"
FT                   /note="gene_id=mCG15831.2 transcript_id=mCT174252.0
FT                   protein_id=mCP97171.0 isoform=CRA_b"
FT                   /protein_id="EDL31143.1"
FT                   /translation="MLLLDGQLKPALPQKVFCRLWAVMGKLQSKLRHSTYLYSRPDGII
FT                   EERVQTKAPQEYIPVHVDTVSVIATLNSDLCISGGKDKTAVAYNWKTGRMVKRFTGHER
FT                   EITKIACIPKANQFFSASRDKTVLMWDLQGSSHPRQQLSGHAMVVTGLAVSPDSSQLCT
FT                   GSRDNSLLLWDVGTGQCVERASVSRNLVTHLCWVPSEPYIVQTSEDKTIRLWDSRGLQM
FT                   AHMFPTKQHIQTHCEVSVDGHTCISCSSGFGGEGCEATLASPPCLWMDQDP"
FT   CDS             complement(join(618966..618994,620631..620775,
FT                   622252..622326,623455..623587,624038..624153))
FT                   /codon_start=1
FT                   /gene="Wdr31"
FT                   /locus_tag="mCG_15831"
FT                   /product="WD repeat domain 31, isoform CRA_a"
FT                   /note="gene_id=mCG15831.2 transcript_id=mCT174251.0
FT                   protein_id=mCP97170.0 isoform=CRA_a"
FT                   /protein_id="EDL31142.1"
FT                   /translation="MLLLDGQLKPALPQKVFCRLWAVMGKLQSKLRHSTYLYSRPDGII
FT                   EERVQTKAPQEYIPVHVDTVSVIATLNSDLCISGGKDKTAVAYNWKTGRMVKRFTGHER
FT                   EITKIACIPKANQFFSASRDKTVLMWDLQGSSHPRQQLSGHAMVVTGLAVSPGHTPVLG
FT                   PE"
FT   assembly_gap    625011..625199
FT                   /estimated_length=189
FT                   /gap_type="unknown"
FT   gene            <640115..657348
FT                   /gene="Bspry"
FT                   /locus_tag="mCG_15827"
FT                   /note="gene_id=mCG15827.2"
FT   mRNA            join(640115..640491,642672..642770,646469..646699,
FT                   648240..648265,654780..654904,657029..657346)
FT                   /gene="Bspry"
FT                   /locus_tag="mCG_15827"
FT                   /product="B-box and SPRY domain containing, transcript
FT                   variant mCT174247"
FT                   /note="gene_id=mCG15827.2 transcript_id=mCT174247.0 created
FT                   on 09-OCT-2002"
FT   mRNA            join(<640115..640491,642672..642770,646469..646699,
FT                   648240..648265,654780..654904,656045..657345)
FT                   /gene="Bspry"
FT                   /locus_tag="mCG_15827"
FT                   /product="B-box and SPRY domain containing, transcript
FT                   variant mCT192824"
FT                   /note="gene_id=mCG15827.2 transcript_id=mCT192824.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(640115..640491,642672..642770,646469..646699,
FT                   654778..654913)
FT                   /gene="Bspry"
FT                   /locus_tag="mCG_15827"
FT                   /product="B-box and SPRY domain containing, transcript
FT                   variant mCT174246"
FT                   /note="gene_id=mCG15827.2 transcript_id=mCT174246.0 created
FT                   on 09-OCT-2002"
FT   mRNA            join(640116..640491,642672..642770,646469..646699,
FT                   648240..648265,654780..654904,656045..656618,
FT                   657029..657348)
FT                   /gene="Bspry"
FT                   /locus_tag="mCG_15827"
FT                   /product="B-box and SPRY domain containing, transcript
FT                   variant mCT13878"
FT                   /note="gene_id=mCG15827.2 transcript_id=mCT13878.1 created
FT                   on 09-OCT-2002"
FT   CDS             join(<640117..640491,642672..642770,646469..646699,
FT                   648240..648265,654780..654904,656045..656640)
FT                   /codon_start=1
FT                   /gene="Bspry"
FT                   /locus_tag="mCG_15827"
FT                   /product="B-box and SPRY domain containing, isoform CRA_d"
FT                   /note="gene_id=mCG15827.2 transcript_id=mCT192824.0
FT                   protein_id=mCP113796.0 isoform=CRA_d"
FT                   /protein_id="EDL31141.1"
FT                   /translation="GGARGLRLSAMSADVSGTESGSESGPEPEPGPEPGPESRPESRPK
FT                   PGPGPEPRPESGPEPGPRSGLRRGPKQGSERSQLCPEHFEPLSWFCLSERRPVCATCAG
FT                   FGGRCHRHRIRRAEEHAEELRNKIVDQCERLQLQSAGISKYMAEVLQGKNQKAVVMASA
FT                   ARDLIIQRLSLVRSLCESEEQRLLEQVHGEEERAHQSILTQRAHWVDAVQKLDTLRTNM
FT                   VDMITHLDDLQLIQREQEIFERAEEAEGILDPQDSEKLSFNEKCAWSPLLTQLWAASVL
FT                   GSLSGVEEVLIDERTVSPLLHLSEDRRTLTFIAKKSKVCSDEPERFDHWPNALAATAFQ
FT                   TGLHAWIVNVKHSCAYKVGVASDQLPRKGSGNDCRLGHNAFSWVFSRYDQEFCFSHNGY
FT                   HEPLPLLRCPAQLGMLLDLQAGELVFYEPASGTVLHIHRASFPQVLFPVFAVADQLISI
FT                   VRGPLATVRLDSPPHHPCRSGHASR"
FT   CDS             join(640147..640491,642672..642770,646469..646699,
FT                   648240..648265,654780..654904,657029..657174)
FT                   /codon_start=1
FT                   /gene="Bspry"
FT                   /locus_tag="mCG_15827"
FT                   /product="B-box and SPRY domain containing, isoform CRA_c"
FT                   /note="gene_id=mCG15827.2 transcript_id=mCT174247.0
FT                   protein_id=mCP97165.0 isoform=CRA_c"
FT                   /protein_id="EDL31140.1"
FT                   /translation="MSADVSGTESGSESGPEPEPGPEPGPESRPESRPKPGPGPEPRPE
FT                   SGPEPGPRSGLRRGPKQGSERSQLCPEHFEPLSWFCLSERRPVCATCAGFGGRCHRHRI
FT                   RRAEEHAEELRNKIVDQCERLQLQSAGISKYMAEVLQGKNQKAVVMASAARDLIIQRLS
FT                   LVRSLCESEEQRLLEQVHGEEERAHQSILTQRAHWVDAVQKLDTLRTNMVDMITHLDDL
FT                   QLIQREQEIFERAEEAEGILDPQDSEKLSFNEKCAWSPLLTQLWAASVLGSLSAYEGQP
FT                   ARILLARTSSWECGSLLPPPLSPGNLLAAHLLASVPGPEAEL"
FT   CDS             join(640147..640491,642672..642770,646469..646699,
FT                   648240..648265,654780..654904,656045..656618,
FT                   657029..657089)
FT                   /codon_start=1
FT                   /gene="Bspry"
FT                   /locus_tag="mCG_15827"
FT                   /product="B-box and SPRY domain containing, isoform CRA_a"
FT                   /note="gene_id=mCG15827.2 transcript_id=mCT13878.1
FT                   protein_id=mCP2753.2 isoform=CRA_a"
FT                   /db_xref="GOA:B2RT02"
FT                   /db_xref="InterPro:IPR000315"
FT                   /db_xref="InterPro:IPR001870"
FT                   /db_xref="InterPro:IPR003877"
FT                   /db_xref="InterPro:IPR003879"
FT                   /db_xref="InterPro:IPR006574"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="MGI:MGI:2177191"
FT                   /db_xref="UniProtKB/TrEMBL:B2RT02"
FT                   /protein_id="EDL31138.1"
FT                   /translation="MSADVSGTESGSESGPEPEPGPEPGPESRPESRPKPGPGPEPRPE
FT                   SGPEPGPRSGLRRGPKQGSERSQLCPEHFEPLSWFCLSERRPVCATCAGFGGRCHRHRI
FT                   RRAEEHAEELRNKIVDQCERLQLQSAGISKYMAEVLQGKNQKAVVMASAARDLIIQRLS
FT                   LVRSLCESEEQRLLEQVHGEEERAHQSILTQRAHWVDAVQKLDTLRTNMVDMITHLDDL
FT                   QLIQREQEIFERAEEAEGILDPQDSEKLSFNEKCAWSPLLTQLWAASVLGSLSGVEEVL
FT                   IDERTVSPLLHLSEDRRTLTFIAKKSKVCSDEPERFDHWPNALAATAFQTGLHAWIVNV
FT                   KHSCAYKVGVASDQLPRKGSGNDCRLGHNAFSWVFSRYDQEFCFSHNGYHEPLPLLRCP
FT                   AQLGMLLDLQAGELVFYEPASGTVLHIHRASFPQVLFPVFAVADQLISIVRGPLATVRL
FT                   DSPPHHPCSIRRTTCQDTVGQNVVVGVW"
FT   CDS             join(640147..640491,642672..642770,646469..646699,
FT                   654778..654909)
FT                   /codon_start=1
FT                   /gene="Bspry"
FT                   /locus_tag="mCG_15827"
FT                   /product="B-box and SPRY domain containing, isoform CRA_b"
FT                   /note="gene_id=mCG15827.2 transcript_id=mCT174246.0
FT                   protein_id=mCP97166.0 isoform=CRA_b"
FT                   /protein_id="EDL31139.1"
FT                   /translation="MSADVSGTESGSESGPEPEPGPEPGPESRPESRPKPGPGPEPRPE
FT                   SGPEPGPRSGLRRGPKQGSERSQLCPEHFEPLSWFCLSERRPVCATCAGFGGRCHRHRI
FT                   RRAEEHAEELRNKIVDQCERLQLQSAGISKYMAEVLQGKNQKAVVMASAARDLIIQRLS
FT                   LVRSLCESEEQRLLEQVHGEEERAHQSILTQRAHWVDAVQKLDTLRTNMVDMITHLDDL
FT                   QLIRAEEAEGILDPQDSEKLSFNEKCAWSPLLTQLWAASVLGSLSG"
FT   gene            complement(659056..662312)
FT                   /gene="Hdhd3"
FT                   /locus_tag="mCG_132783"
FT                   /note="gene_id=mCG132783.0"
FT   mRNA            complement(join(659056..660140,662205..662312))
FT                   /gene="Hdhd3"
FT                   /locus_tag="mCG_132783"
FT                   /product="haloacid dehalogenase-like hydrolase domain
FT                   containing 3"
FT                   /note="gene_id=mCG132783.0 transcript_id=mCT134142.0
FT                   created on 30-OCT-2002"
FT   CDS             complement(659229..659984)
FT                   /codon_start=1
FT                   /gene="Hdhd3"
FT                   /locus_tag="mCG_132783"
FT                   /product="haloacid dehalogenase-like hydrolase domain
FT                   containing 3"
FT                   /note="gene_id=mCG132783.0 transcript_id=mCT134142.0
FT                   protein_id=mCP76298.1"
FT                   /protein_id="EDL31137.1"
FT                   /translation="MAHRLQMRLLTWDVKDTLIKLRRPVGEEYASKARAHGVVVEDITV
FT                   EQAFRQAYRAQSHNFPNYGLSRGLTSRQWWKDVVLHTFRLAGVPDAQAMTPVADQLYED
FT                   FSSPFTWQVLEGAEMTLKGCRKRGLKLAVVSNFDRRLEDILTGLGLREHFDFVLTSEAV
FT                   GCPKPDPRIFREALQRACVEPAVAAHVGDSYLCDYQGSQAVGMHSFLVAGSEPLDSAVR
FT                   DSVPKEHILPSLSHLLPALDLLEASSPMS"
FT   gene            complement(669215..>671619)
FT                   /gene="Alad"
FT                   /locus_tag="mCG_132771"
FT                   /note="gene_id=mCG132771.0"
FT   mRNA            complement(join(669215..669357,670152..670281,
FT                   670562..670648,670741..670828,670915..670970,
FT                   671573..>671619))
FT                   /gene="Alad"
FT                   /locus_tag="mCG_132771"
FT                   /product="aminolevulinate, delta-, dehydratase"
FT                   /note="gene_id=mCG132771.0 transcript_id=mCT134130.0
FT                   created on 09-OCT-2002"
FT   CDS             complement(join(669296..669357,670152..670281,
FT                   670562..670648,670741..670828,670915..670970,
FT                   671573..>671617))
FT                   /codon_start=1
FT                   /gene="Alad"
FT                   /locus_tag="mCG_132771"
FT                   /product="aminolevulinate, delta-, dehydratase"
FT                   /note="gene_id=mCG132771.0 transcript_id=mCT134130.0
FT                   protein_id=mCP76431.0"
FT                   /protein_id="EDL31136.1"
FT                   /translation="EAIKAALLKHGLGNRVSVMSYSAKFASCFYGPFRDAAQSSPAFGD
FT                   RRCYQLPPGARGLALRAVARDIQEGADMLMVKPGLPYLDMVREVKDKHPELPLAVYQVS
FT                   GEFAMLWHGAQAGAFDLRTAVLETMTAFRRAGADIIITYFAPQLLKWLKEE"
FT   assembly_gap    671620..673578
FT                   /estimated_length=1959
FT                   /gap_type="unknown"
FT   gene            complement(680567..682189)
FT                   /gene="Pole3"
FT                   /locus_tag="mCG_7136"
FT                   /note="gene_id=mCG7136.3"
FT   mRNA            complement(join(680567..681230,681438..681556,
FT                   681870..681955,682051..682134))
FT                   /gene="Pole3"
FT                   /locus_tag="mCG_7136"
FT                   /product="polymerase (DNA directed), epsilon 3 (p17
FT                   subunit), transcript variant mCT6036"
FT                   /note="gene_id=mCG7136.3 transcript_id=mCT6036.2 created on
FT                   24-FEB-2003"
FT   mRNA            complement(join(<681064..681230,681438..681556,
FT                   681730..681955,682051..682189))
FT                   /gene="Pole3"
FT                   /locus_tag="mCG_7136"
FT                   /product="polymerase (DNA directed), epsilon 3 (p17
FT                   subunit), transcript variant mCT180765"
FT                   /note="gene_id=mCG7136.3 transcript_id=mCT180765.0 created
FT                   on 24-FEB-2003"
FT   CDS             complement(join(681064..681230,681438..681556,
FT                   681870..681955,682051..682116))
FT                   /codon_start=1
FT                   /gene="Pole3"
FT                   /locus_tag="mCG_7136"
FT                   /product="polymerase (DNA directed), epsilon 3 (p17
FT                   subunit), isoform CRA_b"
FT                   /note="gene_id=mCG7136.3 transcript_id=mCT6036.2
FT                   protein_id=mCP20156.2 isoform=CRA_b"
FT                   /protein_id="EDL31135.1"
FT                   /translation="MAERPEDLNLPNAVITRIIKEALPDGVNISKEARSAISRAASVFV
FT                   LYATSCANNFAMKGKRKTLNASDVLSAMEEMEFQRFITPLKEALEAYRREQKGKKEASE
FT                   QKKKDKDKKDSEEQDKSREEEEEDEERLDEDDQNEEEEIDN"
FT   CDS             complement(join(681064..681230,681438..681540))
FT                   /codon_start=1
FT                   /gene="Pole3"
FT                   /locus_tag="mCG_7136"
FT                   /product="polymerase (DNA directed), epsilon 3 (p17
FT                   subunit), isoform CRA_a"
FT                   /note="gene_id=mCG7136.3 transcript_id=mCT180765.0
FT                   protein_id=mCP103687.0 isoform=CRA_a"
FT                   /protein_id="EDL31134.1"
FT                   /translation="MKGKRKTLNASDVLSAMEEMEFQRFITPLKEALEAYRREQKGKKE
FT                   ASEQKKKDKDKKDSEEQDKSREEEEEDEERLDEDDQNEEEEIDN"
FT   gene            682488..>704884
FT                   /gene="4933430I17Rik"
FT                   /locus_tag="mCG_1043750"
FT                   /note="gene_id=mCG1043750.1"
FT   mRNA            join(682488..682516,682902..682998,689343..689495,
FT                   689607..689751,693602..693659,695954..696054,
FT                   697547..697610,698931..699094,699764..699911,
FT                   700256..700343,700583..700629,700825..700867,
FT                   703142..703263,704387..704450,704655..>704884)
FT                   /gene="4933430I17Rik"
FT                   /locus_tag="mCG_1043750"
FT                   /product="RIKEN cDNA 4933430I17"
FT                   /note="gene_id=mCG1043750.1 transcript_id=mCT161454.1
FT                   created on 29-JAN-2003"
FT   CDS             join(682938..682998,689343..689495,689607..689751,
FT                   693602..693659,695954..696054,697547..697610,
FT                   698931..699094,699764..699911,700256..700343,
FT                   700583..700629,700825..700867,703142..703263,
FT                   704387..704450,704655..704884)
FT                   /codon_start=1
FT                   /gene="4933430I17Rik"
FT                   /locus_tag="mCG_1043750"
FT                   /product="RIKEN cDNA 4933430I17"
FT                   /note="gene_id=mCG1043750.1 transcript_id=mCT161454.1
FT                   protein_id=mCP76522.1"
FT                   /db_xref="GOA:Q8BHW4"
FT                   /db_xref="InterPro:IPR029134"
FT                   /db_xref="MGI:MGI:3045314"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BHW4"
FT                   /protein_id="EDL31133.1"
FT                   /translation="MRLRSSIWSGSVLKAQESFDSMNVADESQWDEAVCTLSGCQHPQC
FT                   WASLRRIERGHPRILDPSPKSPRETEDKLPTLTIVNITDTCLWTQKRVAQQQPSEFTFP
FT                   KDRPSLSKPASKRQSRSPKALRDKDVTSRSPRPLKLSVLNLNEAKLPLSENVSNMVVTW
FT                   VPEETEKDVSPVQKTDVSSWPGKKRRKKLRKKSKPSLYYPGRQYSRSPAAIVPPPSPEH
FT                   HLEQLSPEAIPLWAQVGMLPQDLLEECILAHEKSIIGPEVKIELSKMRKSLPLERRRPE
FT                   SAISSKMYLTIQRLTLQRPSLRYPARLRKLCPNLKQGEGLAGHGSSDSLMQQGKAKTFP
FT                   PKQEPKKKAKRNVKGQYGEETTSGHFFHDSVGLRISGQEDQQTPWEEEDIEKTSAETHV
FT                   SLEEVYEFDKYYTEYYATPESAVLYETVYQNLDDDEETMVGIKASSKDRNLKNLSAMMD
FT                   GIGWNPELKLLRILQATEEEDEEGHNSRAQSKTSLEA"
FT   assembly_gap    696233..696252
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    710374..710913
FT                   /estimated_length=540
FT                   /gap_type="unknown"
FT   gene            717662..812736
FT                   /locus_tag="mCG_7138"
FT                   /note="gene_id=mCG7138.1"
FT   mRNA            join(717662..717697,724326..724501,734305..734430,
FT                   755308..755358,757875..757933,758894..758988,
FT                   759997..760065,767703..767763,768848..768938,
FT                   769449..769504,776625..776706,777885..777990,
FT                   778530..778881,779273..779312,783905..784101,
FT                   787227..787310,793620..793731,799587..799630,
FT                   805620..805742,810005..812736)
FT                   /locus_tag="mCG_7138"
FT                   /product="mCG7138"
FT                   /note="gene_id=mCG7138.1 transcript_id=mCT6037.1 created on
FT                   09-OCT-2002"
FT   assembly_gap    731984..732005
FT                   /estimated_length=22
FT                   /gap_type="unknown"
FT   CDS             join(734328..734430,755308..755358,757875..757933,
FT                   758894..758988,759997..760065,767703..767763,
FT                   768848..768938,769449..769504,776625..776706,
FT                   777885..777990,778530..778881,779273..779312,
FT                   783905..784101,787227..787310,793620..793731,
FT                   799587..799630,805620..805742,810005..810112)
FT                   /codon_start=1
FT                   /locus_tag="mCG_7138"
FT                   /product="mCG7138"
FT                   /note="gene_id=mCG7138.1 transcript_id=mCT6037.1
FT                   protein_id=mCP20158.1"
FT                   /db_xref="GOA:Z4YJQ4"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="MGI:MGI:1354734"
FT                   /db_xref="UniProtKB/TrEMBL:Z4YJQ4"
FT                   /protein_id="EDL31132.1"
FT                   /translation="MERPHQDASLSKKDACTQTYPPRRRIRHAQVQDAGQLKLSIDAQD
FT                   RVLLLHIIEGKGLMSREPGICDPYVKVSLIPEDSQLPCQTTQIIPDCRDPAFHEHFFFP
FT                   VPEEGDQKRLLVTVWNRASETRQHTLIGCMSFGVRSLLTPDKEISGWYYLLGEDLGRTK
FT                   HLKVARRRLQPLRDMLLRMPGEGDPENGEKLQITIRRGKDGFGFTICCDSPVRVQAVDS
FT                   GGPAERAGLQQLDTVLQLNERPVEHWKCVELAHEIRSCPSEIILLVWRVVPQIKPGPDG
FT                   GVLRRASCKSTHDLLSPPNKREKNCTHGAPVRPEQRHSCHLVCDSSDGLLLGGWERYTE
FT                   VGKRSGQHTLPALSRTTTPTDPNYIILAPLNPGSQLLRPVYQEDTIPEEPGTTTKGKSY
FT                   TGLGKKSRLMKTVQTMKGHSNYQDCSALRPHIPHSSYGTYVTLAPKVLVFPVFVQPLDL
FT                   CNPARTLLLSEELLLYEGRNKTSQVTLFAYSDLLLFTKEEEPGRCDVLRNPLYLQSVKL
FT                   QEGSSEDLKFCVLYLAEKAECLFTLEAHSQEQKKRVCWCLSENIAKQQQLAAPPTERKK
FT                   LHPYGSLQQEMGPVTSISATQDRSFTSSGQTLIG"
FT   assembly_gap    749927..750043
FT                   /estimated_length=117
FT                   /gap_type="unknown"
FT   assembly_gap    769749..770378
FT                   /estimated_length=630
FT                   /gap_type="unknown"
FT   assembly_gap    789291..789393
FT                   /estimated_length=103
FT                   /gap_type="unknown"
FT   assembly_gap    826906..826925
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <826926..855964
FT                   /locus_tag="mCG_145490"
FT                   /note="gene_id=mCG145490.0"
FT   mRNA            join(<826926..827105,842276..843403,850211..850272,
FT                   852946..853047,853302..853363,853982..854148,
FT                   855009..855964)
FT                   /locus_tag="mCG_145490"
FT                   /product="mCG145490"
FT                   /note="gene_id=mCG145490.0 transcript_id=mCT184914.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<826986..827105,842276..843403,850211..850272,
FT                   852946..853047,853302..853363,853982..854148,
FT                   855009..855194)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145490"
FT                   /product="mCG145490"
FT                   /note="gene_id=mCG145490.0 transcript_id=mCT184914.0
FT                   protein_id=mCP105843.0"
FT                   /protein_id="EDL31131.1"
FT                   /translation="KKKKKKKKKKKKKTLPPCGRWNLVIWFCFSQQVPLLWGTWMFETE
FT                   ADEKEMPLVEGKGPGAEEPAPSKNPSPGQELPPGQDLPPSKDPSPSQELPAGQDLPPSK
FT                   DPSPSQELPAGQDLPPSKDPSPSQELPVGQDLPPRKDSSGQEAAPGPESPSSEDIATCP
FT                   KPPQSPETSTSKDSPPGQGSSPTTELPSCQGLPAGQESTSQDPLLSQEPPVIPESSASV
FT                   QKRLPSQESPSSLGSLPEKDLAEQTISSGEPPVATGAVLPASRPNFVIPEVRLDNAYSQ
FT                   LDGAHGGSSGEDEDAEEGEEGGEGEEDEEDDTSDDNYGDRSEAKRSSLIETGQGAEGGF
FT                   SLRVQNSLRRRTHSEGSLLQESRGPCFASDTTLHCSDGEGATSTWAIPSPRTLKKELGR
FT                   NGGSMHHLSLFFTGHRKMSGTDLTECDEASRKRKSKNIAKDMKNKLAIFRRRNESPGAQ
FT                   PASKTDKTTKSFKPTSEEALKWSESLEKLLLHKYGLEVFQAFLRTEFSEENLEFWLACE
FT                   DFKKVKSQSKMAAKAKKIFAEFIAIQACKEVNLDSYTREHTKENLQSITRGCFDLAQKR
FT                   IFGLMEKDSYPRFLRSDLYLDLINQKKMSPPL"
FT   assembly_gap    844052..844071
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    848753..849135
FT                   /estimated_length=383
FT                   /gap_type="unknown"
FT   assembly_gap    865793..865812
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    881855..881874
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    893019..893038
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    899426..899445
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    941567..941703
FT                   /estimated_length=137
FT                   /gap_type="unknown"
FT   assembly_gap    942193..942596
FT                   /estimated_length=404
FT                   /gap_type="unknown"
FT   assembly_gap    955383..955682
FT                   /estimated_length=300
FT                   /gap_type="unknown"
FT   assembly_gap    968055..971913
FT                   /estimated_length=3859
FT                   /gap_type="unknown"
FT   assembly_gap    973502..974093
FT                   /estimated_length=592
FT                   /gap_type="unknown"
FT   assembly_gap    976762..977075
FT                   /estimated_length=314
FT                   /gap_type="unknown"
FT   assembly_gap    992503..992767
FT                   /estimated_length=265
FT                   /gap_type="unknown"
FT   assembly_gap    1000754..1000773
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1017491..1017570
FT                   /estimated_length=80
FT                   /gap_type="unknown"
FT   assembly_gap    1043131..1043171
FT                   /estimated_length=41
FT                   /gap_type="unknown"
FT   assembly_gap    1046343..1046791
FT                   /estimated_length=449
FT                   /gap_type="unknown"
FT   assembly_gap    1053809..1053839
FT                   /estimated_length=31
FT                   /gap_type="unknown"
FT   assembly_gap    1067156..1067365
FT                   /estimated_length=210
FT                   /gap_type="unknown"
FT   assembly_gap    1090375..1090394
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1091611..1091630
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1111448..1112344
FT                   /estimated_length=897
FT                   /gap_type="unknown"
FT   assembly_gap    1137244..1137737
FT                   /estimated_length=494
FT                   /gap_type="unknown"
FT   assembly_gap    1149568..1150075
FT                   /estimated_length=508
FT                   /gap_type="unknown"
FT   gene            1180239..1262325
FT                   /locus_tag="mCG_7133"
FT                   /note="gene_id=mCG7133.2"
FT   mRNA            join(1180239..1180338,1208072..1208115,1226408..1226664,
FT                   1233120..1233215,1235955..1236032,1236594..1236632,
FT                   1241022..1241111,1241938..1241973,1242067..1242144,
FT                   1250109..1250198,1261778..1262325)
FT                   /locus_tag="mCG_7133"
FT                   /product="mCG7133"
FT                   /note="gene_id=mCG7133.2 transcript_id=mCT6033.3 created on
FT                   27-FEB-2003"
FT   gene            complement(1182088..1186374)
FT                   /locus_tag="mCG_148072"
FT                   /note="gene_id=mCG148072.0"
FT   mRNA            complement(join(1182088..1184320,1184581..1186374))
FT                   /locus_tag="mCG_148072"
FT                   /product="mCG148072"
FT                   /note="gene_id=mCG148072.0 transcript_id=mCT188335.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(1182440..1182751)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148072"
FT                   /product="mCG148072"
FT                   /note="gene_id=mCG148072.0 transcript_id=mCT188335.0
FT                   protein_id=mCP109414.0"
FT                   /protein_id="EDL31130.1"
FT                   /translation="MLTMSNEASFGRETGDVNSQNRGAYYKEQSIKTARQKPPRRHAFL
FT                   QPSPPNRPWGRSPALNKQTPVRYLQRRMTSHSLVSNDQPVCEVSLGSEARLQQGFERP"
FT   assembly_gap    1184524..1184543
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1188133..1188152
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1191292..1191751
FT                   /estimated_length=460
FT                   /gap_type="unknown"
FT   assembly_gap    1220343..1220362
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(1226499..1226664,1233120..1233215,1235955..1236032,
FT                   1236594..1236632,1241022..1241111,1241938..1241973,
FT                   1242067..1242144,1250109..1250198,1261778..1262229)
FT                   /codon_start=1
FT                   /locus_tag="mCG_7133"
FT                   /product="mCG7133"
FT                   /note="gene_id=mCG7133.2 transcript_id=mCT6033.3
FT                   protein_id=mCP20160.3"
FT                   /db_xref="GOA:R4GMK9"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="MGI:MGI:1919950"
FT                   /db_xref="UniProtKB/TrEMBL:R4GMK9"
FT                   /protein_id="EDL31129.1"
FT                   /translation="MTEVKVKTEVPDDYIQEVIWQGEAKEEKAGGKDSTGDVPAEICVV
FT                   IGGVRNQQTLDGKAPEGSPHGGSVRSRYSGTWIFDQALKYASGSYECGICGKKYKYYNC
FT                   FQTHVRAHRDTEATSGEGVSQSNNFRYTCDICGKKYKYYSCFQEHRDLHAVDVFSVEGA
FT                   PENRADPFDQGVVATDEVKEEPPEPFQKIGPKTGNYTCEFCGKQYKYYTPYQEHVALHA
FT                   PISTAPGWEPPEDPDTGSECSHPEVTPSPRFVAAKTQSNQSGKKAPASVVRCTSLLHRT
FT                   PPATQTQTFRAPNSGSPASKAAAGTDGLSHRCLPGFPPTTCRSCSPARTRLEFPSCFGA
FT                   DWDPWPLATSVTLADQVINLSWRFIQRNLQTFSK"
FT   assembly_gap    1277310..1277329
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1289881..1301403)
FT                   /gene="Ambp"
FT                   /locus_tag="mCG_7140"
FT                   /note="gene_id=mCG7140.2"
FT   mRNA            complement(join(1289881..1290005,1290272..1290445,
FT                   1290756..1290923,1291870..1291951,1295306..1295352,
FT                   1296023..1296124,1296932..1296959,1299287..1299330,
FT                   1300546..1300750,1301263..1301403))
FT                   /gene="Ambp"
FT                   /locus_tag="mCG_7140"
FT                   /product="alpha 1 microglobulin/bikunin, transcript variant
FT                   mCT174255"
FT                   /note="gene_id=mCG7140.2 transcript_id=mCT174255.0 created
FT                   on 09-OCT-2002"
FT   mRNA            complement(join(1289881..1290005,1290272..1290445,
FT                   1290756..1290923,1291870..1291951,1295306..1295352,
FT                   1296023..1296099,1299263..1299330,1300546..1300750,
FT                   1301263..1301403))
FT                   /gene="Ambp"
FT                   /locus_tag="mCG_7140"
FT                   /product="alpha 1 microglobulin/bikunin, transcript variant
FT                   mCT174258"
FT                   /note="gene_id=mCG7140.2 transcript_id=mCT174258.0 created
FT                   on 09-OCT-2002"
FT   mRNA            complement(join(1289881..1290005,1290272..1290445,
FT                   1290756..1290899,1296023..1296089,1298119..1298134,
FT                   1299188..1299330,1300546..1300750,1301263..1301403))
FT                   /gene="Ambp"
FT                   /locus_tag="mCG_7140"
FT                   /product="alpha 1 microglobulin/bikunin, transcript variant
FT                   mCT174260"
FT                   /note="gene_id=mCG7140.2 transcript_id=mCT174260.0 created
FT                   on 09-OCT-2002"
FT   mRNA            complement(join(1289883..1289970,1295302..1295352,
FT                   1296023..1296124,1296932..1297047,1298058..1298134,
FT                   1299188..1299330,1300546..1300750,1301263..1301403))
FT                   /gene="Ambp"
FT                   /locus_tag="mCG_7140"
FT                   /product="alpha 1 microglobulin/bikunin, transcript variant
FT                   mCT174259"
FT                   /note="gene_id=mCG7140.2 transcript_id=mCT174259.0 created
FT                   on 09-OCT-2002"
FT   mRNA            complement(join(1289884..1290005,1290272..1290445,
FT                   1290756..1290923,1291870..1291936,1299188..1299330,
FT                   1300546..1300750,1301263..1301403))
FT                   /gene="Ambp"
FT                   /locus_tag="mCG_7140"
FT                   /product="alpha 1 microglobulin/bikunin, transcript variant
FT                   mCT174257"
FT                   /note="gene_id=mCG7140.2 transcript_id=mCT174257.0 created
FT                   on 09-OCT-2002"
FT   mRNA            complement(join(1289884..1290005,1290272..1290445,
FT                   1290756..1290923,1298058..1298134,1299188..1299330,
FT                   1300546..1300750,1301263..1301403))
FT                   /gene="Ambp"
FT                   /locus_tag="mCG_7140"
FT                   /product="alpha 1 microglobulin/bikunin, transcript variant
FT                   mCT174256"
FT                   /note="gene_id=mCG7140.2 transcript_id=mCT174256.0 created
FT                   on 09-OCT-2002"
FT   mRNA            complement(join(1289884..1290005,1290272..1290445,
FT                   1290756..1290923,1291870..1291951,1295306..1295352,
FT                   1296023..1296124,1296932..1297048,1298058..1298134,
FT                   1299188..1299330,1300546..1300750,1301263..1301403))
FT                   /gene="Ambp"
FT                   /locus_tag="mCG_7140"
FT                   /product="alpha 1 microglobulin/bikunin, transcript variant
FT                   mCT6028"
FT                   /note="gene_id=mCG7140.2 transcript_id=mCT6028.1 created on
FT                   09-OCT-2002"
FT   CDS             complement(join(1289980..1290005,1290272..1290445,
FT                   1290756..1290923,1291870..1291951,1295306..1295352,
FT                   1296023..1296099,1299263..1299330,1300546..1300659))
FT                   /codon_start=1
FT                   /gene="Ambp"
FT                   /locus_tag="mCG_7140"
FT                   /product="alpha 1 microglobulin/bikunin, isoform CRA_f"
FT                   /note="gene_id=mCG7140.2 transcript_id=mCT174258.0
FT                   protein_id=mCP97178.0 isoform=CRA_f"
FT                   /protein_id="EDL31127.1"
FT                   /translation="MQGLRTLFLLLTACLASRADPASTLPDIQVQENFSESRIYGKWYN
FT                   LAVGSTCPWLSRIKDNLLQEFKDVALNVGISENSIIFMPDRGECVPGDREVEPTSIARA
FT                   RRAVLPQESEGSGTEPLITGTLKKEDSCQLNYSEGPCLGMQERYYYNGASMACETFQYG
FT                   GCLGNGNNFISEKDCLQTCRTIAACNLPIVQGPCRAFIKLWAFDAAQGKCIQFHYGGCK
FT                   GNGNKFYSEKECKEYCGVPGDGYEELIRS"
FT   CDS             complement(join(1289980..1290005,1290272..1290445,
FT                   1290756..1290899,1296023..1296089,1298119..1298134,
FT                   1299188..1299330,1300546..1300659))
FT                   /codon_start=1
FT                   /gene="Ambp"
FT                   /locus_tag="mCG_7140"
FT                   /product="alpha 1 microglobulin/bikunin, isoform CRA_d"
FT                   /note="gene_id=mCG7140.2 transcript_id=mCT174260.0
FT                   protein_id=mCP97174.0 isoform=CRA_d"
FT                   /protein_id="EDL31125.1"
FT                   /translation="MQGLRTLFLLLTACLASRADPASTLPDIQVQENFSESRIYGKWYN
FT                   LAVGSTCPWLSRIKDKMSVSTLVLQEGATETEISMTSTRWRRGVCEEFKDVALNVGISE
FT                   NSIIFMPDREGPCLGMQERYYYNGASMACETFQYGGCLGNGNNFISEKDCLQTCRTIAA
FT                   CNLPIVQGPCRAFIKLWAFDAAQGKCIQFHYGGCKGNGNKFYSEKECKEYCGVPGDGYE
FT                   ELIRS"
FT   CDS             complement(join(1289980..1290005,1290272..1290445,
FT                   1290756..1290923,1298058..1298134,1299188..1299330,
FT                   1300546..1300659))
FT                   /codon_start=1
FT                   /gene="Ambp"
FT                   /locus_tag="mCG_7140"
FT                   /product="alpha 1 microglobulin/bikunin, isoform CRA_b"
FT                   /note="gene_id=mCG7140.2 transcript_id=mCT174256.0
FT                   protein_id=mCP97175.0 isoform=CRA_b"
FT                   /protein_id="EDL31123.1"
FT                   /translation="MQGLRTLFLLLTACLASRADPASTLPDIQVQENFSESRIYGKWYN
FT                   LAVGSTCPWLSRIKDKMSVSTLVLQEGATETEISMTSTRWRRGVCEEITGAYQKTDIDG
FT                   KFLYHKSNSCQLNYSEGPCLGMQERYYYNGASMACETFQYGGCLGNGNNFISEKDCLQT
FT                   CRTIAACNLPIVQGPCRAFIKLWAFDAAQGKCIQFHYGGCKGNGNKFYSEKECKEYCGV
FT                   PGDGYEELIRS"
FT   CDS             complement(join(1289980..1290005,1290272..1290445,
FT                   1290756..1290923,1291870..1291951,1295306..1295352,
FT                   1296023..1296124,1296932..1297048,1298058..1298134,
FT                   1299188..1299330,1300546..1300659))
FT                   /codon_start=1
FT                   /gene="Ambp"
FT                   /locus_tag="mCG_7140"
FT                   /product="alpha 1 microglobulin/bikunin, isoform CRA_e"
FT                   /note="gene_id=mCG7140.2 transcript_id=mCT6028.1
FT                   protein_id=mCP20162.1 isoform=CRA_e"
FT                   /protein_id="EDL31126.1"
FT                   /translation="MQGLRTLFLLLTACLASRADPASTLPDIQVQENFSESRIYGKWYN
FT                   LAVGSTCPWLSRIKDKMSVSTLVLQEGATETEISMTSTRWRRGVCEEITGAYQKTDIDG
FT                   KFLYHKSKWNITLESYVVHTNYDEYAIFLTKKSSHHHGLTITAKLYGREPQLRDSLLQE
FT                   FKDVALNVGISENSIIFMPDRGECVPGDREVEPTSIARARRAVLPQESEGSGTEPLITG
FT                   TLKKEDSCQLNYSEGPCLGMQERYYYNGASMACETFQYGGCLGNGNNFISEKDCLQTCR
FT                   TIAACNLPIVQGPCRAFIKLWAFDAAQGKCIQFHYGGCKGNGNKFYSEKECKEYCGVPG
FT                   DGYEELIRS"
FT   CDS             complement(join(1289980..1290005,1290272..1290445,
FT                   1290756..1290923,1291870..1291951,1295306..1295352,
FT                   1296023..1296124,1296932..1296959,1299287..1299319))
FT                   /codon_start=1
FT                   /gene="Ambp"
FT                   /locus_tag="mCG_7140"
FT                   /product="alpha 1 microglobulin/bikunin, isoform CRA_a"
FT                   /note="gene_id=mCG7140.2 transcript_id=mCT174255.0
FT                   protein_id=mCP97176.0 isoform=CRA_a"
FT                   /protein_id="EDL31122.1"
FT                   /translation="MVQPGGGIHLPGLTITAKLYGREPQLRDSLLQEFKDVALNVGISE
FT                   NSIIFMPDRGECVPGDREVEPTSIARARRAVLPQESEGSGTEPLITGTLKKEDSCQLNY
FT                   SEGPCLGMQERYYYNGASMACETFQYGGCLGNGNNFISEKDCLQTCRTIAACNLPIVQG
FT                   PCRAFIKLWAFDAAQGKCIQFHYGGCKGNGNKFYSEKECKEYCGVPGDGYEELIRS"
FT   CDS             complement(join(1289980..1290005,1290272..1290445,
FT                   1290756..1290923,1291870..1291936,1299188..1299193))
FT                   /codon_start=1
FT                   /gene="Ambp"
FT                   /locus_tag="mCG_7140"
FT                   /product="alpha 1 microglobulin/bikunin, isoform CRA_c"
FT                   /note="gene_id=mCG7140.2 transcript_id=mCT174257.0
FT                   protein_id=mCP97177.0 isoform=CRA_c"
FT                   /protein_id="EDL31124.1"
FT                   /translation="MAVLPQESEGSGTEPLITGTLKKEDSCQLNYSEGPCLGMQERYYY
FT                   NGASMACETFQYGGCLGNGNNFISEKDCLQTCRTIAACNLPIVQGPCRAFIKLWAFDAA
FT                   QGKCIQFHYGGCKGNGNKFYSEKECKEYCGVPGDGYEELIRS"
FT   CDS             complement(join(1297037..1297047,1298058..1298134,
FT                   1299188..1299330,1300546..1300659))
FT                   /codon_start=1
FT                   /gene="Ambp"
FT                   /locus_tag="mCG_7140"
FT                   /product="alpha 1 microglobulin/bikunin, isoform CRA_g"
FT                   /note="gene_id=mCG7140.2 transcript_id=mCT174259.0
FT                   protein_id=mCP97179.0 isoform=CRA_g"
FT                   /protein_id="EDL31128.1"
FT                   /translation="MQGLRTLFLLLTACLASRADPASTLPDIQVQENFSESRIYGKWYN
FT                   LAVGSTCPWLSRIKDKMSVSTLVLQEGATETEISMTSTRWRRGVCEEITGAYQKTDIDG
FT                   KFLYHKSNGT"
FT   assembly_gap    1302751..1302831
FT                   /estimated_length=81
FT                   /gap_type="unknown"
FT   assembly_gap    1306511..1306530
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1312086..1318600)
FT                   /gene="Kif12"
FT                   /locus_tag="mCG_7135"
FT                   /note="gene_id=mCG7135.2"
FT   mRNA            complement(join(1312086..1312960,1313384..1313482,
FT                   1313558..1313642,1313927..1314013,1314179..1314269,
FT                   1314352..1314454,1314944..1316242,1316881..1317016,
FT                   1317138..1317272,1317604..1317679,1317769..1317896,
FT                   1318117..1318195,1318286..1318351,1318445..>1318511))
FT                   /gene="Kif12"
FT                   /locus_tag="mCG_7135"
FT                   /product="kinesin family member 12, transcript variant
FT                   mCT192827"
FT                   /note="gene_id=mCG7135.2 transcript_id=mCT192827.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(1312087..1312421,1312659..1312777,
FT                   1312857..1312957,1313384..1313482,1313558..1313642,
FT                   1313927..1314013,1314179..1314269,1314352..1314454,
FT                   1314944..1315048,1315137..1315255,1315815..1315971,
FT                   1316151..1316242,1316881..1317016,1317138..1317272,
FT                   1317604..1317679,1317769..1317883,1318117..1318195,
FT                   1318286..1318351,1318445..1318600))
FT                   /gene="Kif12"
FT                   /locus_tag="mCG_7135"
FT                   /product="kinesin family member 12, transcript variant
FT                   mCT6031"
FT                   /note="gene_id=mCG7135.2 transcript_id=mCT6031.2 created on
FT                   30-OCT-2002"
FT   CDS             complement(join(1312282..1312421,1312659..1312777,
FT                   1312857..1312957,1313384..1313482,1313558..1313642,
FT                   1313927..1314013,1314179..1314269,1314352..1314454,
FT                   1314944..1315048,1315137..1315255,1315815..1315971,
FT                   1316151..1316242,1316881..1317016,1317138..1317233))
FT                   /codon_start=1
FT                   /gene="Kif12"
FT                   /locus_tag="mCG_7135"
FT                   /product="kinesin family member 12, isoform CRA_b"
FT                   /note="gene_id=mCG7135.2 transcript_id=mCT6031.2
FT                   protein_id=mCP20128.2 isoform=CRA_b"
FT                   /protein_id="EDL31121.1"
FT                   /translation="MQRTFTWLLDRVQHLDSPVTLRASYLEIYNEQVWDLLSLGSPRPL
FT                   PVRWTKARGFYVEQLRVVEFGSLEALMELLQMGLSRRRSSSHTLNQASSRSHALLTLHI
FT                   SRPTSQQVPPVDLGEPPVGGKLCFVDLAGSEKVAATGSQGQLMLEANSINRSLLALGHC
FT                   ISLLLDPQRKQNHIPFRDSKLTKLLADSLGGRGVTLMVACVSPSAQCLPETLSTLRYAS
FT                   RAQRITTRPQGPKSPGVKPPQQVENELLRLQEENRHLRFQLDQMHTTAPGAHGARMAWA
FT                   QRNLYGMLQEFMLENERLRKEMRQLRSSRDLARAEQRVLAQQVHDLERRLLSACPLPQQ
FT                   GSTPVCPCRMVPAASCHALPPLCYCHHFCPLCRVPLAHWTCPRRECHMPQVLEPEAPGH
FT                   ISQSVWPPPWAPPPSPGSAKPPRERSQSDWTQTRVLAEMLMGEEVVPSAPPLSAGPSNM
FT                   PYGLRGGSGIPNLTPRLETLTQQINSSLHLSQRQPQPSEDTQSPGQGLSSC"
FT   CDS             complement(join(1315857..1316242,1316881..1317016,
FT                   1317138..1317272,1317604..1317679,1317769..1317896,
FT                   1318117..1318195,1318286..1318351,1318445..>1318509))
FT                   /codon_start=1
FT                   /gene="Kif12"
FT                   /locus_tag="mCG_7135"
FT                   /product="kinesin family member 12, isoform CRA_a"
FT                   /note="gene_id=mCG7135.2 transcript_id=mCT192827.0
FT                   protein_id=mCP113822.0 isoform=CRA_a"
FT                   /protein_id="EDL31120.1"
FT                   /translation="HIRKGKKSCPLQDMEERGSPDGDPARNLEQGPEGSETPIQVVLRV
FT                   RPMSTVELRRGEQSALHCSGTRTLQVSPPGGGPDVAFRFGAVLDGARTQEDVFRACGVK
FT                   RLGELALRGFSCTVFTFGQTGSGKTYTLTGPPPQGEGVPVPPSLAGIMQRTFTWLLDRV
FT                   QHLDSPVTLRASYLEIYNEQVWDLLSLGSPRPLPVRWTKARGFYVEQLRVVEFGSLEAL
FT                   MELLQMGLSRRRSSSHTLNQASSRSHALLTLHISRPTVSVQPVEGLAQGYPLRLSAFAW
FT                   IKQLGSVGCMGRKPLTLRHWDFNTDSPPQVPIKPWFTSLSRYLLWTLGSPLLEGSCALW
FT                   ILQAVRKWQPQDPKGS"
FT   assembly_gap    1321764..1322773
FT                   /estimated_length=1010
FT                   /gap_type="unknown"
FT   assembly_gap    1335944..1335963
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1337697..1338171
FT                   /estimated_length=475
FT                   /gap_type="unknown"
FT   assembly_gap    1357021..1357166
FT                   /estimated_length=146
FT                   /gap_type="unknown"
FT   gene            1360826..1480491
FT                   /gene="Col27a1"
FT                   /locus_tag="mCG_7139"
FT                   /note="gene_id=mCG7139.3"
FT   mRNA            join(1360826..1361229,1367841..1367911,1371031..1372766,
FT                   1378602..1378655,1381227..1381314,1382141..1382194,
FT                   1390795..1390848,1391867..1391920,1400437..1400481,
FT                   1401082..1401135,1401490..1401534,1456298..1456405,
FT                   1460202..1460255,1462335..1462388,1464101..1464157,
FT                   1464260..1464313,1464757..1464810,1465035..1465088,
FT                   1465694..1465747,1465823..1465930,1466223..1466330,
FT                   1468204..1468311,1470222..1470275,1470693..1470755,
FT                   1471205..1471258,1471405..1471440,1471546..1471563,
FT                   1471952..1471987,1472900..1472926,1474601..1474666,
FT                   1475306..1475474,1476569..1476678,1478053..1478271,
FT                   1479949..1480205)
FT                   /gene="Col27a1"
FT                   /locus_tag="mCG_7139"
FT                   /product="procollagen, type XXVII, alpha 1, transcript
FT                   variant mCT6030"
FT                   /note="gene_id=mCG7139.3 transcript_id=mCT6030.2 created on
FT                   30-OCT-2002"
FT   mRNA            join(<1362651..1362706,1367841..1367911,1371031..1372766,
FT                   1378602..1378655,1382141..1382194,1390795..1390848,
FT                   1391867..1391920,1400437..1400481,1401082..1401135,
FT                   1401490..1401534,1403850..1403903,1404942..1404986,
FT                   1410465..1410518,1412381..1412425,1419250..1419303,
FT                   1419796..1419840,1422662..1422715,1423854..1423907,
FT                   1424529..1424582,1427820..1427873,1428003..1428056,
FT                   1429429..1429473,1430689..1430742,1433378..1433422,
FT                   1438311..1438364,1439934..1439987,1440203..1440256,
FT                   1444556..1444609,1447426..1447479,1447906..1447950,
FT                   1448039..1448083,1448304..1448357,1449114..1449167,
FT                   1449780..1449833,1451951..1452004,1453453..1453506,
FT                   1456298..1456405,1460202..1460255,1460407..1460514,
FT                   1461446..1461499,1462335..1462388,1464101..1464157,
FT                   1464260..1464313,1464757..1464810,1465035..1465088,
FT                   1465694..1465747,1465823..1465930,1466223..1466330,
FT                   1468204..1468311,1470222..1470275,1470693..1470755,
FT                   1471205..1471258,1471405..1471460,1471952..1471987,
FT                   1472900..1472926,1474601..1474666,1475306..1475474,
FT                   1476569..1476678,1478053..1478271,1479949..1480095)
FT                   /gene="Col27a1"
FT                   /locus_tag="mCG_7139"
FT                   /product="procollagen, type XXVII, alpha 1, transcript
FT                   variant mCT192835"
FT                   /note="gene_id=mCG7139.3 transcript_id=mCT192835.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(<1362651..1362706,1367841..1367911,1371031..1372766,
FT                   1378602..1378655,1382141..1382194,1390795..1390848,
FT                   1391867..1391920,1400437..1400481,1401082..1401135,
FT                   1401490..1401534,1403850..1403903,1404942..1404986,
FT                   1410465..1410518,1412381..1412425,1419250..1419303,
FT                   1419796..1419840,1422662..1422715,1423854..1423907,
FT                   1424529..1424582,1427820..1427873,1428003..1428056,
FT                   1429429..1429473,1430689..1430742,1433378..1433422,
FT                   1438311..1438364,1439934..1439987,1440203..1440256,
FT                   1444556..1444609,1447426..1447479,1447906..1447950,
FT                   1448039..1448083,1448304..1448357,1449114..1449167,
FT                   1449780..1449833,1451951..1452004,1453453..1453506,
FT                   1456298..1456405,1460202..1460255,1460407..1460514,
FT                   1461446..1461499,1462335..1462388,1464101..1464157,
FT                   1464260..1464313,1464757..1464810,1465035..1465088,
FT                   1465694..1465747,1465823..1465930,1466223..1466330,
FT                   1468204..1468311,1470222..1470275,1470693..1470755,
FT                   1471205..1471258,1471405..1471440,1471546..1471563,
FT                   1471952..1471987,1472900..1472926,1474601..1474666,
FT                   1475306..1475474,1476569..1476678,1478053..1478271,
FT                   1479949..>1480095)
FT                   /gene="Col27a1"
FT                   /locus_tag="mCG_7139"
FT                   /product="procollagen, type XXVII, alpha 1, transcript
FT                   variant mCT192834"
FT                   /note="gene_id=mCG7139.3 transcript_id=mCT192834.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(1362651..1362706,1367841..1367911,1371031..1372766,
FT                   1378602..1378655,1382141..1382194,1390795..1390848,
FT                   1391867..1391920,1400437..1400481,1401082..1401135,
FT                   1401490..1401534,1403850..1403903,1404942..1404986,
FT                   1410465..1410518,1412381..1412425,1419250..1419303,
FT                   1419796..1419840,1422662..1422715,1423854..1423907,
FT                   1424529..1424582,1427820..1427873,1428003..1428056,
FT                   1429429..1429473,1430689..1430742,1433378..1433422,
FT                   1438311..1438364,1439934..1439987,1440203..1440256,
FT                   1444556..1444609,1447426..1447479,1447906..1447950,
FT                   1448039..1448083,1448304..1448357,1449114..1449167,
FT                   1449780..1449833,1451951..1452004,1453453..1453506,
FT                   1456298..1456405,1460202..1460255,1460407..1460514,
FT                   1461446..1461499,1462335..1462388,1464101..1464157,
FT                   1464260..1464313,1464757..1464810,1465035..1465088,
FT                   1465694..1465747,1465823..1465930,1466223..1466330,
FT                   1468204..1468311,1470222..1470275,1470693..1470755,
FT                   1471205..1471258,1471405..1471440,1471546..1471563,
FT                   1471952..1471987,1472900..1472926,1474601..1474666,
FT                   1475306..1475474,1476569..1476678,1478053..1478271,
FT                   1479949..1480095)
FT                   /codon_start=1
FT                   /gene="Col27a1"
FT                   /locus_tag="mCG_7139"
FT                   /product="procollagen, type XXVII, alpha 1, isoform CRA_a"
FT                   /note="gene_id=mCG7139.3 transcript_id=mCT192834.0
FT                   protein_id=mCP113824.0 isoform=CRA_a"
FT                   /protein_id="EDL31116.1"
FT                   /translation="MGTGFARGARGTAASGPGGGFLFAWILVSFTCHLASTQGAPEDVD
FT                   VLQRLGLSWTKAGGGRSPTPPGVIPFPSGFIFTQRAKLQAPTANVLPTTLGRELALVLS
FT                   LCSHRVNHAFLFAIRSRKHKLQLGLQFLPGRTIIHLGPRQSVAFDLDVHDGRWHHLALE
FT                   LRGRTVTMVTACGQHRVPVPLPSRRDSMLDPQGSFLLGKVNPRAVQFEGALCQFSIHPV
FT                   AQVAHNYCAHLRERCRQVDTYSPQVGTLFPWDSGPAFALHPEPALLGLGNLTRTPATLG
FT                   ARPVSRALAVTLAPAMPTKPLRTVHPDVSEHSSSQTPLSPAKQSARKTPSPSSSASLAN
FT                   STRVYRPAAAQPRQITATSPTKRSPTKPSVSPLSVTPMKSPHATQKTGVPSFTKPVPPT
FT                   QKPAPFTSYLAPSKASSPTVRPVQKTFMTPRPPVPSPQPLRPTTGLSKKFTNPTVAKSK
FT                   SKTTSWASKPVLARSSVPKTLQQTVLSQSPVSYLGSQTLAPALPPLGVGNPRTMPPTRD
FT                   SALTPAGSKKFTGRETSKKTRQKSSPRKPEPLSPGKSARDASPRDLTTKPSRPSTPALV
FT                   LAPAYLLSSSPQPTSSSFPFFHLLGPTPFPMLMGPPGSKGDCGLPGPPGLPGLPGSPGA
FT                   RGPRGPPGPYGNPGPPGPPGAKGQKGDPGLSPGQAHDGAKGNMGLPGLSGNPGPLGRKG
FT                   HKGHPGAAGHPGEQGQPGPEGSPGAKGYPGRQGFPGPVGDPGPKGSRGYIGLPGLFGLP
FT                   GSDGERGLPGVPGKRGEMGRPGFPGDFGERGPPGLDGNPGEIGLPGPPGVLGLIGDTGA
FT                   LGPIGYPGPKGMKGLMGGVGEPGLKGDKGEQGVPGVSGDPGFQGDKGSHGLPGLPGGRG
FT                   KPGPLGKAGDKGSLGFPGPPGPEGFPGDIGPPGDNGPEGMKGKPGARGLPGPPGQLGPE
FT                   GDEGPMGPPGVPGLEGQPGRKGFPGRPGLDGSKGEPGDPGRPGPVGEQGLMGFIGLVGE
FT                   PGIVGEKGDRGVMGPPGAPGPKGSMGHPGTPGGIGNPGEPGPWGPPGSRGLPGMRGAKG
FT                   HRGPRGPDGPAGEQGSKGLKGRVGPRGRPGQPGQQGAAGERGHSGAKGFLGIPGPSGPP
FT                   GAKGLPGEPGSQGPQGPVGPPGEMGPKGPPGAVGEPGLPGDSGMKGDLGPLGPPGEQGL
FT                   IGQRGEPGLEGDHGPVGPDGLKGDRGDPGPDGEHGEKGQEGLKGEDGSPGPPGITGVPG
FT                   REGKPGKQGEKGQRGAKGAKGHQGYLGEMGIPGEPGPPGTPGPKGSRGTLGPTGAPGRM
FT                   GAQGEPGLAGYNGHKGITGPLGPPGPKGEKGDQGEDGKTEGPPGPPGDRGPVGDRGDRG
FT                   EPGDPGYPGQEGVQGLRGEPGQQGQPGHPGPRGRPGPKGSKGEEGPKGKPGKAGPSGRR
FT                   GTQGLQGLPGPRGVVGRQGPEGTAGSDGIPGRDGRPGYQGDQGNDGDPGPVGPAGRRGN
FT                   PGVAGLPGAQGPPGFKGESGLPGQLGPPGKRGTEGGTGLPGNQGEPGSKGQPGDSGEMG
FT                   FPGVAGLFGPKGPPGDIGFKGIQGPRGPPGLMGKEGIIGPPGMLGPSGLPGPKGDRGSR
FT                   GDLGLQGPRGPPGPRGRPGPPGPPWHPIQFQQDDLGAAFQTWMDAQGAVRSEGYSYPDQ
FT                   LALDQGGEIFKTLHYLSNLIQSIKTPLGTKENPARVCRDLMDCEQRMADGTYWVDPNLG
FT                   CSSDTIEVSCNFTQGGQTCLKPITASKAEFAVSRVQMNFLHLLSSEGTQHITIHCLNMT
FT                   VWQEGPGRSSARQAVRFRAWNGQVFEAGGQFRPEVSMDGCKVHDGRWHQTLFTFRTQDP
FT                   QQLPIVSVDNLPPVSSGKQYRLEVGPACFL"
FT   CDS             join(1362651..1362706,1367841..1367911,1371031..1372766,
FT                   1378602..1378655,1382141..1382194,1390795..1390848,
FT                   1391867..1391920,1400437..1400481,1401082..1401135,
FT                   1401490..1401534,1403850..1403903,1404942..1404986,
FT                   1410465..1410518,1412381..1412425,1419250..1419303,
FT                   1419796..1419840,1422662..1422715,1423854..1423907,
FT                   1424529..1424582,1427820..1427873,1428003..1428056,
FT                   1429429..1429473,1430689..1430742,1433378..1433422,
FT                   1438311..1438364,1439934..1439987,1440203..1440256,
FT                   1444556..1444609,1447426..1447479,1447906..1447950,
FT                   1448039..1448083,1448304..1448357,1449114..1449167,
FT                   1449780..1449833,1451951..1452004,1453453..1453506,
FT                   1456298..1456405,1460202..1460255,1460407..1460514,
FT                   1461446..1461499,1462335..1462388,1464101..1464157,
FT                   1464260..1464313,1464757..1464810,1465035..1465088,
FT                   1465694..1465747,1465823..1465930,1466223..1466330,
FT                   1468204..1468311,1470222..1470275,1470693..1470755,
FT                   1471205..1471258,1471405..1471460,1471952..1471987,
FT                   1472900..1472926,1474601..1474666,1475306..1475336)
FT                   /codon_start=1
FT                   /gene="Col27a1"
FT                   /locus_tag="mCG_7139"
FT                   /product="procollagen, type XXVII, alpha 1, isoform CRA_b"
FT                   /note="gene_id=mCG7139.3 transcript_id=mCT192835.0
FT                   protein_id=mCP113825.0 isoform=CRA_b"
FT                   /protein_id="EDL31117.1"
FT                   /translation="MGTGFARGARGTAASGPGGGFLFAWILVSFTCHLASTQGAPEDVD
FT                   VLQRLGLSWTKAGGGRSPTPPGVIPFPSGFIFTQRAKLQAPTANVLPTTLGRELALVLS
FT                   LCSHRVNHAFLFAIRSRKHKLQLGLQFLPGRTIIHLGPRQSVAFDLDVHDGRWHHLALE
FT                   LRGRTVTMVTACGQHRVPVPLPSRRDSMLDPQGSFLLGKVNPRAVQFEGALCQFSIHPV
FT                   AQVAHNYCAHLRERCRQVDTYSPQVGTLFPWDSGPAFALHPEPALLGLGNLTRTPATLG
FT                   ARPVSRALAVTLAPAMPTKPLRTVHPDVSEHSSSQTPLSPAKQSARKTPSPSSSASLAN
FT                   STRVYRPAAAQPRQITATSPTKRSPTKPSVSPLSVTPMKSPHATQKTGVPSFTKPVPPT
FT                   QKPAPFTSYLAPSKASSPTVRPVQKTFMTPRPPVPSPQPLRPTTGLSKKFTNPTVAKSK
FT                   SKTTSWASKPVLARSSVPKTLQQTVLSQSPVSYLGSQTLAPALPPLGVGNPRTMPPTRD
FT                   SALTPAGSKKFTGRETSKKTRQKSSPRKPEPLSPGKSARDASPRDLTTKPSRPSTPALV
FT                   LAPAYLLSSSPQPTSSSFPFFHLLGPTPFPMLMGPPGSKGDCGLPGPPGLPGLPGSPGA
FT                   RGPRGPPGPYGNPGPPGPPGAKGQKGDPGLSPGQAHDGAKGNMGLPGLSGNPGPLGRKG
FT                   HKGHPGAAGHPGEQGQPGPEGSPGAKGYPGRQGFPGPVGDPGPKGSRGYIGLPGLFGLP
FT                   GSDGERGLPGVPGKRGEMGRPGFPGDFGERGPPGLDGNPGEIGLPGPPGVLGLIGDTGA
FT                   LGPIGYPGPKGMKGLMGGVGEPGLKGDKGEQGVPGVSGDPGFQGDKGSHGLPGLPGGRG
FT                   KPGPLGKAGDKGSLGFPGPPGPEGFPGDIGPPGDNGPEGMKGKPGARGLPGPPGQLGPE
FT                   GDEGPMGPPGVPGLEGQPGRKGFPGRPGLDGSKGEPGDPGRPGPVGEQGLMGFIGLVGE
FT                   PGIVGEKGDRGVMGPPGAPGPKGSMGHPGTPGGIGNPGEPGPWGPPGSRGLPGMRGAKG
FT                   HRGPRGPDGPAGEQGSKGLKGRVGPRGRPGQPGQQGAAGERGHSGAKGFLGIPGPSGPP
FT                   GAKGLPGEPGSQGPQGPVGPPGEMGPKGPPGAVGEPGLPGDSGMKGDLGPLGPPGEQGL
FT                   IGQRGEPGLEGDHGPVGPDGLKGDRGDPGPDGEHGEKGQEGLKGEDGSPGPPGITGVPG
FT                   REGKPGKQGEKGQRGAKGAKGHQGYLGEMGIPGEPGPPGTPGPKGSRGTLGPTGAPGRM
FT                   GAQGEPGLAGYNGHKGITGPLGPPGPKGEKGDQGEDGKTEGPPGPPGDRGPVGDRGDRG
FT                   EPGDPGYPGQEGVQGLRGEPGQQGQPGHPGPRGRPGPKGSKGEEGPKGKPGKAGPSGRR
FT                   GTQGLQGLPGPRGVVGRQGPEGTAGSDGIPGRDGRPGYQGDQGNDGDPGPVGPAGRRGN
FT                   PGVAGLPGAQGPPGFKGESGLPGQLGPPGKRGTEGGTGLPGNQGEPGSKGQPGDSGEMG
FT                   FPGVAGLFGPKGPPGDIGFKGIQGPRGPPGLMGKEGIIGPPGMLGPSGLPGPKGDRGSR
FT                   GDLVSGQPGWVLLVQGAGQVPRALLGIPSSFSKMTLEQLSRHGWMLKEPSDRRGTAIRT
FT                   SWR"
FT   mRNA            join(<1381098..1381314,1382141..1382194,1390795..1390848,
FT                   1391867..1391920,1400437..1400481,1401082..1401135,
FT                   1401490..1401534,1403850..1403903,1404942..1404986,
FT                   1410465..1410518,1412381..1412425,1419250..1419303,
FT                   1419796..1419840,1422662..1422715,1423854..1423907,
FT                   1424529..1424582,1427820..1427873,1428003..1428056,
FT                   1429429..1429473,1430689..1430742,1433378..1433422,
FT                   1438311..1438364,1439934..1439987,1440203..1440256,
FT                   1444556..1444609,1447426..1447479,1447906..1447950,
FT                   1448039..1448083,1448304..1448357,1449114..1449167,
FT                   1449780..1449833,1451951..1452004,1453453..1453506,
FT                   1456298..1456405,1460202..1460255,1460407..1460514,
FT                   1461446..1461499,1462335..1462388,1464101..1464157,
FT                   1464260..1464313,1464757..1464810,1465035..1465088,
FT                   1465694..1465747,1465833..1465930,1466223..1466330,
FT                   1468204..1468311,1470222..1470275,1470693..1470755,
FT                   1471168..1471258,1471405..1471440,1471546..1471563,
FT                   1471952..1471987,1472900..1472926,1474601..1474666,
FT                   1475306..1475474,1476569..1476678,1478053..1478271,
FT                   1479949..1480491)
FT                   /gene="Col27a1"
FT                   /locus_tag="mCG_7139"
FT                   /product="procollagen, type XXVII, alpha 1, transcript
FT                   variant mCT192836"
FT                   /note="gene_id=mCG7139.3 transcript_id=mCT192836.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<1381165..1381314,1382141..1382194,1390795..1390848,
FT                   1391867..1391920,1400437..1400481,1401082..1401135,
FT                   1401490..1401534,1403850..1403903,1404942..1404986,
FT                   1410465..1410518,1412381..1412425,1419250..1419303,
FT                   1419796..1419840,1422662..1422715,1423854..1423907,
FT                   1424529..1424582,1427820..1427873,1428003..1428056,
FT                   1429429..1429473,1430689..1430742,1433378..1433422,
FT                   1438311..1438364,1439934..1439987,1440203..1440256,
FT                   1444556..1444609,1447426..1447479,1447906..1447950,
FT                   1448039..1448083,1448304..1448357,1449114..1449167,
FT                   1449780..1449833,1451951..1452004,1453453..1453506,
FT                   1456298..1456405,1460202..1460255,1460407..1460514,
FT                   1461446..1461499,1462335..1462388,1464101..1464157,
FT                   1464260..1464313,1464757..1464810,1465035..1465088,
FT                   1465694..1465747,1465833..1465930,1466223..1466330,
FT                   1468204..1468311,1470222..1470275,1470693..1470753)
FT                   /codon_start=1
FT                   /gene="Col27a1"
FT                   /locus_tag="mCG_7139"
FT                   /product="procollagen, type XXVII, alpha 1, isoform CRA_c"
FT                   /note="gene_id=mCG7139.3 transcript_id=mCT192836.0
FT                   protein_id=mCP113826.0 isoform=CRA_c"
FT                   /protein_id="EDL31118.1"
FT                   /translation="GSSGPSRCPFPLHLLLTVVSRQRPWDMTHLYEFVVLGWKPVDVFL
FT                   LEEVEGPPGPYGNPGPPGPPGAKGQKGDPGLSPGQAHDGAKGNMGLPGLSGNPGPLGRK
FT                   GHKGHPGAAGHPGEQGQPGPEGSPGAKGYPGRQGFPGPVGDPGPKGSRGYIGLPGLFGL
FT                   PGSDGERGLPGVPGKRGEMGRPGFPGDFGERGPPGLDGNPGEIGLPGPPGVLGLIGDTG
FT                   ALGPIGYPGPKGMKGLMGGVGEPGLKGDKGEQGVPGVSGDPGFQGDKGSHGLPGLPGGR
FT                   GKPGPLGKAGDKGSLGFPGPPGPEGFPGDIGPPGDNGPEGMKGKPGARGLPGPPGQLGP
FT                   EGDEGPMGPPGVPGLEGQPGRKGFPGRPGLDGSKGEPGDPGRPGPVGEQGLMGFIGLVG
FT                   EPGIVGEKGDRGVMGPPGAPGPKGSMGHPGTPGGIGNPGEPGPWGPPGSRGLPGMRGAK
FT                   GHRGPRGPDGPAGEQGSKGLKGRVGPRGRPGQPGQQGAAGERGHSGAKGFLGIPGPSGP
FT                   PGAKGLPGEPGSQGPQGPVGPPGEMGPKGPPGAVGEPGLPGDSGMKGDLGPLGPPGEQG
FT                   LIGQRGEPGLEGDHGPVGPDGLKGDRGDPGPDGEHGEKGQEGLKGEDGSPGPPGITGVP
FT                   GREGKPGKQGEKGQRGAKGAKGHQGYLGEMGIPGEPGPPGTPGPKGSRGTLGPTGAPGR
FT                   MGAQGEPGLAGYNGHKGITGPLGPPGPKGEKGDQGEDGKTEGPPGPPGDRGPVGDRGDR
FT                   GEPGDPGYPGQEGVQGLRGEPGQQGQPGHPGPRGRPGPKGSKGEEGPKGKPGKAGPSGR
FT                   RGTQDCQAPEAWWGDRALRALLDLMGFLAEMVGQDIRETREMMGTLALWALLGEEEIQV
FT                   WLACLEHRGLRDSRVKVGYLGNWVPLENEGQKVEQGFLGTRGSQDPKASRVTLARWASQ
FT                   EWLASLDPRAPLETLASKASKVLGGLLA"
FT   CDS             join(1381243..1381314,1382141..1382194,1390795..1390848,
FT                   1391867..1391920,1400437..1400481,1401082..1401135,
FT                   1401490..1401534,1456298..1456405,1460202..1460255,
FT                   1462335..1462388,1464101..1464157,1464260..1464313,
FT                   1464757..1464810,1465035..1465088,1465694..1465747,
FT                   1465823..1465930,1466223..1466330,1468204..1468311,
FT                   1470222..1470275,1470693..1470755,1471205..1471258,
FT                   1471405..1471440,1471546..1471563,1471952..1471987,
FT                   1472900..1472926,1474601..1474666,1475306..1475474,
FT                   1476569..1476678,1478053..1478271,1479949..1480095)
FT                   /codon_start=1
FT                   /gene="Col27a1"
FT                   /locus_tag="mCG_7139"
FT                   /product="procollagen, type XXVII, alpha 1, isoform CRA_d"
FT                   /note="gene_id=mCG7139.3 transcript_id=mCT6030.2
FT                   protein_id=mCP20142.2 isoform=CRA_d"
FT                   /protein_id="EDL31119.1"
FT                   /translation="MTHLYEFVVLGWKPVDVFLLEEVEGPPGPYGNPGPPGPPGAKGQK
FT                   GDPGLSPGQAHDGAKGNMGLPGLSGNPGPLGRKGHKGHPGAAGHPGEQGQPGPEGSPGA
FT                   KGYPGRQGFPGPVGDPGPKGSRGDRGDPGPDGEHGEKGQEGLKGEDGSPGPPGITGVPG
FT                   REGKPGKQGEKGQRGAKGHKGITGPLGPPGPKGEKGDQGEDGKTEGPPGPPGDRGPVGD
FT                   RGDRGEPGDPGYPGQEGVQGLRGEPGQQGQPGHPGPRGRPGPKGSKGEEGPKGKPGKAG
FT                   PSGRRGTQGLQGLPGPRGVVGRQGPEGTAGSDGIPGRDGRPGYQGDQGNDGDPGPVGPA
FT                   GRRGNPGVAGLPGAQGPPGFKGESGLPGQLGPPGKRGTEGGTGLPGNQGEPGSKGQPGD
FT                   SGEMGFPGVAGLFGPKGPPGDIGFKGIQGPRGPPGLMGKEGIIGPPGMLGPSGLPGPKG
FT                   DRGSRGDLGLQGPRGPPGPRGRPGPPGPPWHPIQFQQDDLGAAFQTWMDAQGAVRSEGY
FT                   SYPDQLALDQGGEIFKTLHYLSNLIQSIKTPLGTKENPARVCRDLMDCEQRMADGTYWV
FT                   DPNLGCSSDTIEVSCNFTQGGQTCLKPITASKAEFAVSRVQMNFLHLLSSEGTQHITIH
FT                   CLNMTVWQEGPGRSSARQAVRFRAWNGQVFEAGGQFRPEVSMDGCKVHDGRWHQTLFTF
FT                   RTQDPQQLPIVSVDNLPPVSSGKQYRLEVGPACFL"
FT   assembly_gap    1384464..1384493
FT                   /estimated_length=30
FT                   /gap_type="unknown"
FT   assembly_gap    1386682..1386750
FT                   /estimated_length=69
FT                   /gap_type="unknown"
FT   gene            complement(1473683..1515098)
FT                   /locus_tag="mCG_1051073"
FT                   /note="gene_id=mCG1051073.0"
FT   mRNA            complement(join(1473683..1474702,1477980..1478104,
FT                   1515026..1515098))
FT                   /locus_tag="mCG_1051073"
FT                   /product="mCG1051073"
FT                   /note="gene_id=mCG1051073.0 transcript_id=mCT194862.0
FT                   created on 27-JAN-2005"
FT   CDS             complement(1474124..1474345)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1051073"
FT                   /product="mCG1051073"
FT                   /note="gene_id=mCG1051073.0 transcript_id=mCT194862.0
FT                   protein_id=mCP115891.0"
FT                   /protein_id="EDL31107.1"
FT                   /translation="MVRNPVCVLWSSSLSPSIQVLAPGTHSSSKSLKAVLCLAPGPFHI
FT                   FHPDWGGVRGRVRVFPVSNTVSGFLNLG"
FT   assembly_gap    1487093..1487538
FT                   /estimated_length=446
FT                   /gap_type="unknown"
FT   gene            1491425..1500820
FT                   /locus_tag="mCG_7142"
FT                   /note="gene_id=mCG7142.3"
FT   mRNA            join(1491425..1491583,1491938..1492084,1492980..1493016,
FT                   1493151..1493254,1494839..1495035)
FT                   /locus_tag="mCG_7142"
FT                   /product="mCG7142, transcript variant mCT174265"
FT                   /note="gene_id=mCG7142.3 transcript_id=mCT174265.0 created
FT                   on 19-JUN-2003"
FT   mRNA            join(1491425..1491583,1491938..1492080,1492290..1492378,
FT                   1493151..1493254,1494839..1495026)
FT                   /locus_tag="mCG_7142"
FT                   /product="mCG7142, transcript variant mCT174262"
FT                   /note="gene_id=mCG7142.3 transcript_id=mCT174262.0 created
FT                   on 19-JUN-2003"
FT   mRNA            join(1491425..1491583,1493151..1493254,1494839..1495025)
FT                   /locus_tag="mCG_7142"
FT                   /product="mCG7142, transcript variant mCT174261"
FT                   /note="gene_id=mCG7142.3 transcript_id=mCT174261.0 created
FT                   on 19-JUN-2003"
FT   mRNA            join(1491425..1491583,1491938..1492080,1492290..1492360,
FT                   1492909..1492928,1493151..1493254,1494839..>1495019)
FT                   /locus_tag="mCG_7142"
FT                   /product="mCG7142, transcript variant mCT174266"
FT                   /note="gene_id=mCG7142.3 transcript_id=mCT174266.0 created
FT                   on 19-JUN-2003"
FT   mRNA            join(1491435..1491583,1491938..1492080,1492290..1492360,
FT                   1492909..1493016,1493151..1493254,1494839..1495032)
FT                   /locus_tag="mCG_7142"
FT                   /product="mCG7142, transcript variant mCT6038"
FT                   /note="gene_id=mCG7142.3 transcript_id=mCT6038.1 created on
FT                   19-JUN-2003"
FT   mRNA            join(1491438..1491583,1491938..1492080,1492290..1492360,
FT                   1492909..1493016,1493151..1493254,1494839..1495010,
FT                   1500805..1500820)
FT                   /locus_tag="mCG_7142"
FT                   /product="mCG7142, transcript variant mCT174264"
FT                   /note="gene_id=mCG7142.3 transcript_id=mCT174264.0 created
FT                   on 19-JUN-2003"
FT   CDS             join(1491467..1491583,1491938..1492080,1492290..1492360,
FT                   1492909..1492928,1493151..1493254,1494839..1495019)
FT                   /codon_start=1
FT                   /locus_tag="mCG_7142"
FT                   /product="mCG7142, isoform CRA_e"
FT                   /note="gene_id=mCG7142.3 transcript_id=mCT174266.0
FT                   protein_id=mCP97185.0 isoform=CRA_e"
FT                   /protein_id="EDL31114.1"
FT                   /translation="MALHTVLIILSLLPMLEAQNPEHANFTIGEPITNETLSWLSDKWF
FT                   FMGAAFRKLEYRQAIQTMQSEFFYLTTNLINDTIELRESQTIGDQCVYNSTHLGFQREN
FT                   GTFSKYEGGVETFPKGQISPRSCGKYSRRLSHTWAWMNQKSYLSTGKRIGAVSRRRSSL
FT                   SWGRRPRKILRKARHELSSLNSEGCPQAHQTPPPPVHFDSVSATIKVC"
FT   CDS             join(1491467..1491583,1493151..1493254,1494839..1495019)
FT                   /codon_start=1
FT                   /locus_tag="mCG_7142"
FT                   /product="mCG7142, isoform CRA_a"
FT                   /note="gene_id=mCG7142.3 transcript_id=mCT174261.0
FT                   protein_id=mCP97180.0 isoform=CRA_a"
FT                   /protein_id="EDL31110.1"
FT                   /translation="MALHTVLIILSLLPMLEAQNPEHANFTIGEPITNETLSWPKGQIS
FT                   PRSCGKYSRRLSHTWAWMNQKSYLSTGKRIGAVSRRRSSLSWGRRPRKILRKARHELSS
FT                   LNSEGCPQAHQTPPPPVHFDSVSATIKVC"
FT   CDS             join(1491467..1491583,1491938..1492080,1492290..1492378,
FT                   1493151..1493254,1494839..1494919)
FT                   /codon_start=1
FT                   /locus_tag="mCG_7142"
FT                   /product="mCG7142, isoform CRA_b"
FT                   /note="gene_id=mCG7142.3 transcript_id=mCT174262.0
FT                   protein_id=mCP97181.0 isoform=CRA_b"
FT                   /protein_id="EDL31111.1"
FT                   /translation="MALHTVLIILSLLPMLEAQNPEHANFTIGEPITNETLSWLSDKWF
FT                   FMGAAFRKLEYRQAIQTMQSEFFYLTTNLINDTIELRESQTIGDQCVYNSTHLGFQREN
FT                   GTFSKYGEGVKHSKRPDITPELREVFQKAVTHVGMDESEIIFVDWKKDRCGQQEKKQLE
FT                   LGKETKKDPEEGQA"
FT   CDS             join(1491467..1491583,1491938..1492080,1492290..1492360,
FT                   1492909..1493016,1493151..1493254,1494839..1494919)
FT                   /codon_start=1
FT                   /locus_tag="mCG_7142"
FT                   /product="mCG7142, isoform CRA_c"
FT                   /note="gene_id=mCG7142.3 transcript_id=mCT174264.0
FT                   protein_id=mCP97184.0 isoform=CRA_c"
FT                   /protein_id="EDL31112.1"
FT                   /translation="MALHTVLIILSLLPMLEAQNPEHANFTIGEPITNETLSWLSDKWF
FT                   FMGAAFRKLEYRQAIQTMQSEFFYLTTNLINDTIELRESQTIGDQCVYNSTHLGFQREN
FT                   GTFSKYEGGVETFAHLIVLRKHGAFMLAFDLKDEKKRGLSLYAKRPDITPELREVFQKA
FT                   VTHVGMDESEIIFVDWKKDRCGQQEKKQLELGKETKKDPEEGQA"
FT   CDS             join(1491467..1491583,1491938..1492080,1492290..1492360,
FT                   1492909..1493016,1493151..1493254,1494839..1494919)
FT                   /codon_start=1
FT                   /locus_tag="mCG_7142"
FT                   /product="mCG7142, isoform CRA_c"
FT                   /note="gene_id=mCG7142.3 transcript_id=mCT6038.1
FT                   protein_id=mCP20129.1 isoform=CRA_c"
FT                   /protein_id="EDL31115.1"
FT                   /translation="MALHTVLIILSLLPMLEAQNPEHANFTIGEPITNETLSWLSDKWF
FT                   FMGAAFRKLEYRQAIQTMQSEFFYLTTNLINDTIELRESQTIGDQCVYNSTHLGFQREN
FT                   GTFSKYEGGVETFAHLIVLRKHGAFMLAFDLKDEKKRGLSLYAKRPDITPELREVFQKA
FT                   VTHVGMDESEIIFVDWKKDRCGQQEKKQLELGKETKKDPEEGQA"
FT   CDS             join(1492987..1493016,1493151..1493254,1494839..1495019)
FT                   /codon_start=1
FT                   /locus_tag="mCG_7142"
FT                   /product="mCG7142, isoform CRA_d"
FT                   /note="gene_id=mCG7142.3 transcript_id=mCT174265.0
FT                   protein_id=mCP97183.0 isoform=CRA_d"
FT                   /protein_id="EDL31113.1"
FT                   /translation="MRRNGDCPSMPKGQISPRSCGKYSRRLSHTWAWMNQKSYLSTGKR
FT                   IGAVSRRRSSLSWGRRPRKILRKARHELSSLNSEGCPQAHQTPPPPVHFDSVSATIKVC
FT                   "
FT   gene            <1503056..>1506273
FT                   /gene="Orm3"
FT                   /locus_tag="mCG_7145"
FT                   /note="gene_id=mCG7145.1"
FT   mRNA            join(<1503056..1503189,1503343..1503515,1503787..1503863,
FT                   1504420..1504527,1504665..1504768,1506193..>1506273)
FT                   /gene="Orm3"
FT                   /locus_tag="mCG_7145"
FT                   /product="orosomucoid 3, transcript variant mCT180965"
FT                   /note="gene_id=mCG7145.1 transcript_id=mCT180965.0 created
FT                   on 03-MAR-2003"
FT   mRNA            join(<1503076..1503189,1503447..1503589,1503787..1503857,
FT                   1504420..1504527,1504665..1504768,1506193..>1506273)
FT                   /gene="Orm3"
FT                   /locus_tag="mCG_7145"
FT                   /product="orosomucoid 3, transcript variant mCT6026"
FT                   /note="gene_id=mCG7145.1 transcript_id=mCT6026.0 created on
FT                   03-MAR-2003"
FT   CDS             join(1503076..1503189,1503447..1503589,1503787..1503857,
FT                   1504420..1504527,1504665..1504768,1506193..1506273)
FT                   /codon_start=1
FT                   /gene="Orm3"
FT                   /locus_tag="mCG_7145"
FT                   /product="orosomucoid 3, isoform CRA_b"
FT                   /note="gene_id=mCG7145.1 transcript_id=mCT6026.0
FT                   protein_id=mCP20133.0 isoform=CRA_b"
FT                   /db_xref="GOA:J3JRU4"
FT                   /db_xref="InterPro:IPR000566"
FT                   /db_xref="InterPro:IPR001500"
FT                   /db_xref="InterPro:IPR011038"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="MGI:MGI:97445"
FT                   /db_xref="UniProtKB/TrEMBL:J3JRU4"
FT                   /protein_id="EDL31109.1"
FT                   /translation="MELHTVLIMLSLLPLLEAQNPEHAINIGDPITNETLSWLSGKWFL
FT                   IAVADSDPDYRQEIQKVQTIFFYLTLNLINDTMELREYHTKDDHCVYNSNLLGFQRENG
FT                   TLFKYEGEVETLLHLRVLEKHGAIMLFFDLKDEKKRGLSLSARRPDIPPELREVFQKAV
FT                   THVGMDESEIIFVDWKKDRCSEQEKKHLELEKETKKDPEESQA"
FT   CDS             join(<1503361..1503515,1503787..1503863,1504420..1504527,
FT                   1504665..1504768,1506193..1506273)
FT                   /codon_start=1
FT                   /gene="Orm3"
FT                   /locus_tag="mCG_7145"
FT                   /product="orosomucoid 3, isoform CRA_a"
FT                   /note="gene_id=mCG7145.1 transcript_id=mCT180965.0
FT                   protein_id=mCP103887.0 isoform=CRA_a"
FT                   /protein_id="EDL31108.1"
FT                   /translation="AIACLPLIVDECQGPHYKACSSVCLLLPSYLANGFSLLWLTQTLI
FT                   IGRKFKRDDHCVYNSNLLGFQRENGTLFKYGEEGEVETLLHLRVLEKHGAIMLFFDLKD
FT                   EKKRGLSLSARRPDIPPELREVFQKAVTHVGMDESEIIFVDWKKDRCSEQEKKHLELEK
FT                   ETKKDPEESQA"
FT   assembly_gap    1507478..1507497
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1509436..1509455
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            1511859..1515245
FT                   /locus_tag="mCG_7132"
FT                   /note="gene_id=mCG7132.0"
FT   mRNA            join(1511859..1511977,1512318..1512460,1512668..1512738,
FT                   1513292..1513399,1513536..1513639,1515053..1515245)
FT                   /locus_tag="mCG_7132"
FT                   /product="mCG7132"
FT                   /note="gene_id=mCG7132.0 transcript_id=mCT6032.0 created on
FT                   08-OCT-2002"
FT   CDS             join(1511861..1511977,1512318..1512460,1512668..1512738,
FT                   1513292..1513399,1513536..1513639,1515053..1515133)
FT                   /codon_start=1
FT                   /locus_tag="mCG_7132"
FT                   /product="mCG7132"
FT                   /note="gene_id=mCG7132.0 transcript_id=mCT6032.0
FT                   protein_id=mCP20135.0"
FT                   /protein_id="EDL31106.1"
FT                   /translation="MALHMILVMVSLLPLLEAQNPEHVNITIGDPITNETLSWLSDKWF
FT                   FIGAAVLNPDYRQEIQKTQMVFFNLTPNLINDTMELREYHTIDDHCVYNSTHLGIQREN
FT                   GTLSKYVGGVKIFADLIVLKMHGAFMLAFDLKDEKKRGLSLNAKRPDITPELREVFQKA
FT                   VTHVGMDESEIIFVDWKKDRCSQQEKQQLELEKETKKDPEEGQA"
FT   gene            complement(1516548..1552724)
FT                   /locus_tag="mCG_127161"
FT                   /note="gene_id=mCG127161.1"
FT   mRNA            complement(join(1516548..1517663,1519849..1520029,
FT                   1520269..1520388,1521174..1521269,1522700..1522846,
FT                   1523374..1523489,1523734..1523907,1526206..1526368,
FT                   1527027..1527235,1527945..1528051,1528530..1528749,
FT                   1529263..1529463,1529574..1529737,1531103..1531304,
FT                   1531718..1531845,1533262..1533321,1535605..1535759,
FT                   1536372..1536528,1541503..1541577,1543957..1545005,
FT                   1547246..1547610,1552598..1552724))
FT                   /locus_tag="mCG_127161"
FT                   /product="mCG127161"
FT                   /note="gene_id=mCG127161.1 transcript_id=mCT128442.1
FT                   created on 08-JAN-2003"
FT   CDS             complement(join(1517423..1517663,1519849..1520029,
FT                   1520269..1520388,1521174..1521269,1522700..1522846,
FT                   1523374..1523489,1523734..1523907,1526206..1526368,
FT                   1527027..1527235,1527945..1528051,1528530..1528749,
FT                   1529263..1529463,1529574..1529737,1531103..1531304,
FT                   1531718..1531845,1533262..1533321,1535605..1535759,
FT                   1536372..1536528,1541503..1541577,1543957..1545005,
FT                   1547246..1547495))
FT                   /codon_start=1
FT                   /locus_tag="mCG_127161"
FT                   /product="mCG127161"
FT                   /note="gene_id=mCG127161.1 transcript_id=mCT128442.1
FT                   protein_id=mCP76331.1"
FT                   /protein_id="EDL31104.1"
FT                   /translation="MASSGAKAQWVGPSLGQGPRRRRWAWAEEQDTDGRRDQGWGNSQS
FT                   LPEAPSPELLEDFRRAQEHLPPLEWDPDMQDSEESSGEETEADDASSPEGSTVPLPWLS
FT                   RSNQQLDMSEEELDEASGRPEVDLAGESCTELECEDQGDSSPPPPGQGPAKGWVTFIKQ
FT                   GSNYRPSEHLEAQPSVEHSRTKSWSSGTVSLRQPSDSLGSTWEGDTEVPQPSILPKALP
FT                   QSPCHNFPHPGDRNGGDVAPATPTEFRDSLAAPAQNAECSAGTWGEETTSLPSSRPEDQ
FT                   TWKRTKTSPKPLPSRFTGSVSPLSTRLGAIKKVVPQHKQGATLAGHSSSQAPKYGRGRR
FT                   LNYPLPDFSKVGPRVRFPKDENYRPPKSRGHNRQQGSTRPLIFKSPAEIVRDVLLSSGE
FT                   ASLAKESSLAHTITRVPQEFQTPEQATELVHQLQEDYHKLLTKYAEAENTIDQLRLGAK
FT                   VHLYSDPPQPSQSFCSGSMPQGSKVLSFSIPQPRVAEWWPDPAQDPQASEATGWPFPRT
FT                   DLSPSSSPGVATPGRLPQSQGIATDQPSTGQTQALTSQASRLLAKVQSFEELVLAGHLP
FT                   PQDQIKSLEQLRAAHMALEAEYLQACREELLDPQLDASQGSPRTLNLCRELEAEIYHLG
FT                   QRLEELQDHMDQTQRETEPCRPDLQDSTPTMSFLPQSAHLSMPSGPVSLPDGQTYQEPA
FT                   TTTTTSPGSSCTLPINKKLSLSIKTEESPRGLPVPLRDRTLQVEQDFHGLLERYLSVKS
FT                   LPEALRDEDEDDLEEEEEEQDHQGPLEVDSPATAPGKTEAVRVPPGERPTQAEESHRDA
FT                   TQEDEEQMGPMKSPDFRPSMARDTYTPVLDTAEVAQRGTKAMVSHQSSLTSLEESRPSE
FT                   LLPRKALLRAGGPHTEEPWMVSPETDSGFVGSETSIVSPFTQTPEHRLSHVSTSGPSAQ
FT                   HLTASVPGDRTSHPKARGLMVPRRATETGIPRSRTQQHFSSLSSPGRGAQSCHLEETSV
FT                   AKIAVPRSEFKRQKQISKQLLPSGRTSPDSAPAPTAASTPHGSAESTANLLLNRTERDQ
FT                   AIKDLQAEVSRLRLQLEDSLHRPHPDGPACVASAFNHSTQTQEKLGSSPSWGPHYGSKS
FT                   TERLSREPNGVEPAEPMGRRRARSSSVPRDVPRLYLSSESESPAPRLSSEKSRTFEEHP
FT                   EAAQWGTRPQSSSKRRERVSFRGQYTGQEYHILSPKAILKDSGTPSCPHCHPIRTQDTG
FT                   SAVSRDTTRGSSAADTLRCALCGEVKSSAEADGSSSGPSEKNTPKKPSTPILKRKNRQT
FT                   GSPVRMAPGLWYLAAAPPAPAPPALAYISSAPIMPYLPPTVYYAAPAPTSAQTASPQPA
FT                   RGPRRTRHSVQLGLNDLEELQAALREAAQAAENVRSTTRQLSRSLSADLRHARSLRGSC
FT                   LF"
FT   gene            <1530732..1543387
FT                   /gene="4933437N03Rik"
FT                   /locus_tag="mCG_146035"
FT                   /note="gene_id=mCG146035.0"
FT   mRNA            join(<1530732..1531108,1534686..1535123,1543100..1543387)
FT                   /gene="4933437N03Rik"
FT                   /locus_tag="mCG_146035"
FT                   /product="RIKEN cDNA 4933437N03"
FT                   /note="gene_id=mCG146035.0 transcript_id=mCT186143.0
FT                   created on 04-JUL-2003"
FT   CDS             join(<1531085..1531108,1534686..1535078)
FT                   /codon_start=1
FT                   /gene="4933437N03Rik"
FT                   /locus_tag="mCG_146035"
FT                   /product="RIKEN cDNA 4933437N03"
FT                   /note="gene_id=mCG146035.0 transcript_id=mCT186143.0
FT                   protein_id=mCP107595.0"
FT                   /protein_id="EDL31105.1"
FT                   /translation="DGMKQYLLHGLIQNSKLALNSVIGLPPPLKCWRYSHESPVCEITG
FT                   SLILTCPKLLCALNSQPILPQTYPMSRSEQRNKWDSLSHALHLLSVPCLPKRKCYPRYR
FT                   TKNGGSGMLYCWTTEEAENTKETPKKSEGKEEHG"
FT   gene            complement(1564300..1645274)
FT                   /gene="Whrn"
FT                   /locus_tag="mCG_7137"
FT                   /note="gene_id=mCG7137.1"
FT   mRNA            complement(join(1564300..1565054,1565390..1565512,
FT                   1565800..1565981,1567476..1568010,1568810..1568881,
FT                   1575262..1575453,1578507..1578539,1581272..1581481,
FT                   1582087..1582299,1583532..1583568,1584782..1584984,
FT                   1610912..1611037,1622331..1622549,1644311..1644805,
FT                   1644988..1645274))
FT                   /gene="Whrn"
FT                   /locus_tag="mCG_7137"
FT                   /product="whirlin, transcript variant mCT6029"
FT                   /note="gene_id=mCG7137.1 transcript_id=mCT6029.2 created on
FT                   30-OCT-2002"
FT   mRNA            complement(join(1564303..1565054,1565390..1565512,
FT                   1565800..1565978,1567476..1568010,1568810..1568881,
FT                   1581272..1581481,1582087..1582299,1583532..1583568,
FT                   1584782..1584984,1610912..1611037,1622331..1622549,
FT                   1644311..>1644820))
FT                   /gene="Whrn"
FT                   /locus_tag="mCG_7137"
FT                   /product="whirlin, transcript variant mCT192830"
FT                   /note="gene_id=mCG7137.1 transcript_id=mCT192830.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(1564872..1565054,1565390..1565512,
FT                   1565800..1565978,1567476..1568010,1568810..1568881,
FT                   1581272..1581481,1582087..1582299,1583532..1583568,
FT                   1584782..1584984,1610912..1611037,1622331..1622549,
FT                   1644311..>1644820))
FT                   /codon_start=1
FT                   /gene="Whrn"
FT                   /locus_tag="mCG_7137"
FT                   /product="whirlin, isoform CRA_a"
FT                   /note="gene_id=mCG7137.1 transcript_id=mCT192830.0
FT                   protein_id=mCP113823.0 isoform=CRA_a"
FT                   /protein_id="EDL31102.1"
FT                   /translation="ANVRQLHQALTALLSEPEREQFTHCLNAYHARRNVFDLVRTLRVL
FT                   LDSPVKRRLLPMLRLVIPRSDQLLFDQYTAEGLYLPATTPYRQPAWAAPDGAGPGEVRL
FT                   VSLRRAKAHEGLGFSIRGGSEHGVGIYVSLVEPGSLAEKEGLRVGDQILRVNDKSLARV
FT                   THAEAVKALKGSKKLVLSVYSAGRIPGGYVTNHIYTWVDPQGRSTSPPSSLPQPHGSTL
FT                   RQREDDRRSTLHLLQSGDEKKVNLVLGDGRSLGLTIRGGAEYGLGIYITGVDPGSEAES
FT                   SGLKVGDQILEVNGRSFLNILHDEAVKLLKSSRHLILTVKDVGRLPHARTTVDQTKWIA
FT                   SSRIGESVANSAGFPGDHTEEGTSKPGFYKGPAGSQVTLSSLGNQTRALLDDQARHLLT
FT                   EQERATMMYYLAQYRGGTISVEAMVMALFELLNTHAKFSLLSEVRSIISPQDLDRFDHL
FT                   VLRREIESMKARQPPGPGVGDTYSMVSYSDTGSSTGSHGTSTTVSSARNTLDLEGTGET
FT                   TQGSTNALPDVSVDDVKSPSEDLPGIKPPPPPPPLAQGHDRLLGQPRKPGREDPAPLSS
FT                   AAHSGIVFSAPRNRSPPPGTAPTPGPSSAQDSPSSPIYASISHANPSSRKPLDTHLALV
FT                   NQHPIGPFPRVQSPPHLKSPPAETPGAGACLPPPSPSEHPDAVGANQHFVLVEVHRPDS
FT                   EPDVNEVRALPQTRTSTLSQLSDSGQTLSEDSGVDAGETEASTSGRGRQTASAKNKNGK
FT                   EQPRTERTAEGANKPPGLLEPTSTLVRVRKSAATLGIAIEGGANTRQPLPRIVTIQRGG
FT                   SAHNCGQLKVGHVILEVNGQTLRGKEHKEAARIIAEAFKTKERDYIDFLVTEFNVML"
FT   CDS             complement(join(1564872..1565054,1565390..1565512,
FT                   1565800..1565981,1567476..1568010,1568810..1568881,
FT                   1575262..1575453,1578507..1578539,1581272..1581481,
FT                   1582087..1582299,1583532..1583568,1584782..1584984,
FT                   1610912..1611037,1622331..1622549,1644311..1644652))
FT                   /codon_start=1
FT                   /gene="Whrn"
FT                   /locus_tag="mCG_7137"
FT                   /product="whirlin, isoform CRA_b"
FT                   /note="gene_id=mCG7137.1 transcript_id=mCT6029.2
FT                   protein_id=mCP20134.2 isoform=CRA_b"
FT                   /protein_id="EDL31103.1"
FT                   /translation="MLRLVIPRSDQLLFDQYTAEGLYLPATTPYRQPAWAAPDGAGPGE
FT                   VRLVSLRRAKAHEGLGFSIRGGSEHGVGIYVSLVEPGSLAEKEGLRVGDQILRVNDKSL
FT                   ARVTHAEAVKALKGSKKLVLSVYSAGRIPGGYVTNHIYTWVDPQGRSTSPPSSLPQPHG
FT                   STLRQREDDRRSTLHLLQSGDEKKVNLVLGDGRSLGLTIRGGAEYGLGIYITGVDPGSE
FT                   AESSGLKVGDQILEVNGRSFLNILHDEAVKLLKSSRHLILTVKDVGRLPHARTTVDQTK
FT                   WIASSRIGESVANSAGFPGDHTEEGTSKPGFYKGPAGSQVTLSSLGNQTRALLDDQARH
FT                   LLTEQERATMMYYLAQYRGGTISVEAMVMALFELLNTHAKFSLLSEVRSIISPQDLDRF
FT                   DHLVLRREIESMKARQPPGPGVGDTYSMVSYSDTGSSTGSHGTSTTVSSARERLLWLID
FT                   LMEISLPGLKHPSHVWSGVLWLLRVLGWHPTLKATLYSSFPQGSKREAPSIVAAVLPWP
FT                   EPPFPLWQNTLDLEGTGETTQGSTNALPDVSVDDVKSPSEDLPGIKPPPPPPPLAQGHD
FT                   RLLGQPRKPGREDPAPLSSAAHSGIVFSAPRNRSPPPGTAPTPGPSSAQDSPSSPIYAS
FT                   ISHANPSSRKPLDTHLALVNQHPIGPFPRVQSPPHLKSPPAETPGAGACLPPPSPSEHP
FT                   DAVGANQHFVLVEVHRPDSEPDVNEVRALPQTRTASTLSQLSDSGQTLSEDSGVDAGET
FT                   EASTSGRGRQTASAKNKNGKEQPRTERTAEGANKPPGLLEPTSTLVRVRKSAATLGIAI
FT                   EGGANTRQPLPRIVTIQRGGSAHNCGQLKVGHVILEVNGQTLRGKEHKEAARIIAEAFK
FT                   TKERDYIDFLVTEFNVML"
FT   assembly_gap    1616410..1617453
FT                   /estimated_length=1044
FT                   /gap_type="unknown"
FT   assembly_gap    1643922..1643941
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1646533..1646552
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1649128..1651668
FT                   /estimated_length=2541
FT                   /gap_type="unknown"
FT   assembly_gap    1685416..1685435
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <1694871..1700757
FT                   /locus_tag="mCG_20078"
FT                   /note="gene_id=mCG20078.2"
FT   mRNA            join(<1694871..1694910,1700001..1700757)
FT                   /locus_tag="mCG_20078"
FT                   /product="mCG20078, transcript variant mCT186475"
FT                   /note="gene_id=mCG20078.2 transcript_id=mCT186475.0 created
FT                   on 23-JUN-2003"
FT   mRNA            join(1694879..1695334,1698637..1698737,1700001..1700152)
FT                   /locus_tag="mCG_20078"
FT                   /product="mCG20078, transcript variant mCT180748"
FT                   /note="gene_id=mCG20078.2 transcript_id=mCT180748.0 created
FT                   on 23-JUN-2003"
FT   mRNA            join(1694880..1695047,1698637..1698715,1700046..1700174)
FT                   /locus_tag="mCG_20078"
FT                   /product="mCG20078, transcript variant mCT180749"
FT                   /note="gene_id=mCG20078.2 transcript_id=mCT180749.0 created
FT                   on 23-JUN-2003"
FT   mRNA            join(1694883..1695047,1698637..1698737,1700001..1700757)
FT                   /locus_tag="mCG_20078"
FT                   /product="mCG20078, transcript variant mCT18764"
FT                   /note="gene_id=mCG20078.2 transcript_id=mCT18764.1 created
FT                   on 23-JUN-2003"
FT   CDS             join(<1694896..1694910,1700001..1700174)
FT                   /codon_start=1
FT                   /locus_tag="mCG_20078"
FT                   /product="mCG20078, isoform CRA_c"
FT                   /note="gene_id=mCG20078.2 transcript_id=mCT186475.0
FT                   protein_id=mCP107179.0 isoform=CRA_c"
FT                   /protein_id="EDL31100.1"
FT                   /translation="SEGLRALGSHGSCSSEVEKETREKMTVLQNYFEQNRDEVLDNLLA
FT                   FVCDIRPEIHENYRING"
FT   CDS             join(1694966..1695047,1698637..1698737,1700001..1700174)
FT                   /codon_start=1
FT                   /locus_tag="mCG_20078"
FT                   /product="mCG20078, isoform CRA_d"
FT                   /note="gene_id=mCG20078.2 transcript_id=mCT18764.1
FT                   protein_id=mCP20140.2 isoform=CRA_d"
FT                   /db_xref="GOA:Q5HZY7"
FT                   /db_xref="InterPro:IPR005124"
FT                   /db_xref="MGI:MGI:1913540"
FT                   /db_xref="UniProtKB/TrEMBL:Q5HZY7"
FT                   /protein_id="EDL31101.1"
FT                   /translation="MASQSQGIQQLLQAEKRAAEKVSEARKRKNRRLKQAKEEAQAEIE
FT                   QYRLQREKEFKAKEAAALGSHGSCSSEVEKETREKMTVLQNYFEQNRDEVLDNLLAFVC
FT                   DIRPEIHENYRING"
FT   CDS             join(1694966..1695047,1698637..1698715,1700046..1700061)
FT                   /codon_start=1
FT                   /locus_tag="mCG_20078"
FT                   /product="mCG20078, isoform CRA_b"
FT                   /note="gene_id=mCG20078.2 transcript_id=mCT180749.0
FT                   protein_id=mCP103670.0 isoform=CRA_b"
FT                   /protein_id="EDL31099.1"
FT                   /translation="MASQSQGIQQLLQAEKRAAEKVSEARKRKNRRLKQAKEEAQAEIE
FT                   QYRLQREKEPGRR"
FT   CDS             1694966..1695076
FT                   /codon_start=1
FT                   /locus_tag="mCG_20078"
FT                   /product="mCG20078, isoform CRA_a"
FT                   /note="gene_id=mCG20078.2 transcript_id=mCT180748.0
FT                   protein_id=mCP103671.0 isoform=CRA_a"
FT                   /protein_id="EDL31098.1"
FT                   /translation="MASQSQGIQQLLQAEKRAAEKVSEARKRELRDGAGC"
FT   gene            1708860..1734866
FT                   /gene="6330416G13Rik"
FT                   /locus_tag="mCG_20079"
FT                   /note="gene_id=mCG20079.2"
FT   mRNA            join(1708860..1709001,1710956..1711039,1712484..1712675,
FT                   1715701..1715810,1718507..1718614,1719990..1720139,
FT                   1727851..1727961,1729983..1730063,1730343..1730522,
FT                   1733836..1734866)
FT                   /gene="6330416G13Rik"
FT                   /locus_tag="mCG_20079"
FT                   /product="RIKEN cDNA 6330416G13, transcript variant
FT                   mCT175180"
FT                   /note="gene_id=mCG20079.2 transcript_id=mCT175180.0 created
FT                   on 30-OCT-2002"
FT   mRNA            join(1710271..1710449,1710926..1711039,1712484..1712675,
FT                   1715701..1715810,1718507..1718614,1719990..1720139,
FT                   1727851..1727961,1729983..1730063,1730343..1730522,
FT                   1733836..1734866)
FT                   /gene="6330416G13Rik"
FT                   /locus_tag="mCG_20079"
FT                   /product="RIKEN cDNA 6330416G13, transcript variant
FT                   mCT18765"
FT                   /note="gene_id=mCG20079.2 transcript_id=mCT18765.2 created
FT                   on 30-OCT-2002"
FT   CDS             join(1712567..1712675,1715701..1715810,1718507..1718614,
FT                   1719990..1720139,1727851..1727961,1729983..1730063,
FT                   1730343..1730522,1733836..1734015)
FT                   /codon_start=1
FT                   /gene="6330416G13Rik"
FT                   /locus_tag="mCG_20079"
FT                   /product="RIKEN cDNA 6330416G13, isoform CRA_a"
FT                   /note="gene_id=mCG20079.2 transcript_id=mCT175180.0
FT                   protein_id=mCP98099.0 isoform=CRA_a"
FT                   /protein_id="EDL31096.1"
FT                   /translation="MACEPPTDPGGAAGPLPTSTLGCNILPQGNPPGWGQELHNGQVLT
FT                   VLRIDNTCAPISFDLGAAEEQLQAWGIQVPAEQYRNLAESALLEPQVRRYIIYNSRPMR
FT                   LAFAVVFYVLVWANIYSTSQMFALGNQWAGVLLATLAAFSLTLTLVLVFERQQRKANTN
FT                   TDLRLVAANGALLRHRVLLGVTDTVEGCQSVIQLWFVYFDLENCVQFLSDHVQEMKRSQ
FT                   ESLLRSRLSQLCVVMETGVSPVVEGPEDLEDAPLLPSTPGPQERPLTQTELYQLVPEAE
FT                   PEEMARQLLAVFGGYYTRLLVTSRLPQSMGTRHMDSARIPCPCQLIEVHVLGTGCCPFL
FT                   AR"
FT   CDS             join(1712567..1712675,1715701..1715810,1718507..1718614,
FT                   1719990..1720139,1727851..1727961,1729983..1730063,
FT                   1730343..1730522,1733836..1734015)
FT                   /codon_start=1
FT                   /gene="6330416G13Rik"
FT                   /locus_tag="mCG_20079"
FT                   /product="RIKEN cDNA 6330416G13, isoform CRA_a"
FT                   /note="gene_id=mCG20079.2 transcript_id=mCT18765.2
FT                   protein_id=mCP20144.2 isoform=CRA_a"
FT                   /protein_id="EDL31097.1"
FT                   /translation="MACEPPTDPGGAAGPLPTSTLGCNILPQGNPPGWGQELHNGQVLT
FT                   VLRIDNTCAPISFDLGAAEEQLQAWGIQVPAEQYRNLAESALLEPQVRRYIIYNSRPMR
FT                   LAFAVVFYVLVWANIYSTSQMFALGNQWAGVLLATLAAFSLTLTLVLVFERQQRKANTN
FT                   TDLRLVAANGALLRHRVLLGVTDTVEGCQSVIQLWFVYFDLENCVQFLSDHVQEMKRSQ
FT                   ESLLRSRLSQLCVVMETGVSPVVEGPEDLEDAPLLPSTPGPQERPLTQTELYQLVPEAE
FT                   PEEMARQLLAVFGGYYTRLLVTSRLPQSMGTRHMDSARIPCPCQLIEVHVLGTGCCPFL
FT                   AR"
FT   assembly_gap    1743535..1743624
FT                   /estimated_length=90
FT                   /gap_type="unknown"
FT   assembly_gap    1752009..1753524
FT                   /estimated_length=1516
FT                   /gap_type="unknown"
FT   gene            complement(1757037..>1772366)
FT                   /gene="1700018C11Rik"
FT                   /locus_tag="mCG_145492"
FT                   /note="gene_id=mCG145492.1"
FT   mRNA            complement(join(1757037..1757361,1758403..1758513,
FT                   1761827..1761940,1762408..1762504,1772342..>1772366))
FT                   /gene="1700018C11Rik"
FT                   /locus_tag="mCG_145492"
FT                   /product="RIKEN cDNA 1700018C11, transcript variant
FT                   mCT192838"
FT                   /note="gene_id=mCG145492.1 transcript_id=mCT192838.0
FT                   created on 09-MAR-2004"
FT   mRNA            complement(join(1757037..1757361,1758403..1758513,
FT                   1761827..1761940,1762408..1762504,1772325..>1772351))
FT                   /gene="1700018C11Rik"
FT                   /locus_tag="mCG_145492"
FT                   /product="RIKEN cDNA 1700018C11, transcript variant
FT                   mCT184916"
FT                   /note="gene_id=mCG145492.1 transcript_id=mCT184916.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(1757258..1757361,1758403..1758513,
FT                   1761827..1761940,1762408..>1762429))
FT                   /codon_start=1
FT                   /gene="1700018C11Rik"
FT                   /locus_tag="mCG_145492"
FT                   /product="RIKEN cDNA 1700018C11, isoform CRA_a"
FT                   /note="gene_id=mCG145492.1 transcript_id=mCT184916.0
FT                   protein_id=mCP105845.0 isoform=CRA_a"
FT                   /protein_id="EDL31094.1"
FT                   /translation="NLHFFSMAAHQTLASKIFSLCCWDCEEPVIESAKVPSQESQTPTY
FT                   NSLKTEKSELCEQNLKRATAQSVVGQEKHSTASSDYEELTAYNIQTGYPKRNLNRYYQE
FT                   HWALRPCLIGRP"
FT   CDS             complement(join(1757258..1757361,1758403..1758513,
FT                   1761827..1761940,1762408..>1762429))
FT                   /codon_start=1
FT                   /gene="1700018C11Rik"
FT                   /locus_tag="mCG_145492"
FT                   /product="RIKEN cDNA 1700018C11, isoform CRA_a"
FT                   /note="gene_id=mCG145492.1 transcript_id=mCT192838.0
FT                   protein_id=mCP113791.0 isoform=CRA_a"
FT                   /protein_id="EDL31095.1"
FT                   /translation="NLHFFSMAAHQTLASKIFSLCCWDCEEPVIESAKVPSQESQTPTY
FT                   NSLKTEKSELCEQNLKRATAQSVVGQEKHSTASSDYEELTAYNIQTGYPKRNLNRYYQE
FT                   HWALRPCLIGRP"
FT   assembly_gap    1760924..1760943
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <1784332..1789391
FT                   /locus_tag="mCG_145483"
FT                   /note="gene_id=mCG145483.0"
FT   mRNA            join(<1784332..1784392,1786462..1786613,1786909..1787013,
FT                   1788951..1789391)
FT                   /locus_tag="mCG_145483"
FT                   /product="mCG145483"
FT                   /note="gene_id=mCG145483.0 transcript_id=mCT184907.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<1784354..1784392,1786462..1786613,1786909..1786933)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145483"
FT                   /product="mCG145483"
FT                   /note="gene_id=mCG145483.0 transcript_id=mCT184907.0
FT                   protein_id=mCP105836.0"
FT                   /protein_id="EDL31093.1"
FT                   /translation="TILHNLGPIACWERACCCWVIHGAMLWWTVTPQEHLASDTCWSWL
FT                   YCSSLQNHGWEERTSYGVGQLPASLI"
FT   assembly_gap    1796353..1800796
FT                   /estimated_length=4444
FT                   /gap_type="unknown"
FT   assembly_gap    1808711..1810429
FT                   /estimated_length=1719
FT                   /gap_type="unknown"
FT   assembly_gap    1811936..1812057
FT                   /estimated_length=122
FT                   /gap_type="unknown"
FT   assembly_gap    1815412..1815760
FT                   /estimated_length=349
FT                   /gap_type="unknown"
FT   assembly_gap    1830520..1830539
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1856415..1856498
FT                   /estimated_length=84
FT                   /gap_type="unknown"
FT   assembly_gap    1859899..1859923
FT                   /estimated_length=25
FT                   /gap_type="unknown"
FT   gene            complement(<1880139..>1895526)
FT                   /gene="Tnfsf15"
FT                   /locus_tag="mCG_145489"
FT                   /note="gene_id=mCG145489.0"
FT   mRNA            complement(join(<1880139..1880593,1883827..1883865,
FT                   1884753..1884795,1895305..>1895526))
FT                   /gene="Tnfsf15"
FT                   /locus_tag="mCG_145489"
FT                   /product="tumor necrosis factor (ligand) superfamily,
FT                   member 15"
FT                   /note="gene_id=mCG145489.0 transcript_id=mCT184913.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(1880139..1880593,1883827..1883865,
FT                   1884753..1884795,1895305..1895526))
FT                   /codon_start=1
FT                   /gene="Tnfsf15"
FT                   /locus_tag="mCG_145489"
FT                   /product="tumor necrosis factor (ligand) superfamily,
FT                   member 15"
FT                   /note="gene_id=mCG145489.0 transcript_id=mCT184913.0
FT                   protein_id=mCP105842.0"
FT                   /db_xref="GOA:B2RR33"
FT                   /db_xref="InterPro:IPR006052"
FT                   /db_xref="InterPro:IPR006053"
FT                   /db_xref="InterPro:IPR008064"
FT                   /db_xref="InterPro:IPR008983"
FT                   /db_xref="MGI:MGI:2180140"
FT                   /db_xref="UniProtKB/TrEMBL:B2RR33"
FT                   /protein_id="EDL31092.1"
FT                   /translation="MAEELGLGFGEGVPVEVLPEGCRHRPEARAGLAARSKACLALTCC
FT                   LLSFPILAGLSTLLMAGQLRVPGKDCMLRAITEERSEPSPQQVYSPPRGKPRAHLTIKK
FT                   QTPAPHLKNQLSALHWEHDLGMAFTKNGMKYINKSLVIPESGDYFIYSQITFRGTTSVC
FT                   GDISRGRRPNKPDSITMVITKVADSYPEPARLLTGSKSVCEISNNWFQSLYLGATFSLE
FT                   EGDRLMVNVSDISLVDYTKEDKTFFGAFLL"
FT   assembly_gap    1881360..1881890
FT                   /estimated_length=531
FT                   /gap_type="unknown"
FT   assembly_gap    1900041..1900609
FT                   /estimated_length=569
FT                   /gap_type="unknown"
FT   assembly_gap    1917663..1917768
FT                   /estimated_length=106
FT                   /gap_type="unknown"
FT   assembly_gap    1919725..1919744
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1940922..1940941
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1952859..1952986
FT                   /estimated_length=128
FT                   /gap_type="unknown"
FT   gene            complement(1983532..2011502)
FT                   /gene="Tnfsf8"
FT                   /locus_tag="mCG_20076"
FT                   /note="gene_id=mCG20076.1"
FT   mRNA            complement(join(1983532..1984862,1987420..1987491,
FT                   2001443..2001485,2011181..2011502))
FT                   /gene="Tnfsf8"
FT                   /locus_tag="mCG_20076"
FT                   /product="tumor necrosis factor (ligand) superfamily,
FT                   member 8"
FT                   /note="gene_id=mCG20076.1 transcript_id=mCT18762.1 created
FT                   on 08-OCT-2002"
FT   CDS             complement(join(1984468..1984862,1987420..1987491,
FT                   2001443..2001485,2011181..2011390))
FT                   /codon_start=1
FT                   /gene="Tnfsf8"
FT                   /locus_tag="mCG_20076"
FT                   /product="tumor necrosis factor (ligand) superfamily,
FT                   member 8"
FT                   /note="gene_id=mCG20076.1 transcript_id=mCT18762.1
FT                   protein_id=mCP20130.1"
FT                   /db_xref="GOA:Q544U1"
FT                   /db_xref="InterPro:IPR006052"
FT                   /db_xref="InterPro:IPR008983"
FT                   /db_xref="InterPro:IPR021184"
FT                   /db_xref="InterPro:IPR021185"
FT                   /db_xref="MGI:MGI:88328"
FT                   /db_xref="UniProtKB/TrEMBL:Q544U1"
FT                   /protein_id="EDL31091.1"
FT                   /translation="MEPGLQQAGSCGAPSPDPAMQVQPGSVASPWRSTRPWRSTSRSYF
FT                   YLSTTALVCLVVAVAIILVLVVQKKDSTPNTTEKAPLKGGNCSEDLFCTLKSTPSKKSW
FT                   AYLQVSKHLNNTKLSWNEDGTIHGLIYQDGNLIVQFPGLYFIVCQLQFLVQCSNHSVDL
FT                   TLQLLINSKIKKQTLVTVCESGVQSKNIYQNLSQFLLHYLQVNSTISVRVDNFQYVDTN
FT                   TFPLDNVLSVFLYSSSD"
FT   assembly_gap    1998282..1998301
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2041948..2042029
FT                   /estimated_length=82
FT                   /gap_type="unknown"
FT   assembly_gap    2044423..2044442
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<2045911..>2046465)
FT                   /locus_tag="mCG_50909"
FT                   /note="gene_id=mCG50909.0"
FT   mRNA            complement(<2045911..>2046465)
FT                   /locus_tag="mCG_50909"
FT                   /product="mCG50909"
FT                   /note="gene_id=mCG50909.0 transcript_id=mCT51092.0 created
FT                   on 20-FEB-2003"
FT   CDS             complement(2045911..2046465)
FT                   /codon_start=1
FT                   /locus_tag="mCG_50909"
FT                   /product="mCG50909"
FT                   /note="gene_id=mCG50909.0 transcript_id=mCT51092.0
FT                   protein_id=mCP40319.0"
FT                   /protein_id="EDL31090.1"
FT                   /translation="MVRYSLDPENPTKSCKSRGSNLHVHFKNTRETAQAIKGMHIRKAT
FT                   KYLKDVTLKKQCVPFRRYNGGVGRCAQAKQWGWTQGRWPKKSAEFLLHMLKNAESNAEL
FT                   KGLDVDSLVIEHIQVNKAPKMRRRTYRAHGRINPYMSSPSHTEMILTEREQIIPKPEEE
FT                   VAQKKKISQKKLKKQKLMARE"
FT   assembly_gap    2055282..2055513
FT                   /estimated_length=232
FT                   /gap_type="unknown"
FT   assembly_gap    2071618..2071829
FT                   /estimated_length=212
FT                   /gap_type="unknown"
FT   assembly_gap    2073277..2073344
FT                   /estimated_length=68
FT                   /gap_type="unknown"
FT   gene            complement(2110364..2197419)
FT                   /gene="Tnc"
FT                   /locus_tag="mCG_20077"
FT                   /note="gene_id=mCG20077.2"
FT   mRNA            complement(join(2110364..2111119,2112570..2112733,
FT                   2115181..2115342,2116167..2116263,2117094..2117245,
FT                   2117800..2117932,2120897..2121027,2121741..2121884,
FT                   2123261..2123380,2125785..2125928,2127029..2127151,
FT                   2133236..2133508,2143612..2143884,2146126..2146398,
FT                   2150491..2150763,2151276..2151548,2156850..2157113,
FT                   2157952..2158041,2158286..2158471,2159218..2159487,
FT                   2163672..2163828,2164533..2164648,2165499..2165762,
FT                   2167435..2168844,2170748..2171329,2197352..2197419))
FT                   /gene="Tnc"
FT                   /locus_tag="mCG_20077"
FT                   /product="tenascin C, transcript variant mCT18763"
FT                   /note="gene_id=mCG20077.2 transcript_id=mCT18763.1 created
FT                   on 08-OCT-2002"
FT   mRNA            complement(join(2110450..2111119,2112570..2112733,
FT                   2115181..2115342,2116167..2116263,2117094..2117245,
FT                   2117800..2117932,2120897..2121027,2121741..2121884,
FT                   2123261..2123380,2125785..2125928,2127029..2127151,
FT                   2156850..2157113,2157952..2158041,2158286..2158471,
FT                   2159218..2159487,2163672..2163828,2164533..2164648,
FT                   2165499..2165762,2167435..2168844,2170748..2171329,
FT                   2197352..2197419))
FT                   /gene="Tnc"
FT                   /locus_tag="mCG_20077"
FT                   /product="tenascin C, transcript variant mCT174254"
FT                   /note="gene_id=mCG20077.2 transcript_id=mCT174254.0 created
FT                   on 08-OCT-2002"
FT   CDS             complement(join(2111009..2111119,2112570..2112733,
FT                   2115181..2115342,2116167..2116263,2117094..2117245,
FT                   2117800..2117932,2120897..2121027,2121741..2121884,
FT                   2123261..2123380,2125785..2125928,2127029..2127151,
FT                   2156850..2157113,2157952..2158041,2158286..2158471,
FT                   2159218..2159487,2163672..2163828,2164533..2164648,
FT                   2165499..2165762,2167435..2168844,2170748..2171204))
FT                   /codon_start=1
FT                   /gene="Tnc"
FT                   /locus_tag="mCG_20077"
FT                   /product="tenascin C, isoform CRA_a"
FT                   /note="gene_id=mCG20077.2 transcript_id=mCT174254.0
FT                   protein_id=mCP97173.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q148T5"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR002181"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013032"
FT                   /db_xref="InterPro:IPR013111"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014715"
FT                   /db_xref="InterPro:IPR014716"
FT                   /db_xref="MGI:MGI:101922"
FT                   /db_xref="UniProtKB/TrEMBL:Q148T5"
FT                   /protein_id="EDL31088.1"
FT                   /translation="MGAVTWLLPGIFLALFALTPEGGVLKKIIRHKRESGLNMTLPEEN
FT                   QPVVFNHIYNIKLPMGSQCSVDLESASGEKDLTPTPESSGSFQEHTVDGENQIVFTHRI
FT                   NIPRRACGCAAAPDVKELLSRLEELELLVSSLREQCTMGTGCCLQPAEGRLDTRPFCSG
FT                   RGNFSAEGCGCVCEPGWKGPNCSEPDCPGNCNLRGQCLDGQCICDEGFTGEDCSQLACP
FT                   NDCNDQGRCVNGVCVCFEGYAGPDCGLEVCPVPCSEEHGMCVDGRCVCKDGFAGEDCNE
FT                   PLCLNNCYNRGRCVENECVCDEGFTGEDCSELICPNDCFDRGRCINGTCYCEEGFTGED
FT                   CGELTCPNDCQGRGQCEEGQCVCNEGFAGADCSEKRCPADCHHRGRCLNGQCECDDGFT
FT                   GADCGDLQCPNGCSGHGRCVNGQCVCDEGYTGEDCSQRRCPNDCHNRGLCVQGKCICEQ
FT                   GFKGFDCSEMSCPNDCHQHGRCVNGMCICDDDYTGEDCRDRRCPRDCSQRGRCVDGQCI
FT                   CEDGFTGPDCAELSCPSDCHGHGRCVNGQCICHEGFTGKDCKEQRCPSDCHGQGRCEDG
FT                   QCICHEGFTGLDCGQRSCPNDCSNQGQCVSGRCICNEGYTGIDCSEVSPPKDLIVTEVT
FT                   EETVNLAWDNEMRVTEYLIMYTPTHADGLEMQFRVPGDQTSTTIRELEPGVEYFIRVFA
FT                   ILENKRSIPVSARVATYLPAPEGLKFKSIKETSVEVEWDPLDIAFETWEIIFRNMNKED
FT                   EGEITKSLRRPETSYRQTGLAPGQEYEISLHIVKNNTRGPGLKKVTTTRLDAPSHIEVK
FT                   DVTDTTALITWFKPLAEIDSIELSYGIKDVPGDRTTIDLTHEDNQYSIGNLRPDTEYEV
FT                   SLISRRVDMASNPAKETFITGLDAPRNLRRVSQTDNSITLEWRNVKADIDSYRIKYAPI
FT                   SGGDHAEIDVPKSQQATTKTTLTGLRPGTEYGIGVSAVKGDKESDPATINAATEIDAPK
FT                   DLRVSETTQDSLTFFWTTPLAKFDRYRLNYSLPTGQSMEVQLPKDATSHVLTDLEPGQE
FT                   YTVLLIAEKGRHKSKPARVKASTAMGSPKEIMFSDITENAATVSWRAPTAQVESFRITY
FT                   VPMTGGAPSMVTVDGTDTETRLVKLTPGVEYRVSVIAMKGFEESDPVSGTLITALDGPS
FT                   GLLIANITDSEALAMWQPAIATVDSYVISYTGERVPEVTRTVSGNTVEYELHDLEPATE
FT                   YILSIFAEKGQQKSSTIATKFTTDLDSPREFTATEVQSETALLTWRPPRASVTGYLLVY
FT                   ESVDGTVKEVIVGPDTTSYSLADLSPSTHYSARIQALSGSLRSKLIQTIFTTIGLLYPF
FT                   PRDCSQAMLNGDTTSGLYTIYINGDKTQALEVYCDMTSDGGGWIVFLRRKNGREDFYRN
FT                   WKAYAAGFGDRREEFWLGLDNLSKITAQGQYELRVDLQDHGESAYAVYDRFSVGDAKSR
FT                   YKLKVEGYSGTAGDSMNYHNGRSFSTYDKDTDSAITNCALSYKGAFWYKNCHRVNLMGR
FT                   YGDNNHSQGVNWFHWKGHEYSIQFAEMKLRPSNFRNLEGRRKRA"
FT   CDS             complement(join(2111009..2111119,2112570..2112733,
FT                   2115181..2115342,2116167..2116263,2117094..2117245,
FT                   2117800..2117932,2120897..2121027,2121741..2121884,
FT                   2123261..2123380,2125785..2125928,2127029..2127151,
FT                   2133236..2133508,2143612..2143884,2146126..2146398,
FT                   2150491..2150763,2151276..2151548,2156850..2157113,
FT                   2157952..2158041,2158286..2158471,2159218..2159487,
FT                   2163672..2163828,2164533..2164648,2165499..2165762,
FT                   2167435..2168844,2170748..2171204))
FT                   /codon_start=1
FT                   /gene="Tnc"
FT                   /locus_tag="mCG_20077"
FT                   /product="tenascin C, isoform CRA_b"
FT                   /note="gene_id=mCG20077.2 transcript_id=mCT18763.1
FT                   protein_id=mCP20131.1 isoform=CRA_b"
FT                   /protein_id="EDL31089.1"
FT                   /translation="MGAVTWLLPGIFLALFALTPEGGVLKKIIRHKRESGLNMTLPEEN
FT                   QPVVFNHIYNIKLPMGSQCSVDLESASGEKDLTPTPESSGSFQEHTVDGENQIVFTHRI
FT                   NIPRRACGCAAAPDVKELLSRLEELELLVSSLREQCTMGTGCCLQPAEGRLDTRPFCSG
FT                   RGNFSAEGCGCVCEPGWKGPNCSEPDCPGNCNLRGQCLDGQCICDEGFTGEDCSQLACP
FT                   NDCNDQGRCVNGVCVCFEGYAGPDCGLEVCPVPCSEEHGMCVDGRCVCKDGFAGEDCNE
FT                   PLCLNNCYNRGRCVENECVCDEGFTGEDCSELICPNDCFDRGRCINGTCYCEEGFTGED
FT                   CGELTCPNDCQGRGQCEEGQCVCNEGFAGADCSEKRCPADCHHRGRCLNGQCECDDGFT
FT                   GADCGDLQCPNGCSGHGRCVNGQCVCDEGYTGEDCSQRRCPNDCHNRGLCVQGKCICEQ
FT                   GFKGFDCSEMSCPNDCHQHGRCVNGMCICDDDYTGEDCRDRRCPRDCSQRGRCVDGQCI
FT                   CEDGFTGPDCAELSCPSDCHGHGRCVNGQCICHEGFTGKDCKEQRCPSDCHGQGRCEDG
FT                   QCICHEGFTGLDCGQRSCPNDCSNQGQCVSGRCICNEGYTGIDCSEVSPPKDLIVTEVT
FT                   EETVNLAWDNEMRVTEYLIMYTPTHADGLEMQFRVPGDQTSTTIRELEPGVEYFIRVFA
FT                   ILENKRSIPVSARVATYLPAPEGLKFKSIKETSVEVEWDPLDIAFETWEIIFRNMNKED
FT                   EGEITKSLRRPETSYRQTGLAPGQEYEISLHIVKNNTRGPGLKKVTTTRLDAPSHIEVK
FT                   DVTDTTALITWFKPLAEIDSIELSYGIKDVPGDRTTIDLTHEDNQYSIGNLRPDTEYEV
FT                   SLISRRVDMASNPAKETFITGLDAPRNLRRVSQTDNSITLEWRNVKADIDSYRIKYAPI
FT                   SGGDHAEIDVPKSQQATTKTTLTGLRPGTEYGIGVSAVKGDKESDPATINAATEIDAPK
FT                   DLRVSETTQDSLTFFWTTPLAKFDRYRLNYSLPTGQSMEVQLPKDATSHVLTDLEPGQE
FT                   YTVLLIAEKGRHKSKPARVKASTEEVPSLENLTVTEAGWDGLRLNWTADDLAYEYFVIQ
FT                   VQEANNVETAHNFTVPGNLRAADIPGLKVATSYRVSIYGVARGYRTPVLSAETSTGTTP
FT                   NLGEVTVAEVGWDALTLNWTAPEGAYKNFFIQVLEADTTQTVQNLTVPGGLRSVDLPGL
FT                   KAATRYYITLRGVTQDFGTAPLSVEVLTEDLPQLGGLSVTEVSWDGLTLNWTTDDLAYK
FT                   HFVVQVQEANNVEAAQNLTVPGSLRAVDIPGLKADTPYRVSIYGVIQGYRTPMLSTDVS
FT                   TAREPEIGNLNVSDVTPKSFNLSWTATDGIFDMFTIEIIDSNRLLQTAEHNISGAERTA
FT                   HISGLPPSTDFIVYLSGIAPSIRTKTISTTATTEAEPEVDNLLVSDATPDGFRLSWTAD
FT                   EGIFDSFVIRIRDTKKQSEPQEISLPSPERTRDITGLREATEYEIELYGISRGRRSQPV
FT                   SAIATTAMGSPKEIMFSDITENAATVSWRAPTAQVESFRITYVPMTGGAPSMVTVDGTD
FT                   TETRLVKLTPGVEYRVSVIAMKGFEESDPVSGTLITALDGPSGLLIANITDSEALAMWQ
FT                   PAIATVDSYVISYTGERVPEVTRTVSGNTVEYELHDLEPATEYILSIFAEKGQQKSSTI
FT                   ATKFTTDLDSPREFTATEVQSETALLTWRPPRASVTGYLLVYESVDGTVKEVIVGPDTT
FT                   SYSLADLSPSTHYSARIQALSGSLRSKLIQTIFTTIGLLYPFPRDCSQAMLNGDTTSGL
FT                   YTIYINGDKTQALEVYCDMTSDGGGWIVFLRRKNGREDFYRNWKAYAAGFGDRREEFWL
FT                   GLDNLSKITAQGQYELRVDLQDHGESAYAVYDRFSVGDAKSRYKLKVEGYSGTAGDSMN
FT                   YHNGRSFSTYDKDTDSAITNCALSYKGAFWYKNCHRVNLMGRYGDNNHSQGVNWFHWKG
FT                   HEYSIQFAEMKLRPSNFRNLEGRRKRA"
FT   gene            <2130436..2301690
FT                   /gene="8030463A06Rik"
FT                   /locus_tag="mCG_144800"
FT                   /note="gene_id=mCG144800.0"
FT   mRNA            join(<2130436..2130572,2174580..2174677,2231483..2231588,
FT                   2273447..2273573,2299540..2301690)
FT                   /gene="8030463A06Rik"
FT                   /locus_tag="mCG_144800"
FT                   /product="RIKEN cDNA 8030463A06"
FT                   /note="gene_id=mCG144800.0 transcript_id=mCT184224.0
FT                   created on 05-JUN-2003"
FT   assembly_gap    2154608..2154627
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2183371..2183470
FT                   /estimated_length=100
FT                   /gap_type="unknown"
FT   assembly_gap    2190005..2190024
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2227822..2227841
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2229052..2229071
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2234415..2234434
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2245753..2245773
FT                   /estimated_length=21
FT                   /gap_type="unknown"
FT   assembly_gap    2264940..2264959
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             <2300280..2300711
FT                   /codon_start=1
FT                   /gene="8030463A06Rik"
FT                   /locus_tag="mCG_144800"
FT                   /product="RIKEN cDNA 8030463A06"
FT                   /note="gene_id=mCG144800.0 transcript_id=mCT184224.0
FT                   protein_id=mCP105827.0"
FT                   /protein_id="EDL31087.1"
FT                   /translation="LFVLSSQHSSALSMGWGKWVQSFYNLIGHISMKAELKRKHYFIYF
FT                   NYYKIFRRELGILDLCFAYSSCFLKNRKIMFNNANIVFSCAMEASSVCVYLNKRKEAGS
FT                   KIMFWSLPKTSLFFPPSLQSLKVLKAVVISFHTSFLNAK"
FT   assembly_gap    2307132..2307193
FT                   /estimated_length=62
FT                   /gap_type="unknown"
FT   assembly_gap    2310308..2310339
FT                   /estimated_length=32
FT                   /gap_type="unknown"
FT   assembly_gap    2342823..2343017
FT                   /estimated_length=195
FT                   /gap_type="unknown"
FT   assembly_gap    2349069..2349511
FT                   /estimated_length=443
FT                   /gap_type="unknown"
FT   assembly_gap    2350896..2351132
FT                   /estimated_length=237
FT                   /gap_type="unknown"
FT   assembly_gap    2366349..2366494
FT                   /estimated_length=146
FT                   /gap_type="unknown"
FT   assembly_gap    2391760..2391894
FT                   /estimated_length=135
FT                   /gap_type="unknown"
FT   assembly_gap    2393826..2393845
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(2403399..2428092)
FT                   /locus_tag="mCG_148063"
FT                   /note="gene_id=mCG148063.0"
FT   mRNA            complement(join(2403399..2403418,2405770..2405799,
FT                   2405830..2407114,2408842..2409026,2426619..2426692,
FT                   2428039..2428092))
FT                   /locus_tag="mCG_148063"
FT                   /product="mCG148063"
FT                   /note="gene_id=mCG148063.0 transcript_id=mCT188326.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(2405890..2406045)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148063"
FT                   /product="mCG148063"
FT                   /note="gene_id=mCG148063.0 transcript_id=mCT188326.0
FT                   protein_id=mCP109405.0"
FT                   /protein_id="EDL31086.1"
FT                   /translation="MHEDSRQNPRTHIVARYGSMCGPETGGKEICESHSPPCLNKVSSR
FT                   FSGTCS"
FT   assembly_gap    2409521..2409540
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2418377..2418396
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2438931..2445145
FT                   /estimated_length=6215
FT                   /gap_type="unknown"
FT   assembly_gap    2471597..2471616
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2494290..2494395
FT                   /estimated_length=106
FT                   /gap_type="unknown"
FT   assembly_gap    2502301..2502891
FT                   /estimated_length=591
FT                   /gap_type="unknown"
FT   assembly_gap    2505919..2508441
FT                   /estimated_length=2523
FT                   /gap_type="unknown"
FT   assembly_gap    2510896..2516157
FT                   /estimated_length=5262
FT                   /gap_type="unknown"
FT   assembly_gap    2549816..2549835
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2596796..2596815
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2617621..2618990
FT                   /estimated_length=1370
FT                   /gap_type="unknown"
FT   assembly_gap    2696540..2696559
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2710217..2710236
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2749074..2749366
FT                   /estimated_length=293
FT                   /gap_type="unknown"
FT   assembly_gap    2763106..2763125
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2778939..2778958
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2784536..2784687
FT                   /estimated_length=152
FT                   /gap_type="unknown"
FT   assembly_gap    2827757..2833305
FT                   /estimated_length=5549
FT                   /gap_type="unknown"
FT   assembly_gap    2842777..2843280
FT                   /estimated_length=504
FT                   /gap_type="unknown"
FT   assembly_gap    2845107..2846380
FT                   /estimated_length=1274
FT                   /gap_type="unknown"
FT   assembly_gap    2882097..2882595
FT                   /estimated_length=499
FT                   /gap_type="unknown"
FT   assembly_gap    2899220..2899239
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2928885..2928914
FT                   /estimated_length=30
FT                   /gap_type="unknown"
FT   assembly_gap    2967374..2967747
FT                   /estimated_length=374
FT                   /gap_type="unknown"
FT   assembly_gap    2981236..2981984
FT                   /estimated_length=749
FT                   /gap_type="unknown"
FT   assembly_gap    3011333..3011352
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3048781..3049654
FT                   /estimated_length=874
FT                   /gap_type="unknown"
FT   assembly_gap    3092054..3092073
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3109759..3109778
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3113269..3113288
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3129491..3129528
FT                   /estimated_length=38
FT                   /gap_type="unknown"
FT   assembly_gap    3145649..3145668
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3183842..3183861
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3186695..3186714
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3187868..3188028
FT                   /estimated_length=161
FT                   /gap_type="unknown"
FT   assembly_gap    3190626..3190771
FT                   /estimated_length=146
FT                   /gap_type="unknown"
FT   assembly_gap    3218651..3218670
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3221726..3221745
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3232469..3232952
FT                   /estimated_length=484
FT                   /gap_type="unknown"
FT   assembly_gap    3234917..3234936
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3243462..3243595
FT                   /estimated_length=134
FT                   /gap_type="unknown"
FT   assembly_gap    3248035..3248319
FT                   /estimated_length=285
FT                   /gap_type="unknown"
FT   gene            <3248432..3475276
FT                   /gene="Pappa"
FT                   /locus_tag="mCG_18214"
FT                   /note="gene_id=mCG18214.2"
FT   mRNA            join(<3248432..3248600,3279314..3280376,3296772..3296858,
FT                   3299531..3299676,3304167..3304460,3312569..3312761,
FT                   3319968..3320089,3327851..3328349,3354350..3354478,
FT                   3361084..3361175,3385084..3385277,3416500..3416613,
FT                   3417540..3417675,3420428..3420641,3428440..3428608,
FT                   3430931..3431114,3437829..3438039,3439374..3439545,
FT                   3446987..3447134,3450213..3450322,3458820..3458891,
FT                   3463802..3463900,3474735..3475243)
FT                   /gene="Pappa"
FT                   /locus_tag="mCG_18214"
FT                   /product="pregnancy-associated plasma protein A, transcript
FT                   variant mCT192851"
FT                   /note="gene_id=mCG18214.2 transcript_id=mCT192851.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(<3248432..3248600,3279314..3280376,3299531..3299676,
FT                   3304167..3304460,3312569..3312761,3319968..3320089,
FT                   3327851..3328349,3354350..3354478,3361084..3361175,
FT                   3385084..3385277,3416500..3416613,3417540..3417675,
FT                   3420428..3420641,3428440..3428608,3430931..3431114,
FT                   3437829..3438039,3439374..3439545,3446987..3447134,
FT                   3450213..3450322,3458820..3458891,3463802..3463900,
FT                   3474735..3475243)
FT                   /gene="Pappa"
FT                   /locus_tag="mCG_18214"
FT                   /product="pregnancy-associated plasma protein A, transcript
FT                   variant mCT192850"
FT                   /note="gene_id=mCG18214.2 transcript_id=mCT192850.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<3248432..3248600,3279314..3280376,3296772..3296858,
FT                   3299531..3299676,3304167..3304460,3312569..3312761,
FT                   3319968..3320089,3327851..3328349,3354350..3354478,
FT                   3361084..3361175,3385084..3385277,3416500..3416613,
FT                   3417540..3417675,3420428..3420641,3428440..3428608,
FT                   3430931..3431114,3437829..3438039,3439374..3439545,
FT                   3446987..3447134,3450213..3450322,3458820..3458891,
FT                   3463802..3463900,3474735..3474842)
FT                   /codon_start=1
FT                   /gene="Pappa"
FT                   /locus_tag="mCG_18214"
FT                   /product="pregnancy-associated plasma protein A, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG18214.2 transcript_id=mCT192851.0
FT                   protein_id=mCP113804.0 isoform=CRA_c"
FT                   /protein_id="EDL31085.1"
FT                   /translation="AARGAEEPSPPSRALYFSGRGEQLRLRADLELPRDAFTLQVWLRA
FT                   EGGQKSPAVITGLYDKCSYTSRDRGWVMGIHTTSDQGNRDPRYFFSLKTDRARKVTTID
FT                   AHRSYLPGQWVHLAATYDGRLMKLYMNGAQVATSAEQVGGIFSPLTQKCKVLMLGGSAL
FT                   NHNFRGHIEHFSLWKVARTQREIVSDMETRGLHTPLPQLLLQENWDNVKRTWSPMKDGN
FT                   SPQVEFSNAHGFLLDTNLEPPLCGQTLCDNTEVISSYNQLPSFRQPKVVRYRVVNIYDD
FT                   HHENPTVSWQQIDFQHQQLAEAFQHYNISWELEVLNINSSSLRHRLILANCDISKIGDE
FT                   KCDPECNHTLTGHDGGDCRQLRYPAFMKKQQNGVCDMDCNYERFNFDGGECCDPDITDV
FT                   TKTCFDPDSPHRQSIRKRAHVVEESWLPHGKQKAKKRKRTRAYLDVNELKNILRLDGST
FT                   HLNIFFANSSEEELAGVATWPWDKEALMHLGGIVLNPSFYGIPGHTHTMIHEIGHSLGL
FT                   YHIFRGISEIQSCSDPCMETEPSFETGDLCNDTNPAPKHKFCGDPGPGNDTCGFHGFFN
FT                   TPYNNFMSYADDDCTDSFTPNQVSRMHCYLDLVYQSWQPSRKPAPVALAPQVVGHTMDS
FT                   VMLEWFPPIDGHFFERELGSACDLCLEGRILVQYAFNASSPMPCGPSGHWSPREAEGHP
FT                   DVEQPCKSSVRTWSPNSAVNPHTVPPACPEPQGCYLELEFRYPLVPESLTIWVTFVSSD
FT                   WDSSGAVNDIKLLTISGKNISLGPQNVFCDIPLTIRLRDVGEEVYGIQIYTLDEHLEID
FT                   AAMLTSTVDSPLCLQCKPLQYKVLRDPPLLEDVASLLHLNRRFMDTDLKLGSVYQYRII
FT                   TISGNEESEPSPAAIYTHGSGYCGDGVIQKDQGEECDDMNKVNGDGCSLFCKQEVSFNC
FT                   IDEPSRCYFHDGDGMCEEFEQKTSIKDCGVYTPQGFLDQWASNASVSHQDQQCPGWVVI
FT                   GQPAASQVCRTKVIDLSEGISQHAWYPCTITYPYYHLPQTTFWLQTYFSQPMVAAAVII
FT                   HLVTDGTYYGDQKQETISVQLLDTKDQSHDLGLHVLSCRNNPLIIPVVHDLSQPFYHSQ
FT                   AVHVSFSSPLVAISGVALRSFDNFDPVTLSSCQRGETYSPAEQSCVHFACQAADCPELA
FT                   VGNASLNCSSNHHYHGAQCTVSCQTGYVLQIQRDDELIKSQVGPSITVTCTEGKWNKQV
FT                   ACEPVDCGIPDHHHVYAASFSCPEGTTFGRRCSFQCRHPAQLKGNNSFLTCMEDGLWSF
FT                   PEALCELMCLAPPPVPNADLQTARCRENKHKVGSFCKYKCKPGYHVPGSSRKSKKRAFK
FT                   TQCTQDGSWQEGTCVPVTCDPPPPKFHGLYQCTNGFQFNSECRIKCEDSDASQGRGSNI
FT                   IHCRKDGTWSGSFHVCREMQGQCSAPNQLNSNLKLQCPDGYAIGSECAISCLDHNSESI
FT                   ILPVNLTVRDIPHWMNPTRVQRIVCTAGLQWYPHPALIHCVKGCEPFMGDNYCDAINNR
FT                   AFCNYDGGDCCTSTVKTKKVTPFPMSCDLQNDCACRDPEAQEHNRKDLRGYSHG"
FT   CDS             join(<3248432..3248600,3279314..3280376,3299531..3299676,
FT                   3304167..3304460,3312569..3312761,3319968..3320089,
FT                   3327851..3328349,3354350..3354478,3361084..3361175,
FT                   3385084..3385277,3416500..3416613,3417540..3417675,
FT                   3420428..3420641,3428440..3428608,3430931..3431114,
FT                   3437829..3438039,3439374..3439545,3446987..3447134,
FT                   3450213..3450322,3458820..3458891,3463802..3463900,
FT                   3474735..3474842)
FT                   /codon_start=1
FT                   /gene="Pappa"
FT                   /locus_tag="mCG_18214"
FT                   /product="pregnancy-associated plasma protein A, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG18214.2 transcript_id=mCT192850.0
FT                   protein_id=mCP113803.0 isoform=CRA_b"
FT                   /protein_id="EDL31084.1"
FT                   /translation="AARGAEEPSPPSRALYFSGRGEQLRLRADLELPRDAFTLQVWLRA
FT                   EGGQKSPAVITGLYDKCSYTSRDRGWVMGIHTTSDQGNRDPRYFFSLKTDRARKVTTID
FT                   AHRSYLPGQWVHLAATYDGRLMKLYMNGAQVATSAEQVGGIFSPLTQKCKVLMLGGSAL
FT                   NHNFRGHIEHFSLWKVARTQREIVSDMETRGLHTPLPQLLLQENWDNVKRTWSPMKDGN
FT                   SPQVEFSNAHGFLLDTNLEPPLCGQTLCDNTEVISSYNQLPSFRQPKVVRYRVVNIYDD
FT                   HHENPTVSWQQIDFQHQQLAEAFQHYNISWELEVLNINSSSLRHRLILANCDISKIGDE
FT                   KCDPECNHTLTGHDGGDCRQLRYPAFMKKQQNGVCDMDCNYERFNFDGGECCDPDITDV
FT                   TKTCFDPDSPHRAYLDVNELKNILRLDGSTHLNIFFANSSEEELAGVATWPWDKEALMH
FT                   LGGIVLNPSFYGIPGHTHTMIHEIGHSLGLYHIFRGISEIQSCSDPCMETEPSFETGDL
FT                   CNDTNPAPKHKFCGDPGPGNDTCGFHGFFNTPYNNFMSYADDDCTDSFTPNQVSRMHCY
FT                   LDLVYQSWQPSRKPAPVALAPQVVGHTMDSVMLEWFPPIDGHFFERELGSACDLCLEGR
FT                   ILVQYAFNASSPMPCGPSGHWSPREAEGHPDVEQPCKSSVRTWSPNSAVNPHTVPPACP
FT                   EPQGCYLELEFRYPLVPESLTIWVTFVSSDWDSSGAVNDIKLLTISGKNISLGPQNVFC
FT                   DIPLTIRLRDVGEEVYGIQIYTLDEHLEIDAAMLTSTVDSPLCLQCKPLQYKVLRDPPL
FT                   LEDVASLLHLNRRFMDTDLKLGSVYQYRIITISGNEESEPSPAAIYTHGSGYCGDGVIQ
FT                   KDQGEECDDMNKVNGDGCSLFCKQEVSFNCIDEPSRCYFHDGDGMCEEFEQKTSIKDCG
FT                   VYTPQGFLDQWASNASVSHQDQQCPGWVVIGQPAASQVCRTKVIDLSEGISQHAWYPCT
FT                   ITYPYYHLPQTTFWLQTYFSQPMVAAAVIIHLVTDGTYYGDQKQETISVQLLDTKDQSH
FT                   DLGLHVLSCRNNPLIIPVVHDLSQPFYHSQAVHVSFSSPLVAISGVALRSFDNFDPVTL
FT                   SSCQRGETYSPAEQSCVHFACQAADCPELAVGNASLNCSSNHHYHGAQCTVSCQTGYVL
FT                   QIQRDDELIKSQVGPSITVTCTEGKWNKQVACEPVDCGIPDHHHVYAASFSCPEGTTFG
FT                   RRCSFQCRHPAQLKGNNSFLTCMEDGLWSFPEALCELMCLAPPPVPNADLQTARCRENK
FT                   HKVGSFCKYKCKPGYHVPGSSRKSKKRAFKTQCTQDGSWQEGTCVPVTCDPPPPKFHGL
FT                   YQCTNGFQFNSECRIKCEDSDASQGRGSNIIHCRKDGTWSGSFHVCREMQGQCSAPNQL
FT                   NSNLKLQCPDGYAIGSECAISCLDHNSESIILPVNLTVRDIPHWMNPTRVQRIVCTAGL
FT                   QWYPHPALIHCVKGCEPFMGDNYCDAINNRAFCNYDGGDCCTSTVKTKKVTPFPMSCDL
FT                   QNDCACRDPEAQEHNRKDLRGYSHG"
FT   mRNA            join(3248485..3248600,3279314..3280376,3299531..3299676,
FT                   3304167..3304460,3312569..3312761,3319968..3320089,
FT                   3327851..3328349,3354350..3354478,3361084..3361175,
FT                   3385084..3385277,3416500..3416613,3417540..3417633,
FT                   3420428..3420641,3428440..3428608,3430931..3431057,
FT                   3437829..3438039,3439374..3439545,3446987..3447134,
FT                   3450213..3450322,3458820..3458891,3463802..3463900,
FT                   3474735..3475276)
FT                   /gene="Pappa"
FT                   /locus_tag="mCG_18214"
FT                   /product="pregnancy-associated plasma protein A, transcript
FT                   variant mCT13869"
FT                   /note="gene_id=mCG18214.2 transcript_id=mCT13869.1 created
FT                   on 08-JAN-2003"
FT   assembly_gap    3272390..3272409
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(3279361..3280376,3299531..3299676,3304167..3304460,
FT                   3312569..3312761,3319968..3320089,3327851..3328349,
FT                   3354350..3354478,3361084..3361175,3385084..3385277,
FT                   3416500..3416613,3417540..3417633,3420428..3420641,
FT                   3428440..3428608,3430931..3431057,3437829..3438039,
FT                   3439374..3439545,3446987..3447134,3450213..3450322,
FT                   3458820..3458891,3463802..3463900,3474735..3474842)
FT                   /codon_start=1
FT                   /gene="Pappa"
FT                   /locus_tag="mCG_18214"
FT                   /product="pregnancy-associated plasma protein A, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG18214.2 transcript_id=mCT13869.1
FT                   protein_id=mCP20157.2 isoform=CRA_a"
FT                   /protein_id="EDL31083.1"
FT                   /translation="MGIHTTSDQGNRDPRYFFSLKTDRARKVTTIDAHRSYLPGQWVHL
FT                   AATYDGRLMKLYMNGAQVATSAEQVGGIFSPLTQKCKVLMLGGSALNHNFRGHIEHFSL
FT                   WKVARTQREIVSDMETRGLHTPLPQLLLQENWDNVKRTWSPMKDGNSPQVEFSNAHGFL
FT                   LDTNLEPPLCGQTLCDNTEVISSYNQLPSFRQPKVVRYRVVNIYDDHHENPTVSWQQID
FT                   FQHQQLAEAFQHYNISWELEVLNINSSSLRHRLILANCDISKIGDEKCDPECNHTLTGH
FT                   DGGDCRQLRYPAFMKKQQNGVCDMDCNYERFNFDGGECCDPDITDVTKTCFDPDSPHRA
FT                   YLDVNELKNILRLDGSTHLNIFFANSSEEELAGVATWPWDKEALMHLGGIVLNPSFYGI
FT                   PGHTHTMIHEIGHSLGLYHIFRGISEIQSCSDPCMETEPSFETGDLCNDTNPAPKHKFC
FT                   GDPGPGNDTCGFHGFFNTPYNNFMSYADDDCTDSFTPNQVSRMHCYLDLVYQSWQPSRK
FT                   PAPVALAPQVVGHTMDSVMLEWFPPIDGHFFERELGSACDLCLEGRILVQYAFNASSPM
FT                   PCGPSGHWSPREAEGHPDVEQPCKSSVRTWSPNSAVNPHTVPPACPEPQGCYLELEFRY
FT                   PLVPESLTIWVTFVSSDWDSSGAVNDIKLLTISGKNISLGPQNVFCDIPLTIRLRDVGE
FT                   EVYGIQIYTLDEHLEIDAAMLTSTVDSPLCLQCKPLQYKVLRDPPLLEDVASLLHLNRR
FT                   FMDTDLKLGSVYQYRIITISGNEESEPSPAAIYTHGSGYCGDGVIQKDQGEECDDMNKV
FT                   NGDGCSLFCKQEVSFNCIDEPSRCYFHDGDGMCEEFEQKTSIKDCGVYTPQGFLDQWAS
FT                   NASVSHQDQQCPGWVVIGQPAASQVCRTKVIDLSEGISQHAWYPCTITYPYYHLPQTTF
FT                   WLQTYFSQPMVAAAVIIHLVTDGTYYGDQKQETISLHVLSCRNNPLIIPVVHDLSQPFY
FT                   HSQAVHVSFSSPLVAISGVALRSFDNFDPVTLSSCQRGETYSPAEQSCVHFACQAADCP
FT                   ELAVGNASLNCSSNHHYHGAQCTVSCQTGYVLQIQRDDELIKSQVGPSITVTCTEGKWN
FT                   KQVACEPVDCGIPDHHHVYAASFSCPEGNNSFLTCMEDGLWSFPEALCELMCLAPPPVP
FT                   NADLQTARCRENKHKVGSFCKYKCKPGYHVPGSSRKSKKRAFKTQCTQDGSWQEGTCVP
FT                   VTCDPPPPKFHGLYQCTNGFQFNSECRIKCEDSDASQGRGSNIIHCRKDGTWSGSFHVC
FT                   REMQGQCSAPNQLNSNLKLQCPDGYAIGSECAISCLDHNSESIILPVNLTVRDIPHWMN
FT                   PTRVQRIVCTAGLQWYPHPALIHCVKGCEPFMGDNYCDAINNRAFCNYDGGDCCTSTVK
FT                   TKKVTPFPMSCDLQNDCACRDPEAQEHNRKDLRGYSHG"
FT   assembly_gap    3283640..3285799
FT                   /estimated_length=2160
FT                   /gap_type="unknown"
FT   assembly_gap    3319800..3319868
FT                   /estimated_length=69
FT                   /gap_type="unknown"
FT   assembly_gap    3360966..3360985
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3389620..3389833
FT                   /estimated_length=214
FT                   /gap_type="unknown"
FT   assembly_gap    3395304..3395323
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3415598..3415617
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3423458..3423591
FT                   /estimated_length=134
FT                   /gap_type="unknown"
FT   assembly_gap    3458384..3458403
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3493992..3494092
FT                   /estimated_length=101
FT                   /gap_type="unknown"
FT   gene            complement(3503933..>4516763)
FT                   /gene="Astn2"
FT                   /locus_tag="mCG_141271"
FT                   /note="gene_id=mCG141271.0"
FT   mRNA            complement(join(3503933..3504068,3504743..3505495,
FT                   3518881..3519064,3520768..3520868,3558580..3558722,
FT                   3664340..3664488,3666052..3666185,3704848..3705113,
FT                   3767868..3768047,3771433..3771537,3775041..3775165,
FT                   3850568..3850756,3867467..3867633,3913186..3913337,
FT                   4030427..4030564,4031328..4031402,4032480..4032564,
FT                   4068894..4069061,4111369..4111515,4144905..4145051,
FT                   4145289..4145437,4170345..4170464,4177727..4177834,
FT                   4237111..4237266,4238335..4238380,4247117..4247347,
FT                   4265526..4265652,4287936..4287997,4303549..4303933,
FT                   4384491..4384678,4516366..4516763))
FT                   /gene="Astn2"
FT                   /locus_tag="mCG_141271"
FT                   /product="astrotactin 2, transcript variant mCT174253"
FT                   /note="gene_id=mCG141271.0 transcript_id=mCT174253.0
FT                   created on 11-OCT-2002"
FT   assembly_gap    3504070..3504089
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            complement(join(3505085..3505495,3518881..3519064,
FT                   3520768..3520868,3558580..3558721,3664340..3664488,
FT                   3666052..3666185,3704848..3705113,3767868..3768047,
FT                   3771433..3771537,3775041..3775165,3850568..3850756,
FT                   3867467..3867633,3913186..3913336,4030427..4030564,
FT                   4031328..4031402,4032480..4032564,4068894..4069061,
FT                   4111369..4111515,4177727..4177834,4237111..4237266,
FT                   4303549..4303933,4384491..4384678,4516366..>4516763))
FT                   /gene="Astn2"
FT                   /locus_tag="mCG_141271"
FT                   /product="astrotactin 2, transcript variant mCT192873"
FT                   /note="gene_id=mCG141271.0 transcript_id=mCT192873.0
FT                   created on 09-MAR-2004"
FT   CDS             complement(join(3505258..3505495,3518881..3519064,
FT                   3520768..3520868,3558580..3558721,3664340..3664488,
FT                   3666052..3666185,3704848..3705113,3767868..3768047,
FT                   3771433..3771537,3775041..3775165,3850568..3850756,
FT                   3867467..3867633,3913186..3913336,4030427..4030564,
FT                   4031328..4031402,4032480..4032564,4068894..4069061,
FT                   4111369..4111515,4177727..4177834,4237111..4237266,
FT                   4303549..4303933,4384491..4384678,4516366..>4516762))
FT                   /codon_start=1
FT                   /gene="Astn2"
FT                   /locus_tag="mCG_141271"
FT                   /product="astrotactin 2, isoform CRA_b"
FT                   /note="gene_id=mCG141271.0 transcript_id=mCT192873.0
FT                   protein_id=mCP113834.0 isoform=CRA_b"
FT                   /protein_id="EDL31080.1"
FT                   /translation="PPPPPPPPLLLLFLLLLPPPPLLAGATAAAASREPDSPCRLKTVT
FT                   VSTLPALRESDIGWSGARTGAAAGAGAGTGAGAGAAAAAASAASPGSAGSAGTAAESRL
FT                   LLFVRNELPGRIAVQDDLDNTELPFFTLEMSGTAADISLVHWRQQWLENGTLYFHVSMS
FT                   SSGQLAQATAPTLQEPSEIVEEQMHILHISVMGGLIALLLLLLVFTVALYAQRRWQKRR
FT                   RIPQKSASTEATHEIHYIPSVLLGPQARESFRSSRLQTHNSVIGVPIRETPILDDYDYE
FT                   EEEEPPRRANHVSREDEFGSQMTHALDSLGRPGEEKVEFEKKAAAEATQETVESLMQKF
FT                   KESFRANTPVEIGQLQPASRSSTSAGKRKRRNKSRGGISFGRTKGTSGSEADDETQLTF
FT                   YTEQYRSRRRSKGLLKSPVNKTALTLIAVSSCILAMVCGNQMSCPLTVKVTLHVPEHFI
FT                   ADGSSFVVSEGSYLDISDWLNPAKLSLYYQINATSPWVRDLCGQRTTDACEQLCDPDTG
FT                   ECSCHEGYAPDPVHRHLCVRSDWGQSEGPWPYTTLERGYDLVTGEQAPEKILRSTFSLG
FT                   QGLWLPVSKSFVVPPVELSINPLASCKTDVLVTEDPADVREEAMLSTYFETINDLLSSF
FT                   GPVRDCSRNNGGCTRNFKCVSDRQVDSSGCVCPEELKPMKDGSGCYDHSKGIDCSDGFN
FT                   GGCEQLCLQQTLPLPYDTTSSTIFMFCGCVEEYKLAPDGKSCLMLSDVCEGPKCLKPDS
FT                   KFNDTLFGEMLHGYNNRTQHVNQGQVFQMTFRENNFIKDFPQLADGLLVIPLPVEEQCR
FT                   GVLSEPLPDLQLLTGDIRYDEAMGYPMVQQWRVRSNLYRVKLSTITLSAGFTNVLKILT
FT                   KESSRDELLSFIQHYGSHYIAEALYGSELTCIIHFPSKKVQQQLWLQYQKETTELGSKK
FT                   ELKSMPFITYLSGLLTAQMLSDDQLISGVEIRCEEKGRCPSTCHLCRRPGKEQLSPTPV
FT                   LLEINRVVPLYTLIQDNGTKEAFKNALMSSYWCSGKGDVIDDWCRCDLSAFDASGLPNC
FT                   SPLPQPVLRLSPTVEPSSTVVSLEWVDVQPAIGTKVSDYILQHKKVDEYTDTDLYTGEF
FT                   LSFADDLLSGLGTSCVAAGRSHGEVPEVSIYSVIFKCLEPDGLYKFTLYAVDTRGRHSE
FT                   LSTVTLRTACPLVDDNKAEEIADKIYNLYNGYTSGKEQQTAYNTLMEVSASMLFRVQHH
FT                   YNSHYEKFGDFVWRSEDELGPRKAHLILRRLERVSSHCSSLLRSAYIQSRVDTIPYLFC
FT                   RSEEVRPAGMVWYSILKDTKITCEEKMVSMARNTYGETKGR"
FT   assembly_gap    3542672..3542691
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3552582..3552604
FT                   /estimated_length=23
FT                   /gap_type="unknown"
FT   assembly_gap    3555770..3555789
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             complement(join(3558697..3558722,3664340..3664488,
FT                   3666052..3666185,3704848..3705113,3767868..3768047,
FT                   3771433..3771537,3775041..3775165,3850568..3850756,
FT                   3867467..3867633,3913186..3913337,4030427..4030460))
FT                   /codon_start=1
FT                   /gene="Astn2"
FT                   /locus_tag="mCG_141271"
FT                   /product="astrotactin 2, isoform CRA_a"
FT                   /note="gene_id=mCG141271.0 transcript_id=mCT174253.0
FT                   protein_id=mCP97172.0 isoform=CRA_a"
FT                   /protein_id="EDL31079.1"
FT                   /translation="MCSSQKTLRMSGEEAMLSTYFETINDLLSSFGPVRDCSRNNGGCT
FT                   RNFKCVSDRQVDSSGCVCPEELKPMKDGSGCYDHSKGIDCSDGFNGGCEQLCLQQTLPL
FT                   PYDTTSSTIFMFCGCVEEYKLAPDGKSCLMLSDVCEGPKCLKPDSKFNDTLFGEMLHGY
FT                   NNRTQHVNQGQVFQMTFRENNFIKDFPQLADGLLVIPLPVEEQCRGVLSEPLPDLQLLT
FT                   GDIRYDEAMGYPMVQQWRVRSNLYRVKLSTITLSAGFTNVLKILTKESSRDELLSFIQH
FT                   YGSHYIAEALYGSELTCIIHFPSKKVQQQLWLQYQKETTELGSKKELKSMPFITYLSGL
FT                   LTAQMLSDDQLISGVEIRCEEKGRCPSTCHLCRRPGKEQLSPTPVLLEINRVVPLYTLI
FT                   QDNGTKEAFKNALMSSYWCSGKGDVIDDWCRCDLSAFDASGLPNCSPLPQPVLRLSPTV
FT                   EPSSTVVSLEWVDVQPAIGTKVSDYILQHKKVDEYTDTDLYTGRIPEFCR"
FT   assembly_gap    3585117..3585136
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3621841..3621901
FT                   /estimated_length=61
FT                   /gap_type="unknown"
FT   assembly_gap    3635963..3636089
FT                   /estimated_length=127
FT                   /gap_type="unknown"
FT   assembly_gap    3660710..3660952
FT                   /estimated_length=243
FT                   /gap_type="unknown"
FT   assembly_gap    3694627..3694646
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <3728326..3739295
FT                   /gene="Trim32"
FT                   /locus_tag="mCG_51740"
FT                   /note="gene_id=mCG51740.2"
FT   mRNA            join(<3728326..3728377,3736183..3739291)
FT                   /gene="Trim32"
FT                   /locus_tag="mCG_51740"
FT                   /product="tripartite motif protein 32, transcript variant
FT                   mCT192862"
FT                   /note="gene_id=mCG51740.2 transcript_id=mCT192862.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(3728329..3728377,3736186..3739295)
FT                   /gene="Trim32"
FT                   /locus_tag="mCG_51740"
FT                   /product="tripartite motif protein 32, transcript variant
FT                   mCT51923"
FT                   /note="gene_id=mCG51740.2 transcript_id=mCT51923.1 created
FT                   on 30-OCT-2002"
FT   assembly_gap    3729954..3732650
FT                   /estimated_length=2697
FT                   /gap_type="unknown"
FT   CDS             <3736229..3738229
FT                   /codon_start=1
FT                   /gene="Trim32"
FT                   /locus_tag="mCG_51740"
FT                   /product="tripartite motif protein 32, isoform CRA_a"
FT                   /note="gene_id=mCG51740.2 transcript_id=mCT192862.0
FT                   protein_id=mCP113817.0 isoform=CRA_a"
FT                   /protein_id="EDL31081.1"
FT                   /translation="AVLAGTFTGRAMAAAAAASHLNLDALREVLECPICMESFTEEQLR
FT                   PKLLHCGHTICRQCLEKLLASSINGVRCPFCSKITRITSLTQLTDNLTVLKIIDTAGLS
FT                   EAVGLLMCRGCGRRLPRQFCRSCGVVLCEPCREADHQPPGHCTLPVKEAAEERRRDFGE
FT                   KLTRLRELTGELQRRKAALEGVSRDLQARYKAVLQEYGHEERRIQEELARSRKFFTGSL
FT                   AEVEKSNSQVVEEQSYLLNIAEVQAVSRCDYFLAKIKQADVALLEETADEEEPELTASL
FT                   PRELTLQDVELLKVGHVGPLQIGQAVKKPRTVNMEDSWAGEEGAASSASASVTFREMDM
FT                   SPEEVAPSPRASPAKQRSSEAASGIQQCLFLKKMGAKGSTPGMFNLPVSLYVTSQSEVL
FT                   VADRGNYRIQVFNRKGFLKEIRRSPSGIDSFVLSFLGADLPNLTPLSVAMNCHGLIGVT
FT                   DSYDNSLKVYTMDGHCVACHRSQLSKPWGITALPSGQFVVTDVEGGKLWCFTVDRGAGV
FT                   VKYSCLCSAVRPKFVTCDAEGTVYFTQGLGLNVENRQNEHHLEGGFSIGSVGPDGQLGR
FT                   QISHFFSENEDFRCIAGMCVDARGDLIVADSSRKEILHFPKGGGYSVLIREGLTCPVGI
FT                   ALTPKGQLLVLDCWDHCVKIYSYHLRRYSTP"
FT   CDS             3736262..3738229
FT                   /codon_start=1
FT                   /gene="Trim32"
FT                   /locus_tag="mCG_51740"
FT                   /product="tripartite motif protein 32, isoform CRA_b"
FT                   /note="gene_id=mCG51740.2 transcript_id=mCT51923.1
FT                   protein_id=mCP40330.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q3TLR3"
FT                   /db_xref="InterPro:IPR000315"
FT                   /db_xref="InterPro:IPR001258"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013017"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="InterPro:IPR027370"
FT                   /db_xref="MGI:MGI:1917057"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TLR3"
FT                   /protein_id="EDL31082.1"
FT                   /translation="MAAAAAASHLNLDALREVLECPICMESFTEEQLRPKLLHCGHTIC
FT                   RQCLEKLLASSINGVRCPFCSKITRITSLTQLTDNLTVLKIIDTAGLSEAVGLLMCRGC
FT                   GRRLPRQFCRSCGVVLCEPCREADHQPPGHCTLPVKEAAEERRRDFGEKLTRLRELTGE
FT                   LQRRKAALEGVSRDLQARYKAVLQEYGHEERRIQEELARSRKFFTGSLAEVEKSNSQVV
FT                   EEQSYLLNIAEVQAVSRCDYFLAKIKQADVALLEETADEEEPELTASLPRELTLQDVEL
FT                   LKVGHVGPLQIGQAVKKPRTVNMEDSWAGEEGAASSASASVTFREMDMSPEEVAPSPRA
FT                   SPAKQRSSEAASGIQQCLFLKKMGAKGSTPGMFNLPVSLYVTSQSEVLVADRGNYRIQV
FT                   FNRKGFLKEIRRSPSGIDSFVLSFLGADLPNLTPLSVAMNCHGLIGVTDSYDNSLKVYT
FT                   MDGHCVACHRSQLSKPWGITALPSGQFVVTDVEGGKLWCFTVDRGAGVVKYSCLCSAVR
FT                   PKFVTCDAEGTVYFTQGLGLNVENRQNEHHLEGGFSIGSVGPDGQLGRQISHFFSENED
FT                   FRCIAGMCVDARGDLIVADSSRKEILHFPKGGGYSVLIREGLTCPVGIALTPKGQLLVL
FT                   DCWDHCVKIYSYHLRRYSTP"
FT   assembly_gap    3766541..3766560
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3781003..3781022
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3784138..3784157
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3797925..3797944
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3803986..3804028
FT                   /estimated_length=43
FT                   /gap_type="unknown"
FT   assembly_gap    3809015..3809083
FT                   /estimated_length=69
FT                   /gap_type="unknown"
FT   assembly_gap    3822019..3822038
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3866379..3866398
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3879202..3879221
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3896590..3900057
FT                   /estimated_length=3468
FT                   /gap_type="unknown"
FT   assembly_gap    3926624..3926903
FT                   /estimated_length=280
FT                   /gap_type="unknown"
FT   assembly_gap    3938490..3938548
FT                   /estimated_length=59
FT                   /gap_type="unknown"
FT   assembly_gap    3945811..3945846
FT                   /estimated_length=36
FT                   /gap_type="unknown"
FT   assembly_gap    3998604..3998940
FT                   /estimated_length=337
FT                   /gap_type="unknown"
FT   assembly_gap    4076669..4077066
FT                   /estimated_length=398
FT                   /gap_type="unknown"
FT   assembly_gap    4103453..4107940
FT                   /estimated_length=4488
FT                   /gap_type="unknown"
FT   assembly_gap    4164316..4167866
FT                   /estimated_length=3551
FT                   /gap_type="unknown"
FT   assembly_gap    4183111..4188920
FT                   /estimated_length=5810
FT                   /gap_type="unknown"
FT   assembly_gap    4199307..4201798
FT                   /estimated_length=2492
FT                   /gap_type="unknown"
FT   assembly_gap    4241690..4241709
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4284469..4284858
FT                   /estimated_length=390
FT                   /gap_type="unknown"
FT   assembly_gap    4292252..4292287
FT                   /estimated_length=36
FT                   /gap_type="unknown"
FT   assembly_gap    4312890..4312909
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4338943..4338962
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4353633..4353708
FT                   /estimated_length=76
FT                   /gap_type="unknown"
FT   assembly_gap    4363171..4363190
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4419819..4419838
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4430471..4430490
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4473858..4473877
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4500991..4501010
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4507299..4507355
FT                   /estimated_length=57
FT                   /gap_type="unknown"
FT   assembly_gap    4514700..4514742
FT                   /estimated_length=43
FT                   /gap_type="unknown"
FT   assembly_gap    4516782..4517364
FT                   /estimated_length=583
FT                   /gap_type="unknown"
FT   assembly_gap    4520480..4523024
FT                   /estimated_length=2545
FT                   /gap_type="unknown"
FT   assembly_gap    4538142..4538467
FT                   /estimated_length=326
FT                   /gap_type="unknown"
FT   assembly_gap    4545293..4545312
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4610718..4610762
FT                   /estimated_length=45
FT                   /gap_type="unknown"
FT   assembly_gap    4629911..4630695
FT                   /estimated_length=785
FT                   /gap_type="unknown"
FT   assembly_gap    4640188..4640207
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4641807..4641826
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4648856..4648875
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4686764..4688239
FT                   /estimated_length=1476
FT                   /gap_type="unknown"
FT   assembly_gap    4690686..4699112
FT                   /estimated_length=8427
FT                   /gap_type="unknown"
FT   assembly_gap    4745258..4745318
FT                   /estimated_length=61
FT                   /gap_type="unknown"
FT   assembly_gap    4759560..4759579
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4779219..4781925
FT                   /estimated_length=2707
FT                   /gap_type="unknown"
FT   assembly_gap    4783731..4783921
FT                   /estimated_length=191
FT                   /gap_type="unknown"
FT   assembly_gap    4806386..4806933
FT                   /estimated_length=548
FT                   /gap_type="unknown"
FT   assembly_gap    4809636..4810270
FT                   /estimated_length=635
FT                   /gap_type="unknown"
FT   assembly_gap    4845771..4845790
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4868235..4868633
FT                   /estimated_length=399
FT                   /gap_type="unknown"
FT   assembly_gap    4871197..4872480
FT                   /estimated_length=1284
FT                   /gap_type="unknown"
FT   assembly_gap    4885500..4886003
FT                   /estimated_length=504
FT                   /gap_type="unknown"
FT   assembly_gap    4888707..4889133
FT                   /estimated_length=427
FT                   /gap_type="unknown"
FT   gene            4920821..4936031
FT                   /gene="Tlr4"
FT                   /locus_tag="mCG_18008"
FT                   /note="gene_id=mCG18008.2"
FT   mRNA            join(4920821..4921158,4927131..4927297,4932466..4936031)
FT                   /gene="Tlr4"
FT                   /locus_tag="mCG_18008"
FT                   /product="toll-like receptor 4"
FT                   /note="gene_id=mCG18008.2 transcript_id=mCT18660.2 created
FT                   on 08-OCT-2002"
FT   CDS             join(4921069..4921158,4927131..4927297,4932466..4934716)
FT                   /codon_start=1
FT                   /gene="Tlr4"
FT                   /locus_tag="mCG_18008"
FT                   /product="toll-like receptor 4"
FT                   /note="gene_id=mCG18008.2 transcript_id=mCT18660.2
FT                   protein_id=mCP20143.1"
FT                   /db_xref="GOA:L0CL36"
FT                   /db_xref="InterPro:IPR000157"
FT                   /db_xref="InterPro:IPR000483"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR027168"
FT                   /db_xref="MGI:MGI:96824"
FT                   /db_xref="UniProtKB/TrEMBL:L0CL36"
FT                   /protein_id="EDL31078.1"
FT                   /translation="MMPPWLLARTLIMALFFSCLTPGSLNPCIEVVPNITYQCMDQKLS
FT                   KVPDDIPSSTKNIDLSFNPLKILKSYSFSNFSELQWLDLSRCEIETIEDKAWHGLHHLS
FT                   NLILTGNPIQSFSPGSFSGLTSLENLVAVETKLASLESFPIGQLITLKKLNVAHNFIHS
FT                   CKLPAYFSNLTNLVHVDLSYNYIQTITVNDLQFLRENPQVNLSLDMSLNPIDFIQDQAF
FT                   QGIKLHELTLRGNFNSSNIMKTCLQNLAGLHVHRLILGEFKDERNLEIFEPSIMEGLCD
FT                   VTIDEFRLTYTNDFSDDIVKFHCLANVSAMSLAGVSIKYLEDVPKHFKWQSLSIIRCQL
FT                   KQFPTLDLPFLKSLTLTMNKGSISFKKVALPSLSYLDLSRNALSFSGCCSYSDLGTNSL
FT                   RHLDLSFNGAIIMSANFMGLEELQHLDFQHSTLKRVTEFSAFLSLEKLLYLDISYTNTK
FT                   IDFDGIFLGLTSLNTLKMAGNSFKDNTLSNVFANTTNLTFLDLSKCQLEQISWGVFDTL
FT                   HRLQLLNMSHNNLLFLDSSHYNQLYSLSTLDCSFNRIETSKGILQHFPKSLAFFNLTNN
FT                   SVACICEHQKFLQWVKEQKQFLVNVEQMTCATPVEMNTSLVLDFNNSTCYMYKTIISVS
FT                   VVSVIVVSTVAFLIYHFYFHLILIAGCKKYSRGESIYDAFVIYSSQNEDWVRNELVKNL
FT                   EEGVPRFHLCLHYRDFIPGVAIAANIIQEGFHKSRKVIVVVSRHFIQSRWCIFEYEIAQ
FT                   TWQFLSSRSGIIFIVLEKVEKSLLRQQVELYRLLSRNTYLEWEDNPLGRHIFWRRLKNA
FT                   LLDGKASNPEQTAEEEQETATWT"
FT   assembly_gap    4946396..4946415
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4989620..4990639
FT                   /estimated_length=1020
FT                   /gap_type="unknown"
FT   assembly_gap    4992983..4995466
FT                   /estimated_length=2484
FT                   /gap_type="unknown"
FT   assembly_gap    4996660..4996679
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4999846..5000268
FT                   /estimated_length=423
FT                   /gap_type="unknown"
FT   assembly_gap    5054603..5057971
FT                   /estimated_length=3369
FT                   /gap_type="unknown"
FT   assembly_gap    5186160..5186179
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5276067..5276821
FT                   /estimated_length=755
FT                   /gap_type="unknown"
FT   assembly_gap    5303498..5303517
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5322135..5327626
FT                   /estimated_length=5492
FT                   /gap_type="unknown"
FT   assembly_gap    5331740..5331759
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5351513..5351532
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5406894..5407497
FT                   /estimated_length=604
FT                   /gap_type="unknown"
FT   assembly_gap    5412277..5412334
FT                   /estimated_length=58
FT                   /gap_type="unknown"
FT   assembly_gap    5421676..5421895
FT                   /estimated_length=220
FT                   /gap_type="unknown"
FT   assembly_gap    5423551..5428995
FT                   /estimated_length=5445
FT                   /gap_type="unknown"
FT   assembly_gap    5430023..5430042
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5431261..5431280
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5432337..5434320
FT                   /estimated_length=1984
FT                   /gap_type="unknown"
FT   assembly_gap    5438093..5443449
FT                   /estimated_length=5357
FT                   /gap_type="unknown"
FT   assembly_gap    5444842..5444861
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5445891..5445910
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5449735..5449754
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5451092..5451111
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5452797..5452816
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5454795..5456741
FT                   /estimated_length=1947
FT                   /gap_type="unknown"
FT   assembly_gap    5458657..5459422
FT                   /estimated_length=766
FT                   /gap_type="unknown"
FT   assembly_gap    5484576..5484595
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5485621..5485640
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5523708..5524032
FT                   /estimated_length=325
FT                   /gap_type="unknown"
FT   assembly_gap    5542642..5542661
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5546898..5546917
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5576827..5577086
FT                   /estimated_length=260
FT                   /gap_type="unknown"
FT   assembly_gap    5594614..5594633
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5605489..5605508
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5610904..5610923
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<5611287..>5611913)
FT                   /locus_tag="mCG_49535"
FT                   /note="gene_id=mCG49535.2"
FT   mRNA            complement(<5611287..>5611913)
FT                   /locus_tag="mCG_49535"
FT                   /product="mCG49535"
FT                   /note="gene_id=mCG49535.2 transcript_id=mCT49718.2 created
FT                   on 20-FEB-2003"
FT   CDS             complement(5611287..5611913)
FT                   /codon_start=1
FT                   /locus_tag="mCG_49535"
FT                   /product="mCG49535"
FT                   /note="gene_id=mCG49535.2 transcript_id=mCT49718.2
FT                   protein_id=mCP40301.2"
FT                   /db_xref="GOA:Q80YZ1"
FT                   /db_xref="InterPro:IPR009071"
FT                   /db_xref="InterPro:IPR017967"
FT                   /db_xref="UniProtKB/TrEMBL:Q80YZ1"
FT                   /protein_id="EDL31077.1"
FT                   /translation="MGKGDPKKLRGKMSCICILYANLPGEHKTTYLDASVNFSEFSKKC
FT                   SERWKTMSAKEKGKFEDMAKADKACYEREMKTYIPHKGETKKKFKDPNAPKRSPSAFFL
FT                   FCSEYCHKIKGEHPGLSIGVVAKKLGEMWINTAVYDKQPCEKKATKLKEKYEKDIAACR
FT                   AKGKPDAAKQGLVKAEKSKKKKEEEDEEEDEEDEEDEDEEEEDNE"
FT   assembly_gap    5672472..5673113
FT                   /estimated_length=642
FT                   /gap_type="unknown"
FT   assembly_gap    5685567..5685779
FT                   /estimated_length=213
FT                   /gap_type="unknown"
FT   assembly_gap    5723056..5723075
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5748509..5749386
FT                   /estimated_length=878
FT                   /gap_type="unknown"
FT   assembly_gap    5752032..5752051
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5754386..5754405
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5755828..5755847
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5756855..5757360
FT                   /estimated_length=506
FT                   /gap_type="unknown"
FT   assembly_gap    5785996..5786349
FT                   /estimated_length=354
FT                   /gap_type="unknown"
FT   assembly_gap    5811200..5811219
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5841396..5841415
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5918614..5918633
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5919715..5919734
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5930457..5930476
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5932334..5932369
FT                   /estimated_length=36
FT                   /gap_type="unknown"
FT   assembly_gap    5938754..5938773
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5940658..5946620
FT                   /estimated_length=5963
FT                   /gap_type="unknown"
FT   assembly_gap    5959418..5959533
FT                   /estimated_length=116
FT                   /gap_type="unknown"
FT   assembly_gap    6020083..6021649
FT                   /estimated_length=1567
FT                   /gap_type="unknown"
FT   assembly_gap    6037588..6037607
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6038748..6041715
FT                   /estimated_length=2968
FT                   /gap_type="unknown"
FT   assembly_gap    6133822..6133841
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6135513..6135532
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6136594..6139796
FT                   /estimated_length=3203
FT                   /gap_type="unknown"
FT   assembly_gap    6156267..6156286
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6159801..6159820
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6182774..6183017
FT                   /estimated_length=244
FT                   /gap_type="unknown"
FT   assembly_gap    6212444..6212987
FT                   /estimated_length=544
FT                   /gap_type="unknown"
FT   assembly_gap    6220502..6220599
FT                   /estimated_length=98
FT                   /gap_type="unknown"
FT   assembly_gap    6251595..6251614
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6270392..6270485
FT                   /estimated_length=94
FT                   /gap_type="unknown"
FT   assembly_gap    6273696..6273936
FT                   /estimated_length=241
FT                   /gap_type="unknown"
FT   assembly_gap    6278124..6278143
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6324320..6324532
FT                   /estimated_length=213
FT                   /gap_type="unknown"
FT   assembly_gap    6325640..6325659
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6328077..6328096
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6359802..6360706
FT                   /estimated_length=905
FT                   /gap_type="unknown"
FT   assembly_gap    6389002..6393736
FT                   /estimated_length=4735
FT                   /gap_type="unknown"
FT   assembly_gap    6411585..6412330
FT                   /estimated_length=746
FT                   /gap_type="unknown"
FT   assembly_gap    6449578..6449597
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6470020..6470039
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6513967..6514413
FT                   /estimated_length=447
FT                   /gap_type="unknown"
FT   assembly_gap    6541165..6541821
FT                   /estimated_length=657
FT                   /gap_type="unknown"
FT   assembly_gap    6544023..6544174
FT                   /estimated_length=152
FT                   /gap_type="unknown"
FT   assembly_gap    6575443..6575462
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6592359..6592384
FT                   /estimated_length=26
FT                   /gap_type="unknown"
FT   assembly_gap    6608787..6608806
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6630460..6630479
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6633377..6633396
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6725478..6725497
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6767481..6767500
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6768494..6772547
FT                   /estimated_length=4054
FT                   /gap_type="unknown"
FT   assembly_gap    6774404..6774423
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6795564..6795670
FT                   /estimated_length=107
FT                   /gap_type="unknown"
FT   assembly_gap    6796781..6796894
FT                   /estimated_length=114
FT                   /gap_type="unknown"
FT   assembly_gap    6801532..6804529
FT                   /estimated_length=2998
FT                   /gap_type="unknown"
FT   assembly_gap    6809351..6809505
FT                   /estimated_length=155
FT                   /gap_type="unknown"
FT   assembly_gap    6820545..6820564
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<6855948..7048426)
FT                   /gene="Dbc1"
FT                   /locus_tag="mCG_20080"
FT                   /note="gene_id=mCG20080.2"
FT   mRNA            complement(join(<6855948..6857085,6886703..6886925,
FT                   6892566..6892802,6921121..6921226,6923591..6923760,
FT                   6935504..6935694,6998891..6999158,7048043..7048426))
FT                   /gene="Dbc1"
FT                   /locus_tag="mCG_20080"
FT                   /product="deleted in bladder cancer 1 (human), transcript
FT                   variant mCT18568"
FT                   /note="gene_id=mCG20080.2 transcript_id=mCT18568.1 created
FT                   on 08-OCT-2002"
FT   CDS             complement(join(6855948..6857085,6886703..6886925,
FT                   6892566..6892802,6921121..6921226,6923591..6923760,
FT                   6935504..6935694,6998891..6999108))
FT                   /codon_start=1
FT                   /gene="Dbc1"
FT                   /locus_tag="mCG_20080"
FT                   /product="deleted in bladder cancer 1 (human), isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG20080.2 transcript_id=mCT18568.1
FT                   protein_id=mCP20141.1 isoform=CRA_a"
FT                   /protein_id="EDL31075.1"
FT                   /translation="MNWRFVELLYFLFVWGRISVQPSRQEPAGTDQHVSKEFDWLISDR
FT                   GPFHHSRSYLSFVERHRQGFTTRYKIYREFARWKVRNTAIERRDLVRHPVPLMPEFQRS
FT                   IRLLGRRPTTQQFIDTIIKKYGTHLLISATLGGEEALTMYMDKSRLDRKSGNATQSVEA
FT                   LHQLASSYFVDRDGTMRRLHEIQISTGAIKVTETRTGPLGCNSYDNLDSVSSVLLQSTE
FT                   SKLHLQGLQIIFPQYLQEKFVQSALSYIMCNGEGEYVCQNSQCRCQCAEEFPQCNCPIT
FT                   DIQIMEFTLANMAKAWTEAYKDLENSDEFKSFMKRLPSNHFLTIGSIHQHWGNDWDLQS
FT                   RYKLLQSATEAQRQKIQRTARKLFGLSVRCRHNPNHQLPRERTIQQWLARVQSLLYCNE
FT                   NGFWGTFLESQRSCVCHGSTTLCQRPIPCIIGGNNSCAMCSLANISLCGSCNKGYKLYR
FT                   GRCEPQNVDSERSEQFISFETDLDFQDLELKYLLQKMDSRLYVHTTFISNEIRLDTFFD
FT                   PRWRKRMSLTLKSNKNRMDFIHMVIGMSMRICQMRNSSLDPMFFVYVNPFSGSHSEGWN
FT                   MPFGEFGYPRWEKIRLQNSQCYNWTLLLGNRWKTFFETVHIYLRSRTRLPTLRNETGQG
FT                   PVDLSDPSKRQFYIKISDVQVFGYSLRFNADLLRSAVQQVNQSYTQGGQFYSSSSVMLL
FT                   MLDIRDRINRLAPPVAPGKPQLDLFSCMLKHRLKLTNSEIIRVNHALDLYNTEILKQSD
FT                   QMTAKLC"
FT   assembly_gap    6875949..6875968
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            complement(join(6889834..6892802,6921121..6921226,
FT                   6923591..6923760,6935504..6935694,6998891..6999158,
FT                   7048043..>7048385))
FT                   /gene="Dbc1"
FT                   /locus_tag="mCG_20080"
FT                   /product="deleted in bladder cancer 1 (human), transcript
FT                   variant mCT192861"
FT                   /note="gene_id=mCG20080.2 transcript_id=mCT192861.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(6892525..6892802,6921121..6921226,
FT                   6923591..6923760,6935504..6935694,6998891..>6999132))
FT                   /codon_start=1
FT                   /gene="Dbc1"
FT                   /locus_tag="mCG_20080"
FT                   /product="deleted in bladder cancer 1 (human), isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG20080.2 transcript_id=mCT192861.0
FT                   protein_id=mCP113805.0 isoform=CRA_b"
FT                   /protein_id="EDL31076.1"
FT                   /translation="EEKGRQQSMNWRFVELLYFLFVWGRISVQPSRQEPAGTDQHVSKE
FT                   FDWLISDRGPFHHSRSYLSFVERHRQGFTTRYKIYREFARWKVRNTAIERRDLVRHPVP
FT                   LMPEFQRSIRLLGRRPTTQQFIDTIIKKYGTHLLISATLGGEEALTMYMDKSRLDRKSG
FT                   NATQSVEALHQLASSYFVDRDGTMRRLHEIQISTGAIKVTETRTGPLGCNSYDNLDSVS
FT                   SVLLQSTESKLHLQGLQIIFPQYLQEKFVQSALSYIMCNGEGEYVCQNSQCRCQCAEEF
FT                   PQCNCPITDIQIMEFTLANMAKAWTEAYKDLENSGTQTTTVNASGQT"
FT   assembly_gap    6897940..6897959
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6911284..6911303
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6924289..6924404
FT                   /estimated_length=116
FT                   /gap_type="unknown"
FT   assembly_gap    6939161..6939180
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6962969..6965925
FT                   /estimated_length=2957
FT                   /gap_type="unknown"
FT   assembly_gap    7030943..7031742
FT                   /estimated_length=800
FT                   /gap_type="unknown"
FT   assembly_gap    7045491..7045510
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7057619..7058197
FT                   /estimated_length=579
FT                   /gap_type="unknown"
FT   assembly_gap    7084132..7084347
FT                   /estimated_length=216
FT                   /gap_type="unknown"
FT   assembly_gap    7094386..7095135
FT                   /estimated_length=750
FT                   /gap_type="unknown"
FT   assembly_gap    7157618..7157637
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7200887..7200906
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7205981..7207782
FT                   /estimated_length=1802
FT                   /gap_type="unknown"
FT   assembly_gap    7230375..7231544
FT                   /estimated_length=1170
FT                   /gap_type="unknown"
FT   assembly_gap    7254917..7257839
FT                   /estimated_length=2923
FT                   /gap_type="unknown"
FT   assembly_gap    7259448..7259467
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7264509..7265844
FT                   /estimated_length=1336
FT                   /gap_type="unknown"
FT   assembly_gap    7267941..7269571
FT                   /estimated_length=1631
FT                   /gap_type="unknown"
FT   assembly_gap    7281476..7281495
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7288113..7289680
FT                   /estimated_length=1568
FT                   /gap_type="unknown"
FT   assembly_gap    7294165..7294195
FT                   /estimated_length=31
FT                   /gap_type="unknown"
FT   assembly_gap    7310432..7310766
FT                   /estimated_length=335
FT                   /gap_type="unknown"
FT   assembly_gap    7314460..7314742
FT                   /estimated_length=283
FT                   /gap_type="unknown"
FT   assembly_gap    7321253..7321275
FT                   /estimated_length=23
FT                   /gap_type="unknown"
FT   assembly_gap    7368724..7369156
FT                   /estimated_length=433
FT                   /gap_type="unknown"
FT   assembly_gap    7376581..7379940
FT                   /estimated_length=3360
FT                   /gap_type="unknown"
FT   assembly_gap    7404727..7405174
FT                   /estimated_length=448
FT                   /gap_type="unknown"
FT   assembly_gap    7405855..7406376
FT                   /estimated_length=522
FT                   /gap_type="unknown"
FT   assembly_gap    7486535..7486554
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7497209..7497703
FT                   /estimated_length=495
FT                   /gap_type="unknown"
FT   assembly_gap    7522022..7522041
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7525746..7528423
FT                   /estimated_length=2678
FT                   /gap_type="unknown"
FT   assembly_gap    7536000..7536019
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7549002..7549329
FT                   /estimated_length=328
FT                   /gap_type="unknown"
FT   assembly_gap    7577776..7577795
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7590903..7591772
FT                   /estimated_length=870
FT                   /gap_type="unknown"
FT   assembly_gap    7605809..7607024
FT                   /estimated_length=1216
FT                   /gap_type="unknown"
FT   assembly_gap    7662751..7662770
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7665219..7665238
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7680069..7680088
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7732057..7732186
FT                   /estimated_length=130
FT                   /gap_type="unknown"
FT   assembly_gap    7742143..7742162
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7785604..7785903
FT                   /estimated_length=300
FT                   /gap_type="unknown"
FT   gene            <7786138..>7786698
FT                   /locus_tag="mCG_49018"
FT                   /note="gene_id=mCG49018.0"
FT   mRNA            <7786138..>7786698
FT                   /locus_tag="mCG_49018"
FT                   /product="mCG49018"
FT                   /note="gene_id=mCG49018.0 transcript_id=mCT49201.0 created
FT                   on 20-FEB-2003"
FT   CDS             7786138..7786698
FT                   /codon_start=1
FT                   /locus_tag="mCG_49018"
FT                   /product="mCG49018"
FT                   /note="gene_id=mCG49018.0 transcript_id=mCT49201.0
FT                   protein_id=mCP40321.0"
FT                   /protein_id="EDL31074.1"
FT                   /translation="MGKQKKTRKYVTMKRMLSLRDERLKEKDRLKPKKKEKKDPSALKE
FT                   REVPQHPSCLFFQYNTQLGPPYHILVGTNFINFSIKAKLDLVQSMMDCLYAKCIPCITD
FT                   CVMTETEKLGQKYSVALRIAKDPRFDRLPCTHKGTYAEDCLIQRVTQHKCYIVATVDRD
FT                   LKRRIRKIPGVPIMYLSNHRYNI"
FT   assembly_gap    7801712..7814097
FT                   /estimated_length=12386
FT                   /gap_type="unknown"
FT   assembly_gap    7882140..7885700
FT                   /estimated_length=3561
FT                   /gap_type="unknown"
FT   assembly_gap    7896533..7896552
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7920502..7920532
FT                   /estimated_length=31
FT                   /gap_type="unknown"
FT   gene            <7946484..>7947221
FT                   /locus_tag="mCG_50177"
FT                   /note="gene_id=mCG50177.0"
FT   mRNA            <7946484..>7947221
FT                   /locus_tag="mCG_50177"
FT                   /product="mCG50177"
FT                   /note="gene_id=mCG50177.0 transcript_id=mCT50360.1 created
FT                   on 20-FEB-2003"
FT   CDS             7946484..7947221
FT                   /codon_start=1
FT                   /locus_tag="mCG_50177"
FT                   /product="mCG50177"
FT                   /note="gene_id=mCG50177.0 transcript_id=mCT50360.1
FT                   protein_id=mCP40293.1"
FT                   /protein_id="EDL31073.1"
FT                   /translation="MAEEGERKKIPLVRENLLKKRKAYQALKATQAKQALLAKRERKGK
FT                   QFRFRRLESFVHDSWRQQRDKVRVQRLEVKPRALEGPDQHSLALVIRMERIEGVSLLVK
FT                   STIMKLGLKKLFSGVFVKVTPQSVRMLRTVEPYVTWGFPNLKSVCPGTHLETWASKDKT
FT                   VPLTDNTVIEEHLGRFGVIGLEDLLHEIAFPGKHFQEVSSFLCPFLLSVARHATRNRVG
FT                   FRKEMGSPGYRGDRINQLIRQLN"
FT   assembly_gap    7948562..7954898
FT                   /estimated_length=6337
FT                   /gap_type="unknown"
FT   assembly_gap    8004055..8004074
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8005941..8007753
FT                   /estimated_length=1813
FT                   /gap_type="unknown"
FT   assembly_gap    8008991..8009842
FT                   /estimated_length=852
FT                   /gap_type="unknown"
FT   gene            complement(<8017569..>8018018)
FT                   /locus_tag="mCG_7351"
FT                   /note="gene_id=mCG7351.0"
FT   mRNA            complement(<8017569..>8018018)
FT                   /locus_tag="mCG_7351"
FT                   /product="mCG7351"
FT                   /note="gene_id=mCG7351.0 transcript_id=mCT6339.0 created on
FT                   30-OCT-2002"
FT   CDS             complement(8017569..8018018)
FT                   /codon_start=1
FT                   /locus_tag="mCG_7351"
FT                   /product="mCG7351"
FT                   /note="gene_id=mCG7351.0 transcript_id=mCT6339.0
FT                   protein_id=mCP20145.0"
FT                   /protein_id="EDL31072.1"
FT                   /translation="MASSDIQVKELEKRASGQAFELILSPRSKESVPDFPLSPPKKKDL
FT                   SLEEIQKKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNDFSKMAEEKLTHK
FT                   MEANKENREAQMAAKLERLREKDKHVEEVRKNKESKDPADETEAD"
FT   assembly_gap    8034673..8034877
FT                   /estimated_length=205
FT                   /gap_type="unknown"
FT   assembly_gap    8036652..8036796
FT                   /estimated_length=145
FT                   /gap_type="unknown"
FT   assembly_gap    8055711..8056713
FT                   /estimated_length=1003
FT                   /gap_type="unknown"
FT   assembly_gap    8069528..8069547
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8088473..8088601
FT                   /estimated_length=129
FT                   /gap_type="unknown"
FT   assembly_gap    8097839..8098006
FT                   /estimated_length=168
FT                   /gap_type="unknown"
FT   assembly_gap    8100836..8100948
FT                   /estimated_length=113
FT                   /gap_type="unknown"
FT   assembly_gap    8137952..8138275
FT                   /estimated_length=324
FT                   /gap_type="unknown"
FT   gene            <8139487..>8140230
FT                   /locus_tag="mCG_1043341"
FT                   /note="gene_id=mCG1043341.0"
FT   mRNA            <8139487..>8140230
FT                   /locus_tag="mCG_1043341"
FT                   /product="mCG1043341"
FT                   /note="gene_id=mCG1043341.0 transcript_id=mCT161045.0
FT                   created on 20-FEB-2003"
FT   CDS             8139487..8140230
FT                   /codon_start=1
FT                   /locus_tag="mCG_1043341"
FT                   /product="mCG1043341"
FT                   /note="gene_id=mCG1043341.0 transcript_id=mCT161045.0
FT                   protein_id=mCP75992.0"
FT                   /protein_id="EDL31071.1"
FT                   /translation="MLPSSMNSVEVYSGANRILKKKKKVKNGSLLIDSSTTDPSVSKEL
FT                   AKEVEKMGAVFMDSPVSSSVGAVRSGNLTFMVGRVEDEFAASQELLECVGSNVLHCGAV
FT                   GTGQSAEICNNMLLALSIIGTTEAMNLGIRSGLGPKLLAKILNMTSGQCWSRDTYNPVP
FT                   GVIHGIPSPNSYQGGFETTLMAKDLGLAQDSATSTKTPILLGSLAHQIYRMMCSKGYSK
FT                   KDFSSVSVSTGGGALLTVPCGCGHC"
FT   assembly_gap    8161115..8172633
FT                   /estimated_length=11519
FT                   /gap_type="unknown"
FT   assembly_gap    8176919..8176938
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8204668..8204687
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8212352..8212371
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8213460..8213479
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8216882..8216901
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8236048..8236067
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8263912..8263931
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8280641..8280787
FT                   /estimated_length=147
FT                   /gap_type="unknown"
FT   assembly_gap    8305511..8305639
FT                   /estimated_length=129
FT                   /gap_type="unknown"
FT   gene            complement(8312610..>8494573)
FT                   /gene="Cdk5rap2"
FT                   /locus_tag="mCG_142404"
FT                   /note="gene_id=mCG142404.0"
FT   mRNA            complement(join(8312610..8313985,8314401..8314447,
FT                   8319472..8319598,8326225..8326368,8329058..8329323,
FT                   8330163..8330240,8333349..8333473,8334274..8334463,
FT                   8336259..8336375,8341231..8341350,8345514..8345692,
FT                   8348212..8348260,8355383..8355615,8357367..8357940,
FT                   8363536..8363667,8367362..8367596,8371978..8372410,
FT                   8380718..8380902,8382705..8382800,8389703..8389831,
FT                   8391449..8391558,8392967..8393097,8398081..8398169,
FT                   8406171..8406316,8408281..8408451,8428270..8428488,
FT                   8433862..8433963,8437386..8437505,8438327..8438368,
FT                   8439430..8439592,8445525..8445679,8448720..8448843,
FT                   8461149..8461225,8464547..8464657,8485468..8485535,
FT                   8487697..8487764,8494435..>8494573))
FT                   /gene="Cdk5rap2"
FT                   /locus_tag="mCG_142404"
FT                   /product="CDK5 regulatory subunit associated protein 2"
FT                   /note="gene_id=mCG142404.0 transcript_id=mCT180387.0
FT                   created on 11-FEB-2003"
FT   CDS             complement(join(8313929..8313985,8314401..8314447,
FT                   8319472..8319598,8326225..8326368,8329058..8329323,
FT                   8330163..8330240,8333349..8333473,8334274..8334463,
FT                   8336259..8336375,8341231..8341350,8345514..8345692,
FT                   8348212..8348260,8355383..8355615,8357367..8357940,
FT                   8363536..8363667,8367362..8367596,8371978..8372410,
FT                   8380718..8380902,8382705..8382800,8389703..8389831,
FT                   8391449..8391558,8392967..8393097,8398081..8398169,
FT                   8406171..>8406305))
FT                   /codon_start=1
FT                   /gene="Cdk5rap2"
FT                   /locus_tag="mCG_142404"
FT                   /product="CDK5 regulatory subunit associated protein 2"
FT                   /note="gene_id=mCG142404.0 transcript_id=mCT180387.0
FT                   protein_id=mCP103309.0"
FT                   /protein_id="EDL31069.1"
FT                   /translation="KRFGSNTAELLFNDCRGAQVWERWLNNRKVFSAVTRQQTHLLQGK
FT                   QQSEYEGLTGDLKAEQNIYAHLAKTQDTDSVSNLQAELKEVLALRKQLEQDVLAYRNLQ
FT                   KALQEQLSEIRSREEEPFSFYSDQTSYLSICLEEHNQFQLEHFSQEELKKKVSDLIQLV
FT                   KDLHTDNQHLKKTIFDLSSVGFQGSDRLELTKQEELVASKEDEDTLKFEADVETPFQSD
FT                   QHLEQSREIMEDYAEGGCKSGYGRHMDSNILGHDGAQTPGASEEHTLEDELLGLLATLF
FT                   SKKATPLLESRPDLLKALGALLLERICLAEQGRPGDHLDSKTEKALQQVAVQLRDELGH
FT                   SFPANSFSKSYNEVKSMWGNWLVKTGDEDTVELKSVSVQTMAIEDTPHGFKPQSKRDAW
FT                   AEKQEEAIFSTELESEALGEMPGQQATHLSFPSAINPDAEKTGLLIQLKTPELLENLYN
FT                   LPASPEVVVAQLQGQVLELQRELKEFKTRNKQLHEKLILAEAMMEGLPVPNSALVNVPA
FT                   AQAVVRTAFQDNPGEQEGPETTQSAGRDKDMDSDQYTSFEIDSEICPPDDLALLPACKE
FT                   NLEDLLGPSSIATYLDSKSQLSVKVSVNGTDQSENINIPDDTEDLKQKIHDLQTELEGY
FT                   RNIIVQLLKHSQCSEAIITVLCGTEGAQDGLNKPKGHIDEEEMTFSSLHQVRYVKHMKI
FT                   LRPLTPEMIDGKMLESLKQQLVDQEQELQKEQDLNLELFGEIHDLQNKFQDLSPSRYDS
FT                   LVQSQARELSLQRQQIKDSHGICVIYRQHMSTMIKAFEELLQASDVDSCVAEGFREQLT
FT                   QCAGLLEQLERLFLHGKSARVEPHPQNELLKGLRTVEGNLPYHHLLPESPEPSASHALS
FT                   DDEMSEKSFLSRDPKPDSDTEKYPAMASHFPQDLLMEHIQEIRTLRKHLEESIKTNEKL
FT                   RKQLERQGSETDQGSRNVSACGLALHSSLTSEIHFLRKQNEALSMMLEKGSKDKQKESE
FT                   KLRESLARKAESLEQLQLEYTSVREENERLQRDIIEKERHNQELTEEVCSSRQELSRVQ
FT                   EEAKSRQQLLSQKDKLLQSLQMELKVYEKLAEEHPRLQQDGSKCPEASDNSFDLFESTQ
FT                   AMAPKSASETPLLSGTDVDSLSCDSTSSATSPTSMPCLVAGHHMWASKSGHHMLGLIED
FT                   YDALYKQISWGQTLLAKMDVQTQEALSPTSHKLGPKGSSSVPLSKFLSSMNTAKLVLEK
FT                   ASRLLKLFWRVSVPTNGQCSLHCEQIGEMKAENTKLHKKLFEQEKKLQNTAKLLQQSKH
FT                   QEKVIFDQLVITHQVLRKARGNLELRPGATRPGASSPSRPGS"
FT   gene            complement(8339373..8340288)
FT                   /locus_tag="mCG_126220"
FT                   /note="gene_id=mCG126220.0"
FT   mRNA            complement(8339373..8340288)
FT                   /locus_tag="mCG_126220"
FT                   /product="mCG126220"
FT                   /note="gene_id=mCG126220.0 transcript_id=mCT127487.0
FT                   created on 30-OCT-2002"
FT   CDS             complement(8339514..8340251)
FT                   /codon_start=1
FT                   /locus_tag="mCG_126220"
FT                   /product="mCG126220"
FT                   /note="gene_id=mCG126220.0 transcript_id=mCT127487.0
FT                   protein_id=mCP76024.1"
FT                   /db_xref="GOA:A3KML3"
FT                   /db_xref="InterPro:IPR000308"
FT                   /db_xref="InterPro:IPR023409"
FT                   /db_xref="InterPro:IPR023410"
FT                   /db_xref="UniProtKB/TrEMBL:A3KML3"
FT                   /protein_id="EDL31070.1"
FT                   /translation="MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLS
FT                   VAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKY
FT                   LIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIENSQGAYQEAFDISKKEMQPT
FT                   HPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLR
FT                   DNLTLWTSDSAGEECDAAEGAEN"
FT   assembly_gap    8351954..8351973
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8377963..8377982
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8425021..8425201
FT                   /estimated_length=181
FT                   /gap_type="unknown"
FT   assembly_gap    8455599..8456589
FT                   /estimated_length=991
FT                   /gap_type="unknown"
FT   assembly_gap    8471283..8471483
FT                   /estimated_length=201
FT                   /gap_type="unknown"
FT   gene            complement(8516026..8615879)
FT                   /gene="Megf9"
FT                   /locus_tag="mCG_7348"
FT                   /note="gene_id=mCG7348.1"
FT   mRNA            complement(join(8516026..8517758,8519444..8519713,
FT                   8533007..8533150,8540200..8540339,8569050..8569251,
FT                   8615106..8615879))
FT                   /gene="Megf9"
FT                   /locus_tag="mCG_7348"
FT                   /product="multiple EGF-like-domains 9"
FT                   /note="gene_id=mCG7348.1 transcript_id=mCT6342.1 created on
FT                   30-OCT-2002"
FT   CDS             complement(join(8517307..8517758,8519444..8519713,
FT                   8533007..8533150,8540200..8540339,8569050..8569251,
FT                   8615106..8615700))
FT                   /codon_start=1
FT                   /gene="Megf9"
FT                   /locus_tag="mCG_7348"
FT                   /product="multiple EGF-like-domains 9"
FT                   /note="gene_id=mCG7348.1 transcript_id=mCT6342.1
FT                   protein_id=mCP20154.1"
FT                   /db_xref="InterPro:IPR001368"
FT                   /db_xref="InterPro:IPR002049"
FT                   /db_xref="MGI:MGI:1918264"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VGR4"
FT                   /protein_id="EDL31068.1"
FT                   /translation="MNGGAERAMRSLPSLGGLALLCCAAAAAASTASAGNVTGGGGAEG
FT                   QVVPSPSPGLRDQASSPFPKTAAPTAQAPRTGPPRTTVRKTGATTPSAGSPEIIPPLRT
FT                   SAQPAATPFPALDLSPATPSEDGHTPTTESPPSRPAPTTLASTVGQPPTTSVVTTAQAS
FT                   STPGTPTAESPDRSSNSSGVPPTAPVTEAPTSPPPEHMCNCSEVGSLDVKRCNQTTGQC
FT                   DCHVGYQGLHCDTCKEGFYLNHTVGLCLPCHCSPHGAVSILCNSSGNCQCKVGVTGSMC
FT                   DKCQDGHYGFGKTGCLPCQCNNRSDSCDVHTGACLNCQENSKGEHCEECKEGFYPSPDA
FT                   AKQCHRCPCSAVTSTGNCTIESGELEPTCDQCKDGYTGQNCNKCENGYYNSDSICTQCE
FT                   CHGHVDPIKTPKICKPESGECINCLHNTTGFWCEKCLEGYVRDLQRNCIKQEVIVPTPE
FT                   GSTILVSNASLTTSVPTPVINSTFAPTTLQTIFAVSSSENSTSALADVSWTQFNIIILT
FT                   VIIIVVVLLMGFVGAVYMYREYQNRKLNAPFWTIELKEDNISFSSYHDSIPNADVSGLL
FT                   EDDANEVAPNGQLTLTTPIHNYKA"
FT   assembly_gap    8524884..8525036
FT                   /estimated_length=153
FT                   /gap_type="unknown"
FT   assembly_gap    8541389..8541408
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8546276..8546295
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8547473..8547492
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8562007..8562026
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8567894..8567920
FT                   /estimated_length=27
FT                   /gap_type="unknown"
FT   assembly_gap    8574532..8574551
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8594676..8594695
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8607156..8607175
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8618368..8618387
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8667009..8667028
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8670196..8671565
FT                   /estimated_length=1370
FT                   /gap_type="unknown"
FT   assembly_gap    8673089..8673227
FT                   /estimated_length=139
FT                   /gap_type="unknown"
FT   assembly_gap    8676211..8676230
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8679153..8708148
FT                   /estimated_length=28996
FT                   /gap_type="unknown"
FT   assembly_gap    8709194..8709213
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8710221..8710240
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8712995..8713427
FT                   /estimated_length=433
FT                   /gap_type="unknown"
FT   assembly_gap    8729912..8729931
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8775701..8776128
FT                   /estimated_length=428
FT                   /gap_type="unknown"
FT   assembly_gap    8784759..8784778
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8788300..8788319
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8795804..8795870
FT                   /estimated_length=67
FT                   /gap_type="unknown"
FT   assembly_gap    8830919..8831624
FT                   /estimated_length=706
FT                   /gap_type="unknown"
FT   assembly_gap    8835365..8835977
FT                   /estimated_length=613
FT                   /gap_type="unknown"
FT   assembly_gap    8922233..8925082
FT                   /estimated_length=2850
FT                   /gap_type="unknown"
FT   assembly_gap    8927412..8927837
FT                   /estimated_length=426
FT                   /gap_type="unknown"
FT   assembly_gap    8939610..8939629
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8941861..8941880
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8945084..8945103
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8946225..8947154
FT                   /estimated_length=930
FT                   /gap_type="unknown"
FT   assembly_gap    8951601..8952501
FT                   /estimated_length=901
FT                   /gap_type="unknown"
FT   assembly_gap    8995476..8995495
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9036115..9036134
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9047284..9047825
FT                   /estimated_length=542
FT                   /gap_type="unknown"
FT   assembly_gap    9078615..9079517
FT                   /estimated_length=903
FT                   /gap_type="unknown"
FT   assembly_gap    9086894..9086913
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9087919..9087938
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9089551..9089570
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9118510..9118692
FT                   /estimated_length=183
FT                   /gap_type="unknown"
FT   gene            complement(9154660..>9212834)
FT                   /locus_tag="mCG_144804"
FT                   /note="gene_id=mCG144804.0"
FT   mRNA            complement(join(9154660..9156356,9211453..9211682,
FT                   9212748..>9212834))
FT                   /locus_tag="mCG_144804"
FT                   /product="mCG144804"
FT                   /note="gene_id=mCG144804.0 transcript_id=mCT184228.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(9155065..>9155292)
FT                   /codon_start=1
FT                   /locus_tag="mCG_144804"
FT                   /product="mCG144804"
FT                   /note="gene_id=mCG144804.0 transcript_id=mCT184228.0
FT                   protein_id=mCP105830.0"
FT                   /protein_id="EDL31067.1"
FT                   /translation="NSRFPHCIFNIHVVSLDPSTDLSFSHSSLLSFLISHSHSYCMTFY
FT                   FCISHVYSLTKYLTDNFLYLGNIQISNSEY"
FT   assembly_gap    9158690..9158709
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9160503..9160522
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9165388..9165407
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9170280..9171959
FT                   /estimated_length=1680
FT                   /gap_type="unknown"
FT   assembly_gap    9180665..9180908
FT                   /estimated_length=244
FT                   /gap_type="unknown"
FT   assembly_gap    9211929..9211948
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9221475..9224753
FT                   /estimated_length=3279
FT                   /gap_type="unknown"
FT   assembly_gap    9250610..9250712
FT                   /estimated_length=103
FT                   /gap_type="unknown"
FT   assembly_gap    9320660..9320905
FT                   /estimated_length=246
FT                   /gap_type="unknown"
FT   assembly_gap    9352801..9352827
FT                   /estimated_length=27
FT                   /gap_type="unknown"
FT   assembly_gap    9377034..9377053
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9407043..9407062
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9417682..9418044
FT                   /estimated_length=363
FT                   /gap_type="unknown"
FT   assembly_gap    9428528..9428608
FT                   /estimated_length=81
FT                   /gap_type="unknown"
FT   assembly_gap    9431131..9431184
FT                   /estimated_length=54
FT                   /gap_type="unknown"
FT   assembly_gap    9445280..9445395
FT                   /estimated_length=116
FT                   /gap_type="unknown"
FT   assembly_gap    9465509..9466413
FT                   /estimated_length=905
FT                   /gap_type="unknown"
FT   assembly_gap    9499484..9499503
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9500557..9500576
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9503371..9503390
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9521896..9522543
FT                   /estimated_length=648
FT                   /gap_type="unknown"
FT   assembly_gap    9525862..9526649
FT                   /estimated_length=788
FT                   /gap_type="unknown"
FT   assembly_gap    9551595..9551614
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9553519..9553538
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9555622..9555641
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9580162..9580181
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9597640..9597659
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9626538..9627052
FT                   /estimated_length=515
FT                   /gap_type="unknown"
FT   assembly_gap    9666742..9666761
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9697503..9697522
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9764207..9764269
FT                   /estimated_length=63
FT                   /gap_type="unknown"
FT   assembly_gap    9795573..9795592
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9798873..9798892
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9807083..9807102
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9808272..9808291
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9823493..9823802
FT                   /estimated_length=310
FT                   /gap_type="unknown"
FT   assembly_gap    9827076..9827948
FT                   /estimated_length=873
FT                   /gap_type="unknown"
FT   assembly_gap    9830948..9833148
FT                   /estimated_length=2201
FT                   /gap_type="unknown"
FT   assembly_gap    9871227..9871275
FT                   /estimated_length=49
FT                   /gap_type="unknown"
FT   assembly_gap    9872285..9874402
FT                   /estimated_length=2118
FT                   /gap_type="unknown"
FT   assembly_gap    9875794..9877853
FT                   /estimated_length=2060
FT                   /gap_type="unknown"
FT   assembly_gap    9885480..9885835
FT                   /estimated_length=356
FT                   /gap_type="unknown"
FT   assembly_gap    9892878..9892972
FT                   /estimated_length=95
FT                   /gap_type="unknown"
FT   assembly_gap    9903383..9905296
FT                   /estimated_length=1914
FT                   /gap_type="unknown"
FT   assembly_gap    9917893..9917914
FT                   /estimated_length=22
FT                   /gap_type="unknown"
FT   assembly_gap    9943594..9945839
FT                   /estimated_length=2246
FT                   /gap_type="unknown"
FT   assembly_gap    9969168..9969187
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9975421..9975440
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9990541..9990956
FT                   /estimated_length=416
FT                   /gap_type="unknown"
FT   assembly_gap    9992497..9993400
FT                   /estimated_length=904
FT                   /gap_type="unknown"
FT   assembly_gap    9994558..9994577
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9995735..9997167
FT                   /estimated_length=1433
FT                   /gap_type="unknown"
FT   assembly_gap    9998260..9998432
FT                   /estimated_length=173
FT                   /gap_type="unknown"
FT   assembly_gap    10002417..10004536
FT                   /estimated_length=2120
FT                   /gap_type="unknown"
FT   assembly_gap    10025431..10025561
FT                   /estimated_length=131
FT                   /gap_type="unknown"
FT   assembly_gap    10031318..10031337
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10032425..10032444
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10036562..10036581
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10052650..10054702
FT                   /estimated_length=2053
FT                   /gap_type="unknown"
FT   assembly_gap    10059415..10064030
FT                   /estimated_length=4616
FT                   /gap_type="unknown"
FT   gene            10068464..10087573
FT                   /locus_tag="mCG_148061"
FT                   /note="gene_id=mCG148061.0"
FT   mRNA            join(10068464..10068609,10086873..10087573)
FT                   /locus_tag="mCG_148061"
FT                   /product="mCG148061"
FT                   /note="gene_id=mCG148061.0 transcript_id=mCT188324.0
FT                   created on 13-JAN-2004"
FT   CDS             10087307..10087492
FT                   /codon_start=1
FT                   /locus_tag="mCG_148061"
FT                   /product="mCG148061"
FT                   /note="gene_id=mCG148061.0 transcript_id=mCT188324.0
FT                   protein_id=mCP109400.0"
FT                   /protein_id="EDL31066.1"
FT                   /translation="MNQTFMISFESYLSFSWSQAREASQLPCLAFKIPCKNERTKQNME
FT                   ISGHCPGRDASSLFKE"
FT   assembly_gap    10103197..10103220
FT                   /estimated_length=24
FT                   /gap_type="unknown"
FT   assembly_gap    10122158..10122308
FT                   /estimated_length=151
FT                   /gap_type="unknown"
FT   assembly_gap    10138743..10138762
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10153320..10153339
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10160404..10166127
FT                   /estimated_length=5724
FT                   /gap_type="unknown"
FT   assembly_gap    10167473..10169248
FT                   /estimated_length=1776
FT                   /gap_type="unknown"
FT   assembly_gap    10169916..10171377
FT                   /estimated_length=1462
FT                   /gap_type="unknown"
FT   gene            complement(10194369..>10277181)
FT                   /locus_tag="mCG_2299"
FT                   /note="gene_id=mCG2299.3"
FT   mRNA            complement(join(10194369..10194935,10195035..10195111,
FT                   10196684..10196834,10198888..10199035,10201155..10201402,
FT                   10202571..10202820,10213479..10213555,10214889..10215085,
FT                   10216086..10216230,10217558..10217710,10218224..10218277,
FT                   10221707..10221817,10233909..10233925,10234659..10234860,
FT                   10245567..10245641,10247147..10247209,10274231..10274275,
FT                   10274376..10274439,10275755..10275855,10276440..>10277181))
FT                   /locus_tag="mCG_2299"
FT                   /product="mCG2299, transcript variant mCT192864"
FT                   /note="gene_id=mCG2299.3 transcript_id=mCT192864.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(10194565..10194935,10195035..10195111,
FT                   10196684..10196834,10198888..10199035,10201155..10201402,
FT                   10202571..10202820,10213479..10213555,10214889..10215085,
FT                   10216086..10216230,10217558..10217710,10218224..10218277,
FT                   10221707..10221817,10274231..10274275,10274376..10274439,
FT                   10275755..10275855,10276440..>10276510))
FT                   /locus_tag="mCG_2299"
FT                   /product="mCG2299, transcript variant mCT192865"
FT                   /note="gene_id=mCG2299.3 transcript_id=mCT192865.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(10194565..10194935,10195035..10195111,
FT                   10196684..10196834,10198888..10199035,10201155..10201402,
FT                   10202571..10202820,10213479..10213555,10214889..10215085,
FT                   10216086..10216230,10217558..10217710,10218224..10218277,
FT                   10221707..10221817,10245567..10245641,10247147..10247209,
FT                   10274231..10274275,10274376..10274439,10275755..10275855,
FT                   10276440..>10276509))
FT                   /locus_tag="mCG_2299"
FT                   /product="mCG2299, transcript variant mCT192866"
FT                   /note="gene_id=mCG2299.3 transcript_id=mCT192866.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(10194825..10194935,10195035..10195111,
FT                   10196684..10196834,10198888..10199035,10201155..10201402,
FT                   10202571..10202820,10213479..10213555,10214889..10215085,
FT                   10216086..10216230,10217558..10217710,10218224..10218277,
FT                   10221707..10221819,10234647..10234863,10245567..10245641,
FT                   10247147..10247209,10274231..10274275,10274376..10274439,
FT                   10275755..10275855,10276440..10276849))
FT                   /locus_tag="mCG_2299"
FT                   /product="mCG2299, transcript variant mCT1623"
FT                   /note="gene_id=mCG2299.3 transcript_id=mCT1623.2 created on
FT                   08-OCT-2002"
FT   CDS             complement(join(10194828..10194935,10195035..10195111,
FT                   10196684..10196834,10198888..10199035,10201155..10201402,
FT                   10202571..10202820,10213479..10213555,10214889..10215085,
FT                   10216086..10216230,10217558..10217710,10218224..10218277,
FT                   10221707..10221817,10233909..10233925,10234659..10234860,
FT                   10245567..10245641,10247147..10247209,10274231..10274275,
FT                   10274376..10274439,10275755..10275855,10276440..>10276619))
FT                   /codon_start=1
FT                   /locus_tag="mCG_2299"
FT                   /product="mCG2299, isoform CRA_b"
FT                   /note="gene_id=mCG2299.3 transcript_id=mCT192864.0
FT                   protein_id=mCP113810.0 isoform=CRA_b"
FT                   /protein_id="EDL31063.1"
FT                   /translation="GRGPHPSRPGLASRVPRAPACCAASRSSAGFKLEVARRIELSRNR
FT                   AAAAARAMFPQSRHPTPHQAAGQPFKFTIPESLDRIKEEFQFLQAQYHSLKLECEKLAS
FT                   EKTEMQRHYVMYYEMSYGLNIEMHKQTEIAKRLNTICAQVIPFLSQEHQQQVAQAVERA
FT                   KQVTMAELNAIIGQQLQAQHLSHGHGPPVPLTPHPSGLQPPGIPPLGGSASLLALSSAL
FT                   SGQSHLAIKDDKKHHDAERHRDREPGTSNSLLVPDSLRGTDKRRNGPEFSSDIKKRKVD
FT                   DKDNYDSDGDKSDDNLVVDVSNEDPSSPHASPTHSPRENGIDKNRLLKKDASGSPASTA
FT                   SSGSSSSLKSKEVSLHEKANTPVLKSSTPTPRSDMPTPGTSATPGLRPGLGKPPAMEPL
FT                   VNQAAAGLRTPLAVPGPYPAPFGMVPHAGMNGELTSPGAAYAGLHSMSPQMSAAAAAAA
FT                   AAVVAYGRSPMVGFDPPPHMRVPSIPPNLAGIPGGKPAYSFHVTADGQMQPVPFPPDAL
FT                   IGPGIPRHARQINTLNHGEVVCAVTISNPTRHVYTGGKGCVKVWDISHPGNKSPVSQLD
FT                   CLNRDNYIRSCKLLPDGCTLIVGGEASTLSIWDLAAPTPRIKAELTSSAPACYALAISP
FT                   DSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLDNTVRSW
FT                   DLREGRQLQQHDFTSQIFSLGYCPTGEWLAVGMESSNVEVLHVNKPDKYQLHLHESCVL
FT                   SLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISVDDKYIVTGSGDK
FT                   KATVYEVIY"
FT   CDS             complement(join(10194828..10194935,10195035..10195111,
FT                   10196684..10196834,10198888..10199035,10201155..10201402,
FT                   10202571..10202820,10213479..10213555,10214889..10215085,
FT                   10216086..10216230,10217558..10217710,10218224..10218277,
FT                   10221707..10221817,10274231..10274275,10274376..10274439,
FT                   10275755..10275855,10276440..>10276508))
FT                   /codon_start=1
FT                   /locus_tag="mCG_2299"
FT                   /product="mCG2299, isoform CRA_c"
FT                   /note="gene_id=mCG2299.3 transcript_id=mCT192865.0
FT                   protein_id=mCP113811.0 isoform=CRA_c"
FT                   /protein_id="EDL31064.1"
FT                   /translation="RIELSRNRAAAAARAMFPQSRHPTPHQAAGQPFKFTIPESLDRIK
FT                   EEFQFLQAQYHSLKLECEKLASEKTEMQRHYVMYYEMSYGLNIEMHKQSNSLLVPDSLR
FT                   GTDKRRNGPEFSSDIKKRKVDDKDNYDSDGDKSDDNLVVDVSNEDPSSPHASPTHSPRE
FT                   NGIDKNRLLKKDASGSPASTASSGSSSSLKSKEVSLHEKANTPVLKSSTPTPRSDMPTP
FT                   GTSATPGLRPGLGKPPAMEPLVNQAAAGLRTPLAVPGPYPAPFGMVPHAGMNGELTSPG
FT                   AAYAGLHSMSPQMSAAAAAAAAAVVAYGRSPMVGFDPPPHMRVPSIPPNLAGIPGGKPA
FT                   YSFHVTADGQMQPVPFPPDALIGPGIPRHARQINTLNHGEVVCAVTISNPTRHVYTGGK
FT                   GCVKVWDISHPGNKSPVSQLDCLNRDNYIRSCKLLPDGCTLIVGGEASTLSIWDLAAPT
FT                   PRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCI
FT                   DISNDGTKLWTGGLDNTVRSWDLREGRQLQQHDFTSQIFSLGYCPTGEWLAVGMESSNV
FT                   EVLHVNKPDKYQLHLHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESS
FT                   SVLSCDISVDDKYIVTGSGDKKATVYEVIY"
FT   CDS             complement(join(10194828..10194935,10195035..10195111,
FT                   10196684..10196834,10198888..10199035,10201155..10201402,
FT                   10202571..10202820,10213479..10213555,10214889..10215085,
FT                   10216086..10216230,10217558..10217710,10218224..10218277,
FT                   10221707..10221817,10245567..10245641,10247147..10247209,
FT                   10274231..10274275,10274376..10274439,10275755..10275855,
FT                   10276440..>10276508))
FT                   /codon_start=1
FT                   /locus_tag="mCG_2299"
FT                   /product="mCG2299, isoform CRA_d"
FT                   /note="gene_id=mCG2299.3 transcript_id=mCT192866.0
FT                   protein_id=mCP113812.0 isoform=CRA_d"
FT                   /protein_id="EDL31065.1"
FT                   /translation="RIELSRNRAAAAARAMFPQSRHPTPHQAAGQPFKFTIPESLDRIK
FT                   EEFQFLQAQYHSLKLECEKLASEKTEMQRHYVMYYEMSYGLNIEMHKQTEIAKRLNTIC
FT                   AQVIPFLSQEHQQQVAQAVERAKQVTMAELNAIIGSNSLLVPDSLRGTDKRRNGPEFSS
FT                   DIKKRKVDDKDNYDSDGDKSDDNLVVDVSNEDPSSPHASPTHSPRENGIDKNRLLKKDA
FT                   SGSPASTASSGSSSSLKSKEVSLHEKANTPVLKSSTPTPRSDMPTPGTSATPGLRPGLG
FT                   KPPAMEPLVNQAAAGLRTPLAVPGPYPAPFGMVPHAGMNGELTSPGAAYAGLHSMSPQM
FT                   SAAAAAAAAAVVAYGRSPMVGFDPPPHMRVPSIPPNLAGIPGGKPAYSFHVTADGQMQP
FT                   VPFPPDALIGPGIPRHARQINTLNHGEVVCAVTISNPTRHVYTGGKGCVKVWDISHPGN
FT                   KSPVSQLDCLNRDNYIRSCKLLPDGCTLIVGGEASTLSIWDLAAPTPRIKAELTSSAPA
FT                   CYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGG
FT                   LDNTVRSWDLREGRQLQQHDFTSQIFSLGYCPTGEWLAVGMESSNVEVLHVNKPDKYQL
FT                   HLHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISVDDKY
FT                   IVTGSGDKKATVYEVIY"
FT   CDS             complement(join(10194828..10194935,10195035..10195111,
FT                   10196684..10196834,10198888..10199035,10201155..10201402,
FT                   10202571..10202820,10213479..10213555,10214889..10215085,
FT                   10216086..10216230,10217558..10217710,10218224..10218277,
FT                   10221707..10221819,10234647..10234863,10245567..10245641,
FT                   10247147..10247209,10274231..10274275,10274376..10274439,
FT                   10275755..10275855,10276440..10276463))
FT                   /codon_start=1
FT                   /locus_tag="mCG_2299"
FT                   /product="mCG2299, isoform CRA_a"
FT                   /note="gene_id=mCG2299.3 transcript_id=mCT1623.2
FT                   protein_id=mCP6425.2 isoform=CRA_a"
FT                   /protein_id="EDL31062.1"
FT                   /translation="MFPQSRHPTPHQAAGQPFKFTIPESLDRIKEEFQFLQAQYHSLKL
FT                   ECEKLASEKTEMQRHYVMYYEMSYGLNIEMHKQTEIAKRLNTICAQVIPFLSQEHQQQV
FT                   AQAVERAKQVTMAELNAIIGQQQLQAQHLSHGHGPPVPLTPHPSGLQPPGIPPLGGSAS
FT                   LLALSSALSGQSHLAIKDDKKHHDAERHRGERPESNSLLVPDSLRGTDKRRNGPEFSSD
FT                   IKKRKVDDKDNYDSDGDKSDDNLVVDVSNEDPSSPHASPTHSPRENGIDKNRLLKKDAS
FT                   GSPASTASSGSSSSLKSKEVSLHEKANTPVLKSSTPTPRSDMPTPGTSATPGLRPGLGK
FT                   PPAMEPLVNQAAAGLRTPLAVPGPYPAPFGMVPHAGMNGELTSPGAAYAGLHSMSPQMS
FT                   AAAAAAAAAVVAYGRSPMVGFDPPPHMRVPSIPPNLAGIPGGKPAYSFHVTADGQMQPV
FT                   PFPPDALIGPGIPRHARQINTLNHGEVVCAVTISNPTRHVYTGGKGCVKVWDISHPGNK
FT                   SPVSQLDCLNRDNYIRSCKLLPDGCTLIVGGEASTLSIWDLAAPTPRIKAELTSSAPAC
FT                   YALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGL
FT                   DNTVRSWDLREGRQLQQHDFTSQIFSLGYCPTGEWLAVGMESSNVEVLHVNKPDKYQLH
FT                   LHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISVDDKYI
FT                   VTGSGDKKATVYEVIY"
FT   assembly_gap    10199869..10199888
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10232668..10233030
FT                   /estimated_length=363
FT                   /gap_type="unknown"
FT   gene            <10277803..10291819
FT                   /locus_tag="mCG_145485"
FT                   /note="gene_id=mCG145485.0"
FT   mRNA            join(<10277803..10278728,10289298..10289569,
FT                   10290432..10291819)
FT                   /locus_tag="mCG_145485"
FT                   /product="mCG145485"
FT                   /note="gene_id=mCG145485.0 transcript_id=mCT184909.0
FT                   created on 05-JUN-2003"
FT   CDS             <10290721..10291029
FT                   /codon_start=1
FT                   /locus_tag="mCG_145485"
FT                   /product="mCG145485"
FT                   /note="gene_id=mCG145485.0 transcript_id=mCT184909.0
FT                   protein_id=mCP105839.0"
FT                   /protein_id="EDL31061.1"
FT                   /translation="LSVKPLCTCAHWLFTQIYRWWPAVAGAILSWRMWLPTPRSYRYCL
FT                   NSGKCIWEASLPCPQCFHVVTHHLWLLHSLNPSFHMIPKPLKLGEYTGIYVLLYRKG"
FT   assembly_gap    10299313..10299332
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10300629..10300648
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10326617..10326638
FT                   /estimated_length=22
FT                   /gap_type="unknown"
FT   assembly_gap    10371894..10371913
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10375506..10375554
FT                   /estimated_length=49
FT                   /gap_type="unknown"
FT   assembly_gap    10378638..10378657
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10391661..10391680
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10442958..10443060
FT                   /estimated_length=103
FT                   /gap_type="unknown"
FT   assembly_gap    10462277..10462398
FT                   /estimated_length=122
FT                   /gap_type="unknown"
FT   assembly_gap    10475126..10475145
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10484543..10484816
FT                   /estimated_length=274
FT                   /gap_type="unknown"
FT   assembly_gap    10493547..10493774
FT                   /estimated_length=228
FT                   /gap_type="unknown"
FT   assembly_gap    10507423..10507484
FT                   /estimated_length=62
FT                   /gap_type="unknown"
FT   assembly_gap    10525108..10525380
FT                   /estimated_length=273
FT                   /gap_type="unknown"
FT   assembly_gap    10551135..10551641
FT                   /estimated_length=507
FT                   /gap_type="unknown"
FT   assembly_gap    10561888..10561907
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10563114..10563133
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10565024..10565043
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10568747..10568766
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10575347..10575366
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10585542..10585561
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10592872..10594457
FT                   /estimated_length=1586
FT                   /gap_type="unknown"
FT   assembly_gap    10603148..10604108
FT                   /estimated_length=961
FT                   /gap_type="unknown"
FT   assembly_gap    10610467..10610950
FT                   /estimated_length=484
FT                   /gap_type="unknown"
FT   gene            10612374..10618851
FT                   /locus_tag="mCG_1043340"
FT                   /note="gene_id=mCG1043340.1"
FT   mRNA            join(10612374..10612813,10618557..10618851)
FT                   /locus_tag="mCG_1043340"
FT                   /product="mCG1043340"
FT                   /note="gene_id=mCG1043340.1 transcript_id=mCT161044.1
FT                   created on 02-APR-2003"
FT   CDS             10612411..10612713
FT                   /codon_start=1
FT                   /locus_tag="mCG_1043340"
FT                   /product="mCG1043340"
FT                   /note="gene_id=mCG1043340.1 transcript_id=mCT161044.1
FT                   protein_id=mCP75985.0"
FT                   /protein_id="EDL31060.1"
FT                   /translation="MAPEVIIRAKGEGHGRGADIWSLGCVVIEMVTGKRPWHEYEHNFQ
FT                   IMYKVGMGHKPPIPERLSPEGKAFLSHCLESDPKIQWTASQLLDHAFVKVCTDEE"
FT   assembly_gap    10616496..10618550
FT                   /estimated_length=2055
FT                   /gap_type="unknown"
FT   assembly_gap    10649222..10649739
FT                   /estimated_length=518
FT                   /gap_type="unknown"
FT   assembly_gap    10651922..10651941
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10705322..10705341
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10706434..10706453
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10708663..10708682
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10709769..10710180
FT                   /estimated_length=412
FT                   /gap_type="unknown"
FT   assembly_gap    10711233..10711252
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10713082..10713101
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10744646..10744665
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10748417..10753711
FT                   /estimated_length=5295
FT                   /gap_type="unknown"
FT   assembly_gap    10774771..10781214
FT                   /estimated_length=6444
FT                   /gap_type="unknown"
FT   assembly_gap    10793554..10793573
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10808572..10808814
FT                   /estimated_length=243
FT                   /gap_type="unknown"
FT   assembly_gap    10894493..10894512
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10896504..10897467
FT                   /estimated_length=964
FT                   /gap_type="unknown"
FT   assembly_gap    10920095..10920114
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10939488..10939507
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10977537..10977556
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10999420..10999439
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11001950..11001969
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11027756..11028138
FT                   /estimated_length=383
FT                   /gap_type="unknown"
FT   assembly_gap    11032199..11032218
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11033665..11035229
FT                   /estimated_length=1565
FT                   /gap_type="unknown"
FT   assembly_gap    11041838..11041857
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11058330..11058349
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11062308..11062400
FT                   /estimated_length=93
FT                   /gap_type="unknown"
FT   assembly_gap    11071157..11071176
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11076863..11076882
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11077925..11077944
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11102284..11102303
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11110780..11110923
FT                   /estimated_length=144
FT                   /gap_type="unknown"
FT   assembly_gap    11122299..11122525
FT                   /estimated_length=227
FT                   /gap_type="unknown"
FT   assembly_gap    11123816..11123925
FT                   /estimated_length=110
FT                   /gap_type="unknown"
FT   assembly_gap    11146677..11146696
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11147931..11148191
FT                   /estimated_length=261
FT                   /gap_type="unknown"
FT   assembly_gap    11166248..11166267
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11197391..11197410
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11212112..11212131
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11258209..11262861
FT                   /estimated_length=4653
FT                   /gap_type="unknown"
FT   assembly_gap    11264361..11268306
FT                   /estimated_length=3946
FT                   /gap_type="unknown"
FT   assembly_gap    11274341..11278511
FT                   /estimated_length=4171
FT                   /gap_type="unknown"
FT   assembly_gap    11304303..11306376
FT                   /estimated_length=2074
FT                   /gap_type="unknown"
FT   assembly_gap    11307643..11307785
FT                   /estimated_length=143
FT                   /gap_type="unknown"
FT   assembly_gap    11314201..11314961
FT                   /estimated_length=761
FT                   /gap_type="unknown"
FT   assembly_gap    11316915..11316934
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11371846..11371865
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11375980..11376519
FT                   /estimated_length=540
FT                   /gap_type="unknown"
FT   assembly_gap    11469870..11470218
FT                   /estimated_length=349
FT                   /gap_type="unknown"
FT   assembly_gap    11496524..11496709
FT                   /estimated_length=186
FT                   /gap_type="unknown"
FT   assembly_gap    11540941..11541012
FT                   /estimated_length=72
FT                   /gap_type="unknown"
FT   assembly_gap    11561845..11561864
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11571417..11571647
FT                   /estimated_length=231
FT                   /gap_type="unknown"
FT   assembly_gap    11602054..11602073
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11615289..11615308
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11624430..11624449
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11640570..11640589
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11656043..11656062
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11666730..11753759
FT                   /estimated_length=87030
FT                   /gap_type="unknown"
FT   gene            complement(11780240..11854855)
FT                   /gene="Rasef"
FT                   /locus_tag="mCG_126350"
FT                   /note="gene_id=mCG126350.1"
FT   mRNA            complement(join(11780240..11780610,11791651..11791727,
FT                   11795506..11795625,11798523..11798637,11804234..11804478,
FT                   11805016..11805247,11808148..11808236,11809114..11809198,
FT                   11812939..11813007,11814220..11814335,11823856..11823933,
FT                   11827029..11827124,11833961..11834051,11835460..11835606,
FT                   11853891..11854061,11854744..11854855))
FT                   /gene="Rasef"
FT                   /locus_tag="mCG_126350"
FT                   /product="RAS and EF hand domain containing"
FT                   /note="gene_id=mCG126350.1 transcript_id=mCT127618.1
FT                   created on 07-JAN-2003"
FT   CDS             complement(join(11780505..11780610,11791651..11791727,
FT                   11795506..11795625,11798523..11798637,11804234..11804478,
FT                   11805016..11805247,11808148..11808236,11809114..11809198,
FT                   11812939..11813007,11814220..11814335,11823856..11823933,
FT                   11827029..11827124,11833961..11834051,11835460..11835488))
FT                   /codon_start=1
FT                   /gene="Rasef"
FT                   /locus_tag="mCG_126350"
FT                   /product="RAS and EF hand domain containing"
FT                   /note="gene_id=mCG126350.1 transcript_id=mCT127618.1
FT                   protein_id=mCP76274.1"
FT                   /protein_id="EDL31059.1"
FT                   /translation="MENLAIAVKRAQDKAAIQLSELEEEMDQRIQAVENESRKDEKRKA
FT                   EEALTDLRRQYETEVGDLQVTIKRLKKLEEQSRQISQKQDVTALKKQIHDLTMENQKLK
FT                   KELLEAQTNVAFLQSELDALKSDYADQSLNSERDLEIIREYTEDRSSLERQIEILQTAN
FT                   RKLHDSNDGLRSALENTYSKLNRSLRINNISPGNTISRSSPKFNHHSSQPLAYDRSFHS
FT                   SYADEDCDSLALCDPLQKMNYEVDSLPESCFDSGLSTLRDNECDSEVDYKHQGEFQTLH
FT                   RTEESLGGDASDTDTDMVDNTSKVTSQKAYKIVLAGDAAVGKSSFLMRLCKNEFQGNTS
FT                   ATLGTALTYPDNHRIGISSLIVFLSVSHTQIHRSKYLFRSIAKSYFRKADGVLLLYDVT
FT                   CEKSFLNVREWVDMVEDGTHRTIPIMLVGNKADLRDVDNAENQKCISAYLGEKLAMTYG
FT                   ALFCETSAKDGSNVVEAVLHLAREVKKRTEDDDSRSITSLAGSTSKKSLQMKNCCNG"
FT   assembly_gap    11784280..11785990
FT                   /estimated_length=1711
FT                   /gap_type="unknown"
FT   assembly_gap    11788517..11788697
FT                   /estimated_length=181
FT                   /gap_type="unknown"
FT   assembly_gap    11812293..11812312
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11853320..11853583
FT                   /estimated_length=264
FT                   /gap_type="unknown"
FT   assembly_gap    11855087..11855792
FT                   /estimated_length=706
FT                   /gap_type="unknown"
FT   assembly_gap    11862645..11862664
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11872620..11872676
FT                   /estimated_length=57
FT                   /gap_type="unknown"
FT   assembly_gap    11880379..11880434
FT                   /estimated_length=56
FT                   /gap_type="unknown"
FT   assembly_gap    11883441..11883479
FT                   /estimated_length=39
FT                   /gap_type="unknown"
FT   assembly_gap    11884225..11884244
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11893856..11896832
FT                   /estimated_length=2977
FT                   /gap_type="unknown"
FT   assembly_gap    11903543..11903562
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11907126..11907145
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11908427..11908446
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11911728..11911747
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11914947..11914966
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11917682..11919329
FT                   /estimated_length=1648
FT                   /gap_type="unknown"
FT   gene            complement(11930794..11933953)
FT                   /gene="RP23-289L21.1"
FT                   /locus_tag="mCG_126352"
FT                   /note="gene_id=mCG126352.0"
FT   mRNA            complement(join(11930794..11931211,11931517..11931822,
FT                   11932799..11932876,11933155..11933451,11933911..11933953))
FT                   /gene="RP23-289L21.1"
FT                   /locus_tag="mCG_126352"
FT                   /product="hypothetical protein LOC433719"
FT                   /note="gene_id=mCG126352.0 transcript_id=mCT127620.0
FT                   created on 07-JAN-2003"
FT   CDS             complement(join(11930916..11931211,11931517..11931822,
FT                   11932799..11932876,11933155..11933404))
FT                   /codon_start=1
FT                   /gene="RP23-289L21.1"
FT                   /locus_tag="mCG_126352"
FT                   /product="hypothetical protein LOC433719"
FT                   /note="gene_id=mCG126352.0 transcript_id=mCT127620.0
FT                   protein_id=mCP75838.1"
FT                   /protein_id="EDL31058.1"
FT                   /translation="MVEYELGDPGNKMHAKAKSLSRRLSNRGLRKSKNSCLDVMVKMKD
FT                   LHTRLCNERPRAYRLYSTYEWILYEILGHPRSQGGYVPGLWFDGHSKPPASYAPSLCIG
FT                   GAISPGPSFSPWTDPEIKIFLQEWQVVEREIGHPGQKIKQKSSLVCQRLYHRGLFKDIQ
FT                   SCLDLMWTLKDLHSTLSRERSRTVPLFSPYRDYLERIFDPKCQRGHVPGALYNWSGYHR
FT                   PSSSPQTPMVMPSPVYQPWDYGMSASSGQLHGNPSLIMSSQDSLVPRWDAWNATYPLPV
FT                   QHVLLASLSGDNNFQLAWSPRDESSSPQ"
FT   gene            complement(11953455..11964924)
FT                   /gene="2310002L09Rik"
FT                   /locus_tag="mCG_6158"
FT                   /note="gene_id=mCG6158.1"
FT   mRNA            complement(join(11953455..11953682,11956865..11957320,
FT                   11964649..11964924))
FT                   /gene="2310002L09Rik"
FT                   /locus_tag="mCG_6158"
FT                   /product="RIKEN cDNA 2310002L09, transcript variant
FT                   mCT5096"
FT                   /note="gene_id=mCG6158.1 transcript_id=mCT5096.0 created on
FT                   30-OCT-2002"
FT   CDS             complement(join(11953663..11953682,11956865..11957320,
FT                   11964649..11964775))
FT                   /codon_start=1
FT                   /gene="2310002L09Rik"
FT                   /locus_tag="mCG_6158"
FT                   /product="RIKEN cDNA 2310002L09, isoform CRA_b"
FT                   /note="gene_id=mCG6158.1 transcript_id=mCT5096.0
FT                   protein_id=mCP12560.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q14C20"
FT                   /db_xref="MGI:MGI:1916780"
FT                   /db_xref="UniProtKB/TrEMBL:Q14C20"
FT                   /protein_id="EDL31057.1"
FT                   /translation="MAKCLVKIRTQRSLHLHMMNHCSSNVFVRLLKHGSKVIPRNAGAP
FT                   LSKVDASEHMVASSPVKGAQSAGSPRKEEDKVKEDPLILSELAYNTSASLLPTQVDDDE
FT                   VDMLFDCPSRFVLEREDTDTFEDVEADENVFLMAEEEKVKEAHQALSWSYSILTGRIWL
FT                   NPLVKRCSRLLVVGLGLLLFVFPLVLLLLESVPVSMP"
FT   mRNA            complement(join(11955665..11957320,11964649..>11964922))
FT                   /gene="2310002L09Rik"
FT                   /locus_tag="mCG_6158"
FT                   /product="RIKEN cDNA 2310002L09, transcript variant
FT                   mCT192832"
FT                   /note="gene_id=mCG6158.1 transcript_id=mCT192832.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(11956794..11957320,11964649..>11964787))
FT                   /codon_start=1
FT                   /gene="2310002L09Rik"
FT                   /locus_tag="mCG_6158"
FT                   /product="RIKEN cDNA 2310002L09, isoform CRA_a"
FT                   /note="gene_id=mCG6158.1 transcript_id=mCT192832.0
FT                   protein_id=mCP113820.0 isoform=CRA_a"
FT                   /protein_id="EDL31056.1"
FT                   /translation="YISNMAKCLVKIRTQRSLHLHMMNHCSSNVFVRLLKHGSKVIPRN
FT                   AGAPLSKVDASEHMVASSPVKGAQSAGSPRKEEDKVKEDPLILSELAYNTSASLLPTQV
FT                   DDDEVDMLFDCPSRFVLEREDTDTFEDVEADENVFLMAEEEKVKEAHQALSWSYSILTG
FT                   RIWLNPLVKRCSRLLVVGLGLLLFVFPLVLLLLESGIDISFLFKNMNLSNFTMNTTVL"
FT   assembly_gap    12003640..12007125
FT                   /estimated_length=3486
FT                   /gap_type="unknown"
FT   assembly_gap    12014114..12014133
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            12024441..12211876
FT                   /gene="Frmd3"
FT                   /locus_tag="mCG_6155"
FT                   /note="gene_id=mCG6155.1"
FT   mRNA            join(12024441..12024912,12082416..12082520,
FT                   12108881..12108923,12130340..12130418,12138356..12138453,
FT                   12145987..12146110,12154810..12154897,12163476..12163564,
FT                   12171608..12171682,12171958..12172026,12180527..12180651,
FT                   12197186..12197641,12211655..12211876)
FT                   /gene="Frmd3"
FT                   /locus_tag="mCG_6155"
FT                   /product="FERM domain containing 3, transcript variant
FT                   mCT5103"
FT                   /note="gene_id=mCG6155.1 transcript_id=mCT5103.2 created on
FT                   07-JAN-2003"
FT   mRNA            join(<12024598..12024912,12082416..12082520,
FT                   12108881..12108923,12130340..12130418,12138356..12138453,
FT                   12145987..12146110,12154810..12154897,12163476..12163564,
FT                   12169153..12169216,12170276..12170364,12171608..12171682,
FT                   12171958..12172026,12180527..12180651,12197186..12197641,
FT                   12211655..12211875)
FT                   /gene="Frmd3"
FT                   /locus_tag="mCG_6155"
FT                   /product="FERM domain containing 3, transcript variant
FT                   mCT192828"
FT                   /note="gene_id=mCG6155.1 transcript_id=mCT192828.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(<12024624..12024912,12082416..12082520,
FT                   12108881..12108923,12130340..12130418,12138356..12138453,
FT                   12145987..12146110,12154810..12154897,12163476..12163564,
FT                   12169153..12169216,12170276..12170364,12171608..12171682,
FT                   12171958..12172026,12180527..12180651,12197186..12198872)
FT                   /gene="Frmd3"
FT                   /locus_tag="mCG_6155"
FT                   /product="FERM domain containing 3, transcript variant
FT                   mCT192829"
FT                   /note="gene_id=mCG6155.1 transcript_id=mCT192829.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<12024688..12024912,12082416..12082520,
FT                   12108881..12108923,12130340..12130418,12138356..12138453,
FT                   12145987..12146110,12154810..12154897,12163476..12163564,
FT                   12169153..12169216,12170276..12170364,12171608..12171682,
FT                   12171958..12172026,12180527..12180651,12197186..12197641,
FT                   12211655..12211668)
FT                   /codon_start=1
FT                   /gene="Frmd3"
FT                   /locus_tag="mCG_6155"
FT                   /product="FERM domain containing 3, isoform CRA_a"
FT                   /note="gene_id=mCG6155.1 transcript_id=mCT192828.0
FT                   protein_id=mCP113818.0 isoform=CRA_a"
FT                   /protein_id="EDL31053.1"
FT                   /translation="ERVNVRVDQGRAGPAPPTAASRVLLCMFASCHCAPRGRRTMKMIH
FT                   FRSSSIKSLNQEMKCTIRLLDDSEVSCHIQRETKGQFLIEYICNYYSLLEKDYFGIRYV
FT                   DPEKQRHWLEPNKSIFKQMKSHPPYTMCFRVKFYPHEPLKIKEELTRYLLYLQIKRDIF
FT                   HGRLLCSFSDAAYLGACIVQAEFGDYYPDEHPENYISEFEIFPKQSQKLERKIMEIHNN
FT                   ELRGQSPAIAEFNLLLKAHTLETYGVDPHPCKDSRGATAFLGFTAAGFVVFQGNKRIHL
FT                   RKWSDVCKLKFEGKTFYVIGSQKEKNAVLAFHTSTPAACKHLWKCGVENQAFYKYAKSS
FT                   QIKTVSSSKIFFKGSRFRYSGKVAKEVVEASSKIQRDPPEVHRVNITQSRSFHSLNKQL
FT                   IINMEPLQPLLPSPTEQEEEVPVGEGVPLPKMDVSEPLIASSPVKGAQCADPPDEEEDR
FT                   VKEDPLTISELAYNPSASLLPTPVDDDEINMLFDCPSRLELEREDTDSFEELEADENAF
FT                   LIAEEEELKEARQALSWSYSILTGHIWVNPLVKSFSRLLVVGLGLLLFVFPLLLLLLES
FT                   VSMP"
FT   CDS             join(<12024688..12024912,12082416..12082520,
FT                   12108881..12108923,12130340..12130418,12138356..12138453,
FT                   12145987..12146110,12154810..12154897,12163476..12163564,
FT                   12169153..12169216,12170276..12170364,12171608..12171682,
FT                   12171958..12172026,12180527..12180651,12197186..12197778)
FT                   /codon_start=1
FT                   /gene="Frmd3"
FT                   /locus_tag="mCG_6155"
FT                   /product="FERM domain containing 3, isoform CRA_b"
FT                   /note="gene_id=mCG6155.1 transcript_id=mCT192829.0
FT                   protein_id=mCP113819.0 isoform=CRA_b"
FT                   /protein_id="EDL31054.1"
FT                   /translation="ERVNVRVDQGRAGPAPPTAASRVLLCMFASCHCAPRGRRTMKMIH
FT                   FRSSSIKSLNQEMKCTIRLLDDSEVSCHIQRETKGQFLIEYICNYYSLLEKDYFGIRYV
FT                   DPEKQRHWLEPNKSIFKQMKSHPPYTMCFRVKFYPHEPLKIKEELTRYLLYLQIKRDIF
FT                   HGRLLCSFSDAAYLGACIVQAEFGDYYPDEHPENYISEFEIFPKQSQKLERKIMEIHNN
FT                   ELRGQSPAIAEFNLLLKAHTLETYGVDPHPCKDSRGATAFLGFTAAGFVVFQGNKRIHL
FT                   RKWSDVCKLKFEGKTFYVIGSQKEKNAVLAFHTSTPAACKHLWKCGVENQAFYKYAKSS
FT                   QIKTVSSSKIFFKGSRFRYSGKVAKEVVEASSKIQRDPPEVHRVNITQSRSFHSLNKQL
FT                   IINMEPLQPLLPSPTEQEEEVPVGEGVPLPKMDVSEPLIASSPVKGAQCADPPDEEEDR
FT                   VKEDPLTISELAYNPSASLLPTPVDDDEINMLFDCPSRLELEREDTDSFEELEADENAF
FT                   LIAEEEELKEARQALSWSYSILTGHIWVNPLVKSFSRLLVVGLGLLLFVFPLLLLLLES
FT                   GIDLSFLCEIRQTPEFEQFHYEYYCPLKEWVAGKVNIVLYMLGCS"
FT   CDS             join(12024766..12024912,12082416..12082520,
FT                   12108881..12108923,12130340..12130418,12138356..12138453,
FT                   12145987..12146110,12154810..12154897,12163476..12163564,
FT                   12171608..12171682,12171958..12172026,12180527..12180651,
FT                   12197186..12197641,12211655..12211668)
FT                   /codon_start=1
FT                   /gene="Frmd3"
FT                   /locus_tag="mCG_6155"
FT                   /product="FERM domain containing 3, isoform CRA_c"
FT                   /note="gene_id=mCG6155.1 transcript_id=mCT5103.2
FT                   protein_id=mCP12562.2 isoform=CRA_c"
FT                   /protein_id="EDL31055.1"
FT                   /translation="MFASCHCAPRGRRTMKMIHFRSSSIKSLNQEMKCTIRLLDDSEVS
FT                   CHIQRETKGQFLIEYICNYYSLLEKDYFGIRYVDPEKQRHWLEPNKSIFKQMKSHPPYT
FT                   MCFRVKFYPHEPLKIKEELTRYLLYLQIKRDIFHGRLLCSFSDAAYLGACIVQAEFGDY
FT                   YPDEHPENYISEFEIFPKQSQKLERKIMEIHNNELRGQSPAIAEFNLLLKAHTLETYGV
FT                   DPHPCKDSRGATAFLGFTAAGFVVFQGNKRIHLRKWYAKSSQIKTVSSSKIFFKGSRFR
FT                   YSGKVAKEVVEASSKIQRDPPEVHRVNITQSRSFHSLNKQLIINMEPLQPLLPSPTEQE
FT                   EEVPVGEGVPLPKMDVSEPLIASSPVKGAQCADPPDEEEDRVKEDPLTISELAYNPSAS
FT                   LLPTPVDDDEINMLFDCPSRLELEREDTDSFEELEADENAFLIAEEEELKEARQALSWS
FT                   YSILTGHIWVNPLVKSFSRLLVVGLGLLLFVFPLLLLLLESVSMP"
FT   assembly_gap    12027581..12027658
FT                   /estimated_length=78
FT                   /gap_type="unknown"
FT   assembly_gap    12029860..12029879
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12035663..12036215
FT                   /estimated_length=553
FT                   /gap_type="unknown"
FT   assembly_gap    12066958..12067032
FT                   /estimated_length=75
FT                   /gap_type="unknown"
FT   assembly_gap    12078257..12078350
FT                   /estimated_length=94
FT                   /gap_type="unknown"
FT   assembly_gap    12085829..12087257
FT                   /estimated_length=1429
FT                   /gap_type="unknown"
FT   assembly_gap    12092259..12092278
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12096649..12096668
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12112751..12112770
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12127495..12128538
FT                   /estimated_length=1044
FT                   /gap_type="unknown"
FT   assembly_gap    12135998..12136149
FT                   /estimated_length=152
FT                   /gap_type="unknown"
FT   assembly_gap    12157463..12157583
FT                   /estimated_length=121
FT                   /gap_type="unknown"
FT   assembly_gap    12200661..12200680
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12206035..12206208
FT                   /estimated_length=174
FT                   /gap_type="unknown"
FT   assembly_gap    12223394..12223413
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12224552..12224571
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12225500..12225795
FT                   /estimated_length=296
FT                   /gap_type="unknown"
FT   assembly_gap    12227466..12227583
FT                   /estimated_length=118
FT                   /gap_type="unknown"
FT   assembly_gap    12237461..12237480
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12239175..12241510
FT                   /estimated_length=2336
FT                   /gap_type="unknown"
FT   assembly_gap    12243633..12244084
FT                   /estimated_length=452
FT                   /gap_type="unknown"
FT   assembly_gap    12251254..12251365
FT                   /estimated_length=112
FT                   /gap_type="unknown"
FT   assembly_gap    12259999..12260018
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            12263099..12417214
FT                   /gene="Jmjd2c"
FT                   /locus_tag="mCG_6157"
FT                   /note="gene_id=mCG6157.2"
FT   mRNA            join(12263099..12263244,12273793..12273953,
FT                   12282178..12282353,12291874..12291988,12309435..12309628,
FT                   12317926..12317975,12322610..12322713,12326467..12326604,
FT                   12341610..12341803,12344588..12344823,12345504..12345823,
FT                   12347837..12347945,12354325..12354506,12356399..12356612,
FT                   12359359..12359435,12368243..12368298,12370317..12370425,
FT                   12384902..12385087,12388969..12389139,12402719..12402838,
FT                   12410700..12410792,12416174..12416520)
FT                   /gene="Jmjd2c"
FT                   /locus_tag="mCG_6157"
FT                   /product="jumonji domain containing 2C, transcript variant
FT                   mCT5095"
FT                   /note="gene_id=mCG6157.2 transcript_id=mCT5095.2 created on
FT                   06-DEC-2002"
FT   mRNA            join(12263103..12263244,12282178..12282353,
FT                   12291874..12291988,12309435..12309628,12317926..12317975,
FT                   12322610..12322713,12326467..12326604,12341610..12341803,
FT                   12344588..12344823,12345504..12345823,12347837..12347945,
FT                   12354325..12354506,12356399..12356612,12359359..12359435,
FT                   12368243..12368298,12370317..12370425,12384902..12385087,
FT                   12388969..12389139,12402719..12402838,12410700..12410792,
FT                   12416174..12417214)
FT                   /gene="Jmjd2c"
FT                   /locus_tag="mCG_6157"
FT                   /product="jumonji domain containing 2C, transcript variant
FT                   mCT176755"
FT                   /note="gene_id=mCG6157.2 transcript_id=mCT176755.0 created
FT                   on 06-DEC-2002"
FT   assembly_gap    12268889..12268908
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12270102..12270177
FT                   /estimated_length=76
FT                   /gap_type="unknown"
FT   CDS             join(12273810..12273953,12282178..12282353,
FT                   12291874..12291988,12309435..12309628,12317926..12317975,
FT                   12322610..12322713,12326467..12326604,12341610..12341803,
FT                   12344588..12344823,12345504..12345823,12347837..12347945,
FT                   12354325..12354506,12356399..12356612,12359359..12359435,
FT                   12368243..12368298,12370317..12370425,12384902..12385087,
FT                   12388969..12389139,12402719..12402838,12410700..12410792,
FT                   12416174..12416350)
FT                   /codon_start=1
FT                   /gene="Jmjd2c"
FT                   /locus_tag="mCG_6157"
FT                   /product="jumonji domain containing 2C, isoform CRA_a"
FT                   /note="gene_id=mCG6157.2 transcript_id=mCT5095.2
FT                   protein_id=mCP12559.2 isoform=CRA_a"
FT                   /protein_id="EDL31051.1"
FT                   /translation="MEVVEVESPLNPSCKIMTFRPSMEEFREFNKYLAYMESKGAHRAG
FT                   LAKVIPPKEWKPRQCYDDIDNLLIPAPIQQMVTGQSGLFTQYNIQKKAMTVKEFRQLAN
FT                   SSKYCTPRYLDYEDLERKYWKNLTFVAPIYGADINGSIYDEGVDEWNIARLNTVLDVVE
FT                   EECGISIEGVNTPYLYFGMWKTTFAWHTEDMDLYSINYLHFGEPKSWYAIPPEHGKRLE
FT                   RLAQGFFPSSSQGCDAFLRHKMTLISPSVLKKYGIPFDKITQEAGEFMITFPYGYHAGF
FT                   NHGFNCAESTNFATVRWIDYGKVAKLCTCRNDMVKISMDIFVKKFQPDRYQIWKQGKDI
FT                   YTIDHTKPTPESTPEVKTWLQRKKKLRKPPKSLQGNKPLCKRPKPEEDEEFAEFSGEEG
FT                   ANPAMGPRHLKVTEKPEKALKLGKLEESSAKEALDTRIQVDQSLLNDTKLSGKGCISSS
FT                   VTAEIPPEDNRASAVISPSQLKEGADCIPLSHGHQAGKESHLLKILKLESPKIPSPLPE
FT                   SNKVLTEGEENDEEGHGSNLEPGEIPEALSEERNGLNIPKIIEGQPKTTKSWRHPLGKP
FT                   PARSPMTLVKQQVASDEELPEVLSIDEEVEETESWAKPLIHLWQTKSPNFMAEQEYNAT
FT                   VAKMEPNCAICTLLMPYYKPDSSKEENDSRWETAVNEVVQSGRKTKPIIPEMCFIYSEE
FT                   NVDYSPPNAFLEEDGTSLLISCAKCFVRVHASCYGVPSHEVCDGWLCARCKRNAWTAEC
FT                   CLCNLRGGALKQTKNNQWAHVICAVAVPEVRFTNVPERTQIDVDRIPLQRLKLKCIFCR
FT                   HRVKKVSGACIQCSYGRCPASFHVTCAHAAGVLMEPDDWPYVVNITCFRHRVNSNAKSK
FT                   TCEKAISVGQTVITKHRNTRYYSCRVIDVTSQTFYEVMFDDGSFSRDTFPEDIVSRNCV
FT                   KLGPPAEGEVIQVKWPDGKLYGAKYLGSNVAYMYQVEFEDGSQIAMKREDIYTLDEELP
FT                   KRVKARFSTASDMRFEDTFYGADVIQGERKRQRVLSSRLKNEYVDDPVYRTFLKSSFQK
FT                   KCQKRQ"
FT   CDS             join(12282259..12282353,12291874..12291988,
FT                   12309435..12309628,12317926..12317975,12322610..12322713,
FT                   12326467..12326604,12341610..12341803,12344588..12344823,
FT                   12345504..12345823,12347837..12347945,12354325..12354506,
FT                   12356399..12356612,12359359..12359435,12368243..12368298,
FT                   12370317..12370425,12384902..12385087,12388969..12389139,
FT                   12402719..12402838,12410700..12410792,12416174..12416350)
FT                   /codon_start=1
FT                   /gene="Jmjd2c"
FT                   /locus_tag="mCG_6157"
FT                   /product="jumonji domain containing 2C, isoform CRA_b"
FT                   /note="gene_id=mCG6157.2 transcript_id=mCT176755.0
FT                   protein_id=mCP99677.0 isoform=CRA_b"
FT                   /protein_id="EDL31052.1"
FT                   /translation="MVTGQSGLFTQYNIQKKAMTVKEFRQLANSSKYCTPRYLDYEDLE
FT                   RKYWKNLTFVAPIYGADINGSIYDEGVDEWNIARLNTVLDVVEEECGISIEGVNTPYLY
FT                   FGMWKTTFAWHTEDMDLYSINYLHFGEPKSWYAIPPEHGKRLERLAQGFFPSSSQGCDA
FT                   FLRHKMTLISPSVLKKYGIPFDKITQEAGEFMITFPYGYHAGFNHGFNCAESTNFATVR
FT                   WIDYGKVAKLCTCRNDMVKISMDIFVKKFQPDRYQIWKQGKDIYTIDHTKPTPESTPEV
FT                   KTWLQRKKKLRKPPKSLQGNKPLCKRPKPEEDEEFAEFSGEEGANPAMGPRHLKVTEKP
FT                   EKALKLGKLEESSAKEALDTRIQVDQSLLNDTKLSGKGCISSSVTAEIPPEDNRASAVI
FT                   SPSQLKEGADCIPLSHGHQAGKESHLLKILKLESPKIPSPLPESNKVLTEGEENDEEGH
FT                   GSNLEPGEIPEALSEERNGLNIPKIIEGQPKTTKSWRHPLGKPPARSPMTLVKQQVASD
FT                   EELPEVLSIDEEVEETESWAKPLIHLWQTKSPNFMAEQEYNATVAKMEPNCAICTLLMP
FT                   YYKPDSSKEENDSRWETAVNEVVQSGRKTKPIIPEMCFIYSEENVDYSPPNAFLEEDGT
FT                   SLLISCAKCFVRVHASCYGVPSHEVCDGWLCARCKRNAWTAECCLCNLRGGALKQTKNN
FT                   QWAHVICAVAVPEVRFTNVPERTQIDVDRIPLQRLKLKCIFCRHRVKKVSGACIQCSYG
FT                   RCPASFHVTCAHAAGVLMEPDDWPYVVNITCFRHRVNSNAKSKTCEKAISVGQTVITKH
FT                   RNTRYYSCRVIDVTSQTFYEVMFDDGSFSRDTFPEDIVSRNCVKLGPPAEGEVIQVKWP
FT                   DGKLYGAKYLGSNVAYMYQVEFEDGSQIAMKREDIYTLDEELPKRVKARFSTASDMRFE
FT                   DTFYGADVIQGERKRQRVLSSRLKNEYVDDPVYRTFLKSSFQKKCQKRQ"
FT   assembly_gap    12294616..12294888
FT                   /estimated_length=273
FT                   /gap_type="unknown"
FT   assembly_gap    12301304..12302043
FT                   /estimated_length=740
FT                   /gap_type="unknown"
FT   assembly_gap    12361548..12362247
FT                   /estimated_length=700
FT                   /gap_type="unknown"
FT   assembly_gap    12379620..12379639
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12407875..12407894
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12417438..12417457
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12435450..12435469
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12446836..12452769
FT                   /estimated_length=5934
FT                   /gap_type="unknown"
FT   assembly_gap    12466843..12466862
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12472703..12472827
FT                   /estimated_length=125
FT                   /gap_type="unknown"
FT   assembly_gap    12487582..12487846
FT                   /estimated_length=265
FT                   /gap_type="unknown"
FT   assembly_gap    12502561..12506796
FT                   /estimated_length=4236
FT                   /gap_type="unknown"
FT   assembly_gap    12516032..12516208
FT                   /estimated_length=177
FT                   /gap_type="unknown"
FT   assembly_gap    12523007..12523026
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12531325..12531344
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12565198..12565217
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12573055..12573074
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12589473..12589786
FT                   /estimated_length=314
FT                   /gap_type="unknown"
FT   assembly_gap    12598540..12599295
FT                   /estimated_length=756
FT                   /gap_type="unknown"
FT   assembly_gap    12600039..12603421
FT                   /estimated_length=3383
FT                   /gap_type="unknown"
FT   assembly_gap    12612437..12612456
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12620471..12620638
FT                   /estimated_length=168
FT                   /gap_type="unknown"
FT   assembly_gap    12622452..12622764
FT                   /estimated_length=313
FT                   /gap_type="unknown"
FT   assembly_gap    12636773..12641334
FT                   /estimated_length=4562
FT                   /gap_type="unknown"
FT   assembly_gap    12642443..12642462
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12643802..12643821
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12651077..12651099
FT                   /estimated_length=23
FT                   /gap_type="unknown"
FT   assembly_gap    12665872..12665891
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12670474..12673804
FT                   /estimated_length=3331
FT                   /gap_type="unknown"
FT   assembly_gap    12692787..12692806
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12736479..12736498
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12738326..12738345
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12744686..12744769
FT                   /estimated_length=84
FT                   /gap_type="unknown"
FT   assembly_gap    12789608..12789786
FT                   /estimated_length=179
FT                   /gap_type="unknown"
FT   assembly_gap    12797970..12797989
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12846013..12846032
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12857169..12862684
FT                   /estimated_length=5516
FT                   /gap_type="unknown"
FT   assembly_gap    12883866..12899664
FT                   /estimated_length=15799
FT                   /gap_type="unknown"
FT   assembly_gap    12916582..12916601
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12919702..12919755
FT                   /estimated_length=54
FT                   /gap_type="unknown"
FT   assembly_gap    12935527..12935546
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12956684..12956703
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12974117..12975108
FT                   /estimated_length=992
FT                   /gap_type="unknown"
FT   assembly_gap    12979635..12980057
FT                   /estimated_length=423
FT                   /gap_type="unknown"
FT   assembly_gap    12983106..12983182
FT                   /estimated_length=77
FT                   /gap_type="unknown"
FT   assembly_gap    12994076..12994095
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12995632..12995651
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13025194..13025704
FT                   /estimated_length=511
FT                   /gap_type="unknown"
FT   assembly_gap    13048557..13053293
FT                   /estimated_length=4737
FT                   /gap_type="unknown"
FT   assembly_gap    13077288..13077307
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13103981..13104036
FT                   /estimated_length=56
FT                   /gap_type="unknown"
FT   assembly_gap    13109492..13109527
FT                   /estimated_length=36
FT                   /gap_type="unknown"
FT   assembly_gap    13111362..13111848
FT                   /estimated_length=487
FT                   /gap_type="unknown"
FT   assembly_gap    13145442..13151901
FT                   /estimated_length=6460
FT                   /gap_type="unknown"
FT   assembly_gap    13154084..13154103
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13156039..13156058
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13157336..13157355
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13158917..13158936
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13160002..13160021
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13164355..13164374
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13165461..13165480
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13167387..13167406
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13169535..13170763
FT                   /estimated_length=1229
FT                   /gap_type="unknown"
FT   assembly_gap    13175400..13175419
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13197323..13197342
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13201565..13201802
FT                   /estimated_length=238
FT                   /gap_type="unknown"
FT   assembly_gap    13214526..13214545
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13227311..13227330
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13241577..13241624
FT                   /estimated_length=48
FT                   /gap_type="unknown"
FT   gene            complement(13250473..13251406)
FT                   /gene="3110001D03Rik"
FT                   /locus_tag="mCG_20379"
FT                   /note="gene_id=mCG20379.0"
FT   mRNA            complement(join(13250473..13250886,13251098..13251406))
FT                   /gene="3110001D03Rik"
FT                   /locus_tag="mCG_20379"
FT                   /product="RIKEN cDNA 3110001D03"
FT                   /note="gene_id=mCG20379.0 transcript_id=mCT20588.0 created
FT                   on 08-OCT-2002"
FT   CDS             complement(join(13250822..13250886,13251098..13251368))
FT                   /codon_start=1
FT                   /gene="3110001D03Rik"
FT                   /locus_tag="mCG_20379"
FT                   /product="RIKEN cDNA 3110001D03"
FT                   /note="gene_id=mCG20379.0 transcript_id=mCT20588.0
FT                   protein_id=mCP6469.1"
FT                   /protein_id="EDL31050.1"
FT                   /translation="MGSSFSGSTEFSAPAPPTVSTAVPANPPAKSAVPASPARDPELKT
FT                   CWSCRVLSGSTLFGAGTYVYLVARRPLKQGIPPGPGTVLQMVIGISIACWGVVVLVDPK
FT                   GKSHPVI"
FT   assembly_gap    13265183..13274586
FT                   /estimated_length=9404
FT                   /gap_type="unknown"
FT   assembly_gap    13280795..13280943
FT                   /estimated_length=149
FT                   /gap_type="unknown"
FT   assembly_gap    13319057..13320543
FT                   /estimated_length=1487
FT                   /gap_type="unknown"
FT   assembly_gap    13358884..13358903
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13448443..13448462
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13449772..13459201
FT                   /estimated_length=9430
FT                   /gap_type="unknown"
FT   assembly_gap    13463320..13463339
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13464550..13464569
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13465788..13465807
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13489972..13490351
FT                   /estimated_length=380
FT                   /gap_type="unknown"
FT   assembly_gap    13513628..13513726
FT                   /estimated_length=99
FT                   /gap_type="unknown"
FT   assembly_gap    13543347..13543589
FT                   /estimated_length=243
FT                   /gap_type="unknown"
FT   assembly_gap    13607449..13607468
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13628896..13628915
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13702213..13702232
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13740827..13741029
FT                   /estimated_length=203
FT                   /gap_type="unknown"
FT   assembly_gap    13751349..13757786
FT                   /estimated_length=6438
FT                   /gap_type="unknown"
FT   assembly_gap    13761170..13761339
FT                   /estimated_length=170
FT                   /gap_type="unknown"
FT   assembly_gap    13776758..13776867
FT                   /estimated_length=110
FT                   /gap_type="unknown"
FT   assembly_gap    13780831..13780850
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13819812..13819892
FT                   /estimated_length=81
FT                   /gap_type="unknown"
FT   assembly_gap    13843682..13843931
FT                   /estimated_length=250
FT                   /gap_type="unknown"
FT   assembly_gap    13867219..13867238
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13874333..13877971
FT                   /estimated_length=3639
FT                   /gap_type="unknown"
FT   assembly_gap    13881620..13881639
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(13894561..14293963)
FT                   /gene="Ptprd"
FT                   /locus_tag="mCG_126139"
FT                   /note="gene_id=mCG126139.0"
FT   mRNA            complement(join(13894561..13895642,13897663..13897798,
FT                   13901271..13901425,13904691..13904816,13905834..13905960,
FT                   13906924..13907102,13907714..13907999,13932578..13932732,
FT                   13933210..13933329,13949188..13949363,13962678..13962801,
FT                   13990751..13990848,14001845..14001957,14011202..14011362,
FT                   14017699..14017908,14023489..14023579,14035875..14036134,
FT                   14037019..14037116,14037569..14038156,14042983..14043100,
FT                   14047080..14047106,14050977..14051170,14052009..14052314,
FT                   14054506..14054650,14058760..14058893,14077434..14078015,
FT                   14082008..14082277,14085766..14085876,14089452..14089640,
FT                   14185169..14185310,14188314..14188459,14273170..14273335,
FT                   14293889..14293963))
FT                   /gene="Ptprd"
FT                   /locus_tag="mCG_126139"
FT                   /product="protein tyrosine phosphatase, receptor type, D"
FT                   /note="gene_id=mCG126139.0 transcript_id=mCT127406.1
FT                   created on 07-JAN-2003"
FT   CDS             complement(join(13895574..13895642,13897663..13897798,
FT                   13901271..13901425,13904691..13904816,13905834..13905960,
FT                   13906924..13907102,13907714..13907999,13932578..13932732,
FT                   13933210..13933329,13949188..13949363,13962678..13962801,
FT                   13990751..13990848,14001845..14001957,14011202..14011362,
FT                   14017699..14017908,14023489..14023579,14035875..14036134,
FT                   14037019..14037116,14037569..14038156,14042983..14043100,
FT                   14047080..14047106,14050977..14051170,14052009..14052314,
FT                   14054506..14054650,14058760..14058893,14077434..14078015,
FT                   14082008..14082277,14085766..14085876,14089452..14089640,
FT                   14185169..14185310,14188314..14188459,14273170..14273254))
FT                   /codon_start=1
FT                   /gene="Ptprd"
FT                   /locus_tag="mCG_126139"
FT                   /product="protein tyrosine phosphatase, receptor type, D"
FT                   /note="gene_id=mCG126139.0 transcript_id=mCT127406.1
FT                   protein_id=mCP76426.1"
FT                   /protein_id="EDL31049.1"
FT                   /translation="MPLTNCRMVPVARPLSLLLTFFLCACAETPPRFTRTPVDQTGVSG
FT                   GVASFICQATGDPRPKIVWNKKGKKVSNQRFEVIEFDDGSGSVLRIQPLRTPRDEAIYE
FT                   CVASNNVGEISVSTRLTVLREDQIPRGFPTIDMGPQLKVVERTRTATMLCAASGNPDPE
FT                   ITWFKDFLPVDTSNNNGRIKQLRSGALQIEQSEESDQGKYECVATNSAGTRYSAPANLY
FT                   VRVRRVPPRFSIPPTNHEIMPGGSVNITCVAVGSPMPYVKWMLGAEDLTPEDDMPIGRN
FT                   VLELNDVRQSANYTCVAMSTLGVIEAIAQITVKALPKPPGTPVVTESTATSITLTWDSG
FT                   NPEPVSYYIIQHKPKNSEEPYKEIDGIATTRYSVAGLSPYSDYEFRVVAVNNIGRGPAS
FT                   EPVLTQTSEQAPSSAPRDVQARMLSSTTILVQWKEPEEPNGQIQGYRVYYTMDPTQHVN
FT                   NWMKHNVADSQITTIGNLVPQKTYSVKVLAFTSIGDGPLSSDIQVITQTGVPGQPLNFK
FT                   AEPESETSILLSWTPPRSDTIASYELVYRDGDQGEEQRITIEPGTSYRLQGLKPNSLYY
FT                   FRLSARSPQGLGASTAEISARTMQSKPSAPPQDISCTSPSSTSILVSWQPPPVEKQNGI
FT                   ITEYSLKYAAVDGEDYKPHEILGIPSDTTKYLLEQLEKWTEYRITVTAHTDVGPGPESL
FT                   SVLIRTDEDVPSGPPRKVEVEAVNATAVKVSWRSPVPNKQHGQIRGYQVHYVKMENGEP
FT                   KGQPMLKDVMLADAQWEFDDTTEHDMIISGLQPETSYSLTVTAYTTKGDGARSKPKLVS
FT                   TTGAVPGKPRLVINHTQMNTALIQWHPPVDTFGPLQGYRLKFGRKDMEPLTTLEFSEKE
FT                   DHFTATDIHKGASYVFRLSARNKVGFGEEMVKEISVPEEIPTGFPQNLHSEGTTSTSVQ
FT                   LSWQPPVLAERNGVITKYTLLYRDINVPLLPMEHLIVPADTSMTLTGLKSDTTYDVKVR
FT                   AHTSKGPGPYSPSVQFRTLPVDQVFAKNFHVKAVMKTSVLLSWEIPENYNSAMPFKILY
FT                   DDGKMVEEVDGRATQKLIVNLKPEKSYSFVLTNRGNSAGGLQHRVTAKTAPDVLRTKPA
FT                   FIGKTNLDGMITVQLPDVPANENIKGYYIIIVPLKKSRGKFIKPWESPDEMELDELLKE
FT                   ISRKRRSIRYGREVELKPYIAAHFDVLPTEFTLGDDKHYGGFTNKQLQSGQEYVFFVLA
FT                   VMDHAESKMYATSPYSDPVVSMDLDPQPITDEEEGLIWVVGPVLAVVFIICIVIAILLY
FT                   KRKRAESESRKSSLPNSKEVPSHHPTDPVELRRLNFQTPGMASHPPIPILELADHIERL
FT                   KANDNLKFSQEYESIDPGQQFTWEHSNLEVNKPKNRYANVIAYDHSRVLLSAIEGIPGS
FT                   DYVNANYIDGYRKQNAYIATQGSLPETFGDFWRMIWEQRSATVVMMTKLEERSRVKCDQ
FT                   YWPSRGTETHGLVQVTLLDTVELATYCVRTFALYKNGSSEKREVRQFQFTAWPDHGVPE
FT                   HPTPFLAFLRRVKTCNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHV
FT                   TLMRAQRNYMVQTEDQYIFIHDALLEAVTCGNTEVPARNLYAYIQKLTQIETGENVTGM
FT                   ELEFKRLASSKAHTSRFISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINAS
FT                   FLDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAER
FT                   SARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFI
FT                   DFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLR
FT                   TQRPAMVQTEDQYQFCYRAALEYLGSFDHYAT"
FT   assembly_gap    13989556..13989575
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14062946..14065676
FT                   /estimated_length=2731
FT                   /gap_type="unknown"
FT   assembly_gap    14066846..14066865
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14068078..14068097
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14090530..14090549
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14099742..14099946
FT                   /estimated_length=205
FT                   /gap_type="unknown"
FT   assembly_gap    14120673..14120692
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14121726..14122373
FT                   /estimated_length=648
FT                   /gap_type="unknown"
FT   assembly_gap    14123761..14123810
FT                   /estimated_length=50
FT                   /gap_type="unknown"
FT   assembly_gap    14163333..14163352
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14198807..14199104
FT                   /estimated_length=298
FT                   /gap_type="unknown"
FT   assembly_gap    14218998..14219260
FT                   /estimated_length=263
FT                   /gap_type="unknown"
FT   assembly_gap    14223188..14223207
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14230001..14230137
FT                   /estimated_length=137
FT                   /gap_type="unknown"
FT   assembly_gap    14233240..14237508
FT                   /estimated_length=4269
FT                   /gap_type="unknown"
FT   assembly_gap    14241048..14241067
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14287853..14287872
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14289276..14289295
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14290533..14290552
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14292483..14292502
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14298027..14298046
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14299422..14302017
FT                   /estimated_length=2596
FT                   /gap_type="unknown"
FT   assembly_gap    14317053..14317072
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14318334..14318353
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14341414..14341433
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14375664..14375683
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14383897..14383916
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14385897..14385916
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14387120..14387139
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14388451..14390502
FT                   /estimated_length=2052
FT                   /gap_type="unknown"
FT   assembly_gap    14411670..14411871
FT                   /estimated_length=202
FT                   /gap_type="unknown"
FT   assembly_gap    14434468..14434487
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14453461..14453541
FT                   /estimated_length=81
FT                   /gap_type="unknown"
FT   assembly_gap    14463626..14468644
FT                   /estimated_length=5019
FT                   /gap_type="unknown"
FT   assembly_gap    14477710..14477812
FT                   /estimated_length=103
FT                   /gap_type="unknown"
FT   assembly_gap    14492116..14492135
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14503070..14503245
FT                   /estimated_length=176
FT                   /gap_type="unknown"
FT   assembly_gap    14538479..14538539
FT                   /estimated_length=61
FT                   /gap_type="unknown"
FT   assembly_gap    14599042..14599079
FT                   /estimated_length=38
FT                   /gap_type="unknown"
FT   assembly_gap    14631281..14631300
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14665853..14665872
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14700943..14700962
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14712846..14713654
FT                   /estimated_length=809
FT                   /gap_type="unknown"
FT   assembly_gap    14715040..14715688
FT                   /estimated_length=649
FT                   /gap_type="unknown"
FT   assembly_gap    14717056..14717075
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14718403..14718422
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14720133..14720152
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14721262..14721281
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14722713..14723067
FT                   /estimated_length=355
FT                   /gap_type="unknown"
FT   assembly_gap    14755627..14755646
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14763530..14763549
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14764459..14764478
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14766001..14766020
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14767045..14767064
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14770867..14770886
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14774483..14774502
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14795271..14795429
FT                   /estimated_length=159
FT                   /gap_type="unknown"
FT   assembly_gap    14812185..14812560
FT                   /estimated_length=376
FT                   /gap_type="unknown"
FT   assembly_gap    14825315..14825334
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14826383..14826402
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14827640..14827659
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14840545..14840564
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14850562..14850581
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14860198..14860217
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14881589..14881608
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14892672..14892747
FT                   /estimated_length=76
FT                   /gap_type="unknown"
FT   assembly_gap    14893835..14893854
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14895018..14895037
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14910304..14910323
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14913732..14913751
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14928459..14928515
FT                   /estimated_length=57
FT                   /gap_type="unknown"
FT   assembly_gap    14937830..14938109
FT                   /estimated_length=280
FT                   /gap_type="unknown"
FT   assembly_gap    14962419..14963105
FT                   /estimated_length=687
FT                   /gap_type="unknown"
FT   assembly_gap    14965225..14965244
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14966466..14966485
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14967731..14967750
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14973654..14974461
FT                   /estimated_length=808
FT                   /gap_type="unknown"
FT   assembly_gap    15001570..15001589
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15003139..15003158
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15013118..15013137
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15014930..15014949
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15016225..15017949
FT                   /estimated_length=1725
FT                   /gap_type="unknown"
FT   assembly_gap    15023318..15023337
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15043631..15043650
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15050362..15051163
FT                   /estimated_length=802
FT                   /gap_type="unknown"
FT   assembly_gap    15058823..15059122
FT                   /estimated_length=300
FT                   /gap_type="unknown"
FT   assembly_gap    15061681..15061700
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15063977..15063996
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15079408..15079591
FT                   /estimated_length=184
FT                   /gap_type="unknown"
FT   assembly_gap    15095021..15095179
FT                   /estimated_length=159
FT                   /gap_type="unknown"
FT   assembly_gap    15114921..15115860
FT                   /estimated_length=940
FT                   /gap_type="unknown"
FT   assembly_gap    15123407..15123426
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15124612..15124631
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15140166..15140185
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15142073..15142092
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15143552..15143571
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15147569..15147588
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15151316..15151335
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15152356..15152375
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15156019..15156604
FT                   /estimated_length=586
FT                   /gap_type="unknown"
FT   assembly_gap    15158938..15158957
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15173473..15173564
FT                   /estimated_length=92
FT                   /gap_type="unknown"
FT   assembly_gap    15178224..15178306
FT                   /estimated_length=83
FT                   /gap_type="unknown"
FT   assembly_gap    15211608..15211627
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15216066..15218896
FT                   /estimated_length=2831
FT                   /gap_type="unknown"
FT   assembly_gap    15220340..15220359
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15268488..15269184
FT                   /estimated_length=697
FT                   /gap_type="unknown"
FT   assembly_gap    15297940..15300229
FT                   /estimated_length=2290
FT                   /gap_type="unknown"
FT   assembly_gap    15303010..15303029
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15304241..15304260
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15305769..15305788
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15307613..15307632
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15310786..15310805
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15312492..15312585
FT                   /estimated_length=94
FT                   /gap_type="unknown"
FT   gene            complement(15358531..15646853)
FT                   /locus_tag="mCG_148060"
FT                   /note="gene_id=mCG148060.0"
FT   mRNA            complement(join(15358531..15360008,15378882..15378923,
FT                   15570276..15570383,15646785..15646853))
FT                   /locus_tag="mCG_148060"
FT                   /product="mCG148060"
FT                   /note="gene_id=mCG148060.0 transcript_id=mCT188323.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(15359713..15359874)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148060"
FT                   /product="mCG148060"
FT                   /note="gene_id=mCG148060.0 transcript_id=mCT188323.0
FT                   protein_id=mCP109403.0"
FT                   /protein_id="EDL31048.1"
FT                   /translation="MELTETLPGFLSPKCSEWLPTSYLCFLRVFLISKFLLGVQNCAKL
FT                   KDPDTLLN"
FT   assembly_gap    15372334..15372353
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15393467..15393486
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15412027..15412046
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15413404..15421313
FT                   /estimated_length=7910
FT                   /gap_type="unknown"
FT   assembly_gap    15422561..15422580
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15423650..15423669
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15424941..15424960
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15429120..15429279
FT                   /estimated_length=160
FT                   /gap_type="unknown"
FT   assembly_gap    15430514..15435445
FT                   /estimated_length=4932
FT                   /gap_type="unknown"
FT   assembly_gap    15437919..15443148
FT                   /estimated_length=5230
FT                   /gap_type="unknown"
FT   assembly_gap    15445172..15445286
FT                   /estimated_length=115
FT                   /gap_type="unknown"
FT   assembly_gap    15478551..15478740
FT                   /estimated_length=190
FT                   /gap_type="unknown"
FT   assembly_gap    15522048..15522225
FT                   /estimated_length=178
FT                   /gap_type="unknown"
FT   assembly_gap    15522808..15526689
FT                   /estimated_length=3882
FT                   /gap_type="unknown"
FT   assembly_gap    15553530..15553549
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15583452..15583727
FT                   /estimated_length=276
FT                   /gap_type="unknown"
FT   assembly_gap    15600417..15600436
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15601438..15601457
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15613639..15613658
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15614732..15614751
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15616696..15616715
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15638078..15640725
FT                   /estimated_length=2648
FT                   /gap_type="unknown"
FT   assembly_gap    15642391..15642410
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15643696..15645527
FT                   /estimated_length=1832
FT                   /gap_type="unknown"
FT   assembly_gap    15659693..15659766
FT                   /estimated_length=74
FT                   /gap_type="unknown"
FT   assembly_gap    15684809..15684828
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15722935..15722954
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15735995..15736109
FT                   /estimated_length=115
FT                   /gap_type="unknown"
FT   assembly_gap    15739014..15740291
FT                   /estimated_length=1278
FT                   /gap_type="unknown"
FT   assembly_gap    15741483..15741502
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15742630..15746549
FT                   /estimated_length=3920
FT                   /gap_type="unknown"
FT   assembly_gap    15758145..15758164
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15760080..15760099
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15761695..15762705
FT                   /estimated_length=1011
FT                   /gap_type="unknown"
FT   assembly_gap    15764793..15764979
FT                   /estimated_length=187
FT                   /gap_type="unknown"
FT   assembly_gap    15770135..15770154
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15778473..15778492
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15799830..15799849
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15803267..15803286
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15804299..15804318
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15805567..15813363
FT                   /estimated_length=7797
FT                   /gap_type="unknown"
FT   assembly_gap    15815426..15815445
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15816841..15816860
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15824451..15825884
FT                   /estimated_length=1434
FT                   /gap_type="unknown"
FT   assembly_gap    15837098..15837117
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15838237..15838256
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15840237..15840256
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15849299..15849318
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15852716..15852735
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15854782..15854801
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15909755..15909774
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(15947862..>16225503)
FT                   /locus_tag="mCG_145482"
FT                   /note="gene_id=mCG145482.0"
FT   mRNA            complement(join(15947862..15948694,15955862..15955916,
FT                   16225292..>16225503))
FT                   /locus_tag="mCG_145482"
FT                   /product="mCG145482"
FT                   /note="gene_id=mCG145482.0 transcript_id=mCT184906.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(15955916,16225292..>16225503))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145482"
FT                   /product="mCG145482"
FT                   /note="gene_id=mCG145482.0 transcript_id=mCT184906.0
FT                   protein_id=mCP105835.0"
FT                   /protein_id="EDL31047.1"
FT                   /translation="PAPPSHTQIPLLKKPKRCSPPTPSERCRLRPLLSLSAVEPGPWDR
FT                   KTVLGWTGRKGRKTPLFPRRAERLP"
FT   assembly_gap    15966963..15966982
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15972237..15972256
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15974644..15974663
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15989623..15989847
FT                   /estimated_length=225
FT                   /gap_type="unknown"
FT   assembly_gap    15999651..16001833
FT                   /estimated_length=2183
FT                   /gap_type="unknown"
FT   assembly_gap    16004337..16004356
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16028590..16029864
FT                   /estimated_length=1275
FT                   /gap_type="unknown"
FT   assembly_gap    16031041..16031279
FT                   /estimated_length=239
FT                   /gap_type="unknown"
FT   assembly_gap    16040931..16040950
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16059109..16059128
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16073350..16073369
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16103035..16103054
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16104862..16104881
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16133585..16133769
FT                   /estimated_length=185
FT                   /gap_type="unknown"
FT   assembly_gap    16143647..16148341
FT                   /estimated_length=4695
FT                   /gap_type="unknown"
FT   assembly_gap    16152788..16153607
FT                   /estimated_length=820
FT                   /gap_type="unknown"
FT   assembly_gap    16155069..16157762
FT                   /estimated_length=2694
FT                   /gap_type="unknown"
FT   assembly_gap    16158461..16159472
FT                   /estimated_length=1012
FT                   /gap_type="unknown"
FT   assembly_gap    16176654..16176673
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16177678..16177697
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16178775..16178794
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16179861..16183212
FT                   /estimated_length=3352
FT                   /gap_type="unknown"
FT   assembly_gap    16184273..16184292
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16186632..16186651
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16190491..16190510
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16192455..16192474
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16193616..16193674
FT                   /estimated_length=59
FT                   /gap_type="unknown"
FT   assembly_gap    16195367..16195887
FT                   /estimated_length=521
FT                   /gap_type="unknown"
FT   assembly_gap    16225504..16225720
FT                   /estimated_length=217
FT                   /gap_type="unknown"
FT   assembly_gap    16244774..16244793
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16247144..16247163
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16248199..16248218
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16294121..16294140
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16313985..16314004
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16320654..16324834
FT                   /estimated_length=4181
FT                   /gap_type="unknown"
FT   assembly_gap    16330174..16330193
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16331355..16332728
FT                   /estimated_length=1374
FT                   /gap_type="unknown"
FT   assembly_gap    16335972..16335991
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16337245..16339009
FT                   /estimated_length=1765
FT                   /gap_type="unknown"
FT   assembly_gap    16340646..16340665
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16341746..16341765
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16344104..16344123
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16364428..16364447
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16368682..16368701
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16377808..16378021
FT                   /estimated_length=214
FT                   /gap_type="unknown"
FT   assembly_gap    16379399..16379418
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16380626..16380871
FT                   /estimated_length=246
FT                   /gap_type="unknown"
FT   assembly_gap    16382120..16382139
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16394697..16394716
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16397187..16401040
FT                   /estimated_length=3854
FT                   /gap_type="unknown"
FT   assembly_gap    16422954..16423144
FT                   /estimated_length=191
FT                   /gap_type="unknown"
FT   assembly_gap    16433227..16433246
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16448668..16448833
FT                   /estimated_length=166
FT                   /gap_type="unknown"
FT   assembly_gap    16453219..16453315
FT                   /estimated_length=97
FT                   /gap_type="unknown"
FT   assembly_gap    16463209..16463340
FT                   /estimated_length=132
FT                   /gap_type="unknown"
FT   assembly_gap    16478896..16478915
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16500113..16500132
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16501422..16501441
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16502484..16502503
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16503515..16503534
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16505178..16505197
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16513930..16513949
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16530187..16530206
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16541606..16541625
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16588313..16588332
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16589608..16589627
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16598856..16599014
FT                   /estimated_length=159
FT                   /gap_type="unknown"
FT   assembly_gap    16601730..16601749
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16603237..16603256
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16604359..16604378
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16606197..16606216
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16614341..16614360
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16616126..16616145
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16620874..16625980
FT                   /estimated_length=5107
FT                   /gap_type="unknown"
FT   assembly_gap    16627682..16640048
FT                   /estimated_length=12367
FT                   /gap_type="unknown"
FT   assembly_gap    16643466..16646162
FT                   /estimated_length=2697
FT                   /gap_type="unknown"
FT   assembly_gap    16652174..16652356
FT                   /estimated_length=183
FT                   /gap_type="unknown"
FT   assembly_gap    16700260..16700279
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16709102..16709485
FT                   /estimated_length=384
FT                   /gap_type="unknown"
FT   assembly_gap    16722516..16722535
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16753032..16753355
FT                   /estimated_length=324
FT                   /gap_type="unknown"
FT   assembly_gap    16774783..16774802
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16808425..16808520
FT                   /estimated_length=96
FT                   /gap_type="unknown"
FT   assembly_gap    16811567..16817539
FT                   /estimated_length=5973
FT                   /gap_type="unknown"
FT   assembly_gap    16838522..16838541
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16881131..16881150
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16891839..16892364
FT                   /estimated_length=526
FT                   /gap_type="unknown"
FT   assembly_gap    16893386..16895531
FT                   /estimated_length=2146
FT                   /gap_type="unknown"
FT   assembly_gap    16919776..16919902
FT                   /estimated_length=127
FT                   /gap_type="unknown"
FT   assembly_gap    16967662..16967681
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16969188..16969207
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17073627..17073833
FT                   /estimated_length=207
FT                   /gap_type="unknown"
FT   assembly_gap    17083431..17083490
FT                   /estimated_length=60
FT                   /gap_type="unknown"
FT   assembly_gap    17163372..17163391
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17164563..17164582
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17180224..17180243
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17182786..17183278
FT                   /estimated_length=493
FT                   /gap_type="unknown"
FT   assembly_gap    17184980..17184999
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17214101..17214391
FT                   /estimated_length=291
FT                   /gap_type="unknown"
FT   assembly_gap    17230601..17230654
FT                   /estimated_length=54
FT                   /gap_type="unknown"
FT   assembly_gap    17274744..17275785
FT                   /estimated_length=1042
FT                   /gap_type="unknown"
FT   assembly_gap    17291901..17291920
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            17360839..17361658
FT                   /pseudo
FT                   /locus_tag="mCG_142397"
FT                   /note="gene_id=mCG142397.0"
FT   mRNA            17360839..17361658
FT                   /pseudo
FT                   /locus_tag="mCG_142397"
FT                   /note="gene_id=mCG142397.0 transcript_id=mCT180380.0
FT                   created on 11-FEB-2003"
FT   assembly_gap    17392144..17392163
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17398160..17398179
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17399354..17399373
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17405848..17405867
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17409530..17409549
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17412553..17412572
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17413710..17413729
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17437959..17438947
FT                   /estimated_length=989
FT                   /gap_type="unknown"
FT   assembly_gap    17444781..17444800
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17453513..17453532
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17454644..17461316
FT                   /estimated_length=6673
FT                   /gap_type="unknown"
FT   assembly_gap    17464267..17465572
FT                   /estimated_length=1306
FT                   /gap_type="unknown"
FT   assembly_gap    17466653..17466672
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17512542..17514208
FT                   /estimated_length=1667
FT                   /gap_type="unknown"
FT   assembly_gap    17541353..17541535
FT                   /estimated_length=183
FT                   /gap_type="unknown"
FT   assembly_gap    17556307..17556384
FT                   /estimated_length=78
FT                   /gap_type="unknown"
FT   assembly_gap    17566620..17566677
FT                   /estimated_length=58
FT                   /gap_type="unknown"
FT   assembly_gap    17592883..17594812
FT                   /estimated_length=1930
FT                   /gap_type="unknown"
FT   assembly_gap    17599540..17602255
FT                   /estimated_length=2716
FT                   /gap_type="unknown"
FT   assembly_gap    17612822..17612841
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17615049..17615282
FT                   /estimated_length=234
FT                   /gap_type="unknown"
FT   assembly_gap    17648888..17649145
FT                   /estimated_length=258
FT                   /gap_type="unknown"
FT   assembly_gap    17663827..17668912
FT                   /estimated_length=5086
FT                   /gap_type="unknown"
FT   assembly_gap    17672507..17672526
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17690529..17690548
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17692244..17693240
FT                   /estimated_length=997
FT                   /gap_type="unknown"
FT   assembly_gap    17736917..17736936
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17748632..17749940
FT                   /estimated_length=1309
FT                   /gap_type="unknown"
FT   assembly_gap    17753866..17754273
FT                   /estimated_length=408
FT                   /gap_type="unknown"
FT   assembly_gap    17760194..17760535
FT                   /estimated_length=342
FT                   /gap_type="unknown"
FT   assembly_gap    17844343..17845764
FT                   /estimated_length=1422
FT                   /gap_type="unknown"
FT   assembly_gap    17851524..17851543
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17892940..17893076
FT                   /estimated_length=137
FT                   /gap_type="unknown"
FT   assembly_gap    17903677..17903696
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17919389..17919538
FT                   /estimated_length=150
FT                   /gap_type="unknown"
FT   assembly_gap    17931923..17931988
FT                   /estimated_length=66
FT                   /gap_type="unknown"
FT   assembly_gap    17943882..17943901
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17953796..17953815
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17974041..17975230
FT                   /estimated_length=1190
FT                   /gap_type="unknown"
FT   assembly_gap    17982328..17982347
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17998002..17998021
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18006324..18007485
FT                   /estimated_length=1162
FT                   /gap_type="unknown"
FT   assembly_gap    18008746..18008765
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18024006..18024048
FT                   /estimated_length=43
FT                   /gap_type="unknown"
FT   assembly_gap    18025375..18025394
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18027962..18027981
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18029075..18029094
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18038449..18038468
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18039818..18039837
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18045632..18046407
FT                   /estimated_length=776
FT                   /gap_type="unknown"
FT   assembly_gap    18088785..18088937
FT                   /estimated_length=153
FT                   /gap_type="unknown"
FT   assembly_gap    18096567..18096586
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18101448..18101488
FT                   /estimated_length=41
FT                   /gap_type="unknown"
FT   assembly_gap    18120169..18120188
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18121252..18121739
FT                   /estimated_length=488
FT                   /gap_type="unknown"
FT   assembly_gap    18122770..18125275
FT                   /estimated_length=2506
FT                   /gap_type="unknown"
FT   assembly_gap    18126603..18126622
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18127976..18127995
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18129484..18129503
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18131029..18131763
FT                   /estimated_length=735
FT                   /gap_type="unknown"
FT   assembly_gap    18150023..18150112
FT                   /estimated_length=90
FT                   /gap_type="unknown"
FT   assembly_gap    18151247..18151588
FT                   /estimated_length=342
FT                   /gap_type="unknown"
FT   assembly_gap    18152803..18152822
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18176748..18177509
FT                   /estimated_length=762
FT                   /gap_type="unknown"
FT   assembly_gap    18213383..18213487
FT                   /estimated_length=105
FT                   /gap_type="unknown"
FT   assembly_gap    18215809..18215828
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18220086..18220105
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18246704..18246723
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18269684..18270806
FT                   /estimated_length=1123
FT                   /gap_type="unknown"
FT   assembly_gap    18278710..18279957
FT                   /estimated_length=1248
FT                   /gap_type="unknown"
FT   assembly_gap    18286758..18289483
FT                   /estimated_length=2726
FT                   /gap_type="unknown"
FT   assembly_gap    18295713..18295732
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18304325..18304344
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18308990..18309009
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18332049..18332068
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18402250..18402269
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18411692..18412423
FT                   /estimated_length=732
FT                   /gap_type="unknown"
FT   assembly_gap    18442925..18442944
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18470340..18470359
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18480876..18481657
FT                   /estimated_length=782
FT                   /gap_type="unknown"
FT   assembly_gap    18483065..18483137
FT                   /estimated_length=73
FT                   /gap_type="unknown"
FT   assembly_gap    18510805..18510824
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18576710..18576729
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18591313..18591332
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18637974..18638343
FT                   /estimated_length=370
FT                   /gap_type="unknown"
FT   assembly_gap    18639868..18641233
FT                   /estimated_length=1366
FT                   /gap_type="unknown"
FT   assembly_gap    18645248..18645820
FT                   /estimated_length=573
FT                   /gap_type="unknown"
FT   assembly_gap    18691025..18691934
FT                   /estimated_length=910
FT                   /gap_type="unknown"
FT   assembly_gap    18693207..18695612
FT                   /estimated_length=2406
FT                   /gap_type="unknown"
FT   assembly_gap    18697872..18697891
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18700856..18700875
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18706227..18707219
FT                   /estimated_length=993
FT                   /gap_type="unknown"
FT   assembly_gap    18709059..18709120
FT                   /estimated_length=62
FT                   /gap_type="unknown"
FT   assembly_gap    18710128..18710770
FT                   /estimated_length=643
FT                   /gap_type="unknown"
FT   assembly_gap    18731405..18731523
FT                   /estimated_length=119
FT                   /gap_type="unknown"
FT   assembly_gap    18742586..18743946
FT                   /estimated_length=1361
FT                   /gap_type="unknown"
FT   assembly_gap    18747507..18748084
FT                   /estimated_length=578
FT                   /gap_type="unknown"
FT   assembly_gap    18749895..18753281
FT                   /estimated_length=3387
FT                   /gap_type="unknown"
FT   assembly_gap    18782375..18782394
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18797841..18797957
FT                   /estimated_length=117
FT                   /gap_type="unknown"
FT   assembly_gap    18838474..18838493
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18852814..18858026
FT                   /estimated_length=5213
FT                   /gap_type="unknown"
FT   gene            18877087..18894487
FT                   /gene="Tyrp1"
FT                   /locus_tag="mCG_8929"
FT                   /note="gene_id=mCG8929.1"
FT   mRNA            join(18877087..18877175,18877769..18878238,
FT                   18880163..18880485,18883374..18883578,18887553..18887720,
FT                   18889339..18889518,18892498..18892644,18893447..18894487)
FT                   /gene="Tyrp1"
FT                   /locus_tag="mCG_8929"
FT                   /product="tyrosinase-related protein 1"
FT                   /note="gene_id=mCG8929.1 transcript_id=mCT8849.2 created on
FT                   08-OCT-2002"
FT   CDS             join(18877854..18878238,18880163..18880485,
FT                   18883374..18883578,18887553..18887720,18889339..18889518,
FT                   18892498..18892644,18893447..18893652)
FT                   /codon_start=1
FT                   /gene="Tyrp1"
FT                   /locus_tag="mCG_8929"
FT                   /product="tyrosinase-related protein 1"
FT                   /note="gene_id=mCG8929.1 transcript_id=mCT8849.2
FT                   protein_id=mCP21209.2"
FT                   /db_xref="GOA:Q3UFS3"
FT                   /db_xref="InterPro:IPR002227"
FT                   /db_xref="InterPro:IPR008922"
FT                   /db_xref="InterPro:IPR015559"
FT                   /db_xref="MGI:MGI:98881"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UFS3"
FT                   /protein_id="EDL31046.1"
FT                   /translation="MKSYNVLPLAYISLFLMLFYQVWAQFPRECANIEALRRGVCCPDL
FT                   LPSSGPGTDPCGSSSGRGRCVAVIADSRPHSRHYPHDGKDDREAWPLRFFNRTCQCNDN
FT                   FSGHNCGTCRPGWRGAACNQKILTVRRNLLDLSPEEKSHFVRALDMAKRTTHPQFVIAT
FT                   RRLEDILGPDGNTPQFENISVYNYFVWTHYYSVKKTFLGTGQESFGDVDFSHEGPAFLT
FT                   WHRYHLLQLERDMQEMLQEPSFSLPYWNFATGKNVCDVCTDDLMGSRSNFDSTLISPNS
FT                   VFSQWRVVCESLEEYDTLGTLCNSTEGGPIRRNPAGNVGRPAVQRLPEPQDVTQCLEVR
FT                   VFDTPPFYSNSTDSFRNTVEGYSAPTGKYDPAVRSLHNLAHLFLNGTGGQTHLSPNDPI
FT                   FVLLHTFTDAVFDEWLRRYNADISTFPLENAPIGHNRQYNMVPFWPPVTNTEMFVTAPD
FT                   NLGYAYEVQWPGQEFTVSEIITIAVVAALLLVAAIFGVASCLIRSRSTKNEANQPLLTD
FT                   HYQRYAEDYEELPNPNHSMV"
FT   assembly_gap    18912945..18913068
FT                   /estimated_length=124
FT                   /gap_type="unknown"
FT   assembly_gap    18914453..18914653
FT                   /estimated_length=201
FT                   /gap_type="unknown"
FT   assembly_gap    18924664..18925464
FT                   /estimated_length=801
FT                   /gap_type="unknown"
FT   assembly_gap    18940166..18940216
FT                   /estimated_length=51
FT                   /gap_type="unknown"
FT   assembly_gap    18945921..18945964
FT                   /estimated_length=44
FT                   /gap_type="unknown"
FT   assembly_gap    18950127..18950309
FT                   /estimated_length=183
FT                   /gap_type="unknown"
FT   gene            <18955681..18999464
FT                   /gene="D4Bwg0951e"
FT                   /locus_tag="mCG_8928"
FT                   /note="gene_id=mCG8928.1"
FT   mRNA            join(<18955681..18956645,18998721..18999464)
FT                   /gene="D4Bwg0951e"
FT                   /locus_tag="mCG_8928"
FT                   /product="DNA segment, Chr 4, Brigham & Women's Genetics
FT                   0951 expressed"
FT                   /note="gene_id=mCG8928.1 transcript_id=mCT8848.2 created on
FT                   30-OCT-2002"
FT   CDS             join(<18956274..18956645,18998721..18999095)
FT                   /codon_start=1
FT                   /gene="D4Bwg0951e"
FT                   /locus_tag="mCG_8928"
FT                   /product="DNA segment, Chr 4, Brigham & Women's Genetics
FT                   0951 expressed"
FT                   /note="gene_id=mCG8928.1 transcript_id=mCT8848.2
FT                   protein_id=mCP21215.1"
FT                   /protein_id="EDL31045.1"
FT                   /translation="APESARPPPPPPRALCLYCQCRPSQRVMEDSPLPDLRDIELKLGR
FT                   KVPESLARSLRGEELAPREGAADPSGVGGSCSSSSSCSSFAPSVSSSSSSSPASGSPRR
FT                   SHPSALERLETKLHILRQEMVNLRATDVRLMRQLLLINESIESIKWMIEEKATITSRGS
FT                   SLSGSLCSLLESQSTSLRGSYNSLHDGSDGLDGISVGSYLDTLADDVPGHQTPSDLDQF
FT                   SDSSIIEDSQALHKHPKLDSEYYCFG"
FT   assembly_gap    18960548..18960567
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18973590..18973609
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18975112..18975131
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18976536..18979860
FT                   /estimated_length=3325
FT                   /gap_type="unknown"
FT   assembly_gap    19006241..19006260
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19007426..19007445
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19018447..19018466
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19077661..19077756
FT                   /estimated_length=96
FT                   /gap_type="unknown"
FT   assembly_gap    19097651..19097845
FT                   /estimated_length=195
FT                   /gap_type="unknown"
FT   assembly_gap    19159942..19159961
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19161245..19161264
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19162874..19162893
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19167643..19167662
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19171261..19172612
FT                   /estimated_length=1352
FT                   /gap_type="unknown"
FT   assembly_gap    19173992..19174011
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19175342..19183785
FT                   /estimated_length=8444
FT                   /gap_type="unknown"
FT   assembly_gap    19193050..19194404
FT                   /estimated_length=1355
FT                   /gap_type="unknown"
FT   assembly_gap    19203076..19203095
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19204813..19204832
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19240753..19241610
FT                   /estimated_length=858
FT                   /gap_type="unknown"
FT   assembly_gap    19243410..19243455
FT                   /estimated_length=46
FT                   /gap_type="unknown"
FT   assembly_gap    19249037..19251087
FT                   /estimated_length=2051
FT                   /gap_type="unknown"
FT   assembly_gap    19267366..19267385
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19268863..19268882
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19281999..19285246
FT                   /estimated_length=3248
FT                   /gap_type="unknown"
FT   assembly_gap    19286255..19286499
FT                   /estimated_length=245
FT                   /gap_type="unknown"
FT   assembly_gap    19303333..19303481
FT                   /estimated_length=149
FT                   /gap_type="unknown"
FT   assembly_gap    19307617..19307636
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(19330551..19465669)
FT                   /gene="Mpdz"
FT                   /locus_tag="mCG_8964"
FT                   /note="gene_id=mCG8964.1"
FT   mRNA            complement(join(19330551..19330727,19332627..19332750,
FT                   19333583..19333695,19334259..19334363,19335501..19335623,
FT                   19336387..19336430,19337284..19337374,19338576..19338662,
FT                   19341152..19341299,19343336..19343529,19343678..19343761,
FT                   19344397..19344542,19346336..19346501,19348203..19348277,
FT                   19348378..19348470,19354533..19354613,19357589..19357679,
FT                   19357887..19357978,19359015..19359211,19360942..19361104,
FT                   19364284..19364382,19368375..19368485,19371128..19371305,
FT                   19377662..19377754,19380224..19380328,19386417..19386615,
FT                   19400670..19400784,19401042..19401317,19408150..19408317,
FT                   19410134..19410250,19411512..19411721,19412824..19413009,
FT                   19414534..19414698,19415513..19415659,19417428..19417534,
FT                   19420208..19420279,19421087..19421249,19429559..19429647,
FT                   19429952..19430066,19433266..19433475,19434902..19435030,
FT                   19435353..19435566,19436758..19436897,19437849..19438061,
FT                   19463298..19463464,19465599..19465669))
FT                   /gene="Mpdz"
FT                   /locus_tag="mCG_8964"
FT                   /product="multiple PDZ domain protein"
FT                   /note="gene_id=mCG8964.1 transcript_id=mCT8927.1 created on
FT                   07-OCT-2002"
FT   CDS             complement(join(19330581..19330727,19332627..19332750,
FT                   19333583..19333695,19334259..19334363,19335501..19335623,
FT                   19336387..19336430,19337284..19337374,19338576..19338662,
FT                   19341152..19341299,19343336..19343529,19343678..19343761,
FT                   19344397..19344542,19346336..19346501,19348203..19348277,
FT                   19348378..19348470,19354533..19354613,19357589..19357679,
FT                   19357887..19357978,19359015..19359211,19360942..19361104,
FT                   19364284..19364382,19368375..19368485,19371128..19371305,
FT                   19377662..19377754,19380224..19380328,19386417..19386615,
FT                   19400670..19400784,19401042..19401317,19408150..19408317,
FT                   19410134..19410250,19411512..19411721,19412824..19413009,
FT                   19414534..19414698,19415513..19415659,19417428..19417534,
FT                   19420208..19420279,19421087..19421249,19429559..19429647,
FT                   19429952..19430066,19433266..19433475,19434902..19435030,
FT                   19435353..19435566,19436758..19436897,19437849..19438061,
FT                   19463298..19463464,19465599..19465614))
FT                   /codon_start=1
FT                   /gene="Mpdz"
FT                   /locus_tag="mCG_8964"
FT                   /product="multiple PDZ domain protein"
FT                   /note="gene_id=mCG8964.1 transcript_id=mCT8927.1
FT                   protein_id=mCP21211.2"
FT                   /protein_id="EDL31044.1"
FT                   /translation="MLETIDKNRALQAAERLQSKLKERGDVANEDKLSLLKSVLQSPLF
FT                   SQILNLQTSLQQLKDQVNIATLATAAADHAHTPQFSSAVISNLQSESLLLSPNHGNLEA
FT                   LPGPGAPAVMDGKPTCDELDQLIKNMAQGRHVEIFELLKPPCGGLGFSVVGLRSENRGE
FT                   LGIFVQEIQEGSVAHRDGRLKETDQILAINGQVLDQTITHQQAISILQKAKDTVQLVIA
FT                   RGSLPPVSSPRISRSPSAASTISAHSNPMHWQHVETIELVNDGSGLGFGIIGGKATGVI
FT                   VKTILPGGVADQHGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQCGNRVKLMIARGAVE
FT                   ETPASSSLGITLSSSTSSTSEMRVDASTQKNDESETFDVELTKNVQGLGITIAGYIGDK
FT                   KLEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVRL
FT                   TLMRKGASQEAELTSRGDTAKDVDLPAENCEKDEESLSLKRNTSILPIEEEGFPLLSAE
FT                   LEEAEDVQQEAALLTKWQRIMGINYEIVVAHVSKFSENSGLGISLEATVGHHFIRSVLP
FT                   EGPVGHSGKLFSGDELLEVNGINLLGENHQDVVNILKELPIDVTMVCCRRTVPPIALSE
FT                   MDSLDINDLELTEKPHIDLGEFIGSSETEDPMLAMSDVDQNAEEIQTPLAMWEAGVQSI
FT                   ELEKGSRGLGFSILDYQDPIDPANTVIVIRSLVPGGIAEKDGRLFPGDRLMFVNDINLE
FT                   NSTLEEAVEALKGAPSGMVRIGVAKPLPLSPEEGYVSAKEDAFLCSPRACKESGLSDKA
FT                   LFRADLALIDTPDAESIAESRFESQFSPDNDSVYSTQASIFSLHDGACSDGMNYGPSLP
FT                   SSPPKDVTSSSEVVLGLHLSLEELYTQNLLQRQHAGSPPTDMRPAPTSGFPISDYTTTN
FT                   AVEQKYECANPVAWPHSQLPSSLSTSELAPALPAVAQKYLTDQSSLVSDAESVNLQSMS
FT                   QEAFERTVTIAKGSSSLGMTVSANKDGLGVIVRSIIHGGAISRDGRIAVGDCILSINEE
FT                   STISLTNAQARAMLRRHSLIGPDIKITYVPAEHLEEFRVSFGQQAGGIMALDIFSSYTG
FT                   RDIPELPEREEGEGEESELQNAAYSSWSQPRRVELWREPSKSLGISIVGGRGMGSRLSN
FT                   GEVMRGIFIKHVLEDSPAGKNGTLKPGDRIIEVDGMDLRDASHEQAVEAIRKAGNPVVF
FT                   MVQSIINRPRKSPLPSLPHSLYPKYSFSSTNPFADSLQLTTDQAPSQSESETEKPALCN
FT                   VPPSSPSVFSEMGSDCAQPSATAVSEDEDKEDEFGYSWKNIQERYGSLTGQLHVIELEK
FT                   GQSGLGLSLAGNKDRTRMSVFIVGIDPTGAAGRDGRLQIADELLEINGQILYGRSHQNA
FT                   SSIIKCAPSKVKIIFIRNADAVNQMAVCPGNAADSPSSTSDSPQNKEVEPCSTTSASAA
FT                   DLSSLTDVYQLELPKDQGGLGIAICEEDTINGVMIESLTEHGGAAKDGRLKPGDHILAV
FT                   DDEVVAGCPVEKFISLLKTAKATVKLTVRAENPACPAVPSSAVTVSGERKDNSQTPAVP
FT                   APDLEPIPSTSRSSTPAVFASDPATCPIIPGCETTIEISKGQTGLGLSIVGGSDTLLGA
FT                   IIIHEVYEEGAACKDGRLWAGDQILEVNGIDLRKATHDEAINVLRQTPQRVRLTLYRDE
FT                   APYKEEDVCDTFTIELQKRPGKGLGLSIVGKRNDTGVFVSDIVKGGIADADGRLMQGDQ
FT                   ILMVNGEDVRNATQEAVAALLKCSLGAVTLEVGRVKAAPFHSERRPSQSSQVSESSLSS
FT                   FTPPLSGINTSESLESNSKKNALASEIQGLRTVEIKKGPADSLGLSIAGGVGSPLGDVP
FT                   IFIAMMHPNGVAAQTQKLRVGDRIVTICGTSTDGMTHTQAVNLMKNASGSIEVQVVAGG
FT                   DVSVVTGHQQELANPCLAFTGLTSSSIFPDDLGPPQSKTITLDRGPDGLGFSIVGGYGS
FT                   PHGDLPIYVKTVFAKGAAAEDGRLKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTL
FT                   MVLS"
FT   assembly_gap    19390314..19390333
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19396029..19396048
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19409251..19409653
FT                   /estimated_length=403
FT                   /gap_type="unknown"
FT   assembly_gap    19428632..19428651
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19452223..19453482
FT                   /estimated_length=1260
FT                   /gap_type="unknown"
FT   assembly_gap    19486722..19486834
FT                   /estimated_length=113
FT                   /gap_type="unknown"
FT   assembly_gap    19489996..19490015
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19496472..19496544
FT                   /estimated_length=73
FT                   /gap_type="unknown"
FT   assembly_gap    19509050..19509069
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19515089..19515518
FT                   /estimated_length=430
FT                   /gap_type="unknown"
FT   assembly_gap    19529244..19529263
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19582587..19582606
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19596308..19597526
FT                   /estimated_length=1219
FT                   /gap_type="unknown"
FT   assembly_gap    19621940..19622142
FT                   /estimated_length=203
FT                   /gap_type="unknown"
FT   assembly_gap    19627121..19627209
FT                   /estimated_length=89
FT                   /gap_type="unknown"
FT   assembly_gap    19628826..19628886
FT                   /estimated_length=61
FT                   /gap_type="unknown"
FT   assembly_gap    19630958..19631161
FT                   /estimated_length=204
FT                   /gap_type="unknown"
FT   assembly_gap    19647332..19647351
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19723680..19723760
FT                   /estimated_length=81
FT                   /gap_type="unknown"
FT   assembly_gap    19732204..19732223
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19745136..19745155
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19749263..19749282
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19750966..19751128
FT                   /estimated_length=163
FT                   /gap_type="unknown"
FT   assembly_gap    19772024..19772043
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <19783874..19787452
FT                   /locus_tag="mCG_145484"
FT                   /note="gene_id=mCG145484.0"
FT   mRNA            join(<19783874..19783947,19784635..19786964,
FT                   19787054..19787452)
FT                   /locus_tag="mCG_145484"
FT                   /product="mCG145484"
FT                   /note="gene_id=mCG145484.0 transcript_id=mCT184908.0
FT                   created on 05-JUN-2003"
FT   assembly_gap    19784084..19784278
FT                   /estimated_length=195
FT                   /gap_type="unknown"
FT   CDS             <19784758..19785081
FT                   /codon_start=1
FT                   /locus_tag="mCG_145484"
FT                   /product="mCG145484"
FT                   /note="gene_id=mCG145484.0 transcript_id=mCT184908.0
FT                   protein_id=mCP105838.0"
FT                   /protein_id="EDL31043.1"
FT                   /translation="KEETEREKPSTPFCSIHESKRRISSPGIPDNTPAIALATVTGSRH
FT                   GLWRKQSLSLAQAASSSSSSPTTDLLIAPNNCAPHFWPTASCPPACQRTTDTENTEIHI
FT                   LFS"
FT   assembly_gap    19786970..19786989
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19793110..19793330
FT                   /estimated_length=221
FT                   /gap_type="unknown"
FT   assembly_gap    19812358..19821724
FT                   /estimated_length=9367
FT                   /gap_type="unknown"
FT   assembly_gap    19840633..19842572
FT                   /estimated_length=1940
FT                   /gap_type="unknown"
FT   assembly_gap    19845703..19847655
FT                   /estimated_length=1953
FT                   /gap_type="unknown"
FT   assembly_gap    19849787..19849964
FT                   /estimated_length=178
FT                   /gap_type="unknown"
FT   assembly_gap    19853700..19856493
FT                   /estimated_length=2794
FT                   /gap_type="unknown"
FT   assembly_gap    19857194..19857562
FT                   /estimated_length=369
FT                   /gap_type="unknown"
FT   assembly_gap    19883650..19883840
FT                   /estimated_length=191
FT                   /gap_type="unknown"
FT   assembly_gap    19921879..19921936
FT                   /estimated_length=58
FT                   /gap_type="unknown"
FT   assembly_gap    19939540..19939559
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19947682..19952480
FT                   /estimated_length=4799
FT                   /gap_type="unknown"
FT   assembly_gap    19995198..19995217
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20015436..20015471
FT                   /estimated_length=36
FT                   /gap_type="unknown"
FT   assembly_gap    20030108..20032502
FT                   /estimated_length=2395
FT                   /gap_type="unknown"
FT   assembly_gap    20049790..20054500
FT                   /estimated_length=4711
FT                   /gap_type="unknown"
FT   gene            complement(20070582..>20096222)
FT                   /locus_tag="mCG_146034"
FT                   /note="gene_id=mCG146034.0"
FT   mRNA            complement(join(20070582..20072250,20074379..20074466,
FT                   20078549..20079246,20080231..20080430,20082934..20083151,
FT                   20096121..>20096222))
FT                   /locus_tag="mCG_146034"
FT                   /product="mCG146034"
FT                   /note="gene_id=mCG146034.0 transcript_id=mCT186142.0
FT                   created on 04-JUL-2003"
FT   CDS             complement(join(20082992..20083151,20096121..>20096221))
FT                   /codon_start=1
FT                   /locus_tag="mCG_146034"
FT                   /product="mCG146034"
FT                   /note="gene_id=mCG146034.0 transcript_id=mCT186142.0
FT                   protein_id=mCP107594.0"
FT                   /protein_id="EDL31042.1"
FT                   /translation="ILTFHCAENRPAREPCYFYFTARGSQVTNYIRMRSPLRKLPISSP
FT                   FRLPLWGYSPTHPLPFSSPGISCLSTDYIWIELQCRNGGHI"
FT   gene            <20096096..20133107
FT                   /locus_tag="mCG_1043452"
FT                   /note="gene_id=mCG1043452.0"
FT   mRNA            join(<20096096..20096371,20107742..20107807,
FT                   20132760..20133107)
FT                   /locus_tag="mCG_1043452"
FT                   /product="mCG1043452"
FT                   /note="gene_id=mCG1043452.0 transcript_id=mCT161156.1
FT                   created on 29-JAN-2003"
FT   CDS             join(20096096..20096371,20107742..20107807,
FT                   20132760..20132774)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1043452"
FT                   /product="mCG1043452"
FT                   /note="gene_id=mCG1043452.0 transcript_id=mCT161156.1
FT                   protein_id=mCP76029.1"
FT                   /protein_id="EDL31041.1"
FT                   /translation="MSLPTWNLPHPYIICNLRSPRSEVKIARLSGRSVLCTVEGQNGEG
FT                   RTWGEPESWATECPSCGFGRDTFSPVSCDDTENTSEEVVSGFPWEKREEQQHEGRPCAG
FT                   GAKSSTTSSKTQRY"
FT   assembly_gap    20134883..20136803
FT                   /estimated_length=1921
FT                   /gap_type="unknown"
FT   assembly_gap    20140114..20140133
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20143738..20143838
FT                   /estimated_length=101
FT                   /gap_type="unknown"
FT   assembly_gap    20158171..20158268
FT                   /estimated_length=98
FT                   /gap_type="unknown"
FT   assembly_gap    20195908..20195927
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20246432..20246451
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20275954..20276356
FT                   /estimated_length=403
FT                   /gap_type="unknown"
FT   assembly_gap    20293890..20293909
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(20319945..>20529169)
FT                   /gene="Nfib"
FT                   /locus_tag="mCG_125533"
FT                   /note="gene_id=mCG125533.2"
FT   mRNA            complement(join(20319945..20320676,20334187..20334275,
FT                   20344341..20344423,20347445..20347583,20351563..20351747,
FT                   20354128..20354262,20374307..20374425,20377441..20377561,
FT                   20383609..20383677,20407502..20407555,20522094..20522625,
FT                   20528589..20529157))
FT                   /gene="Nfib"
FT                   /locus_tag="mCG_125533"
FT                   /product="nuclear factor I/B, transcript variant mCT126794"
FT                   /note="gene_id=mCG125533.2 transcript_id=mCT126794.1
FT                   created on 07-OCT-2002"
FT   mRNA            complement(join(20319945..20320676,20334187..20334275,
FT                   20351563..20351747,20354128..20354262,20374307..20374425,
FT                   20377441..20377561,20383609..20383677,20407502..20407555,
FT                   20522094..20522625,20528589..20529149))
FT                   /gene="Nfib"
FT                   /locus_tag="mCG_125533"
FT                   /product="nuclear factor I/B, transcript variant mCT174245"
FT                   /note="gene_id=mCG125533.2 transcript_id=mCT174245.0
FT                   created on 07-OCT-2002"
FT   mRNA            complement(join(20319953..20320676,20344341..20344423,
FT                   20347445..20347583,20351563..20351747,20354128..20354262,
FT                   20374307..20374425,20377441..20377561,20383609..20383677,
FT                   20407502..20407555,20522094..20522625,20528589..>20528774))
FT                   /gene="Nfib"
FT                   /locus_tag="mCG_125533"
FT                   /product="nuclear factor I/B, transcript variant mCT192860"
FT                   /note="gene_id=mCG125533.2 transcript_id=mCT192860.0
FT                   created on 09-MAR-2004"
FT   mRNA            complement(join(20320288..20320676,20351563..20351747,
FT                   20354128..20354262,20374307..20374425,20377441..20377561,
FT                   20383609..20383677,20407502..20407555,20522094..20522625,
FT                   20528589..20529157))
FT                   /gene="Nfib"
FT                   /locus_tag="mCG_125533"
FT                   /product="nuclear factor I/B, transcript variant mCT174244"
FT                   /note="gene_id=mCG125533.2 transcript_id=mCT174244.0
FT                   created on 07-OCT-2002"
FT   CDS             complement(join(20320547..20320676,20334187..20334275,
FT                   20351563..20351747,20354128..20354262,20374307..20374425,
FT                   20377441..20377561,20383609..20383677,20407502..20407555,
FT                   20522094..20522625,20528589..20528618))
FT                   /codon_start=1
FT                   /gene="Nfib"
FT                   /locus_tag="mCG_125533"
FT                   /product="nuclear factor I/B, isoform CRA_c"
FT                   /note="gene_id=mCG125533.2 transcript_id=mCT174245.0
FT                   protein_id=mCP97163.0 isoform=CRA_c"
FT                   /protein_id="EDL31037.1"
FT                   /translation="MMYSPICLTQDEFHPFIEALLPHVRAIAYTWFNLQARKRKYFKKH
FT                   EKRMSKDEERAVKDELLSEKPEIKQKWASRLLAKLRKDIRQEYREDFVLTVTGKKHPCC
FT                   VLSNPDQKGKIRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLMKSPHCTNPALC
FT                   VQPHHITVSVKELDLFLAYYVQEQDSGQSGSPSHSDPAKNPPGYLEDSFVKSGVFNVSE
FT                   LVRVSRTPITQGTGVNFPIGEIPSQPYYHDMNSGVNLQRSLSSPPSSKRPKTISIDENM
FT                   EPSPTGDFYPSPNSPAAGSRTWHERDQDMSSPTTMKKPEKPLFSSTSPQDSSPRLSTFP
FT                   QHHHPGIPGVAHSVISTRTPPPPSPLPFPTQAILPPAPSSYFSHPTIRYPPHLNPQDTL
FT                   KNYVPSYDPSSPQTSQLRICDWTMNQNGRHLYPSTSEDTLGITWQSPGTWASLVPFQVS
FT                   NRTPILPANVQNYGLNIIGEPFLQAETSN"
FT   CDS             complement(join(20320547..20320676,20334187..20334275,
FT                   20344341..20344423,20347445..20347583,20351563..20351747,
FT                   20354128..20354262,20374307..20374425,20377441..20377561,
FT                   20383609..20383677,20407502..20407555,20522094..20522625,
FT                   20528589..20528618))
FT                   /codon_start=1
FT                   /gene="Nfib"
FT                   /locus_tag="mCG_125533"
FT                   /product="nuclear factor I/B, isoform CRA_a"
FT                   /note="gene_id=mCG125533.2 transcript_id=mCT126794.1
FT                   protein_id=mCP75909.1 isoform=CRA_a"
FT                   /protein_id="EDL31035.1"
FT                   /translation="MMYSPICLTQDEFHPFIEALLPHVRAIAYTWFNLQARKRKYFKKH
FT                   EKRMSKDEERAVKDELLSEKPEIKQKWASRLLAKLRKDIRQEYREDFVLTVTGKKHPCC
FT                   VLSNPDQKGKIRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLMKSPHCTNPALC
FT                   VQPHHITVSVKELDLFLAYYVQEQDSGQSGSPSHSDPAKNPPGYLEDSFVKSGVFNVSE
FT                   LVRVSRTPITQGTGVNFPIGEIPSQPYYHDMNSGVNLQRSLSSPPSSKRPKTISIDENM
FT                   EPSPTGDFYPSPNSPAAGSRTWHERDQDMSSPTTMKKPEKPLFSSTSPQDSSPRLSTFP
FT                   QHHHPGIPGVAHSVISTRTPPPPSPLPFPTQAILPPAPSSYFSHPTIRYPPHLNPQDTL
FT                   KNYVPSYDPSSPQTSQPNSSGQVVGKVPGHFTPVLAPSPHPSAVRPVTLTMTDTKPITT
FT                   STEAYTASGTSQANRYVGLSPRDPSFLHQQQLRICDWTMNQNGRHLYPSTSEDTLGITW
FT                   QSPGTWASLVPFQVSNRTPILPANVQNYGLNIIGEPFLQAETSN"
FT   CDS             complement(join(20320659..20320676,20344341..20344423,
FT                   20347445..20347583,20351563..20351747,20354128..20354262,
FT                   20374307..20374425,20377441..20377561,20383609..20383677,
FT                   20407502..20407555,20522094..20522625,20528589..>20528627))
FT                   /codon_start=1
FT                   /gene="Nfib"
FT                   /locus_tag="mCG_125533"
FT                   /product="nuclear factor I/B, isoform CRA_f"
FT                   /note="gene_id=mCG125533.2 transcript_id=mCT192860.0
FT                   protein_id=mCP113785.0 isoform=CRA_f"
FT                   /protein_id="EDL31040.1"
FT                   /translation="GEVMMYSPICLTQDEFHPFIEALLPHVRAIAYTWFNLQARKRKYF
FT                   KKHEKRMSKDEERAVKDELLSEKPEIKQKWASRLLAKLRKDIRQEYREDFVLTVTGKKH
FT                   PCCVLSNPDQKGKIRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLMKSPHCTNP
FT                   ALCVQPHHITVSVKELDLFLAYYVQEQDSGQSGSPSHSDPAKNPPGYLEDSFVKSGVFN
FT                   VSELVRVSRTPITQGTGVNFPIGEIPSQPYYHDMNSGVNLQRSLSSPPSSKRPKTISID
FT                   ENMEPSPTGDFYPSPNSPAAGSRTWHERDQDMSSPTTMKKPEKPLFSSTSPQDSSPRLS
FT                   TFPQHHHPGIPGVAHSVISTRTPPPPSPLPFPTQAILPPAPSSYFSHPTIRYPPHLNPQ
FT                   DTLKNYVPSYDPSSPQTSQPNSSGQVVGKVPGHFTPVLAPSPHPSAVRPVTLTMTDTKP
FT                   ITTSTEAYTASGTSQANRYVGLSPRDPSFLHQQQSWYLG"
FT   CDS             complement(join(20320659..20320676,20351563..20351747,
FT                   20354128..20354262,20374307..20374425,20377441..20377561,
FT                   20383609..20383677,20407502..20407555,20522094..20522625,
FT                   20528589..20528618))
FT                   /codon_start=1
FT                   /gene="Nfib"
FT                   /locus_tag="mCG_125533"
FT                   /product="nuclear factor I/B, isoform CRA_b"
FT                   /note="gene_id=mCG125533.2 transcript_id=mCT174244.0
FT                   protein_id=mCP97164.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q6GSP7"
FT                   /db_xref="InterPro:IPR000647"
FT                   /db_xref="InterPro:IPR003619"
FT                   /db_xref="InterPro:IPR019548"
FT                   /db_xref="InterPro:IPR019739"
FT                   /db_xref="InterPro:IPR020604"
FT                   /db_xref="MGI:MGI:103188"
FT                   /db_xref="UniProtKB/TrEMBL:Q6GSP7"
FT                   /protein_id="EDL31036.1"
FT                   /translation="MMYSPICLTQDEFHPFIEALLPHVRAIAYTWFNLQARKRKYFKKH
FT                   EKRMSKDEERAVKDELLSEKPEIKQKWASRLLAKLRKDIRQEYREDFVLTVTGKKHPCC
FT                   VLSNPDQKGKIRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLMKSPHCTNPALC
FT                   VQPHHITVSVKELDLFLAYYVQEQDSGQSGSPSHSDPAKNPPGYLEDSFVKSGVFNVSE
FT                   LVRVSRTPITQGTGVNFPIGEIPSQPYYHDMNSGVNLQRSLSSPPSSKRPKTISIDENM
FT                   EPSPTGDFYPSPNSPAAGSRTWHERDQDMSSPTTMKKPEKPLFSSTSPQDSSPRLSTFP
FT                   QHHHPGIPGVAHSVISTRTPPPPSPLPFPTQAILPPAPSSYFSHPTIRYPPHLNPQDTL
FT                   KNYVPSYDPSSPQTSQSWYLG"
FT   mRNA            complement(join(20350659..20351747,20354128..20354262,
FT                   20374307..20374425,20377441..20377561,20383609..20383677,
FT                   20407502..20407555,20522094..20522625,20528589..>20529169))
FT                   /gene="Nfib"
FT                   /locus_tag="mCG_125533"
FT                   /product="nuclear factor I/B, transcript variant mCT192859"
FT                   /note="gene_id=mCG125533.2 transcript_id=mCT192859.0
FT                   created on 09-MAR-2004"
FT   CDS             complement(join(20351527..20351747,20354128..20354262,
FT                   20374307..20374425,20377441..20377561,20383609..20383677,
FT                   20407502..20407555,20522094..20522625,20528589..>20528627))
FT                   /codon_start=1
FT                   /gene="Nfib"
FT                   /locus_tag="mCG_125533"
FT                   /product="nuclear factor I/B, isoform CRA_e"
FT                   /note="gene_id=mCG125533.2 transcript_id=mCT192859.0
FT                   protein_id=mCP113784.0 isoform=CRA_e"
FT                   /protein_id="EDL31039.1"
FT                   /translation="GEVMMYSPICLTQDEFHPFIEALLPHVRAIAYTWFNLQARKRKYF
FT                   KKHEKRMSKDEERAVKDELLSEKPEIKQKWASRLLAKLRKDIRQEYREDFVLTVTGKKH
FT                   PCCVLSNPDQKGKIRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLMKSPHCTNP
FT                   ALCVQPHHITVSVKELDLFLAYYVQEQDSGQSGSPSHSDPAKNPPGYLEDSFVKSGVFN
FT                   VSELVRVSRTPITQGTGVNFPIGEIPSQPYYHDMNSGVNLQRSLSSPPSSKRPKTISID
FT                   ENMEPSPTGDFYPSPNSPAAGSRTWHERDQDMSSPTTMKKPEKPLFSSTSPQDSSPRLS
FT                   TFPQHHHPGIPGVAHSVISTRTPPPPSPLPFPTQAILPPAPSSYFSHPTIRYPPHLNPQ
FT                   DTLKNYVPSYDPSSPQTSQVKIRENKIDRT"
FT   mRNA            complement(join(20352428..20354262,20374307..20374425,
FT                   20377441..20377561,20383609..20383677,20407502..20407555,
FT                   20522094..20522625,20528589..>20529169))
FT                   /gene="Nfib"
FT                   /locus_tag="mCG_125533"
FT                   /product="nuclear factor I/B, transcript variant mCT192858"
FT                   /note="gene_id=mCG125533.2 transcript_id=mCT192858.0
FT                   created on 09-MAR-2004"
FT   CDS             complement(join(20353973..20354262,20374307..20374425,
FT                   20377441..20377561,20383609..20383677,20407502..20407555,
FT                   20522094..20522625,20528589..>20528627))
FT                   /codon_start=1
FT                   /gene="Nfib"
FT                   /locus_tag="mCG_125533"
FT                   /product="nuclear factor I/B, isoform CRA_d"
FT                   /note="gene_id=mCG125533.2 transcript_id=mCT192858.0
FT                   protein_id=mCP113783.0 isoform=CRA_d"
FT                   /protein_id="EDL31038.1"
FT                   /translation="GEVMMYSPICLTQDEFHPFIEALLPHVRAIAYTWFNLQARKRKYF
FT                   KKHEKRMSKDEERAVKDELLSEKPEIKQKWASRLLAKLRKDIRQEYREDFVLTVTGKKH
FT                   PCCVLSNPDQKGKIRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLMKSPHCTNP
FT                   ALCVQPHHITVSVKELDLFLAYYVQEQDSGQSGSPSHSDPAKNPPGYLEDSFVKSGVFN
FT                   VSELVRVSRTPITQGTGVNFPIGEIPSQPYYHDMNSGVNLQRSLSSPPSSKRPKTISID
FT                   ENMEPSPTGDFYPSPNSPAAGSRTWHERDQDMSSPTTMKKPEKPLFSSTSPQDSSPRLS
FT                   TFPQHHHPGIPGVAHSGEEFEAERKGLLTTHQTLKGGGEVYCRCYGDNILSTQKTGLLM
FT                   DKIFFLPV"
FT   assembly_gap    20379000..20379092
FT                   /estimated_length=93
FT                   /gap_type="unknown"
FT   assembly_gap    20419259..20419364
FT                   /estimated_length=106
FT                   /gap_type="unknown"
FT   assembly_gap    20446779..20446901
FT                   /estimated_length=123
FT                   /gap_type="unknown"
FT   assembly_gap    20458077..20458096
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20472199..20472412
FT                   /estimated_length=214
FT                   /gap_type="unknown"
FT   assembly_gap    20499007..20499026
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20530300..20530372
FT                   /estimated_length=73
FT                   /gap_type="unknown"
FT   assembly_gap    20541977..20542309
FT                   /estimated_length=333
FT                   /gap_type="unknown"
FT   assembly_gap    20557649..20557668
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20564433..20564453
FT                   /estimated_length=21
FT                   /gap_type="unknown"
FT   assembly_gap    20593408..20593429
FT                   /estimated_length=22
FT                   /gap_type="unknown"
FT   gene            complement(20609018..>20611288)
FT                   /locus_tag="mCG_144805"
FT                   /note="gene_id=mCG144805.0"
FT   mRNA            complement(join(20609018..20609685,20610257..20610384,
FT                   20610918..20611129,20611225..>20611288))
FT                   /locus_tag="mCG_144805"
FT                   /product="mCG144805"
FT                   /note="gene_id=mCG144805.0 transcript_id=mCT184229.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(20609563..20609685,20610257..20610384,
FT                   20610918..>20610933))
FT                   /codon_start=1
FT                   /locus_tag="mCG_144805"
FT                   /product="mCG144805"
FT                   /note="gene_id=mCG144805.0 transcript_id=mCT184229.0
FT                   protein_id=mCP105831.0"
FT                   /protein_id="EDL31034.1"
FT                   /translation="EIFVLEMQHIGYPHIFGSKSSELFSPKLALINPSYSQPLLNISTK
FT                   QFKLTIPEAPQIPQRRMTPGHSQTPVTMTFSGRVLHSCVTINF"
FT   assembly_gap    20622714..20623480
FT                   /estimated_length=767
FT                   /gap_type="unknown"
FT   assembly_gap    20632939..20635654
FT                   /estimated_length=2716
FT                   /gap_type="unknown"
FT   assembly_gap    20682468..20682808
FT                   /estimated_length=341
FT                   /gap_type="unknown"
FT   assembly_gap    20740122..20740141
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20741665..20741684
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20743629..20743648
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20746008..20746027
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20747757..20749213
FT                   /estimated_length=1457
FT                   /gap_type="unknown"
FT   assembly_gap    20754369..20754511
FT                   /estimated_length=143
FT                   /gap_type="unknown"
FT   assembly_gap    20755757..20755776
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20757209..20757228
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20770930..20771064
FT                   /estimated_length=135
FT                   /gap_type="unknown"
FT   assembly_gap    20774861..20774907
FT                   /estimated_length=47
FT                   /gap_type="unknown"
FT   assembly_gap    20801324..20801343
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20810633..20810679
FT                   /estimated_length=47
FT                   /gap_type="unknown"
FT   gene            complement(20823764..20880100)
FT                   /gene="Zdhhc21"
FT                   /locus_tag="mCG_8980"
FT                   /note="gene_id=mCG8980.3"
FT   mRNA            complement(join(20823764..20825273,20825829..20825872,
FT                   20839186..20839302,20855991..20856129,20858831..20858942,
FT                   20864661..20864759,20868105..20868301,20874720..20874782,
FT                   20880045..20880100))
FT                   /gene="Zdhhc21"
FT                   /locus_tag="mCG_8980"
FT                   /product="zinc finger, DHHC domain containing 21"
FT                   /note="gene_id=mCG8980.3 transcript_id=mCT8915.3 created on
FT                   06-DEC-2002"
FT   CDS             complement(join(20825141..20825273,20825829..20825872,
FT                   20839186..20839302,20855991..20856129,20858831..20858942,
FT                   20864661..20864759,20868105..20868301,20874720..20874766))
FT                   /codon_start=1
FT                   /gene="Zdhhc21"
FT                   /locus_tag="mCG_8980"
FT                   /product="zinc finger, DHHC domain containing 21"
FT                   /note="gene_id=mCG8980.3 transcript_id=mCT8915.3
FT                   protein_id=mCP21208.3"
FT                   /protein_id="EDL31033.1"
FT                   /translation="MQVPEKSQFISVNLQVIVLPVGGRRVQDCRMGLRIHFVVDPHGWC
FT                   CMGLIVFVWLYNIVIIPKIVLFPHYEEGHIPGILIIIFYGISIFCLVALVRASLTDPGR
FT                   LPENPKIPHAERELWELCNKCNLMRPKRSHHCSRCGHCVRRMDHHCPWINNCVGEDNHW
FT                   LFLQLCFYTELLTCYALMFSFCHYYYFLPLKKRNLDLFVVRHELAIMRLAAFMGITMLV
FT                   GITGLFYTQLIGIITDTTSIEKMSNCCEEISRPRKPWQQTFSEVFGTRWKILWFIPFRQ
FT                   RQPLRVPYHFANHV"
FT   assembly_gap    20833141..20833451
FT                   /estimated_length=311
FT                   /gap_type="unknown"
FT   assembly_gap    20847524..20847543
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20873068..20873272
FT                   /estimated_length=205
FT                   /gap_type="unknown"
FT   assembly_gap    20874783..20874894
FT                   /estimated_length=112
FT                   /gap_type="unknown"
FT   assembly_gap    20878936..20879385
FT                   /estimated_length=450
FT                   /gap_type="unknown"
FT   assembly_gap    20881507..20882059
FT                   /estimated_length=553
FT                   /gap_type="unknown"
FT   assembly_gap    20885011..20885030
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20886607..20886626
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20887874..20887893
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20889160..20889179
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20890663..20890859
FT                   /estimated_length=197
FT                   /gap_type="unknown"
FT   gene            complement(20906775..20910168)
FT                   /gene="Cer1"
FT                   /locus_tag="mCG_8985"
FT                   /note="gene_id=mCG8985.1"
FT   mRNA            complement(join(20906775..20907934,20909594..20910168))
FT                   /gene="Cer1"
FT                   /locus_tag="mCG_8985"
FT                   /product="cerberus 1 homolog (Xenopus laevis)"
FT                   /note="gene_id=mCG8985.1 transcript_id=mCT8920.1 created on
FT                   07-OCT-2002"
FT   CDS             complement(join(20907623..20907934,20909594..20910100))
FT                   /codon_start=1
FT                   /gene="Cer1"
FT                   /locus_tag="mCG_8985"
FT                   /product="cerberus 1 homolog (Xenopus laevis)"
FT                   /note="gene_id=mCG8985.1 transcript_id=mCT8920.1
FT                   protein_id=mCP21205.2"
FT                   /protein_id="EDL31032.1"
FT                   /translation="MHLLLVQLLVLLPLGKADLCVDGCQSQGSLSFPLLERGRRDLHVA
FT                   NHEEAEDKPDLFVAMPHLMGTSLAGEGQRQRGKMLSRLGRFWKKPETEFYPPRDVESDH
FT                   VSSGMQAVTQPADGRKVERSPLQEEAKRFWHQFMFRKGPAFQGVILPIKSHEVHWETCR
FT                   TVPFNQTIAHEDCQKVVVQNNLCFGKCSSIRFPGEGADAHSFCSHCSPTKFTTVHLMLN
FT                   CTSPTPVVKMVMQVEECQCMVKTERGEERLLLAGSQGSFIPGLPASKTNP"
FT   assembly_gap    20910490..20910509
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20917664..20917809
FT                   /estimated_length=146
FT                   /gap_type="unknown"
FT   assembly_gap    20921564..20921771
FT                   /estimated_length=208
FT                   /gap_type="unknown"
FT   gene            complement(20924943..20991323)
FT                   /locus_tag="mCG_125625"
FT                   /note="gene_id=mCG125625.1"
FT   mRNA            complement(join(20924943..20925863,20928759..20928844,
FT                   20937801..20937916,20938473..20938601,20938802..20938966,
FT                   20939236..20939283,20939889..20940109,20941900..20942049,
FT                   20947495..20947567,20950030..20950159,20960120..20960264,
FT                   20961231..20961432,20965577..20965988,20975507..20975771,
FT                   20981411..20981606,20984562..20984703,20988388..20988532,
FT                   20991224..20991323))
FT                   /locus_tag="mCG_125625"
FT                   /product="mCG125625"
FT                   /note="gene_id=mCG125625.1 transcript_id=mCT126888.1
FT                   created on 07-JAN-2003"
FT   CDS             complement(join(20925664..20925863,20928759..20928844,
FT                   20937801..20937916,20938473..20938601,20938802..20938966,
FT                   20939236..20939283,20939889..20940109,20941900..20942049,
FT                   20947495..20947567,20950030..20950159,20960120..20960264,
FT                   20961231..20961432,20965577..20965988,20975507..20975771,
FT                   20981411..20981606,20984562..20984703,20988388..20988530))
FT                   /codon_start=1
FT                   /locus_tag="mCG_125625"
FT                   /product="mCG125625"
FT                   /note="gene_id=mCG125625.1 transcript_id=mCT126888.1
FT                   protein_id=mCP76251.1"
FT                   /protein_id="EDL31031.1"
FT                   /translation="MKLVYAHDDSESSADNFVIQLSDGKHKILKTISVNITPVNDETPT
FT                   LSKKAEISMAVGDTRVLSSAVLSATDKDSPREKIHYVFERLPQNGQLQLKIGRDWVPLS
FT                   TGMQCTQEDVDLNLLRYTHAGKTDSQDGDSFTFYLWDEDNRSPAFDCHIIIEDMGKGDI
FT                   VIHAKPLVVVKGDRGLLTTATLLAVDGADKPEELLYLITSPPRHGQVEYVHSPGVPIAS
FT                   FSQMDIAGQTVCYIHKSRTAVPTDSFRFTISNGLQTQRGVFEITLQTVDSALPVLTKNK
FT                   RLRLAEGAMGLLSADHLQLTDPDTPPENLTFFLAQLPRHGYLFLRGKALQHNFTQRDVD
FT                   SGGVAYQHSGGGAREDYFTFLATDRKNQGFVVDGKVQKEPVRFTIQVDQLDKAAPRITH
FT                   LHSPTQVGLLKNGCYGIYITSRVLKASDPDTEDDQIIFKILRGPLYGRLENTTTGEFIH
FT                   ERFSQKDLSHKTILYIINPSLQVTSDILEFQAMDPTGNTATPQSLDLRWSYIEWAQTAY
FT                   EVCENVGLLPLEVTRRGYPMDSAFVGVEVNQVSATVGKDFTVTPSKLLQFDPGMSTKMW
FT                   NIAITYDGLEEDDEVFEVILNSPVNAVLGTQTKAAVKILDSKGGRCHPSNSFNQSKHST
FT                   WGKGPWHPLPSGSSSLTTSGSPLLERPPPSFTSGDALQGFGLTDLTQRKTMTQGNGKSV
FT                   LPSSVCRNGTDTIYNYHGIVSLKLEGDRFSAHKRKAKISIVSQPQRTIKVAELPLADKV
FT                   ESTTDLHFLRQGLRPLFPKNCSVDLKGLFHFEESTHRLYQCDGISWKAWSPQTKGLEDR
FT                   SCPGGWLLHSGYCHILVTRQKGTWTTATRACREQHQGDLVTVLSRRHMQWLWAMSGRKP
FT                   FWIGLKNQPRTGHWEWIGGEPVAFTNWRRGAPLHPKPGKNCALVQKRGQWQTKNCSKGK
FT                   AHNFVCSRKL"
FT   assembly_gap    21000011..21000424
FT                   /estimated_length=414
FT                   /gap_type="unknown"
FT   gene            complement(21018491..>21078192)
FT                   /locus_tag="mCG_144807"
FT                   /note="gene_id=mCG144807.0"
FT   mRNA            complement(join(21018491..21019787,21024364..21024506,
FT                   21025506..21025850,21027254..21027385,21029834..21029942,
FT                   21031099..21031418,21037410..21037606,21039359..21039660,
FT                   21041921..21042015,21046137..21046647,21077752..>21078192))
FT                   /locus_tag="mCG_144807"
FT                   /product="mCG144807"
FT                   /note="gene_id=mCG144807.0 transcript_id=mCT184231.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(21019566..21019787,21024364..21024506,
FT                   21025506..21025850,21027254..21027385,21029834..21029942,
FT                   21031099..21031418,21037410..>21037464))
FT                   /codon_start=1
FT                   /locus_tag="mCG_144807"
FT                   /product="mCG144807"
FT                   /note="gene_id=mCG144807.0 transcript_id=mCT184231.0
FT                   protein_id=mCP105833.0"
FT                   /protein_id="EDL31030.1"
FT                   /translation="LHPHSVGSHRQKEQNRIQESAWLPVYIRVGIPNQVPRAAFMAMFV
FT                   LEVDQFILTPLTTSVLDCEEDETPKPLLVFNITKAPLQGYVTHLLDHTRPISSFTWKDL
FT                   SDMQVAYQPPNSSHPERRHYTMELEVYDFFFERSAPITVHISIRTADTNAPRVSWNTGL
FT                   NLLEGQSRAITWEQFQIVDNDDIGAVQLVTIGGLQHGRLTVREGKGFLFTVTDLQAGVV
FT                   RYHHDDSDTTKDFVAFRIFDGHHSSHHKFPINILPKDDSPPFLITNVVIELEEGKTILI
FT                   QGSMLRASDMDSSDDYIFFNITKFPQAGEIMKKPGPRLIGYPVPGFLQRDLFSGIIYYR
FT                   HFGGEIFEDSFEFVLWDSHEPPNLSVPQVVTIHITPVDDQLPKEAPGISRHLVVKETEV
FT                   AYITKKHLHFLDMESRDGELIYTVTRPPCFSFSHRCPCKATI"
FT   assembly_gap    21059156..21059363
FT                   /estimated_length=208
FT                   /gap_type="unknown"
FT   assembly_gap    21072880..21073019
FT                   /estimated_length=140
FT                   /gap_type="unknown"
FT   assembly_gap    21112468..21113032
FT                   /estimated_length=565
FT                   /gap_type="unknown"
FT   assembly_gap    21115654..21115691
FT                   /estimated_length=38
FT                   /gap_type="unknown"
FT   assembly_gap    21124779..21124860
FT                   /estimated_length=82
FT                   /gap_type="unknown"
FT   assembly_gap    21126546..21126565
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21129132..21129151
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21130310..21130329
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21133949..21133968
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21136115..21136134
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21137303..21137322
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21166196..21166643
FT                   /estimated_length=448
FT                   /gap_type="unknown"
FT   assembly_gap    21168839..21168858
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21170485..21170588
FT                   /estimated_length=104
FT                   /gap_type="unknown"
FT   assembly_gap    21206111..21206130
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(21245136..21342796)
FT                   /gene="1810054D07Rik"
FT                   /locus_tag="mCG_8982"
FT                   /note="gene_id=mCG8982.1"
FT   mRNA            complement(join(21245136..21245940,21249148..21249264,
FT                   21251466..21251583,21255991..21256099,21258817..21258943,
FT                   21260396..21260487,21260907..21261068,21262672..21262731,
FT                   21262816..21262883,21263798..21263906,21265041..21265106,
FT                   21266381..21266486,21271755..21271819,21274811..21274878,
FT                   21279629..21279705,21280573..21280704,21282443..21282550,
FT                   21289773..21289874,21316438..21316472,21342625..21342796))
FT                   /gene="1810054D07Rik"
FT                   /locus_tag="mCG_8982"
FT                   /product="RIKEN cDNA 1810054D07, transcript variant
FT                   mCT8917"
FT                   /note="gene_id=mCG8982.1 transcript_id=mCT8917.2 created on
FT                   30-OCT-2002"
FT   CDS             complement(join(21245850..21245940,21249148..21249264,
FT                   21251466..21251583,21255991..21256099,21258817..21258943,
FT                   21260396..21260487,21260907..21261068,21262672..21262731,
FT                   21262816..21262883,21263798..21263906,21265041..21265106,
FT                   21266381..21266486,21271755..21271819,21274811..21274878,
FT                   21279629..21279705,21280573..21280704,21282443..21282550,
FT                   21289773..21289874,21316438..21316472,21342625..21342666))
FT                   /codon_start=1
FT                   /gene="1810054D07Rik"
FT                   /locus_tag="mCG_8982"
FT                   /product="RIKEN cDNA 1810054D07, isoform CRA_b"
FT                   /note="gene_id=mCG8982.1 transcript_id=mCT8917.2
FT                   protein_id=mCP21216.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q8BYY4"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019412"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR030416"
FT                   /db_xref="MGI:MGI:1917113"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8BYY4"
FT                   /protein_id="EDL31029.1"
FT                   /translation="MALVGSRVELDADEDIFEDALETISRSPSDMATSGFHFVPCETKR
FT                   TSRQLGASAMGRPEGSSAKVDLKSGLEECAEALNLFLSNKFKDALELLRPWAKESMYHA
FT                   LGYSTIVVLQAVMTFEQQDIQNGISAMKDALQTCQKYRKKCTVVESFSSLLSRGSLEQL
FT                   SEEEMHAEICYAECLLQKAALTFVQDENMINFIKGGLKIRTSYQIYKECLSILHVIQKN
FT                   KQEQHFFYEFEGGVKLGTGAFNLMLSLLPARIIRLLEFIGFSGNRDLGLLQLREGASGS
FT                   SMRSPLCCLTILAFHTYISLILGTGEVNVVEAESLLAPFLQQFPNGSLILFYHARIELL
FT                   KGNTEKAQETFRKCISVQEEWKQFHHLCYWELMWIHIYQQNWMQAYYYSDLLCKESKWS
FT                   KATYVFLKAAILSMLPEEEVAATKENVVSLFRQVDGLKQRIAGKSLPTEKFAVRKARRY
FT                   SPPSGVPGKLVMPALEMMYVWNGFSIVGKRKDLSENLLVTVEKAEEALQNQDFTDYSVD
FT                   DECLVKLLKGCCLKNLERPLQAELCFNHVVESEKLLKYDHYLVPFTLFELAFLYKSQGE
FT                   IDKAIKVLETARNNYKDYSLESRLHFRIQAALHLWKKPSTD"
FT   mRNA            complement(join(21258565..21258943,21260396..21260487,
FT                   21260907..21261068,21262672..21262731,21262816..21262883,
FT                   21263798..21263906,21265041..21265106,21266381..21266486,
FT                   21271755..21271819,21274811..21274878,21279629..21279705,
FT                   21280573..21280704,21282443..21282550,21289773..21289874,
FT                   21316438..21316472,21342625..>21342795))
FT                   /gene="1810054D07Rik"
FT                   /locus_tag="mCG_8982"
FT                   /product="RIKEN cDNA 1810054D07, transcript variant
FT                   mCT192831"
FT                   /note="gene_id=mCG8982.1 transcript_id=mCT192831.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(21258679..21258943,21260396..21260487,
FT                   21260907..21261068,21262672..21262731,21262816..21262883,
FT                   21263798..21263906,21265041..21265106,21266381..21266486,
FT                   21271755..21271819,21274811..21274878,21279629..21279705,
FT                   21280573..21280704,21282443..21282550,21289773..21289874,
FT                   21316438..21316472,21342625..>21342702))
FT                   /codon_start=1
FT                   /gene="1810054D07Rik"
FT                   /locus_tag="mCG_8982"
FT                   /product="RIKEN cDNA 1810054D07, isoform CRA_a"
FT                   /note="gene_id=mCG8982.1 transcript_id=mCT192831.0
FT                   protein_id=mCP113828.0 isoform=CRA_a"
FT                   /protein_id="EDL31028.1"
FT                   /translation="VPCGCAAAAEGNMALVGSRVELDADEDIFEDALETISRSPSDMAT
FT                   SGFHFVPCETKRTSRQLGASAMGRPEGSSAKVDLKSGLEECAEALNLFLSNKFKDALEL
FT                   LRPWAKESMYHALGYSTIVVLQAVMTFEQQDIQNGISAMKDALQTCQKYRKKCTVVESF
FT                   SSLLSRGSLEQLSEEEMHAEICYAECLLQKAALTFVQDENMINFIKGGLKIRTSYQIYK
FT                   ECLSILHVIQKNKQEQHFFYEFEGGVKLGTGAFNLMLSLLPARIIRLLEFIGFSGNRDL
FT                   GLLQLREGASGSSMRSPLCCLTILAFHTYISLILGTGEVNVVEAESLLAPFLQQFPNGS
FT                   LILFYHARIELLKGNTEKAQETFRKCISVQEEWKQFHHLCYWELMWIHIYQQNWMQAYY
FT                   YSDLLCKESKWSKATYVFLKAAILSMLPEEEVAATKENVVSLFRQVDGLKQRIAGKSLP
FT                   TEKFAVRKARRYSPPSGVPGKLVMPALVLLLLTVYLPEIRSLLGASRDALTFACEVYSS
FT                   VENYYVFLYLYVN"
FT   assembly_gap    21260673..21260764
FT                   /estimated_length=92
FT                   /gap_type="unknown"
FT   assembly_gap    21306514..21306606
FT                   /estimated_length=93
FT                   /gap_type="unknown"
FT   assembly_gap    21307927..21313797
FT                   /estimated_length=5871
FT                   /gap_type="unknown"
FT   assembly_gap    21325869..21325888
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21335910..21336040
FT                   /estimated_length=131
FT                   /gap_type="unknown"
FT   assembly_gap    21336880..21337403
FT                   /estimated_length=524
FT                   /gap_type="unknown"
FT   assembly_gap    21339864..21339883
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(21398042..>21420898)
FT                   /locus_tag="mCG_144799"
FT                   /note="gene_id=mCG144799.0"
FT   mRNA            complement(join(21398042..21399219,21412506..21412723,
FT                   21420820..>21420898))
FT                   /locus_tag="mCG_144799"
FT                   /product="mCG144799"
FT                   /note="gene_id=mCG144799.0 transcript_id=mCT184223.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(21398074..>21398379)
FT                   /codon_start=1
FT                   /locus_tag="mCG_144799"
FT                   /product="mCG144799"
FT                   /note="gene_id=mCG144799.0 transcript_id=mCT184223.0
FT                   protein_id=mCP105826.0"
FT                   /protein_id="EDL31027.1"
FT                   /translation="SAPPTENQVFKYTSLREHFSSKPPHDHCLFSYLFIYLFIYLFETG
FT                   SYCIALAHLKLIMYTTLASNSQRSICLCLPSDRIKGVYHHAWPDRIVLNCMFILLC"
FT   assembly_gap    21404144..21404163
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21405258..21405277
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21413736..21416482
FT                   /estimated_length=2747
FT                   /gap_type="unknown"
FT   assembly_gap    21425345..21425364
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21429487..21429632
FT                   /estimated_length=146
FT                   /gap_type="unknown"
FT   gene            21448262..21492470
FT                   /gene="Snapc3"
FT                   /locus_tag="mCG_13295"
FT                   /note="gene_id=mCG13295.1"
FT   mRNA            join(21448262..21448804,21449456..21449533,
FT                   21458554..21458638,21465963..21466067,21467096..21467245,
FT                   21472680..21472762,21474430..21474594,21475564..21475671,
FT                   21477400..21478507,21490325..21490497,21491328..21491380,
FT                   21491740..21492470)
FT                   /gene="Snapc3"
FT                   /locus_tag="mCG_13295"
FT                   /product="small nuclear RNA activating complex, polypeptide
FT                   3, transcript variant mCT13809"
FT                   /note="gene_id=mCG13295.1 transcript_id=mCT13809.2 created
FT                   on 30-OCT-2002"
FT   mRNA            join(<21448473..21448804,21449456..21449533,
FT                   21458554..21458638,21465963..21466067,21467096..21467245,
FT                   21472680..21472762,21474430..21474594,21475564..21475671,
FT                   21477400..21478507,21484523..21486206)
FT                   /gene="Snapc3"
FT                   /locus_tag="mCG_13295"
FT                   /product="small nuclear RNA activating complex, polypeptide
FT                   3, transcript variant mCT192847"
FT                   /note="gene_id=mCG13295.1 transcript_id=mCT192847.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<21448473..21448804,21449456..21449533,
FT                   21458554..21458638,21465963..21466067,21467096..21467245,
FT                   21472680..21472762,21474430..21474594,21475564..21475671,
FT                   21477400..21477547)
FT                   /codon_start=1
FT                   /gene="Snapc3"
FT                   /locus_tag="mCG_13295"
FT                   /product="small nuclear RNA activating complex, polypeptide
FT                   3, isoform CRA_b"
FT                   /note="gene_id=mCG13295.1 transcript_id=mCT192847.0
FT                   protein_id=mCP113787.0 isoform=CRA_b"
FT                   /protein_id="EDL31025.1"
FT                   /translation="QLLPEGIVADMAEDLQGGGAGGPQHPVPSASHSSFPEYELPELHT
FT                   RVFHVGSFGELWRGRLGAQDLSLSEPQAAEQPTDGGASNDGFEDAAVASDLGCSLEAAA
FT                   ELRVVCGLDKLRCLGEDEDPEVIPENTDLVTLCVRKGLLDYREENITIDRACRQEIFAY
FT                   EMESHALGKKPENPADMIEEGECILSVNILYPVIFNKHKEHKPYQTMLVLGSQKLTELR
FT                   DSICCVSDLQIGGEFSNAPDQAPEHISKDLYKSAFFYFEGTFYNDRRYPECRDLSRTII
FT                   EWSESHDRGYGKFQTARMEDFTFNDLHIKLGFPYLYCHQGDCEHVVVITDIRLVHHDDC
FT                   LDRTLYPLLTKKHWLWTRKCFVCKMYTARWVTNNDTFAPEDPCFFCDVCFRMLHYDSEG
FT                   NKLGEFLAYPYVDPGTFN"
FT   mRNA            join(<21448492..21448804,21449456..21449533,
FT                   21458554..21458638,21465963..21466067,21467096..21467245,
FT                   21472680..21472762,21474430..21474594,21475564..21475671,
FT                   21477400..21478507,21490325..21490497,21491328..21491578)
FT                   /gene="Snapc3"
FT                   /locus_tag="mCG_13295"
FT                   /product="small nuclear RNA activating complex, polypeptide
FT                   3, transcript variant mCT192848"
FT                   /note="gene_id=mCG13295.1 transcript_id=mCT192848.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<21448494..21448804,21449456..21449533,
FT                   21458554..21458638,21465963..21466067,21467096..21467245,
FT                   21472680..21472762,21474430..21474594,21475564..21475671,
FT                   21477400..21477547)
FT                   /codon_start=1
FT                   /gene="Snapc3"
FT                   /locus_tag="mCG_13295"
FT                   /product="small nuclear RNA activating complex, polypeptide
FT                   3, isoform CRA_c"
FT                   /note="gene_id=mCG13295.1 transcript_id=mCT192848.0
FT                   protein_id=mCP113788.0 isoform=CRA_c"
FT                   /protein_id="EDL31026.1"
FT                   /translation="VADMAEDLQGGGAGGPQHPVPSASHSSFPEYELPELHTRVFHVGS
FT                   FGELWRGRLGAQDLSLSEPQAAEQPTDGGASNDGFEDAAVASDLGCSLEAAAELRVVCG
FT                   LDKLRCLGEDEDPEVIPENTDLVTLCVRKGLLDYREENITIDRACRQEIFAYEMESHAL
FT                   GKKPENPADMIEEGECILSVNILYPVIFNKHKEHKPYQTMLVLGSQKLTELRDSICCVS
FT                   DLQIGGEFSNAPDQAPEHISKDLYKSAFFYFEGTFYNDRRYPECRDLSRTIIEWSESHD
FT                   RGYGKFQTARMEDFTFNDLHIKLGFPYLYCHQGDCEHVVVITDIRLVHHDDCLDRTLYP
FT                   LLTKKHWLWTRKCFVCKMYTARWVTNNDTFAPEDPCFFCDVCFRMLHYDSEGNKLGEFL
FT                   AYPYVDPGTFN"
FT   CDS             join(21448503..21448804,21449456..21449533,
FT                   21458554..21458638,21465963..21466067,21467096..21467245,
FT                   21472680..21472762,21474430..21474594,21475564..21475671,
FT                   21477400..21477547)
FT                   /codon_start=1
FT                   /gene="Snapc3"
FT                   /locus_tag="mCG_13295"
FT                   /product="small nuclear RNA activating complex, polypeptide
FT                   3, isoform CRA_a"
FT                   /note="gene_id=mCG13295.1 transcript_id=mCT13809.2
FT                   protein_id=mCP21202.2 isoform=CRA_a"
FT                   /protein_id="EDL31024.1"
FT                   /translation="MAEDLQGGGAGGPQHPVPSASHSSFPEYELPELHTRVFHVGSFGE
FT                   LWRGRLGAQDLSLSEPQAAEQPTDGGASNDGFEDAAVASDLGCSLEAAAELRVVCGLDK
FT                   LRCLGEDEDPEVIPENTDLVTLCVRKGLLDYREENITIDRACRQEIFAYEMESHALGKK
FT                   PENPADMIEEGECILSVNILYPVIFNKHKEHKPYQTMLVLGSQKLTELRDSICCVSDLQ
FT                   IGGEFSNAPDQAPEHISKDLYKSAFFYFEGTFYNDRRYPECRDLSRTIIEWSESHDRGY
FT                   GKFQTARMEDFTFNDLHIKLGFPYLYCHQGDCEHVVVITDIRLVHHDDCLDRTLYPLLT
FT                   KKHWLWTRKCFVCKMYTARWVTNNDTFAPEDPCFFCDVCFRMLHYDSEGNKLGEFLAYP
FT                   YVDPGTFN"
FT   gene            complement(21478820..21510240)
FT                   /gene="Psip1"
FT                   /locus_tag="mCG_13296"
FT                   /note="gene_id=mCG13296.1"
FT   mRNA            complement(join(21478820..21481438,21482435..21482546,
FT                   21484204..21484417,21484514..21484615,21484819..21484889,
FT                   21485546..21485601,21487955..21488073,21489285..21489510,
FT                   21491068..21491143,21492954..21493047,21497418..21497480,
FT                   21498657..21498761,21500644..21500782,21506758..21506834,
FT                   21510013..21510240))
FT                   /gene="Psip1"
FT                   /locus_tag="mCG_13296"
FT                   /product="PC4 and SFRS1 interacting protein 1"
FT                   /note="gene_id=mCG13296.1 transcript_id=mCT13810.2 created
FT                   on 07-OCT-2002"
FT   CDS             complement(join(21481378..21481438,21482435..21482546,
FT                   21484204..21484417,21484514..21484615,21484819..21484889,
FT                   21485546..21485601,21487955..21488073,21489285..21489510,
FT                   21491068..21491143,21492954..21493047,21497418..21497480,
FT                   21498657..21498761,21500644..21500782,21506758..21506834,
FT                   21510013..21510042))
FT                   /codon_start=1
FT                   /gene="Psip1"
FT                   /locus_tag="mCG_13296"
FT                   /product="PC4 and SFRS1 interacting protein 1"
FT                   /note="gene_id=mCG13296.1 transcript_id=mCT13810.2
FT                   protein_id=mCP21204.2"
FT                   /protein_id="EDL31023.1"
FT                   /translation="MKGYPHWPARVDEVPDGAVKPPTNKLPIFFFGTHETAFLGPKDIF
FT                   PYSENKEKYGKPNKRKGFNEGLWEIDNNPKVKFSSQQASTKQSNASSDVEVEEKETNVS
FT                   KEDTDQEEKASNEDVTKAVDITTPKAARRGRKRKAEKQVDTEEAGMVTAATASNVKASP
FT                   KRGRPAATEVKIPKPRGRPKVVKQPCPSDGDMVIDEDKSKKKGPEEKQPKKQLKKEEEG
FT                   QKEEEKPRKEPDKKEGKKEVESKRKNLAKPGVTSTSDSEDEDDQEGEKKRKGGRNFQAA
FT                   HRRNMLKGQHEKEAGDRKRKQEEQMETEQQNKDEGKKPEVKKVEKKRETSMDSRLQRIH
FT                   AEIKNSLKIDNLDVNRCIEALDELASLQVTMQQAQKHTEMITTLKKIRRFKVSQVIMEK
FT                   STMLYNKFKNMFLVGEGDSVITQVLNKSLAEQRQHEEANKTKDQGKKGPNKKLEKEPTG
FT                   TKSLNGGSDAQESNHPQHNGDSNEDGKDSREASSKTKPPGEEREAEISLKESTLDN"
FT   assembly_gap    21499827..21499853
FT                   /estimated_length=27
FT                   /gap_type="unknown"
FT   assembly_gap    21510309..21510937
FT                   /estimated_length=629
FT                   /gap_type="unknown"
FT   assembly_gap    21512608..21513312
FT                   /estimated_length=705
FT                   /gap_type="unknown"
FT   assembly_gap    21525177..21525659
FT                   /estimated_length=483
FT                   /gap_type="unknown"
FT   assembly_gap    21530370..21531275
FT                   /estimated_length=906
FT                   /gap_type="unknown"
FT   assembly_gap    21543098..21543117
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            21548961..>21639834
FT                   /locus_tag="mCG_13294"
FT                   /note="gene_id=mCG13294.2"
FT   mRNA            join(21548961..21549143,21559167..21559314,
FT                   21565104..21565239,21567873..21568047,21572970..21573160,
FT                   21576230..21576361,21599146..21599292,21620011..21620103,
FT                   21622425..21622585,21639597..>21639834)
FT                   /locus_tag="mCG_13294"
FT                   /product="mCG13294"
FT                   /note="gene_id=mCG13294.2 transcript_id=mCT13808.2 created
FT                   on 30-OCT-2002"
FT   CDS             join(21559268..21559314,21565104..21565239,
FT                   21567873..21568047,21572970..21573160,21576230..21576361,
FT                   21599146..21599292,21620011..21620103,21622425..21622585,
FT                   21639597..21639834)
FT                   /codon_start=1
FT                   /locus_tag="mCG_13294"
FT                   /product="mCG13294"
FT                   /note="gene_id=mCG13294.2 transcript_id=mCT13808.2
FT                   protein_id=mCP21201.2"
FT                   /protein_id="EDL31022.1"
FT                   /translation="MSLNTSSNATPGDTQRLKNASLDVKQMLKNETESDITADLRKKLH
FT                   RAKKEKLEMTTKHNAELSSYESQIARLRSEVEKGEALRQRLEYDLAVARKEAGLGRRAA
FT                   EERLAEAQRIQERLCAQNSELQGKANEIEKTFQISQEKWREECRRFEHDLEERDNIIQN
FT                   CNQEYESLMQEKTRLQKTLQEILEKHEQEKTELESRVRETALGEFRLQTEEWEAERREL
FT                   QLIVQEQDSAVQSMQKKVEQLEAEHMDCSDLLRRQTSELEFSTQREERLRKEFEATTLR
FT                   VRKLEENIEAERAAHLESKFNSEIIQLRIRDLEGALQVEKASQAEAVADLEMIKNEFKE
FT                   VESAYEREKQNTQESCAKLNLLEREYFSQNKKLNEEIEDQKKVIIDLSKRLQYNEKSCG
FT                   ELQEELVMVRIKIKPLWQWLYWAIFDVKQVYPLSPPCIMR"
FT   assembly_gap    21574091..21574134
FT                   /estimated_length=44
FT                   /gap_type="unknown"
FT   assembly_gap    21625130..21625576
FT                   /estimated_length=447
FT                   /gap_type="unknown"
FT   assembly_gap    21638296..21638315
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21642084..21642103
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21666933..21666953
FT                   /estimated_length=21
FT                   /gap_type="unknown"
FT   gene            <21670117..>21678490
FT                   /locus_tag="mCG_13298"
FT                   /note="gene_id=mCG13298.2"
FT   mRNA            join(<21670117..21670223,21671900..21671989,
FT                   21672909..21673109,21676304..21676471,21678089..>21678490)
FT                   /locus_tag="mCG_13298"
FT                   /product="mCG13298"
FT                   /note="gene_id=mCG13298.2 transcript_id=mCT13812.2 created
FT                   on 07-JAN-2003"
FT   CDS             join(<21670119..21670223,21671900..21671989,
FT                   21672909..21673109,21676304..21676471,21678089..21678490)
FT                   /codon_start=1
FT                   /locus_tag="mCG_13298"
FT                   /product="mCG13298"
FT                   /note="gene_id=mCG13298.2 transcript_id=mCT13812.2
FT                   protein_id=mCP21212.2"
FT                   /protein_id="EDL31021.1"
FT                   /translation="VHKDKDKPPSFSVVLETLRRTLTDYQNKLEDASNELNNINDAKEK
FT                   TSNELDSTKQKIETHIKNTKELQDKLTEVHKELSHLRAKCADREALITSLKVELQNVLH
FT                   CWEKEKACAAQCESELQKLSQAFQKDSEEKLTFLHTLYQHLVAGCVLIKQPEGMLDKFS
FT                   WSELCAVLQENVDALIADLNRANEKISHLEYICKNKSDTMRELQQTQEDTFNKVAEQIK
FT                   AQESCWQKQKKELEFQYSELLLEVQRRAQVGRTAERDKAWEQPGNLIETTIPIFFFSFW
FT                   TGSPCVSLADLNLTEILFPLPPNAGIKGVHQHASNAFYQL"
FT   assembly_gap    21689125..21689144
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21692731..21692814
FT                   /estimated_length=84
FT                   /gap_type="unknown"
FT   gene            <21709519..21885123
FT                   /locus_tag="mCG_124723"
FT                   /note="gene_id=mCG124723.1"
FT   mRNA            join(<21709519..21709582,21710694..21710881,
FT                   21711017..21711202,21758334..21758479,21767041..21767095,
FT                   21809116..21809247,21838470..21838622,21884839..21885123)
FT                   /locus_tag="mCG_124723"
FT                   /product="mCG124723"
FT                   /note="gene_id=mCG124723.1 transcript_id=mCT125971.1
FT                   created on 10-DEC-2002"
FT   CDS             join(<21710867..21710881,21711017..21711202,
FT                   21758334..21758479,21767041..21767095,21809116..21809247,
FT                   21838470..21838622,21884839..21885054)
FT                   /codon_start=1
FT                   /locus_tag="mCG_124723"
FT                   /product="mCG124723"
FT                   /note="gene_id=mCG124723.1 transcript_id=mCT125971.1
FT                   protein_id=mCP75945.1"
FT                   /protein_id="EDL31020.1"
FT                   /translation="PSRRAKLITHEKFESACEELNNALLREQQAQMLLNEQAQQLQELN
FT                   YRLELHSSEEADKNQTLGEAVKSLSEAKMELRRKDQSLRQLNRHLTQLEQDKRRLEENI
FT                   RDAESALRMAAKDKECVANHMRTIENMLHKVRDQISLSRTAATRNDFTLQLPKLHLETF
FT                   AMEGLQGGPEVVACQAMIKSFMDVYQLASARISTLEKEMTSHRSHIATLKSELHTACLR
FT                   ENESLQSMGSRDHSNLSVPSRAAAPMDTVGDLLPLQAELDTTYTFLKETFVNTAPHSLS
FT                   SQSSPGVPTNAKRPSQIGL"
FT   assembly_gap    21716340..21716359
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21764214..21764233
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21768836..21768855
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21770559..21774948
FT                   /estimated_length=4390
FT                   /gap_type="unknown"
FT   assembly_gap    21822732..21827231
FT                   /estimated_length=4500
FT                   /gap_type="unknown"
FT   assembly_gap    21861708..21862271
FT                   /estimated_length=564
FT                   /gap_type="unknown"
FT   assembly_gap    21909517..21909536
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21915643..21915994
FT                   /estimated_length=352
FT                   /gap_type="unknown"
FT   assembly_gap    21919386..21919405
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21920687..21920706
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21932856..21932875
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21988675..21988694
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21994827..22007988
FT                   /estimated_length=13162
FT                   /gap_type="unknown"
FT   gene            complement(22048630..22051476)
FT                   /locus_tag="mCG_148058"
FT                   /note="gene_id=mCG148058.0"
FT   mRNA            complement(join(22048630..22049056,22051406..22051476))
FT                   /locus_tag="mCG_148058"
FT                   /product="mCG148058"
FT                   /note="gene_id=mCG148058.0 transcript_id=mCT188321.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(join(22048945..22049056,22051406..22051422))
FT                   /codon_start=1
FT                   /locus_tag="mCG_148058"
FT                   /product="mCG148058"
FT                   /note="gene_id=mCG148058.0 transcript_id=mCT188321.0
FT                   protein_id=mCP109399.0"
FT                   /protein_id="EDL31019.1"
FT                   /translation="MQDIQSSRQAVHLGEEDMATGREGRDTRRRRWLIRLHSNTGK"
FT   assembly_gap    22100587..22100615
FT                   /estimated_length=29
FT                   /gap_type="unknown"
FT   gene            22111450..22112725
FT                   /pseudo
FT                   /locus_tag="mCG_3606"
FT                   /note="gene_id=mCG3606.3"
FT   mRNA            22111450..22112725
FT                   /pseudo
FT                   /locus_tag="mCG_3606"
FT                   /note="gene_id=mCG3606.3 transcript_id=mCT3200.3 created on
FT                   26-JUN-2003"
FT   assembly_gap    22123167..22123923
FT                   /estimated_length=757
FT                   /gap_type="unknown"
FT   assembly_gap    22125382..22147237
FT                   /estimated_length=21856
FT                   /gap_type="unknown"
FT   assembly_gap    22148790..22148809
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22157469..22157918
FT                   /estimated_length=450
FT                   /gap_type="unknown"
FT   assembly_gap    22167298..22167384
FT                   /estimated_length=87
FT                   /gap_type="unknown"
FT   assembly_gap    22216783..22216993
FT                   /estimated_length=211
FT                   /gap_type="unknown"
FT   assembly_gap    22234094..22234113
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22235587..22235606
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22237599..22237618
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22245727..22246362
FT                   /estimated_length=636
FT                   /gap_type="unknown"
FT   assembly_gap    22256149..22256272
FT                   /estimated_length=124
FT                   /gap_type="unknown"
FT   assembly_gap    22259401..22259420
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(22274474..22610523)
FT                   /gene="Bnc2"
FT                   /locus_tag="mCG_3605"
FT                   /note="gene_id=mCG3605.2"
FT   mRNA            complement(join(22274474..22275825,22291090..22293059,
FT                   22390237..22390472,22413799..22413901,22546475..22546675,
FT                   22556072..22556197,22610434..22610523))
FT                   /gene="Bnc2"
FT                   /locus_tag="mCG_3605"
FT                   /product="basonuclin 2, transcript variant mCT3199"
FT                   /note="gene_id=mCG3605.2 transcript_id=mCT3199.2 created on
FT                   10-DEC-2002"
FT   mRNA            complement(join(22274988..22275825,22291090..22293059,
FT                   22390237..22390472,22413799..22413901,22556072..>22556198))
FT                   /gene="Bnc2"
FT                   /locus_tag="mCG_3605"
FT                   /product="basonuclin 2, transcript variant mCT192823"
FT                   /note="gene_id=mCG3605.2 transcript_id=mCT192823.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(22275165..22275825,22291090..22293059,
FT                   22390237..22390472,22413799..22413901,22546475..22546675,
FT                   22556072..22556197,22610434..22610457))
FT                   /codon_start=1
FT                   /gene="Bnc2"
FT                   /locus_tag="mCG_3605"
FT                   /product="basonuclin 2, isoform CRA_b"
FT                   /note="gene_id=mCG3605.2 transcript_id=mCT3199.2
FT                   protein_id=mCP16439.2 isoform=CRA_b"
FT                   /protein_id="EDL31018.1"
FT                   /translation="MMDCRAWLARFVPSPPPNCLSYKSEGRLGEQDWQAHFKVPCCGVD
FT                   PSQLESEEAEVDVRERDTQRDREPKRARDLTLRDSCTDNSMQFGTRTTAAEPGFMGTWQ
FT                   NADTNLLFRMSQQAIRCTLVNCTCECFQPGKINLRTCDQCKHGWVAHALDKLSTQHLYH
FT                   PTQVEIVQSNVVFDISSLMLYGTQAVPVRLKILLDRLFSVLKQEEVLHILHGLGWTLRD
FT                   YVRGYILQDAAGKVLDRWAIMSREEEIITLQQFLRFGETKSIVELMAIQEKEGQAVAVP
FT                   SSKTDSDIRTFIESNNRTRSPSLLAHLENSNPSSIHHFENIPNSLAFLLPFQYINPVSA
FT                   PLLGLPPNGLLLEQPGLRLREPSISTQNEYNESSESEVSPTPYKSDQTPNRNALTSITN
FT                   VEPKTEPACVSPIQNSAPVSDLSKTEHPKSSFRIHRMRRMGSASRKGRVFCNACGKTFY
FT                   DKGTLKIHYNAVHLKIKHRCTIEGCNMVFSSLRSRNRHSANPNPRLHMPMLRNNRDKDL
FT                   IRATSGAATPVIASTKSNLTLTSPGRPPMGFTTPPLDPVLQNPLPSQLVFSGLKTVQPV
FT                   PPFYRSLLTPGEMVSPPTSLPTSPIIPTSGTIEQHPPPPSEPIVPAVMMGTHEPSADLA
FT                   PKKKPRKSSMPVKIEKEIIDTADEFDDEDDDPNDGGTVVNDMSHDNHCHSQDEMSPGMS
FT                   VKDFSKHNRTRCISRTEIRRADSMTSEDQEPERDYENESESSEPKLGEESMEGDEHLHS
FT                   EVSEKVLMNSERPDENHSEPSHQDVIKVKEEFTDPTYDMFYMSQYGLYNGGGASMAALH
FT                   ESFTSSLNYGSPQKFSPEGDLCSSPDPKICYVCKKSFKSSYSVKLHYRNVHLKEMHVCT
FT                   VAGCNAAFPSRRSRDRHSANINLHRKLLTKELDDMSLDSSQPSLSKDLRDEFLMKIYGA
FT                   QHPLGLDGREDASSPAGTEDSHLNGYGRGMAEDYMVLDLSTTSSLQSSSSVHSSRESDA
FT                   GSDEGILLDDIDGASDSGESTHKAEAPTLPGSLGAEVSGSLMFSSLSGSNGGIMCNICH
FT                   KMYSNKGTLRVHYKTVHLREMHKCKVPGCNMMFSSVRSRNRHSQNPNLHKNIPFTSID"
FT   CDS             complement(join(22275165..22275825,22291090..22293059,
FT                   22390237..22390472,22413799..22413901,22556072..>22556197))
FT                   /codon_start=1
FT                   /gene="Bnc2"
FT                   /locus_tag="mCG_3605"
FT                   /product="basonuclin 2, isoform CRA_a"
FT                   /note="gene_id=mCG3605.2 transcript_id=mCT192823.0
FT                   protein_id=mCP113816.0 isoform=CRA_a"
FT                   /protein_id="EDL31017.1"
FT                   /translation="ARFVPSPPPNCLSYKSEGRLGEQDWQAHFKVPCCGVDPSQLEAIR
FT                   CTLVNCTCECFQPGKINLRTCDQCKHGWVAHALDKLSTQHLYHPTQVEIVQSNVVFDIS
FT                   SLMLYGTQAVPVRLKILLDRLFSVLKQEEVLHILHGLGWTLRDYVRGYILQDAAGKVLD
FT                   RWAIMSREEEIITLQQFLRFGETKSIVELMAIQEKEGQAVAVPSSKTDSDIRTFIESNN
FT                   RTRSPSLLAHLENSNPSSIHHFENIPNSLAFLLPFQYINPVSAPLLGLPPNGLLLEQPG
FT                   LRLREPSISTQNEYNESSESEVSPTPYKSDQTPNRNALTSITNVEPKTEPACVSPIQNS
FT                   APVSDLSKTEHPKSSFRIHRMRRMGSASRKGRVFCNACGKTFYDKGTLKIHYNAVHLKI
FT                   KHRCTIEGCNMVFSSLRSRNRHSANPNPRLHMPMLRNNRDKDLIRATSGAATPVIASTK
FT                   SNLTLTSPGRPPMGFTTPPLDPVLQNPLPSQLVFSGLKTVQPVPPFYRSLLTPGEMVSP
FT                   PTSLPTSPIIPTSGTIEQHPPPPSEPIVPAVMMGTHEPSADLAPKKKPRKSSMPVKIEK
FT                   EIIDTADEFDDEDDDPNDGGTVVNDMSHDNHCHSQDEMSPGMSVKDFSKHNRTRCISRT
FT                   EIRRADSMTSEDQEPERDYENESESSEPKLGEESMEGDEHLHSEVSEKVLMNSERPDEN
FT                   HSEPSHQDVIKVKEEFTDPTYDMFYMSQYGLYNGGGASMAALHESFTSSLNYGSPQKFS
FT                   PEGDLCSSPDPKICYVCKKSFKSSYSVKLHYRNVHLKEMHVCTVAGCNAAFPSRRSRDR
FT                   HSANINLHRKLLTKELDDMSLDSSQPSLSKDLRDEFLMKIYGAQHPLGLDGREDASSPA
FT                   GTEDSHLNGYGRGMAEDYMVLDLSTTSSLQSSSSVHSSRESDAGSDEGILLDDIDGASD
FT                   SGESTHKAEAPTLPGSLGAEVSGSLMFSSLSGSNGGIMCNICHKMYSNKGTLRVHYKTV
FT                   HLREMHKCKVPGCNMMFSSVRSRNRHSQNPNLHKNIPFTSID"
FT   assembly_gap    22284636..22284655
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22318212..22318328
FT                   /estimated_length=117
FT                   /gap_type="unknown"
FT   assembly_gap    22363288..22363307
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22400060..22400079
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22409709..22409728
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22472157..22474106
FT                   /estimated_length=1950
FT                   /gap_type="unknown"
FT   assembly_gap    22482740..22483199
FT                   /estimated_length=460
FT                   /gap_type="unknown"
FT   assembly_gap    22511418..22511437
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22526928..22527019
FT                   /estimated_length=92
FT                   /gap_type="unknown"
FT   assembly_gap    22619372..22619391
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22666915..22667007
FT                   /estimated_length=93
FT                   /gap_type="unknown"
FT   assembly_gap    22674993..22676103
FT                   /estimated_length=1111
FT                   /gap_type="unknown"
FT   assembly_gap    22684247..22685315
FT                   /estimated_length=1069
FT                   /gap_type="unknown"
FT   assembly_gap    22693266..22693860
FT                   /estimated_length=595
FT                   /gap_type="unknown"
FT   assembly_gap    22721855..22722310
FT                   /estimated_length=456
FT                   /gap_type="unknown"
FT   assembly_gap    22725993..22726071
FT                   /estimated_length=79
FT                   /gap_type="unknown"
FT   assembly_gap    22740806..22741088
FT                   /estimated_length=283
FT                   /gap_type="unknown"
FT   assembly_gap    22742291..22742775
FT                   /estimated_length=485
FT                   /gap_type="unknown"
FT   assembly_gap    22769729..22769748
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22801243..22801262
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22803944..22804004
FT                   /estimated_length=61
FT                   /gap_type="unknown"
FT   assembly_gap    22815129..22815148
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22818327..22818346
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22865046..22865065
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            22883159..23135129
FT                   /gene="D530005L17Rik"
FT                   /locus_tag="mCG_124373"
FT                   /note="gene_id=mCG124373.0"
FT   mRNA            join(22883159..22883579,22887401..22887489,
FT                   22914570..22915328,22946079..22946163,22954799..22954933,
FT                   22955523..22955702,22969628..22969756,22972339..22972501,
FT                   22977881..22977996,22993055..22993207,22994877..22995002,
FT                   23003384..23003505,23004866..23004985,23032226..23032326,
FT                   23044549..23044640,23047870..23048402,23066293..23066467,
FT                   23070599..23070692,23070776..23070999,23095796..23095987,
FT                   23099909..23100006,23101508..23101634,23103418..23103555,
FT                   23103874..23104059,23118424..23118609,23121653..23121730,
FT                   23133853..23135129)
FT                   /gene="D530005L17Rik"
FT                   /locus_tag="mCG_124373"
FT                   /product="RIKEN cDNA D530005L17"
FT                   /note="gene_id=mCG124373.0 transcript_id=mCT125614.1
FT                   created on 29-OCT-2002"
FT   CDS             join(22883220..22883579,22887401..22887489,
FT                   22914570..22915328,22946079..22946163,22954799..22954933,
FT                   22955523..22955702,22969628..22969756,22972339..22972501,
FT                   22977881..22977996,22993055..22993207,22994877..22995002,
FT                   23003384..23003505,23004866..23004985,23032226..23032326,
FT                   23044549..23044640,23047870..23048402,23066293..23066467,
FT                   23070599..23070692,23070776..23070999,23095796..23095987,
FT                   23099909..23100006,23101508..23101634,23103418..23103555,
FT                   23103874..23104059,23118424..23118609,23121653..23121730,
FT                   23133853..23133954)
FT                   /codon_start=1
FT                   /gene="D530005L17Rik"
FT                   /locus_tag="mCG_124373"
FT                   /product="RIKEN cDNA D530005L17"
FT                   /note="gene_id=mCG124373.0 transcript_id=mCT125614.1
FT                   protein_id=mCP76210.1"
FT                   /protein_id="EDL31015.1"
FT                   /translation="MAARSPSSSPPPPPVRRSSRRSLRVGRGAEVHAVRSEASGLAGAA
FT                   REVVADKSDLLWRGEEGSGGRRGSGRAGAAVAPVASAPAGSWWPEGLSSEEAKATRSQL
FT                   LEEELSSLKEELALCQADKEFVWSLWRRLQATNPDLTQTVSLVVESIIDKAALRPTDVV
FT                   LEVGPGTGNMTVKLLEKAKKVVACELDPRLVAELHKRVQGTPLASKLQVLVGDVLKSDL
FT                   PFFDACVANLPYQISSPFVFKLLLHRPFFRCAILMFQREFALRLVAKPGDKLYCRLSIN
FT                   TQLLAHVDHLMKVGKNNFRLPPKVESSVVRIEPKNPPPPINFQEWDDLVRITFVRKNKT
FT                   LSAAFKSSAVQQLLEKNYRIHCSVQNTVISEDFSIADKIQHILTSTGFSDKRARSMDID
FT                   DFIREKQKSEAKDRKVLEILQVKDSKIQELEQTESVLKQELHDLVKLKTLVDEENAFLR
FT                   KELCDLQKKFKDKSQEVKDAKECVQSKEEQNRLVIKNLEEENERLRTRCTDLLNDLEKL
FT                   RNQEAHWRKEKHSVDTRVKVLEENLIEAKKEIESAQTKYNVVSQQLNNKQAELLQKDMD
FT                   ITLERAAGAAERVQAEQCPHSPASRPDPAAPGSQHGHAESPEEPGRRPHGREHVIPKSQ
FT                   LFQKEQENVKLKEKLEESQGTAPSLSPHDSDSSHSGKAPLSTLETLMISQKSEIEYLQK
FT                   KLKVANEKLMANRSCDQDFSEKGTEGKHKEPPVKRSRSLSPKSSFMGSEELRKLKKAER
FT                   KIENLEKTLQLKSQENDELRDAHEKRKERLQMLHTNYRAVKEQLKQWEEDSGMAESRQM
FT                   KRAEPHQLRQEDSDAVWNELAYFKRENQELMVQKMTLQDELDELKMHMSIDKTTIQELN
FT                   RCMAEKREEQLFRQHEDAEVKKSTPEKNEKAISEETLQKVIELENRLKSFEKNSRKLKE
FT                   ESKRLKKENDFLKSHLKHYQEDSEAREKELEQLLRVSKDVEHDKSELQTKITALETEVT
FT                   TLRRQVTEAKALRGKDEEVVCPEERAHRPTDKAKSEMATTDVRARRCDCKTATTKVKFK
FT                   AAKRKCSVGRHHTVLNHSIKVMSHVENLSKDGWEDVSEGSDSETQTFQNLGTIIVETSQ
FT                   NISPIEDGRNQKEIDQTEGSCAQQRAMQTYSCEDIKAPQSISHNKNTKKMTFQKKSGSL
FT                   QKSLHSALPARVNREKCKNLPAQKSSSSTISLRERIVSLQQQNSLLQNARRAAEASAKE
FT                   YKEANEKLLHQQQVSDHRLQTSRQTIKKLTLDLAELRKEKEDLLKKVESSSDITSLAEE
FT                   VSRIMAPQIKVTTLGPSRSMDLEMKQLQCKLKNATNELTKQSSNVKSLRMELLAKDDHI
FT                   KEMHERTSRMERDITMKRHLIEDLKFRQKVNSESNESFNEMLETLEKKVKSLTEECSNK
FT                   KVSVDSLKQRLNVAVKEKSQYEQMYQKTKEELEKKDLKMSVLISKLNDTETAMAQIETA
FT                   ASEQLQGLALQSEQVLEGAQKKLLSANEKIEEFTVFVKALVNELQSDVHGTRHQIRELK
FT                   KMQKSRHACKTSTHKAQTLAASILNISRSDLEEILDTEDELEIEKTKIDIENDKEWMLY
FT                   IQKLLEGQLPFASYLLEAVLEKIKENKKLTEGYFTVMKDTK"
FT   assembly_gap    22896444..22896604
FT                   /estimated_length=161
FT                   /gap_type="unknown"
FT   assembly_gap    22898463..22899756
FT                   /estimated_length=1294
FT                   /gap_type="unknown"
FT   assembly_gap    22906926..22906945
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<22922118..>22922765)
FT                   /locus_tag="mCG_1719"
FT                   /note="gene_id=mCG1719.2"
FT   mRNA            complement(<22922118..>22922765)
FT                   /locus_tag="mCG_1719"
FT                   /product="mCG1719"
FT                   /note="gene_id=mCG1719.2 transcript_id=mCT1097.2 created on
FT                   20-FEB-2003"
FT   CDS             complement(22922118..22922765)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1719"
FT                   /product="mCG1719"
FT                   /note="gene_id=mCG1719.2 transcript_id=mCT1097.2
FT                   protein_id=mCP2547.2"
FT                   /protein_id="EDL31016.1"
FT                   /translation="MVKVGVNGFGHIGLLVTRAATCSPHGKVEVVAINDPFIDLNYMVS
FT                   MFQYDSTHGKFNGTVKAENGKLVINGKPITIFQERDPTNIKWGEASAEYVVESTGVFTT
FT                   MEKAGTHLKGGAKRVIISAPSADAPMFVMGVNHEKYDNSLKIVSNASCTTNCLAPLAKV
FT                   IHDNFGIVEGLMTTVHAITAIQKTVDGPSGKLWCDGRGAAQKIIPASTGPQH"
FT   assembly_gap    22928665..22928684
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22970528..22970744
FT                   /estimated_length=217
FT                   /gap_type="unknown"
FT   assembly_gap    22978570..22978781
FT                   /estimated_length=212
FT                   /gap_type="unknown"
FT   assembly_gap    23000949..23000968
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23002451..23002470
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23008255..23008300
FT                   /estimated_length=46
FT                   /gap_type="unknown"
FT   assembly_gap    23034872..23034926
FT                   /estimated_length=55
FT                   /gap_type="unknown"
FT   assembly_gap    23038498..23038884
FT                   /estimated_length=387
FT                   /gap_type="unknown"
FT   assembly_gap    23046361..23046485
FT                   /estimated_length=125
FT                   /gap_type="unknown"
FT   assembly_gap    23049795..23056664
FT                   /estimated_length=6870
FT                   /gap_type="unknown"
FT   assembly_gap    23068384..23068403
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23085900..23085919
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23121012..23121137
FT                   /estimated_length=126
FT                   /gap_type="unknown"
FT   assembly_gap    23145090..23145322
FT                   /estimated_length=233
FT                   /gap_type="unknown"
FT   assembly_gap    23165867..23165886
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23188043..23188062
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23189638..23189657
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23190880..23190899
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23195393..23195722
FT                   /estimated_length=330
FT                   /gap_type="unknown"
FT   assembly_gap    23196460..23197354
FT                   /estimated_length=895
FT                   /gap_type="unknown"
FT   assembly_gap    23198989..23199912
FT                   /estimated_length=924
FT                   /gap_type="unknown"
FT   gene            23211126..23392336
FT                   /gene="Sh3gl2"
FT                   /locus_tag="mCG_1718"
FT                   /note="gene_id=mCG1718.2"
FT   mRNA            join(23211126..23211254,23350724..23350792,
FT                   23358928..23359000,23379832..23379975,23380885..23381018,
FT                   23382740..23382898,23384900..23385003,23389418..23389548,
FT                   23391182..23392336)
FT                   /gene="Sh3gl2"
FT                   /locus_tag="mCG_1718"
FT                   /product="SH3-domain GRB2-like 2"
FT                   /note="gene_id=mCG1718.2 transcript_id=mCT1101.2 created on
FT                   07-OCT-2002"
FT   CDS             join(23211210..23211254,23350724..23350792,
FT                   23358928..23359000,23379832..23379975,23380885..23381018,
FT                   23382740..23382898,23384900..23385003,23389418..23389548,
FT                   23391182..23391381)
FT                   /codon_start=1
FT                   /gene="Sh3gl2"
FT                   /locus_tag="mCG_1718"
FT                   /product="SH3-domain GRB2-like 2"
FT                   /note="gene_id=mCG1718.2 transcript_id=mCT1101.2
FT                   protein_id=mCP2538.2"
FT                   /protein_id="EDL31014.1"
FT                   /translation="MSVAGLKKQFHKATQKVSEKVGGAEGTKLDDDFKEMERKVDVTSR
FT                   AVMEIMTKTIEYLQPNPASRAKLSMINTMSKIRGQEKGPGYPQAEALLAEAMLKFGREL
FT                   GDDCNFGPALGEVGEAMRELSEVKDSLDMEVKQNFIDPLQNLHDKDLREIQHHLKKLEG
FT                   RRLDFDYKKKRQGKIPDEELRQALEKFDESKEIAESSMFNLLEMDIEQVSQLSALVQAQ
FT                   LEYHKQAVQILQQVTVRLEERIRQASSQPRREYQPKPRMSLEFATGDSTQPNGGLSHTG
FT                   TPKPPGVQMDQPCCRALYDFEPENEGELGFKEGDIITLTNQIDENWYEGMLHGQSGFFP
FT                   INYVEILVALPH"
FT   assembly_gap    23216499..23216518
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23218428..23218447
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23227663..23227816
FT                   /estimated_length=154
FT                   /gap_type="unknown"
FT   assembly_gap    23245381..23245400
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23246977..23246996
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23279708..23279727
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23302393..23302700
FT                   /estimated_length=308
FT                   /gap_type="unknown"
FT   assembly_gap    23329032..23329051
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23338098..23338117
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23339904..23339923
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23362119..23362397
FT                   /estimated_length=279
FT                   /gap_type="unknown"
FT   assembly_gap    23371562..23371991
FT                   /estimated_length=430
FT                   /gap_type="unknown"
FT   assembly_gap    23400600..23400880
FT                   /estimated_length=281
FT                   /gap_type="unknown"
FT   assembly_gap    23411411..23411515
FT                   /estimated_length=105
FT                   /gap_type="unknown"
FT   assembly_gap    23441159..23441178
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23442554..23442573
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23475072..23478153
FT                   /estimated_length=3082
FT                   /gap_type="unknown"
FT   assembly_gap    23488765..23488784
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23507253..23508783
FT                   /estimated_length=1531
FT                   /gap_type="unknown"
FT   gene            23510206..23785169
FT                   /locus_tag="mCG_148059"
FT                   /note="gene_id=mCG148059.0"
FT   mRNA            join(23510206..23510403,23766975..23767094,
FT                   23783931..23785169)
FT                   /locus_tag="mCG_148059"
FT                   /product="mCG148059"
FT                   /note="gene_id=mCG148059.0 transcript_id=mCT188322.0
FT                   created on 13-JAN-2004"
FT   CDS             join(23510317..23510403,23766975..23767094,
FT                   23783931..23784011)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148059"
FT                   /product="mCG148059"
FT                   /note="gene_id=mCG148059.0 transcript_id=mCT188322.0
FT                   protein_id=mCP109402.0"
FT                   /protein_id="EDL31013.1"
FT                   /translation="MARLVTRNRPGFLARLIGGIWCLLCVAGQVCGDQSQGAVFLREFT
FT                   LIRRESLHEEFLSDFLNSHKTEDPEEEKKKNCCFFHSAIYPGNPTYVAKI"
FT   assembly_gap    23510732..23510751
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23511936..23511955
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23513338..23513364
FT                   /estimated_length=27
FT                   /gap_type="unknown"
FT   assembly_gap    23521737..23521756
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23524047..23524128
FT                   /estimated_length=82
FT                   /gap_type="unknown"
FT   assembly_gap    23525507..23525570
FT                   /estimated_length=64
FT                   /gap_type="unknown"
FT   assembly_gap    23538754..23539192
FT                   /estimated_length=439
FT                   /gap_type="unknown"
FT   assembly_gap    23594359..23594425
FT                   /estimated_length=67
FT                   /gap_type="unknown"
FT   assembly_gap    23604284..23604303
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23635473..23635492
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23672740..23672759
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23686926..23686945
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23703336..23703426
FT                   /estimated_length=91
FT                   /gap_type="unknown"
FT   assembly_gap    23717743..23718272
FT                   /estimated_length=530
FT                   /gap_type="unknown"
FT   assembly_gap    23759210..23759229
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23761297..23761316
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23762636..23762655
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23763895..23763914
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23785170..23785450
FT                   /estimated_length=281
FT                   /gap_type="unknown"
FT   assembly_gap    23791430..23791449
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23795274..23795551
FT                   /estimated_length=278
FT                   /gap_type="unknown"
FT   assembly_gap    23805463..23805482
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23825715..23825734
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23849995..23850014
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23890451..23890470
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23897042..23898550
FT                   /estimated_length=1509
FT                   /gap_type="unknown"
FT   assembly_gap    23900781..23900800
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23903158..23903177
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23911301..23911334
FT                   /estimated_length=34
FT                   /gap_type="unknown"
FT   assembly_gap    23911687..23911842
FT                   /estimated_length=156
FT                   /gap_type="unknown"
FT   assembly_gap    23930280..23930299
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23932378..23932397
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23991946..23992023
FT                   /estimated_length=78
FT                   /gap_type="unknown"
FT   assembly_gap    23998997..23999016
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    24011000..24011218
FT                   /estimated_length=219
FT                   /gap_type="unknown"
FT   assembly_gap    24019710..24021218
FT                   /estimated_length=1509
FT                   /gap_type="unknown"
FT   assembly_gap    24039105..24039124
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    24040401..24040420
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            24056863..>24380171
FT                   /locus_tag="mCG_1698"
FT                   /note="gene_id=mCG1698.2"
FT   mRNA            join(24056863..24057008,24090523..24090650,
FT                   24113624..24113669,24161085..24161321,24203585..24203711,
FT                   24213835..24213984,24238649..24238828,24243258..24243396,
FT                   24258703..24258907,24260508..24260655,24263483..24263567,
FT                   24282114..24282415,24295000..24295129,24327211..24327421,
FT                   24342041..24342191,24347237..24348362,24361497..24361624,
FT                   24380002..>24380171)
FT                   /locus_tag="mCG_1698"
FT                   /product="mCG1698"
FT                   /note="gene_id=mCG1698.2 transcript_id=mCT1073.2 created on
FT                   29-OCT-2002"
FT   CDS             join(24056946..24057008,24090523..24090650,
FT                   24113624..24113669,24161085..24161321,24203585..24203711,
FT                   24213835..24213984,24238649..24238828,24243258..24243396,
FT                   24258703..24258907,24260508..24260655,24263483..24263567,
FT                   24282114..24282415,24295000..24295129,24327211..24327421,
FT                   24342041..24342191,24347237..24348362,24361497..24361624,
FT                   24380002..24380171)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1698"
FT                   /product="mCG1698"
FT                   /note="gene_id=mCG1698.2 transcript_id=mCT1073.2
FT                   protein_id=mCP2537.2"
FT                   /protein_id="EDL31012.1"
FT                   /translation="MECCRRAAPGTPLLVLAFLLLSSRTARSEEDREGLWDAWGPWSEC
FT                   SRTCGGGASYSLRRCLSSKSCEGRNIRYRTCSNVDCPPEAGDFRAQQCSAHNDVKYHGQ
FT                   LYEWLPVSNDPDNPCSLKCQAKGTSLVVELAPKVLDGTRCYTESLDMCISGLCQIVGCD
FT                   HQLGSTVKEDNCGVCNGDGSTCRLVRGQYKSQLSASKYISSLLFGGLSSSCLNTLLQPS
FT                   QFLPTLPIGAHRLWHISQKAMLLAQHVECYQRPRCYPSSYHTPDFPVLFVQIHDLGPAD
FT                   STVQFIFYQPIIHRWRETDFFPCSATCGGGYQLTSAECYDLRSNRVVADQYCHYYPENV
FT                   KPKPKLQECNLDPCPARWEATPWTACSSSCGGGIQSRAVSCVEEDIQGHVTSVEEWKCM
FT                   YTPKMPVVQPCNIFDCPKWLAQEWSPCTVTCGQGLRYRVVLCIDHRGMHTGGCSAKTKP
FT                   HIKEECIIPTPCYKPREKLPIEAKLPWFKQAQELEEGAAVSEEPSFIPEAWSACTVTCG
FT                   VGTQVRIIRCQVLLPFSQSVADLPADECEGPKPASQRACYAGPCNGETPEFNPDNGDGL
FT                   LGGLQDLDELYDWEYEGFTKCSESCGGGVQEAVVSCLNKQTRELADENLCVTSRRPPQL
FT                   LKSCNLDPCPARWEIGKWSPCSLTCGVGLQTRDVVCSHLLSREMNEVVVLADELCHHPK
FT                   PSTVQACNRFNCPPAWYPAQWQLCSRTCGGGIQKRDVLCKQRMADGSFLELPETFCSAS
FT                   KPTSHQGCKKDDCPRPGRPSTKHSPHIAAARNIYIQTRRQRKLHFVVGGFAYLLPKTTV
FT                   VLRCPTRRFRKPLITWEKDGQHSISSAHVTVAPFGYLKIHRLKPSDAGIYTCSAGPARE
FT                   QFVIKLIGGNRKLVARPLSLWSEEEEALQVRKTNPKEALQTHKHQNGIFSNGSKAEKRG
FT                   LTADPGNRYDDIVSRLLEQGGWPGELLASWEVQDSAERNASSEEDPNAEQALLHLPFTM
FT                   VAEQKRLDDILRNLSQQPEELRDLYSKHLVAQLAQDIFRSHLENQDLLPKPSEQRFPPM
FT                   AVPAHKHVSGFSSSLRSSSGEAGGGSRRPHRKPAILRKISAAQQLSASEVVTHLGQTVA
FT                   LASGTLSVLLHCEAVGNPRPTIHWTRNGEAVQFSDRILLQPDDSLQILAPVEADVGFYT
FT                   CNATNALGYDSVSIAVTLAGKPLVKTSRMTVLNTEKPTVTVDIGGTVRTVRGVNVTINC
FT                   QVAGEKLVHVFICFRY"
FT   assembly_gap    24077195..24077214
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    24124067..24124129
FT                   /estimated_length=63
FT                   /gap_type="unknown"
FT   assembly_gap    24136461..24136480
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    24140506..24140525
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    24142934..24142953
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    24152669..24153840
FT                   /estimated_length=1172
FT                   /gap_type="unknown"
FT   assembly_gap    24164876..24165142
FT                   /estimated_length=267
FT                   /gap_type="unknown"
FT   assembly_gap    24204665..24204684
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    24217441..24217460
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    24232685..24237287
FT                   /estimated_length=4603
FT                   /gap_type="unknown"
FT   assembly_gap    24279560..24279579
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    24281129..24281392
FT                   /estimated_length=264
FT                   /gap_type="unknown"
FT   assembly_gap    24282850..24282869
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    24303520..24303539
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    24370241..24370260
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    24408308..24408401
FT                   /estimated_length=94
FT                   /gap_type="unknown"
FT   assembly_gap    24413989..24414033
FT                   /estimated_length=45
FT                   /gap_type="unknown"
FT   gene            <24420762..24431376
FT                   /locus_tag="mCG_124369"
FT                   /note="gene_id=mCG124369.0"
FT   mRNA            join(<24420762..24420887,24423708..24423915,
FT                   24428588..24428697,24429391..24429611,24431073..24431376)
FT                   /locus_tag="mCG_124369"
FT                   /product="mCG124369"
FT                   /note="gene_id=mCG124369.0 transcript_id=mCT125610.0
FT                   created on 10-DEC-2002"
FT   CDS             join(<24420763..24420887,24423708..24423915,
FT                   24428588..24428697,24429391..24429611,24431073..24431179)
FT                   /codon_start=1
FT                   /locus_tag="mCG_124369"
FT                   /product="mCG124369"
FT                   /note="gene_id=mCG124369.0 transcript_id=mCT125610.0
FT                   protein_id=mCP76432.0"
FT                   /protein_id="EDL31011.1"
FT                   /translation="GIHQPRLRCLLNTTEVDPEHCTGKPRPAVQPVACNRRDCPSRWMV
FT                   TSWSACTRSCGGGVQTRRVTCQKLKASGISTPVSNDMCSQLAKRPVDTQACNQQLCVEW
FT                   AFSSWGQCNGPCIGPRLAVQHRQVFCQTRDGITLPSEQCSALPRPVSTQNCWSEACSVH
FT                   WRVSLWTLCTATCGNYGFQSRRVECVHVRTNKAVPEHLCSWGPRPANWQRCNVTPCENT
FT                   ECRDTTRYCEKVRQLKLCQLGQFRSRCCGTCGKA"
FT   assembly_gap    24431708..24431751
FT                   /estimated_length=44
FT                   /gap_type="unknown"
FT   assembly_gap    24446349..24446368
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(24449955..24563064)
FT                   /locus_tag="mCG_1697"
FT                   /note="gene_id=mCG1697.2"
FT   mRNA            complement(join(24449955..24451074,24479830..24480035,
FT                   24488747..24488926,24543709..>24543861))
FT                   /locus_tag="mCG_1697"
FT                   /product="mCG1697, transcript variant mCT192870"
FT                   /note="gene_id=mCG1697.2 transcript_id=mCT192870.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(24449956..24451074,24479830..24480035,
FT                   24488747..24488926,24562710..24563064))
FT                   /locus_tag="mCG_1697"
FT                   /product="mCG1697, transcript variant mCT1072"
FT                   /note="gene_id=mCG1697.2 transcript_id=mCT1072.1 created on
FT                   29-OCT-2002"
FT   mRNA            complement(join(24450066..24451074,24479830..24480035,
FT                   24482607..24482679,24488747..24488926,24562710..24563011))
FT                   /locus_tag="mCG_1697"
FT                   /product="mCG1697, transcript variant mCT175179"
FT                   /note="gene_id=mCG1697.2 transcript_id=mCT175179.0 created
FT                   on 29-OCT-2002"
FT   CDS             complement(join(24450071..24451074,24479830..24480035,
FT                   24488747..24488926,24562710..24562750))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1697"
FT                   /product="mCG1697, isoform CRA_a"
FT                   /note="gene_id=mCG1697.2 transcript_id=mCT1072.1
FT                   protein_id=mCP2562.1 isoform=CRA_a"
FT                   /db_xref="GOA:B1AXP3"
FT                   /db_xref="InterPro:IPR024963"
FT                   /db_xref="MGI:MGI:1923061"
FT                   /db_xref="UniProtKB/TrEMBL:B1AXP3"
FT                   /protein_id="EDL31008.1"
FT                   /translation="MGKRTCICNLCSCGRHRCPHLPTKIYDKTEKTRLLSEYTENYPIY
FT                   QSYLPRNSFKPEWCYRKPSAPMEGLTTCRRDFGLHKMLPVTFHQPDTYVPSQETMDLLT
FT                   TYKHDFNYLPTCPVGLIKPRDSKFPNGDKIMQYLPTYKVDYLPWNQPRRELLRPPHKYR
FT                   PESSKFENRTTHQDDYTMKGLVTTVSCKPPSKSKIYNIPLEDLTNYKMSYVPHPVEKRF
FT                   VKEAEKYIPCDIPFENLTTHKESYRGLLGEPAKSTKPPAKFPVHDAPFTNTTEVQEKFQ
FT                   AWPTPQMVPKAPVVYVPPEEKMDLLTTVQTHYKYLKGSPAITCRPVPSIKKSKCFESST
FT                   TTKDDFKQWAAVNTKPIRPTLHLSLPAEPLDCQTTTKTCFVAHPPIITENYKPPWVGLR
FT                   RNIPVEGQTTYSINFTPKDLGKCPASYMEPPGYIFEEVDSMGHKIYRSISQTGSRQNSS
FT                   ISICDTEKPGQKELEVSA"
FT   CDS             complement(join(24450071..24451074,24479830..24480035,
FT                   24488747..24488926,24543709..>24543731))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1697"
FT                   /product="mCG1697, isoform CRA_c"
FT                   /note="gene_id=mCG1697.2 transcript_id=mCT192870.0
FT                   protein_id=mCP113800.0 isoform=CRA_c"
FT                   /protein_id="EDL31010.1"
FT                   /translation="ANRKLFFWRHRCPHLPTKIYDKTEKTRLLSEYTENYPIYQSYLPR
FT                   NSFKPEWCYRKPSAPMEGLTTCRRDFGLHKMLPVTFHQPDTYVPSQETMDLLTTYKHDF
FT                   NYLPTCPVGLIKPRDSKFPNGDKIMQYLPTYKVDYLPWNQPRRELLRPPHKYRPESSKF
FT                   ENRTTHQDDYTMKGLVTTVSCKPPSKSKIYNIPLEDLTNYKMSYVPHPVEKRFVKEAEK
FT                   YIPCDIPFENLTTHKESYRGLLGEPAKSTKPPAKFPVHDAPFTNTTEVQEKFQAWPTPQ
FT                   MVPKAPVVYVPPEEKMDLLTTVQTHYKYLKGSPAITCRPVPSIKKSKCFESSTTTKDDF
FT                   KQWAAVNTKPIRPTLHLSLPAEPLDCQTTTKTCFVAHPPIITENYKPPWVGLRRNIPVE
FT                   GQTTYSINFTPKDLGKCPASYMEPPGYIFEEVDSMGHKIYRSISQTGSRQNSSISICDT
FT                   EKPGQKELEVSA"
FT   assembly_gap    24473390..24477526
FT                   /estimated_length=4137
FT                   /gap_type="unknown"
FT   CDS             complement(join(24479985..24480035,24482607..24482679,
FT                   24488747..24488926,24562710..24562750))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1697"
FT                   /product="mCG1697, isoform CRA_b"
FT                   /note="gene_id=mCG1697.2 transcript_id=mCT175179.0
FT                   protein_id=mCP98098.0 isoform=CRA_b"
FT                   /protein_id="EDL31009.1"
FT                   /translation="MGKRTCICNLCSCGRHRCPHLPTKIYDKTEKTRLLSEYTENYPIY
FT                   QSYLPRNSFKPEWCYRKPSAPMEGLTTCRITARLNTRECTTGREKPLNVEKQVERFWAS
FT                   QNVTGDIPPA"
FT   assembly_gap    24507034..24508612
FT                   /estimated_length=1579
FT                   /gap_type="unknown"
FT   gene            24563178..24564535
FT                   /locus_tag="mCG_148067"
FT                   /note="gene_id=mCG148067.0"
FT   mRNA            join(24563178..24563498,24564229..24564535)
FT                   /locus_tag="mCG_148067"
FT                   /product="mCG148067"
FT                   /note="gene_id=mCG148067.0 transcript_id=mCT188330.0
FT                   created on 13-JAN-2004"
FT   CDS             join(24563470..24563498,24564229..24564391)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148067"
FT                   /product="mCG148067"
FT                   /note="gene_id=mCG148067.0 transcript_id=mCT188330.0
FT                   protein_id=mCP109407.0"
FT                   /protein_id="EDL31007.1"
FT                   /translation="MRGSSPLLLRFWVKRAMWAKTHVEIRRQPGEVGFLFLPCGPRAGI
FT                   DVISVSFECLKSHGLQQC"
FT   gene            complement(24586272..24616736)
FT                   /gene="6230416J20Rik"
FT                   /locus_tag="mCG_124371"
FT                   /note="gene_id=mCG124371.1"
FT   mRNA            complement(join(24586272..24586707,24587576..24588568,
FT                   24590023..24590158,24590459..24590641,24591009..24591075,
FT                   24593681..24593762,24598280..24598382,24599429..24599555,
FT                   24600052..24600245,24603954..24604124,24605447..24605495,
FT                   24605919..24605984,24607529..24607673,24608867..24608999,
FT                   24610343..24610421,24612591..24612686,24616369..24616736))
FT                   /gene="6230416J20Rik"
FT                   /locus_tag="mCG_124371"
FT                   /product="RIKEN cDNA 6230416J20, transcript variant
FT                   mCT125612"
FT                   /note="gene_id=mCG124371.1 transcript_id=mCT125612.1
FT                   created on 09-DEC-2002"
FT   CDS             complement(join(24586658..24586707,24587576..24588568,
FT                   24590023..24590158,24590459..24590641,24591009..24591075,
FT                   24593681..24593762,24598280..24598382,24599429..24599555,
FT                   24600052..24600245,24603954..24604124,24605447..24605495,
FT                   24605919..24605984,24607529..24607673,24608867..24608999,
FT                   24610343..24610421,24612591..24612686,24616369..24616496))
FT                   /codon_start=1
FT                   /gene="6230416J20Rik"
FT                   /locus_tag="mCG_124371"
FT                   /product="RIKEN cDNA 6230416J20, isoform CRA_a"
FT                   /note="gene_id=mCG124371.1 transcript_id=mCT125612.1
FT                   protein_id=mCP76455.1 isoform=CRA_a"
FT                   /protein_id="EDL31005.1"
FT                   /translation="MSSARDSAFEKQHLWMYLQALGLDPSSSITFGGKMVPHAHLGENM
FT                   FDKLNRDAFHIVSYFLFKTLDEALAKEVFRDCWPPFDQKLDMEFRKHCCEWLKEISAEC
FT                   GSSFPQVVGSLLMSPGGPKFIHLMYHFARYVAIKYIKTKSNNSLHFAETFNVKPQDMHK
FT                   CLARSHVARNRFLQILQREHYVMQKYQENVNLSVKQVRNARSECMSLQNQIKRMEPYDE
FT                   KSNTQEKIQKVRSLWASVNETLMVVEKERDVISSLFGFVNQYALDGAHVAVNIPRLLLD
FT                   RLEEQICRLQIGNVYEAGKLNLLTIIHLLNEVLKIMKYEHCKAGQAGLTINLHYLEKET
FT                   KFQRERLSHMKHMRHKVKETVTAVRQSIADKEGKWHMKWKGFLGLSPFRLIKDRPAAVD
FT                   LLPPMSPLTFDPVSEEVYAKSILFKYPASLPDSHKEPKQESGSRREVDTPGSVCDGANS
FT                   PVPFPLQCAASSDTNSSTLLEKDPNMRTPIEKTLTYKTIADSEEEDSPLSDTAKNSQSS
FT                   VSRGTLPVKRSEPFQKEQARLVDEVARVVLSDSPQLSERKEVELEELIDTLISNPFLTR
FT                   KQIPRTPENLITDIRSSWRKAVETEDNRSSDGILVDASAREVSSESSSTLHNQREFSLA
FT                   IFSPDFDRSYFPEEKAVSDQLKGLPQKHLVTSQIREPPTEDVSDLVNKKMIWKQDLECA
FT                   TTRLSETSHMDVFSPVVGSGIDVMSRSKEDCVPVPPDHSQASCIEPSTHKTLLWDSFQR
FT                   LSGIGILHETLPEVGRLSLNSSTSSETSFNLEPKSYVHSDAFADDVGKGQAIPELDSNL
FT                   QARLTSYEALKKSLSKIREESYLSNPKTLEQHKVELSSVAKAVQADDAHTVWDTQDLFI
FT                   DYAKPSSLVPLDGKTQTVSLTKAFLVEQKLKTTVPCSLGEFLPSLKEEEISSKSLEARD
FT                   SLI"
FT   mRNA            complement(join(24589722..24590158,24590459..24590641,
FT                   24591009..24591075,24593681..24593762,24598280..24598382,
FT                   24599429..24599555,24600052..24600245,24603954..24604124,
FT                   24605447..24605495,24605919..24605984,24607529..24607673,
FT                   24608867..24608999,24610343..24610421,24612591..24612686,
FT                   24616369..>24616726))
FT                   /gene="6230416J20Rik"
FT                   /locus_tag="mCG_124371"
FT                   /product="RIKEN cDNA 6230416J20, transcript variant
FT                   mCT192852"
FT                   /note="gene_id=mCG124371.1 transcript_id=mCT192852.0
FT                   created on 09-MAR-2004"
FT   CDS             complement(join(24589961..24590158,24590459..24590641,
FT                   24591009..24591075,24593681..24593762,24598280..24598382,
FT                   24599429..24599555,24600052..24600245,24603954..24604124,
FT                   24605447..24605495,24605919..24605984,24607529..24607673,
FT                   24608867..24608999,24610343..24610421,24612591..24612686,
FT                   24616369..>24616724))
FT                   /codon_start=1
FT                   /gene="6230416J20Rik"
FT                   /locus_tag="mCG_124371"
FT                   /product="RIKEN cDNA 6230416J20, isoform CRA_b"
FT                   /note="gene_id=mCG124371.1 transcript_id=mCT192852.0
FT                   protein_id=mCP113782.0 isoform=CRA_b"
FT                   /protein_id="EDL31006.1"
FT                   /translation="LPQARESWFAWSAAVTVCFSGRVRPFVVGWLSERRQRAAAAEGLS
FT                   SPRDACRRGPRVLTASVPSFSSVTVALPVESMSSARDSAFEKQHLWMYLQALGLDPSSS
FT                   ITFGGKMVPHAHLGENMFDKLNRDAFHIVSYFLFKTLDEALAKEVFRDCWPPFDQKLDM
FT                   EFRKHCCEWLKEISAECGSSFPQVVGSLLMSPGGPKFIHLMYHFARYVAIKYIKTKSNN
FT                   SLHFAETFNVKPQDMHKCLARSHVARNRFLQILQREHYVMQKYQENVNLSVKQVRNARS
FT                   ECMSLQNQIKRMEPYDEKSNTQEKIQKVRSLWASVNETLMVVEKERDVISSLFGFVNQY
FT                   ALDGAHVAVNIPRLLLDRLEEQICRLQIGNVYEAGKLNLLTIIHLLNEVLKIMKYEHCK
FT                   AGQAGLTINLHYLEKETKFQRERLSHMKHMRHKVKETVTAVRQSIADKEGKWHMKWKGF
FT                   LGLSPFRLIKDRPAAVDLLPPMSPLTFDPVSEEVYAKSILFKYPASLPDSHKEPKQESG
FT                   SRREVDTPGSVCDGANSPVPFPLQCAASSDTNSSTLLEKDPNMRTPIEKTLTYKTIADS
FT                   EEEDSPLSDTAKNSQSSVSRGTLPVKRSEPFQKEQARLVDEVARVVLSDSPQLSERKEV
FT                   ELEELIDTLISNPFLTRKQIPRTPENLSKLLLSVPFPLLRHFPPSDS"
FT   assembly_gap    24595138..24595157
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    24621098..24621182
FT                   /estimated_length=85
FT                   /gap_type="unknown"
FT   gene            complement(24631554..24675278)
FT                   /gene="Adfp"
FT                   /locus_tag="mCG_124367"
FT                   /note="gene_id=mCG124367.1"
FT   mRNA            complement(join(24631554..24631610,24661918..24662387,
FT                   24663564..24663653,24665071..24665247,24666919..24667204,
FT                   24669418..24669500,24673615..24673810,24673898..24673953,
FT                   24675193..24675278))
FT                   /gene="Adfp"
FT                   /locus_tag="mCG_124367"
FT                   /product="adipose differentiation related protein,
FT                   transcript variant mCT174243"
FT                   /note="gene_id=mCG124367.1 transcript_id=mCT174243.0
FT                   created on 06-DEC-2002"
FT   mRNA            complement(join(<24634115..24634130,24669418..24669500,
FT                   24673615..24673810,24673898..24673953,24675193..24675278))
FT                   /gene="Adfp"
FT                   /locus_tag="mCG_124367"
FT                   /product="adipose differentiation related protein,
FT                   transcript variant mCT174240"
FT                   /note="gene_id=mCG124367.1 transcript_id=mCT174240.0
FT                   created on 06-DEC-2002"
FT   CDS             complement(join(<24634115..24634130,24669418..24669500,
FT                   24673615..24673810,24673898..24673927))
FT                   /codon_start=1
FT                   /gene="Adfp"
FT                   /locus_tag="mCG_124367"
FT                   /product="adipose differentiation related protein, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG124367.1 transcript_id=mCT174240.0
FT                   protein_id=mCP97158.0 isoform=CRA_b"
FT                   /protein_id="EDL30999.1"
FT                   /translation="MAAAVVDPQQSVVMRVANLPLVSSTYDLVSSAYVSTKDQYPYLRS
FT                   VCEMAEKGVKTVTSAAMTSALPIIQKLEPQIAVANTYACKGLDRMEERLPILNQPTSEI
FT                   VANA"
FT   assembly_gap    24656057..24656182
FT                   /estimated_length=126
FT                   /gap_type="unknown"
FT   mRNA            complement(join(24661689..24661858,24669404..24669500,
FT                   24673615..24673630,24673704..24673787))
FT                   /gene="Adfp"
FT                   /locus_tag="mCG_124367"
FT                   /product="adipose differentiation related protein,
FT                   transcript variant mCT174242"
FT                   /note="gene_id=mCG124367.1 transcript_id=mCT174242.0
FT                   created on 06-DEC-2002"
FT   mRNA            complement(join(24661693..24662387,24663564..24663698,
FT                   24665073..24665249,24666925..24667204,24669418..24669500,
FT                   24673615..24673810,24673898..24673953,24675193..24675278))
FT                   /gene="Adfp"
FT                   /locus_tag="mCG_124367"
FT                   /product="adipose differentiation related protein,
FT                   transcript variant mCT125608"
FT                   /note="gene_id=mCG124367.1 transcript_id=mCT125608.1
FT                   created on 06-DEC-2002"
FT   mRNA            complement(join(24661693..24662387,24663564..24663698,
FT                   24665071..24665247,24666919..24667204,24669418..24669500,
FT                   24673615..24673810,24673898..24673953,24674949..24675008))
FT                   /gene="Adfp"
FT                   /locus_tag="mCG_124367"
FT                   /product="adipose differentiation related protein,
FT                   transcript variant mCT174238"
FT                   /note="gene_id=mCG124367.1 transcript_id=mCT174238.0
FT                   created on 06-DEC-2002"
FT   mRNA            complement(join(24661693..24662387,24663564..24663698,
FT                   24665071..24665247,24666919..24667204,24669418..24669500,
FT                   24673615..24673810,24673898..24673953,24674694..24674715))
FT                   /gene="Adfp"
FT                   /locus_tag="mCG_124367"
FT                   /product="adipose differentiation related protein,
FT                   transcript variant mCT174239"
FT                   /note="gene_id=mCG124367.1 transcript_id=mCT174239.0
FT                   created on 06-DEC-2002"
FT   mRNA            complement(join(24661697..24661847,24673738..24673810,
FT                   24673898..24673953,24675193..24675278))
FT                   /gene="Adfp"
FT                   /locus_tag="mCG_124367"
FT                   /product="adipose differentiation related protein,
FT                   transcript variant mCT174241"
FT                   /note="gene_id=mCG124367.1 transcript_id=mCT174241.0
FT                   created on 06-DEC-2002"
FT   CDS             complement(join(24661807..24661847,24673738..24673810,
FT                   24673898..24673927))
FT                   /codon_start=1
FT                   /gene="Adfp"
FT                   /locus_tag="mCG_124367"
FT                   /product="adipose differentiation related protein, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG124367.1 transcript_id=mCT174241.0
FT                   protein_id=mCP97160.0 isoform=CRA_c"
FT                   /protein_id="EDL31000.1"
FT                   /translation="MAAAVVDPQQSVVMRVANLPLVSSTYDLVSSAYVNRSSLTWLVSG
FT                   LC"
FT   CDS             complement(join(24661807..24661858,24669404..24669459))
FT                   /codon_start=1
FT                   /gene="Adfp"
FT                   /locus_tag="mCG_124367"
FT                   /product="adipose differentiation related protein, isoform
FT                   CRA_e"
FT                   /note="gene_id=mCG124367.1 transcript_id=mCT174242.0
FT                   protein_id=mCP97159.0 isoform=CRA_e"
FT                   /protein_id="EDL31004.1"
FT                   /translation="MEERLPILNQPTSEVSLGHWPWHRSSLTWLVSGLC"
FT   CDS             complement(join(24663694..24663698,24665073..24665249,
FT                   24666925..24667204,24669418..24669500,24673615..24673810,
FT                   24673898..24673927))
FT                   /codon_start=1
FT                   /gene="Adfp"
FT                   /locus_tag="mCG_124367"
FT                   /product="adipose differentiation related protein, isoform
FT                   CRA_d"
FT                   /note="gene_id=mCG124367.1 transcript_id=mCT125608.1
FT                   protein_id=mCP76395.1 isoform=CRA_d"
FT                   /protein_id="EDL31002.1"
FT                   /translation="MAAAVVDPQQSVVMRVANLPLVSSTYDLVSSAYVSTKDQYPYLRS
FT                   VCEMAEKGVKTVTSAAMTSALPIIQKLEPQIAVANTYACKGLDRMEERLPILNQPTSEI
FT                   VASARGAVTGAKDVVTTTMAGAKDSVASTVSGVVDKTKGAVTGSVERTKSVVNGSINTV
FT                   LGMVQFMNSGVDNAITKSEMLVDQYFPLTQEELDGSKKVEGFDMVQKPSNYERLESLST
FT                   KLCSRAYHQALSRVKEAKQKSQETISQLHSTVHH"
FT   CDS             complement(join(24665222..24665247,24666919..24667204,
FT                   24669418..24669500,24673615..24673810,24673898..24673927))
FT                   /codon_start=1
FT                   /gene="Adfp"
FT                   /locus_tag="mCG_124367"
FT                   /product="adipose differentiation related protein, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG124367.1 transcript_id=mCT174239.0
FT                   protein_id=mCP97157.0 isoform=CRA_a"
FT                   /protein_id="EDL30998.1"
FT                   /translation="MAAAVVDPQQSVVMRVANLPLVSSTYDLVSSAYVSTKDQYPYLRS
FT                   VCEMAEKGVKTVTSAAMTSALPIIQKLEPQIAVANTYACKGLDRMEERLPILNQPTSEI
FT                   VASARGAVTGAKDVVTTTMAGAKDSVASTVSGVVDKTKGAVTGSVERTKSVVNGSINTV
FT                   LGMVQFMNSGVDNAITKSEMLVDQYFPLTQEELGNGKQKGGRI"
FT   CDS             complement(join(24665222..24665247,24666919..24667204,
FT                   24669418..24669500,24673615..24673810,24673898..24673927))
FT                   /codon_start=1
FT                   /gene="Adfp"
FT                   /locus_tag="mCG_124367"
FT                   /product="adipose differentiation related protein, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG124367.1 transcript_id=mCT174243.0
FT                   protein_id=mCP97161.0 isoform=CRA_a"
FT                   /protein_id="EDL31001.1"
FT                   /translation="MAAAVVDPQQSVVMRVANLPLVSSTYDLVSSAYVSTKDQYPYLRS
FT                   VCEMAEKGVKTVTSAAMTSALPIIQKLEPQIAVANTYACKGLDRMEERLPILNQPTSEI
FT                   VASARGAVTGAKDVVTTTMAGAKDSVASTVSGVVDKTKGAVTGSVERTKSVVNGSINTV
FT                   LGMVQFMNSGVDNAITKSEMLVDQYFPLTQEELGNGKQKGGRI"
FT   CDS             complement(join(24665222..24665247,24666919..24667204,
FT                   24669418..24669500,24673615..24673810,24673898..24673927))
FT                   /codon_start=1
FT                   /gene="Adfp"
FT                   /locus_tag="mCG_124367"
FT                   /product="adipose differentiation related protein, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG124367.1 transcript_id=mCT174238.0
FT                   protein_id=mCP97162.0 isoform=CRA_a"
FT                   /protein_id="EDL31003.1"
FT                   /translation="MAAAVVDPQQSVVMRVANLPLVSSTYDLVSSAYVSTKDQYPYLRS
FT                   VCEMAEKGVKTVTSAAMTSALPIIQKLEPQIAVANTYACKGLDRMEERLPILNQPTSEI
FT                   VASARGAVTGAKDVVTTTMAGAKDSVASTVSGVVDKTKGAVTGSVERTKSVVNGSINTV
FT                   LGMVQFMNSGVDNAITKSEMLVDQYFPLTQEELGNGKQKGGRI"
FT   assembly_gap    24665250..24666115
FT                   /estimated_length=866
FT                   /gap_type="unknown"
FT   assembly_gap    24686263..24686392
FT                   /estimated_length=130
FT                   /gap_type="unknown"
FT   assembly_gap    24697562..24697867
FT                   /estimated_length=306
FT                   /gap_type="unknown"
FT   assembly_gap    24710316..24710354
FT                   /estimated_length=39
FT                   /gap_type="unknown"
FT   assembly_gap    24725076..24725306
FT                   /estimated_length=231
FT                   /gap_type="unknown"
FT   assembly_gap    24730670..24730721
FT                   /estimated_length=52
FT                   /gap_type="unknown"
FT   assembly_gap    24764481..24764782
FT                   /estimated_length=302
FT                   /gap_type="unknown"
FT   gene            24774807..24861362
FT                   /locus_tag="mCG_6889"
FT                   /note="gene_id=mCG6889.1"
FT   mRNA            join(24774807..24775128,24778259..24778511,
FT                   24780381..24780450,24782074..24782243,24786581..24786826,
FT                   24791866..24792012,24795657..24795830,24799960..24800107,
FT                   24803458..24803603,24821454..24821546,24822252..24822380,
FT                   24823320..24823464,24823709..24823855,24829799..24829918,
FT                   24831264..24831407,24835283..24835992,24837880..24838060,
FT                   24838832..24838941,24839402..24839577,24846574..24846756,
FT                   24847575..24847770,24849821..24850066,24851174..24851291,
FT                   24855618..24855768,24858709..24858773,24859531..24861362)
FT                   /locus_tag="mCG_6889"
FT                   /product="mCG6889"
FT                   /note="gene_id=mCG6889.1 transcript_id=mCT6192.2 created on
FT                   28-OCT-2002"
FT   CDS             join(24774824..24775128,24778259..24778511,
FT                   24780381..24780450,24782074..24782243,24786581..24786826,
FT                   24791866..24792012,24795657..24795830,24799960..24800107,
FT                   24803458..24803603,24821454..24821546,24822252..24822380,
FT                   24823320..24823464,24823709..24823855,24829799..24829918,
FT                   24831264..24831407,24835283..24835992,24837880..24838060,
FT                   24838832..24838941,24839402..24839577,24846574..24846756,
FT                   24847575..24847770,24849821..24850066,24851174..24851291,
FT                   24855618..24855768,24858709..24858773,24859531..24859667)
FT                   /codon_start=1
FT                   /locus_tag="mCG_6889"
FT                   /product="mCG6889"
FT                   /note="gene_id=mCG6889.1 transcript_id=mCT6192.2
FT                   protein_id=mCP2563.2"
FT                   /protein_id="EDL30997.1"
FT                   /translation="MIEDKGPRVTDYFVVAGLTDTSTLLDQEINRTDTNSIGPKAPITD
FT                   IAVIIKSAGETVPEGYTCVEATPSALQANLNYGSLKSPELFLCYRRGRDKPPLTDIGVL
FT                   YEGKERLMPGCEVIQATPYGRCANVNNSSTTSQRIFITYRRAPPVRSQNSLAVTDICVI
FT                   ITSKGETPPHTFCKVDKNLNCGMWGSNVFLCYKKSVPASNAIAYKAGLIFRYPEEDYES
FT                   FPLSPSVPLFCLPMGATIECWDPQIKYPLPVFSTFVLTGSSAEKVYGAAIQFYEPYSQE
FT                   RLTEKQLTQLGLLTLVEKRVVSKPINSNKCICLLSHWPFFEAFKNFLMFIYKVSVSGPH
FT                   PLPIEKYVSGANFSSLLMNLGPENCATLLLLVLLESKILLHSLRPAVLTGVAEAVVAMI
FT                   FPFQWQCPYIPLCPLSLAGVLSAPLPFIVGVDSRYFDLHDPPQDVVCIDLDTNTLYKMT
FT                   QLEMEIQETFLRFMASILKGYRSYLRPITEAPSNKATAADSLFDRQGFLKSRDRAYTKF
FT                   YTLLSKTQIFIRFIEECSFVSDKDTGLAFFDDCIEKVRVSHPKVRALQQAHDVLVKMRK
FT                   TDVDPLDEVCYRVVMQLCGLWVNPVLAVRVLFEMKTARIKPNAITYGYYNKVVLESPWP
FT                   SSTRSGIFLWTKVRNVVHGLAQFRQPLKKTGQKSQVFSISAPQNAACGSDGDTVSHGSV
FT                   DSSNDANNGEHTVFVRDLISLDSIDNHSSTGGQSDQGYGSKDELVKEGADGHAPEEHTP
FT                   PELTTTELHIEEECDISAIVSKHLQPTPEPQSPTEPPAWGSSIVKVPSGLFDTNNRTST
FT                   EMTCNSLQSNSHSDQSRDTQAGAQDPVHKRSSSYATRKAIEREDVETGLDPLSLLATEC
FT                   VEKTSDSEDKLFSPVISRNLADEIESYMNLKSPLGSKSCSMELHGEGNQEPGSPAVFAH
FT                   PLERSSSLPSDRGPPARDSTETEKSSPAVSSSKTLTGRFKPQSPYRAYKDRSTSLSALV
FT                   RSSPNSSLGSVVNSLSGLKLDNILSGPKIDVLKSSMKQAATVASKMWVAVASAYSYSDD
FT                   EEETNKDYSFPAGLEDHHIVGETLSPNTSVSGLVPSELTQSNTSLGSSSSSGDVGKLQC
FT                   PAGEVPFSRNIKGQDFEKSDHGSSQNTSMSSIYQNCAMEVLMSSCSQCRACGALVYDEE
FT                   IMAGWTADDSNLNTTCPFCKSNFLPLLNVEFKDLRGSASFFLKPSTSGDSLQSGSIPSA
FT                   SEPSEHKPTSSSAEPDLISFMDFSKHSETITEEASYTVESSDEIKKTNGDVQSVKMSSV
FT                   PNSLSKRNVSLTRSHSVGGPLQNIDFSQRPFHGVSTVSLPSSLQEDVDHLGKRPSPPPV
FT                   SVPYLSPLVLRKELESLLENEGDQVIHTSSFINQHPIIFWNLVWYFRRLDLPSNLPGLI
FT                   LTSEHCNGGVQLPLSSLSQDSKLVYIQLLWDNINLHQEPGEPLYVSWRNLNSEKKPSLL
FT                   SEQQQAASALVETIRQSIQQNDVLKPINLLSQQMKPGTKRQRSLYREILFLSLVSLGRE
FT                   NIDIEAFDNEYGLAYRSLPSESLERLQRIDAPPSISVEWCRKCFGAPLI"
FT   assembly_gap    24805031..24805050
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    24813246..24815800
FT                   /estimated_length=2555
FT                   /gap_type="unknown"
FT   assembly_gap    24820016..24820035
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(24827719..24828512)
FT                   /pseudo
FT                   /locus_tag="mCG_6543"
FT                   /note="gene_id=mCG6543.0"
FT   mRNA            complement(24827719..24828512)
FT                   /pseudo
FT                   /locus_tag="mCG_6543"
FT                   /note="gene_id=mCG6543.0 transcript_id=mCT6190.1 created on
FT                   09-DEC-2002"
FT   gene            complement(24847021..24868105)
FT                   /locus_tag="mCG_6542"
FT                   /note="gene_id=mCG6542.1"
FT   mRNA            complement(join(24847021..24847755,24866602..24866748,
FT                   24866881..24867091,24867463..24867594,24868056..24868105))
FT                   /locus_tag="mCG_6542"
FT                   /product="mCG6542, transcript variant mCT175185"
FT                   /note="gene_id=mCG6542.1 transcript_id=mCT175185.0 created
FT                   on 28-OCT-2002"
FT   CDS             complement(join(24847739..24847755,24866602..24866748,
FT                   24866881..24867091,24867463..24867594,24868056..24868061))
FT                   /codon_start=1
FT                   /locus_tag="mCG_6542"
FT                   /product="mCG6542, isoform CRA_e"
FT                   /note="gene_id=mCG6542.1 transcript_id=mCT175185.0
FT                   protein_id=mCP98103.0 isoform=CRA_e"
FT                   /protein_id="EDL30995.1"
FT                   /translation="MKLNISFPATGCQKLIEVDDERKLRTFYEKRMATEVAADALGEEW
FT                   KGYVVRISGGNDKQGFPMKQGVLTHGRVRLLLSKGHSCYRPRRTGERKRKSVRGCIVDA
FT                   NLSVLNLVIVKKGEKDIPGLTDTTVPRRLGPKRASRIRKLFNLSKEDDVRQYVVRKPLN
FT                   KEDCLED"
FT   mRNA            complement(join(24865397..24865690,24866602..24866748,
FT                   24866881..24867091,24867463..24867594,24868056..24868092))
FT                   /locus_tag="mCG_6542"
FT                   /product="mCG6542, transcript variant mCT6189"
FT                   /note="gene_id=mCG6542.1 transcript_id=mCT6189.0 created on
FT                   28-OCT-2002"
FT   mRNA            complement(join(24865397..24865690,24867463..24867594,
FT                   24868056..24868091))
FT                   /locus_tag="mCG_6542"
FT                   /product="mCG6542, transcript variant mCT175182"
FT                   /note="gene_id=mCG6542.1 transcript_id=mCT175182.0 created
FT                   on 28-OCT-2002"
FT   mRNA            complement(join(24865397..24865690,24866602..24866748,
FT                   24866881..24867091,24867463..24867494,24867567..24867594,
FT                   24868056..24868081))
FT                   /locus_tag="mCG_6542"
FT                   /product="mCG6542, transcript variant mCT175183"
FT                   /note="gene_id=mCG6542.1 transcript_id=mCT175183.0 created
FT                   on 28-OCT-2002"
FT   mRNA            complement(join(24865397..24865690,24866602..24866748,
FT                   24866881..24867085,24867500..>24867552))
FT                   /locus_tag="mCG_6542"
FT                   /product="mCG6542, transcript variant mCT175184"
FT                   /note="gene_id=mCG6542.1 transcript_id=mCT175184.0 created
FT                   on 28-OCT-2002"
FT   mRNA            complement(join(24865411..24865690,24866602..24866668,
FT                   24867057..24867091,24867463..24867594,24868056..24868092))
FT                   /locus_tag="mCG_6542"
FT                   /product="mCG6542, transcript variant mCT175181"
FT                   /note="gene_id=mCG6542.1 transcript_id=mCT175181.0 created
FT                   on 28-OCT-2002"
FT   CDS             complement(join(24865437..24865690,24866602..24866748,
FT                   24866881..24867091,24867463..24867494,24867567..24867594,
FT                   24868056..24868061))
FT                   /codon_start=1
FT                   /locus_tag="mCG_6542"
FT                   /product="mCG6542, isoform CRA_c"
FT                   /note="gene_id=mCG6542.1 transcript_id=mCT175183.0
FT                   protein_id=mCP98100.0 isoform=CRA_c"
FT                   /protein_id="EDL30993.1"
FT                   /translation="MKLNISFPATGLAADALGEEWKGYVVRISGGNDKQGFPMKQGVLT
FT                   HGRVRLLLSKGHSCYRPRRTGERKRKSVRGCIVDANLSVLNLVIVKKGEKDIPGLTDTT
FT                   VPRRLGPKRASRIRKLFNLSKEDDVRQYVVRKPLNKEGKKPRTKAPKIQRLVTPRVLQH
FT                   KRRRIALKKQRTKKNKEEAAEYAKLLAKRMKEAKEKRQEQIAKRRRLSSLRASTSKSES
FT                   SQK"
FT   CDS             complement(join(24865437..24865690,24866602..24866748,
FT                   24866881..24867091,24867463..24867594,24868056..24868061))
FT                   /codon_start=1
FT                   /locus_tag="mCG_6542"
FT                   /product="mCG6542, isoform CRA_f"
FT                   /note="gene_id=mCG6542.1 transcript_id=mCT6189.0
FT                   protein_id=mCP2548.1 isoform=CRA_f"
FT                   /db_xref="GOA:Q5BLK1"
FT                   /db_xref="InterPro:IPR001377"
FT                   /db_xref="InterPro:IPR014401"
FT                   /db_xref="InterPro:IPR018282"
FT                   /db_xref="MGI:MGI:98159"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BLK1"
FT                   /protein_id="EDL30996.1"
FT                   /translation="MKLNISFPATGCQKLIEVDDERKLRTFYEKRMATEVAADALGEEW
FT                   KGYVVRISGGNDKQGFPMKQGVLTHGRVRLLLSKGHSCYRPRRTGERKRKSVRGCIVDA
FT                   NLSVLNLVIVKKGEKDIPGLTDTTVPRRLGPKRASRIRKLFNLSKEDDVRQYVVRKPLN
FT                   KEGKKPRTKAPKIQRLVTPRVLQHKRRRIALKKQRTKKNKEEAAEYAKLLAKRMKEAKE
FT                   KRQEQIAKRRRLSSLRASTSKSESSQK"
FT   CDS             complement(join(24865437..24865690,24866602..24866748,
FT                   24866881..24867085,24867500..>24867514))
FT                   /codon_start=1
FT                   /locus_tag="mCG_6542"
FT                   /product="mCG6542, isoform CRA_d"
FT                   /note="gene_id=mCG6542.1 transcript_id=mCT175184.0
FT                   protein_id=mCP98101.0 isoform=CRA_d"
FT                   /protein_id="EDL30994.1"
FT                   /translation="EAHGHVVRISGGNDKQGFPMKQGVLTHGRVRLLLSKGHSCYRPRR
FT                   TGERKRKSVRGCIVDANLSVLNLVIVKKGEKDIPGLTDTTVPRRLGPKRASRIRKLFNL
FT                   SKEDDVRQYVVRKPLNKEGKKPRTKAPKIQRLVTPRVLQHKRRRIALKKQRTKKNKEEA
FT                   AEYAKLLAKRMKEAKEKRQEQIAKRRRLSSLRASTSKSESSQK"
FT   CDS             complement(join(24865604..24865690,24867463..24867594,
FT                   24868056..24868061))
FT                   /codon_start=1
FT                   /locus_tag="mCG_6542"
FT                   /product="mCG6542, isoform CRA_b"
FT                   /note="gene_id=mCG6542.1 transcript_id=mCT175182.0
FT                   protein_id=mCP98104.0 isoform=CRA_b"
FT                   /protein_id="EDL30992.1"
FT                   /translation="MKLNISFPATGCQKLIEVDDERKLRTFYEKRMATEVAADALGEEW
FT                   KVRSPGPKHPRFSDLLLLVSCNTNADVLL"
FT   CDS             complement(join(24866611..24866668,24867057..24867091,
FT                   24867463..24867594,24868056..24868061))
FT                   /codon_start=1
FT                   /locus_tag="mCG_6542"
FT                   /product="mCG6542, isoform CRA_a"
FT                   /note="gene_id=mCG6542.1 transcript_id=mCT175181.0
FT                   protein_id=mCP98102.0 isoform=CRA_a"
FT                   /protein_id="EDL30991.1"
FT                   /translation="MKLNISFPATGCQKLIEVDDERKLRTFYEKRMATEVAADALGEEW
FT                   KGYVVRISGGNDNFLISPKKMMSASMLSGSP"
FT   assembly_gap    24879028..24879183
FT                   /estimated_length=156
FT                   /gap_type="unknown"
FT   assembly_gap    24883487..24883506
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            24884997..24982767
FT                   /gene="Asah3l"
FT                   /locus_tag="mCG_51924"
FT                   /note="gene_id=mCG51924.3"
FT   mRNA            join(24884997..24885197,24897331..24897445,
FT                   24898192..24898333,24907309..24907446,24918462..24918599,
FT                   24926106..24929589)
FT                   /gene="Asah3l"
FT                   /locus_tag="mCG_51924"
FT                   /product="N-acylsphingosine amidohydrolase 3-like,
FT                   transcript variant mCT52107"
FT                   /note="gene_id=mCG51924.3 transcript_id=mCT52107.3 created
FT                   on 12-JUN-2003"
FT   mRNA            join(24885015..24885197,24897331..24897445,
FT                   24898192..24898333,24918462..24918599,24926106..24929589)
FT                   /gene="Asah3l"
FT                   /locus_tag="mCG_51924"
FT                   /product="N-acylsphingosine amidohydrolase 3-like,
FT                   transcript variant mCT185454"
FT                   /note="gene_id=mCG51924.3 transcript_id=mCT185454.0 created
FT                   on 12-JUN-2003"
FT   mRNA            join(24885018..24885197,24897331..24897445,
FT                   24898192..24898333,24907309..24907446,24918462..24918599,
FT                   24941043..24941447,24982709..24982767)
FT                   /gene="Asah3l"
FT                   /locus_tag="mCG_51924"
FT                   /product="N-acylsphingosine amidohydrolase 3-like,
FT                   transcript variant mCT185453"
FT                   /note="gene_id=mCG51924.3 transcript_id=mCT185453.0 created
FT                   on 12-JUN-2003"
FT   CDS             join(24885090..24885197,24897331..24897445,
FT                   24898192..24898333,24907309..24907446,24918462..24918599,
FT                   24941043..24941061)
FT                   /codon_start=1
FT                   /gene="Asah3l"
FT                   /locus_tag="mCG_51924"
FT                   /product="N-acylsphingosine amidohydrolase 3-like, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG51924.3 transcript_id=mCT185453.0
FT                   protein_id=mCP106712.0 isoform=CRA_a"
FT                   /protein_id="EDL30987.1"
FT                   /translation="MGAPHWWDHLRAGSSEVDWCEDNYTIVPAIAEFYNTISNVLFFIL
FT                   PPICMCLFRQYATCFNSGIYLIWTLLVVVGIGSVYFHATLSFLGQMLDELAILWVLMCA
FT                   LAMWFPRRYLPKIFRNDRGRFKAVVCVLSAITTCLAFIKPAINNISLMILGLPCTALLV
FT                   AELKRCDNVRVFKLGLFSGLWWTLALFCWISDQAFCELLSSFHFPYLHCVWSADRG"
FT   CDS             join(24885090..24885197,24897331..24897445,
FT                   24898192..24898333,24907309..24907446,24918462..24918599,
FT                   24926106..24926292)
FT                   /codon_start=1
FT                   /gene="Asah3l"
FT                   /locus_tag="mCG_51924"
FT                   /product="N-acylsphingosine amidohydrolase 3-like, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG51924.3 transcript_id=mCT52107.3
FT                   protein_id=mCP25515.1 isoform=CRA_c"
FT                   /protein_id="EDL30989.1"
FT                   /translation="MGAPHWWDHLRAGSSEVDWCEDNYTIVPAIAEFYNTISNVLFFIL
FT                   PPICMCLFRQYATCFNSGIYLIWTLLVVVGIGSVYFHATLSFLGQMLDELAILWVLMCA
FT                   LAMWFPRRYLPKIFRNDRGRFKAVVCVLSAITTCLAFIKPAINNISLMILGLPCTALLV
FT                   AELKRCDNVRVFKLGLFSGLWWTLALFCWISDQAFCELLSSFHFPYLHCVWHILICLAS
FT                   YLGCVCFAYFDAASEIPEQGPVIRFWPSEKWAFIGVPYVSLLCAHKKSPVKIT"
FT   CDS             join(24885090..24885197,24897331..24897445,
FT                   24898192..24898333,24918462..24918599,24926106..24926292)
FT                   /codon_start=1
FT                   /gene="Asah3l"
FT                   /locus_tag="mCG_51924"
FT                   /product="N-acylsphingosine amidohydrolase 3-like, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG51924.3 transcript_id=mCT185454.0
FT                   protein_id=mCP106711.0 isoform=CRA_b"
FT                   /protein_id="EDL30988.1"
FT                   /translation="MGAPHWWDHLRAGSSEVDWCEDNYTIVPAIAEFYNTISNVLFFIL
FT                   PPICMCLFRQYATCFNSGIYLIWTLLVVVGIGSVYFHATLSFLGQMLDELAILWVLMCA
FT                   LAMWFPRRYLPKIFRNDRCDNVRVFKLGLFSGLWWTLALFCWISDQAFCELLSSFHFPY
FT                   LHCVWHILICLASYLGCVCFAYFDAASEIPEQGPVIRFWPSEKWAFIGVPYVSLLCAHK
FT                   KSPVKIT"
FT   assembly_gap    24918688..24919378
FT                   /estimated_length=691
FT                   /gap_type="unknown"
FT   assembly_gap    24920508..24920527
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    24921921..24921940
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    24923839..24924138
FT                   /estimated_length=300
FT                   /gap_type="unknown"
FT   assembly_gap    24930770..24930922
FT                   /estimated_length=153
FT                   /gap_type="unknown"
FT   assembly_gap    24934909..24935597
FT                   /estimated_length=689
FT                   /gap_type="unknown"
FT   gene            24939715..24941705
FT                   /locus_tag="mCG_124170"
FT                   /note="gene_id=mCG124170.1"
FT   mRNA            join(24939715..24939865,24941043..24941448,
FT                   24941616..24941705)
FT                   /locus_tag="mCG_124170"
FT                   /product="mCG124170"
FT                   /note="gene_id=mCG124170.1 transcript_id=mCT125408.1
FT                   created on 07-OCT-2002"
FT   CDS             join(24941128..24941448,24941616..24941687)
FT                   /codon_start=1
FT                   /locus_tag="mCG_124170"
FT                   /product="mCG124170"
FT                   /note="gene_id=mCG124170.1 transcript_id=mCT125408.1
FT                   protein_id=mCP76032.1"
FT                   /protein_id="EDL30990.1"
FT                   /translation="MAKGKRKNLTNRNQDHSASSEPSMPTTASPGYPNTPEKLDSDLKA
FT                   YFMMMLEDIKKDFNNSLQEIQENTAKQVEELKKEAQKSLKELQENPTKQVMMGIEQNYP
FT                   RPKLPLPSSPPPYFLFPQSPCPTLSQ"
FT   assembly_gap    24941449..24941615
FT                   /estimated_length=167
FT                   /gap_type="unknown"
FT   assembly_gap    24964160..24964179
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    24969128..24969330
FT                   /estimated_length=203
FT                   /gap_type="unknown"
FT   assembly_gap    24984015..24984034
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    24986529..24986548
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(25003353..25245011)
FT                   /gene="Slc24a2"
FT                   /locus_tag="mCG_6544"
FT                   /note="gene_id=mCG6544.2"
FT   mRNA            complement(join(25003353..25003980,25009128..25009294,
FT                   25013921..25014010,25024245..25024388,25041041..25041159,
FT                   25045031..25045129,25062688..25062738,25085916..25086024,
FT                   25088847..25088885,25189967..25190152,25241490..25242570,
FT                   25244903..25245011))
FT                   /gene="Slc24a2"
FT                   /locus_tag="mCG_6544"
FT                   /product="solute carrier family 24
FT                   (sodium/potassium/calcium exchanger), member 2"
FT                   /note="gene_id=mCG6544.2 transcript_id=mCT6191.2 created on
FT                   28-OCT-2002"
FT   CDS             complement(join(25003731..25003980,25009128..25009294,
FT                   25013921..25014010,25024245..25024388,25041041..25041159,
FT                   25045031..25045129,25062688..25062738,25085916..25086024,
FT                   25088847..25088885,25189967..25190152,25241490..25242422))
FT                   /codon_start=1
FT                   /gene="Slc24a2"
FT                   /locus_tag="mCG_6544"
FT                   /product="solute carrier family 24
FT                   (sodium/potassium/calcium exchanger), member 2"
FT                   /note="gene_id=mCG6544.2 transcript_id=mCT6191.2
FT                   protein_id=mCP2556.2"
FT                   /protein_id="EDL30985.1"
FT                   /translation="MDLHQSPTARLLQKWCSHESPFGCRRHYNSRKKLKLIRVIGLVMG
FT                   LVAVSTVPFSISAFTETDSQSNRGEASDMSGPRVAQGHRQRTLLDLNDKIRDYTPQPPA
FT                   SQEDQAENSTEHTQGDYPKDIFSLEERRKGAIILHVIGMIYMFIALAIVCDEFFVPSLT
FT                   VITEKLGISDDVAGATFMAAGGSAPELFTSLIGVFIAHSNVGIGTIVGSAVFNILFVIG
FT                   MCALFSREILNLTWWPLFRDVSFYIVDLLMLITFFLDNVIMWWESLLLLTAYFAYVVFM
FT                   KFNVQVERWVKQMISRNNVIKVTVPEAQAKLSEFPPASQADGRTACPTITNDPDCQSLC
FT                   FEVYPETARHGSCITNVNGEPLKEKTQNSCMEESPTAGDKDGPTLPSKPRLQRGGSSAS
FT                   LHNSLMRNSIFQLMIHTLDPLAEELGSYGKLKYYDTMTEEGRFREKASILHKIAKKKCQ
FT                   VDENERQNGAANHVEKIELPNSTSTEVEMTPSSEASEPVQNGNLSHNIEAADAPKATET
FT                   AEEEDDQPLSLSWPTNTRKQATFLIVFPIVFPLWITLPDVRKPASRKFFPITFFGSITW
FT                   IAVFSYLMVWWAHQVGETIGISEEIMGLTILAAGTSIPDLITSVIVARKGLGDMAVSSS
FT                   VGSNIFDITVGLPLPWLLYTIIHRFSPVTVSSNGLFCAIVLLFIMLLFVILSIALCKWR
FT                   MNKILGFIMFGLYFVFLVVSVLLEDKVLVCPVSI"
FT   assembly_gap    25004340..25004870
FT                   /estimated_length=531
FT                   /gap_type="unknown"
FT   assembly_gap    25005490..25005560
FT                   /estimated_length=71
FT                   /gap_type="unknown"
FT   assembly_gap    25015966..25015985
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    25044960..25044979
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    25053809..25053828
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <25082732..25118670
FT                   /locus_tag="mCG_1043335"
FT                   /note="gene_id=mCG1043335.1"
FT   mRNA            join(<25082732..25082764,25116969..25117580,
FT                   25118200..25118670)
FT                   /locus_tag="mCG_1043335"
FT                   /product="mCG1043335"
FT                   /note="gene_id=mCG1043335.1 transcript_id=mCT161039.1
FT                   created on 10-DEC-2002"
FT   CDS             join(<25082733..25082764,25116969..25117347)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1043335"
FT                   /product="mCG1043335"
FT                   /note="gene_id=mCG1043335.1 transcript_id=mCT161039.1
FT                   protein_id=mCP76376.1"
FT                   /protein_id="EDL30986.1"
FT                   /translation="THTHTHTHTHTKKDYDLSQLQQPDTVEPDAIKPVGIRRLDERPIH
FT                   AEPQYPVRSAAPHPGDIGDFINEGLKAADNDPTAPPYDSLLVFDYEGSGSTAGSLSSLN
FT                   SSSSGGDQDYDYLNDWGPRFKKLADMYGGGDD"
FT   assembly_gap    25106817..25106836
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    25110210..25110229
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    25111474..25111493
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    25114177..25114196
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    25115468..25116477
FT                   /estimated_length=1010
FT                   /gap_type="unknown"
FT   assembly_gap    25117581..25118199
FT                   /estimated_length=619
FT                   /gap_type="unknown"
FT   assembly_gap    25130373..25130392
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    25188135..25188297
FT                   /estimated_length=163
FT                   /gap_type="unknown"
FT   assembly_gap    25205895..25206275
FT                   /estimated_length=381
FT                   /gap_type="unknown"
FT   assembly_gap    25228907..25228989
FT                   /estimated_length=83
FT                   /gap_type="unknown"
FT   assembly_gap    25230850..25230869
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    25267153..25267407
FT                   /estimated_length=255
FT                   /gap_type="unknown"
FT   assembly_gap    25274021..25274558
FT                   /estimated_length=538
FT                   /gap_type="unknown"
FT   assembly_gap    25321634..25323956
FT                   /estimated_length=2323
FT                   /gap_type="unknown"
FT   assembly_gap    25329046..25332817
FT                   /estimated_length=3772
FT                   /gap_type="unknown"
FT   assembly_gap    25352139..25352158
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    25353167..25353186
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    25374982..25375001
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    25379719..25379803
FT                   /estimated_length=85
FT                   /gap_type="unknown"
FT   assembly_gap    25380930..25381126
FT                   /estimated_length=197
FT                   /gap_type="unknown"
FT   assembly_gap    25418202..25418221
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    25430759..25430916
FT                   /estimated_length=158
FT                   /gap_type="unknown"
FT   assembly_gap    25495512..25496155
FT                   /estimated_length=644
FT                   /gap_type="unknown"
FT   assembly_gap    25503937..25504080
FT                   /estimated_length=144
FT                   /gap_type="unknown"
FT   assembly_gap    25520979..25521035
FT                   /estimated_length=57
FT                   /gap_type="unknown"
FT   assembly_gap    25524118..25524679
FT                   /estimated_length=562
FT                   /gap_type="unknown"
FT   assembly_gap    25538930..25538998
FT                   /estimated_length=69
FT                   /gap_type="unknown"
FT   assembly_gap    25577524..25577764
FT                   /estimated_length=241
FT                   /gap_type="unknown"
FT   assembly_gap    25579546..25579583
FT                   /estimated_length=38
FT                   /gap_type="unknown"
FT   assembly_gap    25629778..25630325
FT                   /estimated_length=548
FT                   /gap_type="unknown"
FT   assembly_gap    25633327..25633346
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    25663643..25663662
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    25666883..25666902
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    25683712..25683731
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    25689081..25692289
FT                   /estimated_length=3209
FT                   /gap_type="unknown"
FT   assembly_gap    25715390..25715548
FT                   /estimated_length=159
FT                   /gap_type="unknown"
FT   assembly_gap    25765071..25765182
FT                   /estimated_length=112
FT                   /gap_type="unknown"
FT   assembly_gap    25770927..25770983
FT                   /estimated_length=57
FT                   /gap_type="unknown"
FT   gene            complement(25786821..>26047647)
FT                   /gene="Mllt3"
FT                   /locus_tag="mCG_6568"
FT                   /note="gene_id=mCG6568.3"
FT   mRNA            complement(join(25786821..25788688,25796826..25796897,
FT                   25798188..25798259,25803826..25803925,25806392..25806521,
FT                   25808475..25808550,25854880..25855587,25887903..25888046,
FT                   25894165..25894247,26045943..26046123,26047460..26047487))
FT                   /gene="Mllt3"
FT                   /locus_tag="mCG_6568"
FT                   /product="myeloid/lymphoid or mixed lineage-leukemia
FT                   translocation to 3 homolog (Drosophila), transcript variant
FT                   mCT6119"
FT                   /note="gene_id=mCG6568.3 transcript_id=mCT6119.2 created on
FT                   28-OCT-2002"
FT   mRNA            complement(join(25787210..25788688,25796826..25796897,
FT                   25798188..25798259,25803826..25803925,25806392..25806521,
FT                   25808475..25808550,25854880..25855504,25855539..25855587,
FT                   25887903..25888046,25894165..25894247,26045943..26046123,
FT                   26047460..>26047647))
FT                   /gene="Mllt3"
FT                   /locus_tag="mCG_6568"
FT                   /product="myeloid/lymphoid or mixed lineage-leukemia
FT                   translocation to 3 homolog (Drosophila), transcript variant
FT                   mCT192879"
FT                   /note="gene_id=mCG6568.3 transcript_id=mCT192879.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(25788557..25788688,25796826..25796897,
FT                   25798188..25798259,25803826..25803925,25806392..25806521,
FT                   25808475..25808550,25854880..25855587,25887903..25888046,
FT                   25894165..25894247,26045943..26046123,26047460..26047471))
FT                   /codon_start=1
FT                   /gene="Mllt3"
FT                   /locus_tag="mCG_6568"
FT                   /product="myeloid/lymphoid or mixed lineage-leukemia
FT                   translocation to 3 homolog (Drosophila), isoform CRA_b"
FT                   /note="gene_id=mCG6568.3 transcript_id=mCT6119.2
FT                   protein_id=mCP2540.2 isoform=CRA_b"
FT                   /protein_id="EDL30984.1"
FT                   /translation="MASSCAVQVKLELGHRAQVRKKPTVEGFTHDWMVFVRGPEHSNIQ
FT                   HFVEKVVFHLHESFPRPKRVCKDPPYKVEESGYAGFILPIEVYFKNKEEPKKVRFDYDL
FT                   FLHLEGHPPVNHLRCEKLTFNNPTEDFRRKLLKAGGDPNRSIHTSSSSSSSSSSSSSSS
FT                   SSSSSSSSSSSSSSSSSSSSSSSSSSSTSFSKPHKLMKEHKEKPSKDSREHKSAFKEPS
FT                   RDHNKSSKDSSKKPKENKPLKEEKIVPKMAFKEPKPMSKEPKADSNLLTVTSGQQDKKA
FT                   PSKRPPASDSEELSAKKRKKSSSEALFKSFSSAPPLILTCSADKKQIKDKSHVKMGKVK
FT                   IESETSEKKKSMLPPFDDIVDPNDSDVEENMSSKSDSEQPSPASSSSSSSSSFTPSQTR
FT                   QQGPLRSIMKDLHSDDNEEESDEAEDNDNDSEMERPVNRGGSRSRRVSLSDGSDSESSS
FT                   ASSPLHHEPPPPLLKTNNNQILEVKSPIKQSKSDKQIKNGECDKAYLDELVELHRRLMT
FT                   LRERHILQQIVNLIEETGHFHITNTTFDFDLCSLDKTTVRKLQSYLETSGTS"
FT   CDS             complement(join(25788557..25788688,25796826..25796897,
FT                   25798188..25798259,25803826..25803925,25806392..25806521,
FT                   25808475..25808550,25854880..25855504,25855539..>25855555))
FT                   /codon_start=1
FT                   /gene="Mllt3"
FT                   /locus_tag="mCG_6568"
FT                   /product="myeloid/lymphoid or mixed lineage-leukemia
FT                   translocation to 3 homolog (Drosophila), isoform CRA_a"
FT                   /note="gene_id=mCG6568.3 transcript_id=mCT192879.0
FT                   protein_id=mCP113842.0 isoform=CRA_a"
FT                   /protein_id="EDL30983.1"
FT                   /translation="QQQQQHSSSSSSSSSSSSSSSSSSSSSSTSFSKPHKLMKEHKEKP
FT                   SKDSREHKSAFKEPSRDHNKSSKDSSKKPKENKPLKEEKIVPKMAFKEPKPMSKEPKAD
FT                   SNLLTVTSGQQDKKAPSKRPPASDSEELSAKKRKKSSSEALFKSFSSAPPLILTCSADK
FT                   KQIKDKSHVKMGKVKIESETSEKKKSMLPPFDDIVDPNDSDVEENMSSKSDSEQPSPAS
FT                   SSSSSSSSFTPSQTRQQGPLRSIMKDLHSDDNEEESDEAEDNDNDSEMERPVNRGGSRS
FT                   RRVSLSDGSDSESSSASSPLHHEPPPPLLKTNNNQILEVKSPIKQSKSDKQIKNGECDK
FT                   AYLDELVELHRRLMTLRERHILQQIVNLIEETGHFHITNTTFDFDLCSLDKTTVRKLQS
FT                   YLETSGTS"
FT   assembly_gap    25831337..25831384
FT                   /estimated_length=48
FT                   /gap_type="unknown"
FT   assembly_gap    25841757..25841776
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    25842779..25842798
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    25864067..25864086
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    25869515..25869548
FT                   /estimated_length=34
FT                   /gap_type="unknown"
FT   assembly_gap    25877601..25877620
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    25890044..25890217
FT                   /estimated_length=174
FT                   /gap_type="unknown"
FT   assembly_gap    25914808..25915063
FT                   /estimated_length=256
FT                   /gap_type="unknown"
FT   assembly_gap    25934287..25934306
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    25940835..25940891
FT                   /estimated_length=57
FT                   /gap_type="unknown"
FT   assembly_gap    25951349..25951368
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    25982002..25982212
FT                   /estimated_length=211
FT                   /gap_type="unknown"
FT   assembly_gap    25988014..25988033
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26000028..26000129
FT                   /estimated_length=102
FT                   /gap_type="unknown"
FT   assembly_gap    26005991..26006010
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26008332..26008392
FT                   /estimated_length=61
FT                   /gap_type="unknown"
FT   assembly_gap    26047288..26047343
FT                   /estimated_length=56
FT                   /gap_type="unknown"
FT   assembly_gap    26060638..26060670
FT                   /estimated_length=33
FT                   /gap_type="unknown"
FT   assembly_gap    26073943..26074068
FT                   /estimated_length=126
FT                   /gap_type="unknown"
FT   assembly_gap    26102131..26102323
FT                   /estimated_length=193
FT                   /gap_type="unknown"
FT   gene            26109475..26416602
FT                   /locus_tag="mCG_6580"
FT                   /note="gene_id=mCG6580.3"
FT   mRNA            join(26109475..26109528,26136124..26136212,
FT                   26139154..26139228,26142606..26142760,26168307..26168411,
FT                   26183554..26183655,26188256..26188460,26191725..26191931,
FT                   26196235..26196322,26199531..26199733,26210407..26210664,
FT                   26242973..26243077,26243483..26243584,26244102..26244232,
FT                   26246306..26246432,26287646..26287780,26291757..26291807,
FT                   26292769..26292852,26310293..26310410,26316759..26316944,
FT                   26323108..26323229,26339553..26339645,26344379..26344467,
FT                   26349577..26349621,26352594..26352702,26355612..26355728,
FT                   26357988..26358226,26362213..26362302,26368739..26368886,
FT                   26370815..26370934,26372618..26372740,26373198..26373275,
FT                   26379796..26379867,26381369..26381471,26383451..26383531,
FT                   26397576..26397704,26399150..26399265,26402593..26402853,
FT                   26403460..26403549,26406635..26406812,26408929..26409026,
FT                   26412706..26412957,26414514..26414589,26416210..26416602)
FT                   /locus_tag="mCG_6580"
FT                   /product="mCG6580, transcript variant mCT6105"
FT                   /note="gene_id=mCG6580.3 transcript_id=mCT6105.3 created on
FT                   03-JUL-2003"
FT   mRNA            join(26109475..26109528,26136124..26136666)
FT                   /locus_tag="mCG_6580"
FT                   /product="mCG6580, transcript variant mCT186500"
FT                   /note="gene_id=mCG6580.3 transcript_id=mCT186500.0 created
FT                   on 03-JUL-2003"
FT   assembly_gap    26116401..26116420
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26118934..26118953
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26120005..26120415
FT                   /estimated_length=411
FT                   /gap_type="unknown"
FT   assembly_gap    26127348..26127367
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(26136156..26136212,26139154..26139228,
FT                   26142606..26142760,26168307..26168411,26183554..26183655,
FT                   26188256..26188460,26191725..26191931,26196235..26196322,
FT                   26199531..26199733,26210407..26210664,26242973..26243077,
FT                   26243483..26243584,26244102..26244232,26246306..26246432,
FT                   26287646..26287780,26291757..26291807,26292769..26292852,
FT                   26310293..26310410,26316759..26316944,26323108..26323229,
FT                   26339553..26339645,26344379..26344467,26349577..26349621,
FT                   26352594..26352702,26355612..26355728,26357988..26358226,
FT                   26362213..26362302,26368739..26368886,26370815..26370934,
FT                   26372618..26372740,26373198..26373275,26379796..26379867,
FT                   26381369..26381471,26383451..26383531,26397576..26397704,
FT                   26399150..26399265,26402593..26402853,26403460..26403549,
FT                   26406635..26406812,26408929..26409026,26412706..26412957,
FT                   26414514..26414589,26416210..26416283)
FT                   /codon_start=1
FT                   /locus_tag="mCG_6580"
FT                   /product="mCG6580, isoform CRA_c"
FT                   /note="gene_id=mCG6580.3 transcript_id=mCT6105.3
FT                   protein_id=mCP2566.2 isoform=CRA_c"
FT                   /protein_id="EDL30981.1"
FT                   /translation="MSDDIKKRFDFPNSLIQSQAVGHLIAAVLKEHGVSEKIHQSTNQT
FT                   AALNLLWEKCCSDHVVVRTACSEGLVALVAQGHAEFSYVLNGILNLTPSARNMSGLIKA
FT                   LMKLLQMQALREGQSGEKDIQDIYSIRNPPQPLITVLEHRPDCWPLLLQQLTAFFQQCP
FT                   ERSEASCVQIMAPFLWYLYCEPSQLEEYAKLRLSLLKVLLQPRGVCEEAQLSVREQSTL
FT                   QLCCSMLPCLQMKDLMQTTEMMLFVEEVYLSLLRHPGFWKSQLTQLTLQLLCICEVSLK
FT                   ITGECSSLIHLLERSVELLGEDFPVELVIIGIALLLLQMPASQQKPLLNLALKLLSLTE
FT                   GQKIPKASLLLLVPLLQILSSTALEDCLAMGEEGPSRQQLALSLVEVLQKERHGDDSHT
FT                   ISCRLAFPVSSMYGSIFTAWRILDVIGEESATSDWLATVESLLSATTVIPPHVFLLLAY
FT                   LLVEDVGQNLQQILRVTTQLAQADSSQVPNLIPVLMFKLGRPLDPVSYNHILYTLPTLG
FT                   VHKVCVGQILRVIQLLGTTPRLRAVTLRLLTSLWEKQDRVYPELQRFMAVSDAPSLSVG
FT                   KELQWEKLIAKAASIRDICKQRPYQHGADMLAAISQVLNECTKPDQATPAALVLQGLHA
FT                   LCQAEVVCIRSTWNALSPKLSCDMRPLILKTLSELFSLVPSLTVNTVEYENFKVQVLSF
FT                   LWTHTQNKNPTVASAAYKSLSHFSAGEHTILHLPEKIRPEMPVPGELDEEESVDLSIPG
FT                   ACFLRLLTITAPSVLPALEEFFTSLVRQEMVNMPRGIYHSALKGGVRSDQGKTVAGIPN
FT                   FILKTYETNKQPGLKPGLAGGMLFCYDLAMYQSKDGKPLNRLMASRGRSFKQTTLALIH
FT                   EVHVQLSEWHRAIFLPQAWLAYMTRAYHAILQGRIAELELQLQHGKEGPEEVQYKRSTA
FT                   WLWVRDMLTDEITKTAAKESPVVKANALLALSSLAVVVSKHEASLCSDSDGVLEIQPNF
FT                   LPVKEWVSMVLNTLLVIVDSHYHPSGQLFTCFYHKSYSGENTASAIARSAAATALSLLV
FT                   PVFIISCKEKVEEILNMLTARLPGKPSADESQAVQIHMGLALGMFLSRLCEEKLSDMSG
FT                   QQMNLLLMKSLDALESCCFDPSLEYNTGCILGVGLALSLMSHSSHTESRVHVAASLRKL
FT                   STYLDESGSQSRTFQEVLVYTLSCVCTSAFSAGIIEAAEAEDIMSKLQLLVENNQQTSG
FT                   FALALGNLVYGLSVCGHGKAEDLGNRLRPSWIKVVLTEGAPTMLCLAALHGLVALVGSD
FT                   VDVMQLKSEAIQNTHFQARLNEVIRTLTEVISVSGVIGLQSNAIWLLGHLHLSTLSSNQ
FT                   SRTSVPTDYSYLPEGSFIRAAIGFFITGGKKGPEAVPPSLLKVVMKPIATVGESYQYPP
FT                   ANLAALLSPLMRLNFGEEIQQLCLEIAVTQAPSSQSAASLLGLWVMPPLIHGLSLNIKK
FT                   YLLVSMPLWAKHVSDEQIQGFVENLMVEVFKTASQPCHPEMCLSALQGLSQAMKLPSPS
FT                   HHLWSLLCDATGRIFDLLPNRIRRNDLELYISIAKCLSEMTDEGVNQVSQITKDNIEKA
FT                   AFVKLYLVSQGRLPLMSLTDLLTAAMQHPEKETLAWMILHSLYQARIVNHANTGVLKRL
FT                   EWLLELMGYVRNIAYQSAPIQNVAPEEALDFLMLIFAAAVVAWADHEAPLLLGLSASWL
FT                   PWHQQNGPGGPAAALLGRSPMHRVTVQEVLTQLPRSMLLLLQKEPWKEQTQKFIDWLLS
FT                   IMEIPNKAFAAKSKDLLKATLLSLRVLPEFKKKAVWTRAYGW"
FT   CDS             26136156..26136260
FT                   /codon_start=1
FT                   /locus_tag="mCG_6580"
FT                   /product="mCG6580, isoform CRA_b"
FT                   /note="gene_id=mCG6580.3 transcript_id=mCT186500.0
FT                   protein_id=mCP107203.0 isoform=CRA_b"
FT                   /protein_id="EDL30980.1"
FT                   /translation="MSDDIKKRFDFPNSLIQSQVIFIYFSFMVTKAHF"
FT   assembly_gap    26138217..26138267
FT                   /estimated_length=51
FT                   /gap_type="unknown"
FT   assembly_gap    26141303..26141322
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26152672..26152691
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26157446..26157600
FT                   /estimated_length=155
FT                   /gap_type="unknown"
FT   assembly_gap    26179336..26179355
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26206321..26206447
FT                   /estimated_length=127
FT                   /gap_type="unknown"
FT   assembly_gap    26250297..26250316
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26274270..26274289
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26284849..26284868
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26287232..26287251
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26294773..26299237
FT                   /estimated_length=4465
FT                   /gap_type="unknown"
FT   assembly_gap    26313295..26313314
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26328543..26328562
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26334207..26334226
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            join(26358776..26362302,26368624..26368886,
FT                   26370815..26370934,26372618..26372740,26373198..26373275,
FT                   26379796..26379867,26381369..26381471,26383451..26383531,
FT                   26397576..26397704,26399150..26399265,26402593..26402853,
FT                   26403460..26403549,26406635..26406812,26408929..26409026,
FT                   26412706..26412957,26414514..26414589,26416210..26416602)
FT                   /locus_tag="mCG_6580"
FT                   /product="mCG6580, transcript variant mCT125401"
FT                   /note="gene_id=mCG6580.3 transcript_id=mCT125401.2 created
FT                   on 03-JUL-2003"
FT   assembly_gap    26365236..26365255
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26368275..26368623
FT                   /estimated_length=349
FT                   /gap_type="unknown"
FT   CDS             join(26368779..26368886,26370815..26370934,
FT                   26372618..26372740,26373198..26373275,26379796..26379867,
FT                   26381369..26381471,26383451..26383531,26397576..26397704,
FT                   26399150..26399265,26402593..26402853,26403460..26403549,
FT                   26406635..26406812,26408929..26409026,26412706..26412957,
FT                   26414514..26414589,26416210..26416283)
FT                   /codon_start=1
FT                   /locus_tag="mCG_6580"
FT                   /product="mCG6580, isoform CRA_d"
FT                   /note="gene_id=mCG6580.3 transcript_id=mCT125401.2
FT                   protein_id=mCP76165.2 isoform=CRA_d"
FT                   /protein_id="EDL30982.1"
FT                   /translation="MSHSSHTESRVHVAASLRKLSTYLDESGSQSRTFQEVLVYTLSCV
FT                   CTSAFSAGIIEAAEAEDIMSKLQLLVENNQQTSGFALALGNLVYGLSVCGHGKAEDLGN
FT                   RLRPSWIKVVLTEGAPTMLCLAALHGLVALVGSDVDVMQLKSEAIQNTHFQARLNEVIR
FT                   TLTEVISVSGVIGLQSNAIWLLGHLHLSTLSSNQSRTSVPTDYSYLPEGSFIRAAIGFF
FT                   ITGGKKGPEAVPPSLLKVVMKPIATVGESYQYPPANLAALLSPLMRLNFGEEIQQLCLE
FT                   IAVTQAPSSQSAASLLGLWVMPPLIHGLSLNIKKYLLVSMPLWAKHVSDEQIQGFVENL
FT                   MVEVFKTASQPCHPEMCLSALQGLSQAMKLPSPSHHLWSLLCDATGRIFDLLPNRIRRN
FT                   DLELYISIAKCLSEMTDEGVNQVSQITKDNIEKAAFVKLYLVSQGRLPLMSLTDLLTAA
FT                   MQHPEKETLAWMILHSLYQARIVNHANTGVLKRLEWLLELMGYVRNIAYQSAPIQNVAP
FT                   EEALDFLMLIFAAAVVAWADHEAPLLLGLSASWLPWHQQNGPGGPAAALLGRSPMHRVT
FT                   VQEVLTQLPRSMLLLLQKEPWKEQTQKFIDWLLSIMEIPNKAFAAKSKDLLKATLLSLR
FT                   VLPEFKKKAVWTRAYGW"
FT   assembly_gap    26373864..26379583
FT                   /estimated_length=5720
FT                   /gap_type="unknown"
FT   assembly_gap    26389713..26389842
FT                   /estimated_length=130
FT                   /gap_type="unknown"
FT   assembly_gap    26392938..26392957
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            join(26406183..26406360,26406635..26406812,
FT                   26408929..26409026,26412706..26412957,26414514..26414589,
FT                   26416210..26416602)
FT                   /locus_tag="mCG_6580"
FT                   /product="mCG6580, transcript variant mCT186499"
FT                   /note="gene_id=mCG6580.3 transcript_id=mCT186499.0 created
FT                   on 03-JUL-2003"
FT   CDS             join(26406698..26406812,26408929..26409026,
FT                   26412706..26412957,26414514..26414589,26416210..26416283)
FT                   /codon_start=1
FT                   /locus_tag="mCG_6580"
FT                   /product="mCG6580, isoform CRA_a"
FT                   /note="gene_id=mCG6580.3 transcript_id=mCT186499.0
FT                   protein_id=mCP107204.0 isoform=CRA_a"
FT                   /protein_id="EDL30979.1"
FT                   /translation="MSLTDLLTAAMQHPEKETLAWMILHSLYQARIVNHANTGVLKRLE
FT                   WLLELMGYVRNIAYQSAPIQNVAPEEALDFLMLIFAAAVVAWADHEAPLLLGLSASWLP
FT                   WHQQNGPGGPAAALLGRSPMHRVTVQEVLTQLPRSMLLLLQKEPWKEQTQKFIDWLLSI
FT                   MEIPNKAFAAKSKDLLKATLLSLRVLPEFKKKAVWTRAYGW"
FT   assembly_gap    26411542..26411561
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(26419553..26444517)
FT                   /gene="Ptplad2"
FT                   /locus_tag="mCG_6567"
FT                   /note="gene_id=mCG6567.1"
FT   mRNA            complement(join(26419553..26419939,26425306..26425431,
FT                   26428598..26428704,26432343..26432455,26440546..26440673,
FT                   26443067..26443170,26444440..26444517))
FT                   /gene="Ptplad2"
FT                   /locus_tag="mCG_6567"
FT                   /product="protein tyrosine phosphatase-like A domain
FT                   containing 2"
FT                   /note="gene_id=mCG6567.1 transcript_id=mCT6125.0 created on
FT                   04-OCT-2002"
FT   CDS             complement(join(26419857..26419939,26425306..26425431,
FT                   26428598..26428704,26432343..26432455,26440546..26440673,
FT                   26443067..26443170,26444440..26444477))
FT                   /codon_start=1
FT                   /gene="Ptplad2"
FT                   /locus_tag="mCG_6567"
FT                   /product="protein tyrosine phosphatase-like A domain
FT                   containing 2"
FT                   /note="gene_id=mCG6567.1 transcript_id=mCT6125.0
FT                   protein_id=mCP2555.1"
FT                   /protein_id="EDL30978.1"
FT                   /translation="MGPSVLPAWLQPRYRKNVYLFIYYLIQFCGHSWILANMTVRFFSF
FT                   GKDSMADTFYAIGLVMRVCQSISLLELLHIYIGIESNQLFPRFLQLTERVIILFGVITS
FT                   QEEVQEKCVVCVLFILWNLLDMVRYTYSMLSVIGTSYAALTWLSQTLWMPIYPLCVLAE
FT                   AFTIYQSLPYFESFGTNSTVLPFDLSTCFPYVLKLYLMMLFIGMYFTYSHLYTERKDFL
FT                   RVFSVKQKNV"
FT   assembly_gap    26466484..26466503
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26486701..26487057
FT                   /estimated_length=357
FT                   /gap_type="unknown"
FT   assembly_gap    26488902..26490592
FT                   /estimated_length=1691
FT                   /gap_type="unknown"
FT   assembly_gap    26516851..26516922
FT                   /estimated_length=72
FT                   /gap_type="unknown"
FT   gene            complement(26527613..26528382)
FT                   /gene="Ifnb1"
FT                   /locus_tag="mCG_6581"
FT                   /note="gene_id=mCG6581.0"
FT   mRNA            complement(26527613..26528382)
FT                   /gene="Ifnb1"
FT                   /locus_tag="mCG_6581"
FT                   /product="interferon beta 1, fibroblast"
FT                   /note="gene_id=mCG6581.0 transcript_id=mCT6106.0 created on
FT                   04-OCT-2002"
FT   CDS             complement(26527814..26528362)
FT                   /codon_start=1
FT                   /gene="Ifnb1"
FT                   /locus_tag="mCG_6581"
FT                   /product="interferon beta 1, fibroblast"
FT                   /note="gene_id=mCG6581.0 transcript_id=mCT6106.0
FT                   protein_id=mCP2554.1"
FT                   /db_xref="GOA:Q0VE17"
FT                   /db_xref="InterPro:IPR000471"
FT                   /db_xref="InterPro:IPR009079"
FT                   /db_xref="InterPro:IPR012351"
FT                   /db_xref="InterPro:IPR015588"
FT                   /db_xref="MGI:MGI:107657"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VE17"
FT                   /protein_id="EDL30977.1"
FT                   /translation="MNNRWILHAAFLLCFSTTALSINYKQLQLQERTNIRKCQELLEQL
FT                   NGKINLTYRADFKIPMEMTEKMQKSYTAFAIQEMLQNVFLVFRNNFSSTGWNETIVVRL
FT                   LDELHQQTVFLKTVLEEKQEERLTWEMSSTALHLKSYYWRVQRYLKLMKYNSYAWMVVR
FT                   AEIFRNFLIIRRLTRNFQN"
FT   gene            complement(<26563264..>26563836)
FT                   /locus_tag="mCG_6571"
FT                   /note="gene_id=mCG6571.1"
FT   mRNA            complement(<26563264..>26563836)
FT                   /locus_tag="mCG_6571"
FT                   /product="mCG6571"
FT                   /note="gene_id=mCG6571.1 transcript_id=mCT6123.1 created on
FT                   10-DEC-2002"
FT   CDS             complement(26563264..26563836)
FT                   /codon_start=1
FT                   /locus_tag="mCG_6571"
FT                   /product="mCG6571"
FT                   /note="gene_id=mCG6571.1 transcript_id=mCT6123.1
FT                   protein_id=mCP2552.1"
FT                   /db_xref="GOA:Q61718"
FT                   /db_xref="InterPro:IPR000471"
FT                   /db_xref="InterPro:IPR009079"
FT                   /db_xref="InterPro:IPR012351"
FT                   /db_xref="MGI:MGI:3649418"
FT                   /db_xref="UniProtKB/TrEMBL:Q61718"
FT                   /protein_id="EDL30976.1"
FT                   /translation="MARLCAFLMTLLVMSYWSTCSLGCDLPQTHNLRNKRALTLLVQMR
FT                   RLSPLSCLKDRKDFRFPQEKVDAQQIQNAQAIPVLQELTQQVLNIFTSKDSSAAWDASL
FT                   LDSFCNDLHQQLNDLKACVMQEVGVQEPPLTQEDYLLAVRTYFHRITVYLREKKHSPCA
FT                   WEVVRAEVWRAMSSSAKLLARLSEEKE"
FT   gene            complement(<26576821..>26577390)
FT                   /locus_tag="mCG_146423"
FT                   /note="gene_id=mCG146423.0"
FT   mRNA            complement(<26576821..>26577390)
FT                   /locus_tag="mCG_146423"
FT                   /product="mCG146423"
FT                   /note="gene_id=mCG146423.0 transcript_id=mCT186660.0
FT                   created on 07-AUG-2003"
FT   CDS             complement(26576821..26577390)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146423"
FT                   /product="mCG146423"
FT                   /note="gene_id=mCG146423.0 transcript_id=mCT186660.0
FT                   protein_id=mCP107895.0"
FT                   /db_xref="GOA:Q810G3"
FT                   /db_xref="InterPro:IPR000471"
FT                   /db_xref="InterPro:IPR009079"
FT                   /db_xref="InterPro:IPR012351"
FT                   /db_xref="MGI:MGI:3641425"
FT                   /db_xref="UniProtKB/TrEMBL:Q810G3"
FT                   /protein_id="EDL30975.1"
FT                   /translation="MARLCAFLMTLLVMSYWSTCCLGCDLPQTHNLRNKRALTLLVKMR
FT                   RLSPLSCLKDRKDFGFPQEKVDAQQIKKAQAIPVLSELTQQILTLFTSKDSSAAWDATL
FT                   LDSFCNDLNTQLNDLQGCLMQQVEIQAPPLTQEDSLLAVRKYFHRITVYLREKKHSPCA
FT                   WEVVRAEIWRALSSSAKLLTSLKEEK"
FT   assembly_gap    26583862..26583881
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(26584407..26586040)
FT                   /pseudo
FT                   /locus_tag="mCG_146424"
FT                   /note="gene_id=mCG146424.0"
FT   mRNA            complement(join(26584407..26584537,26585664..26586040))
FT                   /pseudo
FT                   /locus_tag="mCG_146424"
FT                   /note="gene_id=mCG146424.0 transcript_id=mCT186661.0
FT                   created on 07-AUG-2003"
FT   assembly_gap    26592677..26592902
FT                   /estimated_length=226
FT                   /gap_type="unknown"
FT   gene            complement(<26597219..>26597791)
FT                   /locus_tag="mCG_6569"
FT                   /note="gene_id=mCG6569.0"
FT   mRNA            complement(<26597219..>26597791)
FT                   /locus_tag="mCG_6569"
FT                   /product="mCG6569"
FT                   /note="gene_id=mCG6569.0 transcript_id=mCT6121.0 created on
FT                   23-SEP-2002"
FT   CDS             complement(26597219..26597791)
FT                   /codon_start=1
FT                   /locus_tag="mCG_6569"
FT                   /product="mCG6569"
FT                   /note="gene_id=mCG6569.0 transcript_id=mCT6121.0
FT                   protein_id=mCP2545.0"
FT                   /protein_id="EDL30974.1"
FT                   /translation="MARPFAFLMVLVVISYWSTCSLGCDLPQTHNLRNKKILTLLAQMR
FT                   RLSPLSCLKDRKDFGFPQEKVDAQQIQEAQAIPVLSELTQQILTLFTSKDSSAAWNATL
FT                   LDSFCTGLHQLLNDLQGCLMQLVGMKELPLTQEDSQLAMKKYFHRITVYLREKKHSPCA
FT                   WEVVRAEVWRALSSSVNLLARLSEEKE"
FT   gene            complement(26598607..>26605228)
FT                   /locus_tag="mCG_1043334"
FT                   /note="gene_id=mCG1043334.1"
FT   mRNA            complement(join(26598607..26598656,26604340..>26605228))
FT                   /locus_tag="mCG_1043334"
FT                   /product="mCG1043334"
FT                   /note="gene_id=mCG1043334.1 transcript_id=mCT161038.1
FT                   created on 10-DEC-2002"
FT   assembly_gap    26603118..26603181
FT                   /estimated_length=64
FT                   /gap_type="unknown"
FT   CDS             complement(26604530..26605228)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1043334"
FT                   /product="mCG1043334"
FT                   /note="gene_id=mCG1043334.1 transcript_id=mCT161038.1
FT                   protein_id=mCP76374.0"
FT                   /protein_id="EDL30973.1"
FT                   /translation="MPGVVIARVDLRFAQKPLWSRMSGTLGKVLGVWTNTVSKQGFSLL
FT                   RFRSLGENPIFSAGGILWTSRHYKTKPTHGIGRYRHLVKVQEPKKKKAKVELRAINVGT
FT                   DYEYGVLNIHLTAYDMSLAESYAQYVHRLCNRLSIKVEESYAMPTKTIEVMQLPDQGNK
FT                   MVLDSVLSTHERVVQISGLSATFAEIFLEVLQSNLPEGVRLSVREHTEEDFKGRFKARP
FT                   ELEELLAKLN"
FT   gene            complement(26607937..26608733)
FT                   /locus_tag="mCG_6578"
FT                   /note="gene_id=mCG6578.3"
FT   mRNA            complement(26607937..26608733)
FT                   /locus_tag="mCG_6578"
FT                   /product="mCG6578"
FT                   /note="gene_id=mCG6578.3 transcript_id=mCT6103.3 created on
FT                   07-AUG-2003"
FT   CDS             complement(26608096..26608665)
FT                   /codon_start=1
FT                   /locus_tag="mCG_6578"
FT                   /product="mCG6578"
FT                   /note="gene_id=mCG6578.3 transcript_id=mCT6103.3
FT                   protein_id=mCP2543.2"
FT                   /protein_id="EDL30972.1"
FT                   /translation="MARLCAFLMTLLVMSYWSTCSLGCDLPQTHNLRNKRALTLLAQMR
FT                   RLSPLSCLKDRKNFRFPQEKVDAQQIKKAQVIPVLSELTQQILTLFTSKDSSAAWNTTL
FT                   LDSFCNDLHQQLNDLQGCLMQQVGVQEPPLTQEDSLLAVRKYFHRITVYLREKKHSPCA
FT                   WEVVRAEVWRTLSSSAKLLARLSEKE"
FT   assembly_gap    26620628..26620647
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(26632723..26639586)
FT                   /gene="C87499"
FT                   /locus_tag="mCG_146280"
FT                   /note="gene_id=mCG146280.0"
FT   mRNA            complement(join(26632723..26633594,26634185..26634760,
FT                   26635234..26635544,26639517..26639586))
FT                   /gene="C87499"
FT                   /locus_tag="mCG_146280"
FT                   /product="expressed sequence C87499"
FT                   /note="gene_id=mCG146280.0 transcript_id=mCT186383.0
FT                   created on 07-AUG-2003"
FT   CDS             complement(join(26633027..26633594,26634185..26634760,
FT                   26635234..26635544,26639517..26639543))
FT                   /codon_start=1
FT                   /gene="C87499"
FT                   /locus_tag="mCG_146280"
FT                   /product="expressed sequence C87499"
FT                   /note="gene_id=mCG146280.0 transcript_id=mCT186383.0
FT                   protein_id=mCP107597.1"
FT                   /db_xref="GOA:Q3UX49"
FT                   /db_xref="InterPro:IPR026271"
FT                   /db_xref="InterPro:IPR026292"
FT                   /db_xref="MGI:MGI:2140706"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UX49"
FT                   /protein_id="EDL30971.1"
FT                   /translation="MICHQCPDQHDSLEEETMNAYSPPTLLQLARQKLLREEALAISAL
FT                   KDLPRELLPEMFEEAFTDECTKTLRAMIPMWPFPCLPVGTLIKNPNLETLKAVLEGLDI
FT                   LLAPKVRSSRCKLRVLNLRNEHHEFWRIWAGSHEDECLPQLTQKQPVENSPDCGVKKHL
FT                   QVTTDFELMKGRLDESATYLLQWAEQRKDSIHLCCRKLQIQGLSKDAFIEIFKIIDANC
FT                   VQELELSCIWEEELPFLNPYLRQMKNLLTLKLDDITEVTMDGDDLFDEKKRRKLISQLF
FT                   SFYCLQNLYVDGTFAEGNMIECLRYLKKPLETLCLRYCFLSQTDLDYLPHCLNICKLKH
FT                   LSLSYIYLFNLFLEPLGILLERVRDTLQTLELQLCGLTDRHFSVLLPALSQCSHLTKIN
FT                   FYENTISLPVLKQLLYHTANLSQLTQEQYPAPQECYDNMRGVETHRLGNICTELLDILR
FT                   AKRQPERVAFATSRCIKCRGFLVYDLETQRCFFQH"
FT   gene            complement(<26649210..>26649779)
FT                   /gene="Ifna13"
FT                   /locus_tag="mCG_146414"
FT                   /note="gene_id=mCG146414.0"
FT   mRNA            complement(<26649210..>26649779)
FT                   /gene="Ifna13"
FT                   /locus_tag="mCG_146414"
FT                   /product="interferon alpha family, gene 13"
FT                   /note="gene_id=mCG146414.0 transcript_id=mCT186648.0
FT                   created on 07-AUG-2003"
FT   CDS             complement(26649210..26649779)
FT                   /codon_start=1
FT                   /gene="Ifna13"
FT                   /locus_tag="mCG_146414"
FT                   /product="interferon alpha family, gene 13"
FT                   /note="gene_id=mCG146414.0 transcript_id=mCT186648.0
FT                   protein_id=mCP107883.0"
FT                   /protein_id="EDL30970.1"
FT                   /translation="MARPCAFLMVLVVLSYWSACSLGCDLPQTHNLRNKRALTLLEQMR
FT                   RLSPLSCLKDRKDFGFPQEKVDAQQIKKAQAIPFVHELTQQILTLFTSNDSSAAWNATL
FT                   LDSFCNDLHQQLNDLKACLMQQVGVQEFPLTQEDSLLAVRKYFHSITVYLREKKHSPCA
FT                   WEVVRAEVQRTLSSSANLLARLSKEE"
FT   gene            complement(26653870..26654432)
FT                   /pseudo
FT                   /locus_tag="mCG_146421"
FT                   /note="gene_id=mCG146421.0"
FT   mRNA            complement(26653870..26654432)
FT                   /pseudo
FT                   /locus_tag="mCG_146421"
FT                   /note="gene_id=mCG146421.0 transcript_id=mCT186656.0
FT                   created on 07-AUG-2003"
FT   assembly_gap    26665198..26666198
FT                   /estimated_length=1001
FT                   /gap_type="unknown"
FT   assembly_gap    26667645..26668219
FT                   /estimated_length=575
FT                   /gap_type="unknown"
FT   gene            complement(<26673660..>26674229)
FT                   /locus_tag="mCG_146422"
FT                   /note="gene_id=mCG146422.0"
FT   mRNA            complement(<26673660..>26674229)
FT                   /locus_tag="mCG_146422"
FT                   /product="mCG146422"
FT                   /note="gene_id=mCG146422.0 transcript_id=mCT186657.0
FT                   created on 07-AUG-2003"
FT   CDS             complement(26673660..26674229)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146422"
FT                   /product="mCG146422"
FT                   /note="gene_id=mCG146422.0 transcript_id=mCT186657.0
FT                   protein_id=mCP107892.0"
FT                   /db_xref="GOA:Q810G1"
FT                   /db_xref="InterPro:IPR000471"
FT                   /db_xref="InterPro:IPR009079"
FT                   /db_xref="InterPro:IPR012351"
FT                   /db_xref="MGI:MGI:3649260"
FT                   /db_xref="UniProtKB/TrEMBL:Q810G1"
FT                   /protein_id="EDL30969.1"
FT                   /translation="MARLCAFLMVLAVMSYWSTCSLGCDLPQTHKLRNKRALTLLIQMR
FT                   RLSPLSCLKDRKDFGFPQEKVDTLKIQKEKAIPVLSEVTQQILNIFTSKDSSAAWDATL
FT                   LDTFCNDLYQQLNDLQACLVQQVRLQEPPLTQEVSLLAVRKYFHRITVYLREKKHSPCA
FT                   WEVVRAEVWRALSSSANVLGRLREEK"
FT   assembly_gap    26675010..26675029
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(26681256..>26682154)
FT                   /locus_tag="mCG_123693"
FT                   /note="gene_id=mCG123693.1"
FT   mRNA            complement(26681256..>26682154)
FT                   /locus_tag="mCG_123693"
FT                   /product="mCG123693"
FT                   /note="gene_id=mCG123693.1 transcript_id=mCT124927.1
FT                   created on 07-AUG-2003"
FT   CDS             complement(26681582..26682154)
FT                   /codon_start=1
FT                   /locus_tag="mCG_123693"
FT                   /product="mCG123693"
FT                   /note="gene_id=mCG123693.1 transcript_id=mCT124927.1
FT                   protein_id=mCP76184.0"
FT                   /db_xref="GOA:B1AYH7"
FT                   /db_xref="InterPro:IPR000471"
FT                   /db_xref="InterPro:IPR009079"
FT                   /db_xref="InterPro:IPR012351"
FT                   /db_xref="MGI:MGI:107666"
FT                   /db_xref="UniProtKB/TrEMBL:B1AYH7"
FT                   /protein_id="EDL30968.1"
FT                   /translation="MARLCAFLVMLIVMSYWSTCSLGCDLPHTYNLRNKRALKVLAQMR
FT                   RLPFLSCLKDRQDFGFPLEKVDNQQIQKAQAIPVLRDLTQQTLNLFTSKASSAAWNTTL
FT                   LDSFCNDLHQQLNDLQTCLMQQVGVQEPPLTQEDALLAVRKYFHRITVYLREKKHSPCA
FT                   WEVVRAEVWRALSSSVNLLPRLSEEKE"
FT   assembly_gap    26683424..26684047
FT                   /estimated_length=624
FT                   /gap_type="unknown"
FT   gene            complement(<26689684..>26690256)
FT                   /locus_tag="mCG_6573"
FT                   /note="gene_id=mCG6573.0"
FT   mRNA            complement(<26689684..>26690256)
FT                   /locus_tag="mCG_6573"
FT                   /product="mCG6573"
FT                   /note="gene_id=mCG6573.0 transcript_id=mCT6126.1 created on
FT                   04-OCT-2002"
FT   CDS             complement(26689684..26690256)
FT                   /codon_start=1
FT                   /locus_tag="mCG_6573"
FT                   /product="mCG6573"
FT                   /note="gene_id=mCG6573.0 transcript_id=mCT6126.1
FT                   protein_id=mCP2536.0"
FT                   /db_xref="GOA:Q61719"
FT                   /db_xref="InterPro:IPR000471"
FT                   /db_xref="InterPro:IPR009079"
FT                   /db_xref="InterPro:IPR012351"
FT                   /db_xref="MGI:MGI:1097683"
FT                   /db_xref="UniProtKB/TrEMBL:Q61719"
FT                   /protein_id="EDL30967.1"
FT                   /translation="MARLSTFLMVLAVMSYWSTCPLGCDLPQTHNLRNKRALTLLVQMR
FT                   RLSPLSCLKDRKDFGFPQEKVDAQQIQEAQAIPVLTELTQQMLTLFTSKASSAAWNATL
FT                   LDSFCNDLHQQLNDLKTCLMQQVGVQEFPLTQEDSLLAVRKYFHSITVYLREKKHSPCA
FT                   WEVVRAEVWRALSSSAKLLASLSEEKE"
FT   gene            complement(26695173..26695721)
FT                   /pseudo
FT                   /locus_tag="mCG_146425"
FT                   /note="gene_id=mCG146425.0"
FT   mRNA            complement(26695173..26695721)
FT                   /pseudo
FT                   /locus_tag="mCG_146425"
FT                   /note="gene_id=mCG146425.0 transcript_id=mCT186662.0
FT                   created on 07-AUG-2003"
FT   gene            complement(26706943..26707437)
FT                   /pseudo
FT                   /locus_tag="mCG_146426"
FT                   /note="gene_id=mCG146426.0"
FT   mRNA            complement(26706943..26707437)
FT                   /pseudo
FT                   /locus_tag="mCG_146426"
FT                   /note="gene_id=mCG146426.0 transcript_id=mCT186663.0
FT                   created on 07-AUG-2003"
FT   gene            complement(26717319..26722205)
FT                   /locus_tag="mCG_6570"
FT                   /note="gene_id=mCG6570.3"
FT   mRNA            complement(26717319..26722205)
FT                   /locus_tag="mCG_6570"
FT                   /product="mCG6570"
FT                   /note="gene_id=mCG6570.3 transcript_id=mCT6122.3 created on
FT                   07-AUG-2003"
FT   CDS             complement(26719182..26721035)
FT                   /codon_start=1
FT                   /locus_tag="mCG_6570"
FT                   /product="mCG6570"
FT                   /note="gene_id=mCG6570.3 transcript_id=mCT6122.3
FT                   protein_id=mCP2549.2"
FT                   /protein_id="EDL30965.1"
FT                   /translation="MKVSLGNGDMGVSAHLQPCKSGTTRFFTSNTHSSVVLQGFDQLRI
FT                   EGLLCDVTLVPGDGEEIFPVHRAMMASASDYFKAMFTGGMKEKDLMCIKLHGVNKVGLK
FT                   KIIDFIYTAKLSLNMDNLQDTLEAASFLQILPVLDFCKVFLISGVSLDNCVEVGRIANT
FT                   YNLIEVDKYVNNFILKNFPALLNTGEFLKLPFERLAFVLSSNSLKHCSELELFKAACRW
FT                   LRLEDPRMDYAAKLMKNIRFPLMTPQDLINYVQTVDFMRTDNTCVNLLLEASNYQMMPY
FT                   MQPVMQSDRTAIRSDSTHLVTLGGVLRQQLVVSKELRMYDERAQEWKSLAPMDAPRYQH
FT                   GIAVIGNFLYVVGGQSNYDTKGKTAVDTVFRFDPRYNKWMQVASLNEKRTFFHLSALKG
FT                   HLYAVGGRSAAGELATVECYNPRMNEWSYVAKMSEPHYGHAGTVYGGLMYISGGITHDT
FT                   FQNELMCFDPDTDKWTQKAPMTTVRGLHCMCTVGDKLYVIGGNHFRGTSDYDDVLSCEY
FT                   YSPTLDQWTPIAAMLRGQSDVGVAVFENKIYVVGGYSWNNRCMVEIVQKYDPEKDEWHK
FT                   VFDLPESLGGIRACTLTVFPPEENPGSPSRESPLSAPSDHS"
FT   gene            26720837..26721875
FT                   /locus_tag="mCG_148054"
FT                   /note="gene_id=mCG148054.0"
FT   mRNA            26720837..26721875
FT                   /locus_tag="mCG_148054"
FT                   /product="mCG148054"
FT                   /note="gene_id=mCG148054.0 transcript_id=mCT188317.0
FT                   created on 13-JAN-2004"
FT   CDS             26721007..26721468
FT                   /codon_start=1
FT                   /locus_tag="mCG_148054"
FT                   /product="mCG148054"
FT                   /note="gene_id=mCG148054.0 transcript_id=mCT188317.0
FT                   protein_id=mCP109396.0"
FT                   /db_xref="MGI:MGI:5477060"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CAC1"
FT                   /protein_id="EDL30966.1"
FT                   /translation="MSPLPRDTFMGEAGARCELQAADVTKRTLSGNPGAAEPRASKRSP
FT                   QHRSGHTDVRPAATAARTSNLPGERVSHHPGQLRDRFTSSGPGLSSFAAALRAGEGPSR
FT                   PAHPGCRPPRLSHPNELRPRPLRSPLCRRGYGLGLEQGLESRLGPRTAA"
FT   assembly_gap    26750046..26750065
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26751410..26751429
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <26755284..>26755832
FT                   /locus_tag="mCG_146419"
FT                   /note="gene_id=mCG146419.0"
FT   mRNA            <26755284..>26755832
FT                   /locus_tag="mCG_146419"
FT                   /product="mCG146419"
FT                   /note="gene_id=mCG146419.0 transcript_id=mCT186653.0
FT                   created on 07-AUG-2003"
FT   CDS             26755284..26755832
FT                   /codon_start=1
FT                   /locus_tag="mCG_146419"
FT                   /product="mCG146419"
FT                   /note="gene_id=mCG146419.0 transcript_id=mCT186653.0
FT                   protein_id=mCP107888.0"
FT                   /db_xref="GOA:B1AYH9"
FT                   /db_xref="InterPro:IPR000471"
FT                   /db_xref="InterPro:IPR009079"
FT                   /db_xref="InterPro:IPR012351"
FT                   /db_xref="MGI:MGI:3701966"
FT                   /db_xref="UniProtKB/TrEMBL:B1AYH9"
FT                   /protein_id="EDL30964.1"
FT                   /translation="MLPVHLFLVGGVMLSCSPASSLDSGKSGSLHLEHSETPRFLAELR
FT                   SVPGHQCLRDRTDFPCPWKEGTNITQMTLGETTSCYSQTLRHVLHLFDTEASRAAWHER
FT                   ALDQLLSSLWRELQVLKRPREQGQSCPLPFALAIRTYFRVFFRYLKAKAHSACSWEIVR
FT                   VQLQVDLPAFPLSARRGPR"
FT   assembly_gap    26757161..26764074
FT                   /estimated_length=6914
FT                   /gap_type="unknown"
FT   gene            26764320..26769975
FT                   /gene="Ifnz"
FT                   /locus_tag="mCG_1043435"
FT                   /note="gene_id=mCG1043435.2"
FT   mRNA            join(26764320..26764382,26766514..26766525,
FT                   26766569..26766643,26769160..26769975)
FT                   /gene="Ifnz"
FT                   /locus_tag="mCG_1043435"
FT                   /product="interferon zeta"
FT                   /note="gene_id=mCG1043435.2 transcript_id=mCT161139.2
FT                   created on 07-AUG-2003"
FT   assembly_gap    26765534..26765553
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26766988..26767007
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             26769168..26769716
FT                   /codon_start=1
FT                   /gene="Ifnz"
FT                   /locus_tag="mCG_1043435"
FT                   /product="interferon zeta"
FT                   /note="gene_id=mCG1043435.2 transcript_id=mCT161139.2
FT                   protein_id=mCP76033.2"
FT                   /db_xref="GOA:Q810G0"
FT                   /db_xref="InterPro:IPR000471"
FT                   /db_xref="InterPro:IPR009079"
FT                   /db_xref="InterPro:IPR012351"
FT                   /db_xref="UniProtKB/TrEMBL:Q810G0"
FT                   /protein_id="EDL30963.1"
FT                   /translation="MLPVHLFLVGGVMLSCSPASSLDSGKSGSLHLERSETARFLAELR
FT                   SVPGHQCLRDRTDFPCPWKEGTNITQMTLGETTSCYSQTLRQVLHLFDTEASRAAWHER
FT                   ALDQLLSSLWRELQVLKRPREQGQSCPLPFALAIRTYFRGFFRYLKAKAHSACSWEIVR
FT                   VQLQVDLPAFPLSARRGPR"
FT   assembly_gap    26771529..26778080
FT                   /estimated_length=6552
FT                   /gap_type="unknown"
FT   assembly_gap    26784668..26784687
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26787750..26787769
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            26787770..26788392
FT                   /pseudo
FT                   /locus_tag="mCG_146420"
FT                   /note="gene_id=mCG146420.0"
FT   mRNA            26787770..26788392
FT                   /pseudo
FT                   /locus_tag="mCG_146420"
FT                   /note="gene_id=mCG146420.0 transcript_id=mCT186654.0
FT                   created on 07-AUG-2003"
FT   assembly_gap    26789930..26789949
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26791120..26791139
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            26791852..26793334
FT                   /locus_tag="mCG_123689"
FT                   /note="gene_id=mCG123689.0"
FT   mRNA            26791852..26793334
FT                   /locus_tag="mCG_123689"
FT                   /product="mCG123689"
FT                   /note="gene_id=mCG123689.0 transcript_id=mCT124923.0
FT                   created on 02-APR-2003"
FT   CDS             26791918..26792490
FT                   /codon_start=1
FT                   /locus_tag="mCG_123689"
FT                   /product="mCG123689"
FT                   /note="gene_id=mCG123689.0 transcript_id=mCT124923.0
FT                   protein_id=mCP76176.1"
FT                   /protein_id="EDL30962.1"
FT                   /translation="MARLCAFLMILIVMSYWSTCSLGCDLPHTYNLRNKRALKVLAQMR
FT                   RLTPLSCLKDRKDFGFPLEKVDAQQIQKAQSIPVLRDLTQQILNLFASKDSSAAWNATL
FT                   LDSFCNDLHQQLNDLQGCLMQQVGVQEPPLTQEDALLAVRIYFHSITVFLREKKHSPCA
FT                   WEVVRAEVWRALSSSANVLGRLREEKA"
FT   gene            26799308..26800260
FT                   /gene="Ifna6"
FT                   /locus_tag="mCG_14138"
FT                   /note="gene_id=mCG14138.1"
FT   mRNA            26799308..26800260
FT                   /gene="Ifna6"
FT                   /locus_tag="mCG_14138"
FT                   /product="interferon alpha family, gene 6"
FT                   /note="gene_id=mCG14138.1 transcript_id=mCT12993.1 created
FT                   on 02-APR-2003"
FT   CDS             26799376..26799945
FT                   /codon_start=1
FT                   /gene="Ifna6"
FT                   /locus_tag="mCG_14138"
FT                   /product="interferon alpha family, gene 6"
FT                   /note="gene_id=mCG14138.1 transcript_id=mCT12993.1
FT                   protein_id=mCP4117.2"
FT                   /db_xref="GOA:Q810G5"
FT                   /db_xref="InterPro:IPR000471"
FT                   /db_xref="InterPro:IPR009079"
FT                   /db_xref="InterPro:IPR012351"
FT                   /db_xref="MGI:MGI:107662"
FT                   /db_xref="UniProtKB/TrEMBL:Q810G5"
FT                   /protein_id="EDL30961.1"
FT                   /translation="MARLCAFLMVLVVLSYWSTCSLGCDLPQTHNLRNKKALTLLVQMR
FT                   RLSPLSCLKDRKDFGFPLEKVDAQQIQEAQAIPVLTELTQQILTLFTSKDSSAAWNATL
FT                   LDSFCNDLHQQLNDLKACVMQEVGVQESPLTQEDSLLAVRTYFHRITVYLREKKHSPCA
FT                   WEVVRAEVWRALSSSAKLLARLSEDE"
FT   gene            <26807476..>26808045
FT                   /locus_tag="mCG_123694"
FT                   /note="gene_id=mCG123694.0"
FT   mRNA            <26807476..>26808045
FT                   /locus_tag="mCG_123694"
FT                   /product="mCG123694"
FT                   /note="gene_id=mCG123694.0 transcript_id=mCT124928.0
FT                   created on 03-OCT-2002"
FT   CDS             26807476..26808045
FT                   /codon_start=1
FT                   /locus_tag="mCG_123694"
FT                   /product="mCG123694"
FT                   /note="gene_id=mCG123694.0 transcript_id=mCT124928.0
FT                   protein_id=mCP76190.0"
FT                   /db_xref="GOA:Q810G2"
FT                   /db_xref="InterPro:IPR000471"
FT                   /db_xref="InterPro:IPR009079"
FT                   /db_xref="InterPro:IPR012351"
FT                   /db_xref="MGI:MGI:107663"
FT                   /db_xref="UniProtKB/TrEMBL:Q810G2"
FT                   /protein_id="EDL30960.1"
FT                   /translation="MARLCAFLMVLAVLSYWPTCSLGCDLPQTHNLRNKRALTLLVKMR
FT                   RLSPLSCLKDRKDFGFPQEKVGAQQIQEAQAIPVLSELTQQVLNIFTSKDSSAAWNATL
FT                   LDSFCNEVHQQLNDLKACVMQQVGVQESPLTQEDSLLAVRKYFHRITVYLREKKHSPCA
FT                   WEVVRAEVWRALSSSVNLLARLSKEE"
FT   assembly_gap    26809225..26809244
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <26813801..>26814361
FT                   /locus_tag="mCG_123696"
FT                   /note="gene_id=mCG123696.0"
FT   mRNA            <26813801..>26814361
FT                   /locus_tag="mCG_123696"
FT                   /product="mCG123696"
FT                   /note="gene_id=mCG123696.0 transcript_id=mCT124930.0
FT                   created on 03-OCT-2002"
FT   CDS             26813801..26814361
FT                   /codon_start=1
FT                   /locus_tag="mCG_123696"
FT                   /product="mCG123696"
FT                   /note="gene_id=mCG123696.0 transcript_id=mCT124930.0
FT                   protein_id=mCP76195.0"
FT                   /db_xref="GOA:Q540C2"
FT                   /db_xref="InterPro:IPR000471"
FT                   /db_xref="InterPro:IPR009079"
FT                   /db_xref="InterPro:IPR012351"
FT                   /db_xref="MGI:MGI:107664"
FT                   /db_xref="UniProtKB/TrEMBL:Q540C2"
FT                   /protein_id="EDL30959.1"
FT                   /translation="MARLCAFLMILVMMSYYWSACSLGCDLPHTYNLGNKRALTVLEEM
FT                   RRLPPLSCLKDRKDFGFPLEKVDNQQIQKAQAILVLRDLTQQILNLFTSKDLSATWNAT
FT                   LLDSFCNDLHQQLNDLKACVMQEPPLTQEDSLLAVRTYFHRITVYLRKKKHSLCAWEVI
FT                   RAEVWRALSSSTNLLARLSEEKE"
FT   gene            <26822017..>26822586
FT                   /locus_tag="mCG_14139"
FT                   /note="gene_id=mCG14139.1"
FT   mRNA            <26822017..>26822586
FT                   /locus_tag="mCG_14139"
FT                   /product="mCG14139"
FT                   /note="gene_id=mCG14139.1 transcript_id=mCT12994.1 created
FT                   on 03-OCT-2002"
FT   CDS             26822017..26822586
FT                   /codon_start=1
FT                   /locus_tag="mCG_14139"
FT                   /product="mCG14139"
FT                   /note="gene_id=mCG14139.1 transcript_id=mCT12994.1
FT                   protein_id=mCP4126.1"
FT                   /db_xref="GOA:P01572"
FT                   /db_xref="InterPro:IPR000471"
FT                   /db_xref="InterPro:IPR009079"
FT                   /db_xref="InterPro:IPR012351"
FT                   /db_xref="MGI:MGI:107668"
FT                   /db_xref="UniProtKB/Swiss-Prot:P01572"
FT                   /protein_id="EDL30958.1"
FT                   /translation="MARLCAFLMVLAVLSYWPTCSLGCDLPQTHNLRNKRALTLLVQMR
FT                   RLSPLSCLKDRKDFGFPQEKVDAQQIKKAQAIPVLSELTQQILNIFTSKDSSAAWNTTL
FT                   LDSFCNDLHQQLNDLQGCLMQQVGVQEFPLTQEDALLAVRKYFHRITVYLREKKHSPCA
FT                   WEVVRAEVWRALSSSANVLGRLREEK"
FT   gene            complement(26839169..26840314)
FT                   /locus_tag="mCG_148050"
FT                   /note="gene_id=mCG148050.0"
FT   mRNA            complement(26839169..26840314)
FT                   /locus_tag="mCG_148050"
FT                   /product="mCG148050"
FT                   /note="gene_id=mCG148050.0 transcript_id=mCT188313.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(26839540..26839737)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148050"
FT                   /product="mCG148050"
FT                   /note="gene_id=mCG148050.0 transcript_id=mCT188313.0
FT                   protein_id=mCP109392.0"
FT                   /protein_id="EDL30957.1"
FT                   /translation="MHHVIHMTSRRQYSGVGSLFHHGTSESGDHCALGESEVPSLLQTL
FT                   GRGNFYLAQEHKCFPAKQEF"
FT   assembly_gap    26845879..26845898
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26847749..26847768
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26930007..26930171
FT                   /estimated_length=165
FT                   /gap_type="unknown"
FT   assembly_gap    26936988..26937007
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26946113..26946883
FT                   /estimated_length=771
FT                   /gap_type="unknown"
FT   assembly_gap    26948357..26948773
FT                   /estimated_length=417
FT                   /gap_type="unknown"
FT   assembly_gap    26950002..26950431
FT                   /estimated_length=430
FT                   /gap_type="unknown"
FT   assembly_gap    26951918..26953430
FT                   /estimated_length=1513
FT                   /gap_type="unknown"
FT   assembly_gap    26953977..26953996
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26999704..27000137
FT                   /estimated_length=434
FT                   /gap_type="unknown"
FT   assembly_gap    27004952..27005160
FT                   /estimated_length=209
FT                   /gap_type="unknown"
FT   assembly_gap    27010234..27010253
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27057650..27057669
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27069092..27069450
FT                   /estimated_length=359
FT                   /gap_type="unknown"
FT   assembly_gap    27082479..27082915
FT                   /estimated_length=437
FT                   /gap_type="unknown"
FT   assembly_gap    27087373..27087400
FT                   /estimated_length=28
FT                   /gap_type="unknown"
FT   gene            27109749..27153807
FT                   /gene="Mtap"
FT                   /locus_tag="mCG_14141"
FT                   /note="gene_id=mCG14141.1"
FT   mRNA            join(27109749..27110156,27120829..27120915,
FT                   27124649..27124707,27129085..27129252,27143844..27143946,
FT                   27144861..27145100,27149519..27149641,27152184..27153807)
FT                   /gene="Mtap"
FT                   /locus_tag="mCG_14141"
FT                   /product="methylthioadenosine phosphorylase, transcript
FT                   variant mCT12752"
FT                   /note="gene_id=mCG14141.1 transcript_id=mCT12752.2 created
FT                   on 27-FEB-2003"
FT   mRNA            join(<27110068..27110156,27120829..27120921,
FT                   27124649..27124707,27129085..27129252,27143844..27143946,
FT                   27144861..27145100,27149519..27149641,27152184..27152809)
FT                   /gene="Mtap"
FT                   /locus_tag="mCG_14141"
FT                   /product="methylthioadenosine phosphorylase, transcript
FT                   variant mCT192826"
FT                   /note="gene_id=mCG14141.1 transcript_id=mCT192826.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<27110070..27110156,27120829..27120921,
FT                   27124649..27124707,27129085..27129252,27143844..27143946,
FT                   27144861..27145100,27149519..27149641,27152184..27152222)
FT                   /codon_start=1
FT                   /gene="Mtap"
FT                   /locus_tag="mCG_14141"
FT                   /product="methylthioadenosine phosphorylase, isoform CRA_b"
FT                   /note="gene_id=mCG14141.1 transcript_id=mCT192826.0
FT                   protein_id=mCP113789.0 isoform=CRA_b"
FT                   /protein_id="EDL30956.1"
FT                   /translation="QSPPGPTLRPAVDFPGADMASGSACTAVKIGIIGGTGLDDPEILE
FT                   GRTEKYVDTPFGKVSPSDALILGKIKNVDCVLLARHGRQHTIMPSKVNYQANIWALKEE
FT                   GCTHVIVTTACGSLREEIQPGDMVIIDQFIDRTSLRPQTFYDGSHCSARGVCHIPMAEP
FT                   FCPKTREVLIETAKKLGLRCHSKGTIVTIEGPRFSSRAESLIFRTWGADVVNMTTVPEV
FT                   VLAKEAGICYASIAMATDYDCWKEHEEAVSVDGVLKTMKENANKAKSLLLTTIPQIGSM
FT                   EWSETLRNLKNMAQFSVLPPRH"
FT   CDS             join(27110124..27110156,27120829..27120915,
FT                   27124649..27124707,27129085..27129252,27143844..27143946,
FT                   27144861..27145100,27149519..27149641,27152184..27152222)
FT                   /codon_start=1
FT                   /gene="Mtap"
FT                   /locus_tag="mCG_14141"
FT                   /product="methylthioadenosine phosphorylase, isoform CRA_a"
FT                   /note="gene_id=mCG14141.1 transcript_id=mCT12752.2
FT                   protein_id=mCP4128.2 isoform=CRA_a"
FT                   /protein_id="EDL30955.1"
FT                   /translation="MASGSACTAVKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDAL
FT                   ILGKIKNVDCVLLARHGRQHTIMPSKVNYQANIWALKEEGCTHVIVTTACGSLREEIQP
FT                   GDMVIIDQFIDRTSLRPQTFYDGSHCSARGVCHIPMAEPFCPKTREVLIETAKKLGLRC
FT                   HSKGTIVTIEGPRFSSRAESLIFRTWGADVVNMTTVPEVVLAKEAGICYASIAMATDYD
FT                   CWKEHEEAVSVDGVLKTMKENANKAKSLLLTTIPQIGSMEWSETLRNLKNMAQFSVLPP
FT                   RH"
FT   assembly_gap    27131044..27131375
FT                   /estimated_length=332
FT                   /gap_type="unknown"
FT   assembly_gap    27143371..27143390
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27162928..27164730
FT                   /estimated_length=1803
FT                   /gap_type="unknown"
FT   assembly_gap    27177736..27177755
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27182967..27182986
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27188142..27188161
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            27189828..>27190991
FT                   /locus_tag="mCG_50066"
FT                   /note="gene_id=mCG50066.2"
FT   mRNA            join(27189828..27189889,27190469..>27190991)
FT                   /locus_tag="mCG_50066"
FT                   /product="mCG50066"
FT                   /note="gene_id=mCG50066.2 transcript_id=mCT50249.2 created
FT                   on 20-FEB-2003"
FT   CDS             join(27189876..27189889,27190469..27190991)
FT                   /codon_start=1
FT                   /locus_tag="mCG_50066"
FT                   /product="mCG50066"
FT                   /note="gene_id=mCG50066.2 transcript_id=mCT50249.2
FT                   protein_id=mCP27108.2"
FT                   /protein_id="EDL30954.1"
FT                   /translation="MWDSEICNWFINVRRRLLPDMLRKDGKDPNQFTISRRGGKVSDVA
FT                   LPRGSSPSLLALSVPAPTNMLSLSVCSMPRHSGQGEKPAAPFPRVELESPKALVTPAST
FT                   LTLLTRAEAGSPMGGLFNTPPPTPPEQTKDDFSSFQLLVEVAVQRAVEMELQKQQEPVP
FT                   PLLHTPMPLVSENAK"
FT   assembly_gap    27189890..27190333
FT                   /estimated_length=444
FT                   /gap_type="unknown"
FT   assembly_gap    27192381..27192475
FT                   /estimated_length=95
FT                   /gap_type="unknown"
FT   assembly_gap    27200670..27201298
FT                   /estimated_length=629
FT                   /gap_type="unknown"
FT   assembly_gap    27203624..27203829
FT                   /estimated_length=206
FT                   /gap_type="unknown"
FT   gene            complement(27208722..>27249739)
FT                   /locus_tag="mCG_145491"
FT                   /note="gene_id=mCG145491.1"
FT   mRNA            complement(join(27208722..27209393,27211894..27211995,
FT                   27226851..27227101,27248768..>27248923))
FT                   /locus_tag="mCG_145491"
FT                   /product="mCG145491, transcript variant mCT184915"
FT                   /note="gene_id=mCG145491.1 transcript_id=mCT184915.0
FT                   created on 05-JUN-2003"
FT   mRNA            complement(join(27208753..27209393,27226851..27227101,
FT                   27249593..>27249739))
FT                   /locus_tag="mCG_145491"
FT                   /product="mCG145491, transcript variant mCT192833"
FT                   /note="gene_id=mCG145491.1 transcript_id=mCT192833.0
FT                   created on 09-MAR-2004"
FT   CDS             complement(27208801..>27209121)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145491"
FT                   /product="mCG145491, isoform CRA_b"
FT                   /note="gene_id=mCG145491.1 transcript_id=mCT192833.0
FT                   protein_id=mCP113790.0 isoform=CRA_b"
FT                   /protein_id="EDL30953.1"
FT                   /translation="HSRFDNVNKEKPTKLQLSRKNYKSKARIGIRWAFFFFYKEEHNNW
FT                   LSNAKWSALKTYIQITLDGLSWLYLGMHTITIYDKRCHELEGEGEGAYGRVWREKGEEK
FT                   IL"
FT   CDS             complement(join(27226900..27227101,27248768..>27248922))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145491"
FT                   /product="mCG145491, isoform CRA_a"
FT                   /note="gene_id=mCG145491.1 transcript_id=mCT184915.0
FT                   protein_id=mCP105844.0 isoform=CRA_a"
FT                   /protein_id="EDL30952.1"
FT                   /translation="RGLGTSSPIETRQDGRTEQTPSAAHVRARKPRSSRYMVFGWWFRL
FT                   LEPHGFRAVTLGKRSLPKSRARVFLTELSHRIGVTERIVSLNWSYRGTWKEWQMLRPPA
FT                   CTHFPRWGLPTRPG"
FT   assembly_gap    27229539..27229685
FT                   /estimated_length=147
FT                   /gap_type="unknown"
FT   assembly_gap    27235621..27241205
FT                   /estimated_length=5585
FT                   /gap_type="unknown"
FT   gene            complement(27250947..27270540)
FT                   /gene="Cdkn2a"
FT                   /locus_tag="mCG_123699"
FT                   /note="gene_id=mCG123699.1"
FT   mRNA            complement(join(27250947..27251110,27252829..27253169,
FT                   27270232..27270540))
FT                   /gene="Cdkn2a"
FT                   /locus_tag="mCG_123699"
FT                   /product="cyclin-dependent kinase inhibitor 2A"
FT                   /note="gene_id=mCG123699.1 transcript_id=mCT124933.2
FT                   created on 06-DEC-2002"
FT   assembly_gap    27252370..27252389
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             complement(join(27252850..27253169,27270232..27270421))
FT                   /codon_start=1
FT                   /gene="Cdkn2a"
FT                   /locus_tag="mCG_123699"
FT                   /product="cyclin-dependent kinase inhibitor 2A"
FT                   /note="gene_id=mCG123699.1 transcript_id=mCT124933.2
FT                   protein_id=mCP76207.2"
FT                   /protein_id="EDL30951.1"
FT                   /translation="MGRRFLVTVRIQRAGRPLQERVFLVKFVRSRRPRTASCALAFVNM
FT                   LLRLERILRRGPHRNPGPGDDDGQRSRSSSSAQLRCRFELRGPHYLLPPGARRSAGRLP
FT                   GHAGGAARVRGSAGCARCLGSPAARLGPRAGTSRHRAIFAFRWVLFVFRWVVFVYRWER
FT                   RPDRRA"
FT   assembly_gap    27257279..27257379
FT                   /estimated_length=101
FT                   /gap_type="unknown"
FT   assembly_gap    27259593..27259623
FT                   /estimated_length=31
FT                   /gap_type="unknown"
FT   assembly_gap    27281439..27281519
FT                   /estimated_length=81
FT                   /gap_type="unknown"
FT   gene            complement(27282151..27286910)
FT                   /gene="Cdkn2b"
FT                   /locus_tag="mCG_14135"
FT                   /note="gene_id=mCG14135.2"
FT   mRNA            complement(join(27282151..27282449,27282657..27283214,
FT                   27286580..27286910))
FT                   /gene="Cdkn2b"
FT                   /locus_tag="mCG_14135"
FT                   /product="cyclin-dependent kinase inhibitor 2B (p15,
FT                   inhibits CDK4)"
FT                   /note="gene_id=mCG14135.2 transcript_id=mCT12960.2 created
FT                   on 27-SEP-2002"
FT   assembly_gap    27282450..27282656
FT                   /estimated_length=207
FT                   /gap_type="unknown"
FT   CDS             complement(join(27282954..27283214,27286580..27286711))
FT                   /codon_start=1
FT                   /gene="Cdkn2b"
FT                   /locus_tag="mCG_14135"
FT                   /product="cyclin-dependent kinase inhibitor 2B (p15,
FT                   inhibits CDK4)"
FT                   /note="gene_id=mCG14135.2 transcript_id=mCT12960.2
FT                   protein_id=mCP4130.1"
FT                   /db_xref="GOA:Q549R4"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="MGI:MGI:104737"
FT                   /db_xref="UniProtKB/TrEMBL:Q549R4"
FT                   /protein_id="EDL30950.1"
FT                   /translation="MLGGSSDAGLATAAARGQVETVRQLLEAGADPNALNRFGRRPIQV
FT                   MMMGSAQVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVCDAW
FT                   GRLPVDLAEEQGHRDIARYLHAATGD"
FT   assembly_gap    27291951..27295708
FT                   /estimated_length=3758
FT                   /gap_type="unknown"
FT   assembly_gap    27302276..27302330
FT                   /estimated_length=55
FT                   /gap_type="unknown"
FT   assembly_gap    27305087..27305193
FT                   /estimated_length=107
FT                   /gap_type="unknown"
FT   assembly_gap    27314562..27314581
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27329716..27329735
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27332010..27332029
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27336207..27336533
FT                   /estimated_length=327
FT                   /gap_type="unknown"
FT   assembly_gap    27365915..27366410
FT                   /estimated_length=496
FT                   /gap_type="unknown"
FT   assembly_gap    27367129..27367469
FT                   /estimated_length=341
FT                   /gap_type="unknown"
FT   assembly_gap    27368482..27368949
FT                   /estimated_length=468
FT                   /gap_type="unknown"
FT   assembly_gap    27374564..27374583
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27423344..27423363
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27428984..27429003
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27444334..27444353
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27466155..27466393
FT                   /estimated_length=239
FT                   /gap_type="unknown"
FT   assembly_gap    27467381..27467519
FT                   /estimated_length=139
FT                   /gap_type="unknown"
FT   assembly_gap    27469362..27469679
FT                   /estimated_length=318
FT                   /gap_type="unknown"
FT   assembly_gap    27470639..27470864
FT                   /estimated_length=226
FT                   /gap_type="unknown"
FT   assembly_gap    27489436..27489455
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27492015..27493893
FT                   /estimated_length=1879
FT                   /gap_type="unknown"
FT   assembly_gap    27513833..27514165
FT                   /estimated_length=333
FT                   /gap_type="unknown"
FT   assembly_gap    27519888..27519907
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27545883..27545915
FT                   /estimated_length=33
FT                   /gap_type="unknown"
FT   assembly_gap    27561365..27568457
FT                   /estimated_length=7093
FT                   /gap_type="unknown"
FT   assembly_gap    27585806..27585825
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27631907..27631929
FT                   /estimated_length=23
FT                   /gap_type="unknown"
FT   gene            <27637912..>27641816
FT                   /gene="Dmrta1"
FT                   /locus_tag="mCG_52745"
FT                   /note="gene_id=mCG52745.1"
FT   mRNA            join(<27637912..27638478,27640975..>27641816)
FT                   /gene="Dmrta1"
FT                   /locus_tag="mCG_52745"
FT                   /product="doublesex and mab-3 related transcription factor
FT                   like family A1"
FT                   /note="gene_id=mCG52745.1 transcript_id=mCT52928.1 created
FT                   on 27-NOV-2002"
FT   CDS             join(<27637914..27638478,27640975..27641816)
FT                   /codon_start=1
FT                   /gene="Dmrta1"
FT                   /locus_tag="mCG_52745"
FT                   /product="doublesex and mab-3 related transcription factor
FT                   like family A1"
FT                   /note="gene_id=mCG52745.1 transcript_id=mCT52928.1
FT                   protein_id=mCP27133.1"
FT                   /protein_id="EDL30949.1"
FT                   /translation="RAAAPASAARSVSSGIPVSATFLRPPGLFLRSTASSGRAGCAPGP
FT                   GLDRALGAVGCGYPRTPKCARCRNHGVVSALKGHKRFCRWRDCACAKCTLIAERQRVMA
FT                   AQVALRRQQAQEESEARGLHRLLYQGSSGSGAQASGGSGRTESPQVLNNPMAVAVLGAG
FT                   ASRHPGSRSVPTFEVFQQDYADRKQEPKQRNCESCQSRQEEPVSNTHHHSLGSSKGNVT
FT                   VEKQGFMSSIPEHPDKSTIILSPCPTDQSGGEDSPRSFSSSDLESGNESEWARDYIATR
FT                   ASLSTVTSRPRDPLGILTRIFPGYKHSRLEGILQFCKGDVVQAIEQILNGREHKPDCRD
FT                   LARADLENAAFQRASDFSLAGIGFGTLSNKSALSPLEAASAAYGGDSTLYSFNPRLAFS
FT                   PLRLAYSSPGRALSGFVSPYLTPGLVPALPFRPTLDYAFPGMIREPSHLPSKHLVAGGR
FT                   LYFRPNQEHL"
FT   assembly_gap    27654886..27655328
FT                   /estimated_length=443
FT                   /gap_type="unknown"
FT   assembly_gap    27656925..27657786
FT                   /estimated_length=862
FT                   /gap_type="unknown"
FT   assembly_gap    27664903..27665782
FT                   /estimated_length=880
FT                   /gap_type="unknown"
FT   assembly_gap    27668270..27669065
FT                   /estimated_length=796
FT                   /gap_type="unknown"
FT   assembly_gap    27741300..27746718
FT                   /estimated_length=5419
FT                   /gap_type="unknown"
FT   assembly_gap    27788903..27789026
FT                   /estimated_length=124
FT                   /gap_type="unknown"
FT   assembly_gap    27790078..27790097
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27800473..27800561
FT                   /estimated_length=89
FT                   /gap_type="unknown"
FT   assembly_gap    27809727..27809746
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27817347..27817366
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27828777..27828796
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27844743..27844762
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27957086..27957105
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27972006..27972037
FT                   /estimated_length=32
FT                   /gap_type="unknown"
FT   assembly_gap    27973686..27975105
FT                   /estimated_length=1420
FT                   /gap_type="unknown"
FT   assembly_gap    27976379..27983419
FT                   /estimated_length=7041
FT                   /gap_type="unknown"
FT   assembly_gap    27987030..27987357
FT                   /estimated_length=328
FT                   /gap_type="unknown"
FT   assembly_gap    28000278..28000471
FT                   /estimated_length=194
FT                   /gap_type="unknown"
FT   assembly_gap    28015862..28015881
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    28045031..28056405
FT                   /estimated_length=11375
FT                   /gap_type="unknown"
FT   assembly_gap    28086950..28086969
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    28106538..28107191
FT                   /estimated_length=654
FT                   /gap_type="unknown"
FT   assembly_gap    28115363..28115384
FT                   /estimated_length=22
FT                   /gap_type="unknown"
FT   assembly_gap    28155967..28155986
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    28202687..28202706
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    28213953..28213972
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    28222893..28222912
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    28231058..28231077
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    28259058..28262514
FT                   /estimated_length=3457
FT                   /gap_type="unknown"
FT   assembly_gap    28275935..28276015
FT                   /estimated_length=81
FT                   /gap_type="unknown"
FT   assembly_gap    28292856..28292980
FT                   /estimated_length=125
FT                   /gap_type="unknown"
FT   assembly_gap    28315066..28315186
FT                   /estimated_length=121
FT                   /gap_type="unknown"
FT   assembly_gap    28325383..28325708
FT                   /estimated_length=326
FT                   /gap_type="unknown"
FT   assembly_gap    28326813..28326832
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    28333987..28336319
FT                   /estimated_length=2333
FT                   /gap_type="unknown"
FT   assembly_gap    28373765..28373843
FT                   /estimated_length=79
FT                   /gap_type="unknown"
FT   assembly_gap    28430335..28430354
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    28434042..28434211
FT                   /estimated_length=170
FT                   /gap_type="unknown"
FT   assembly_gap    28474436..28474924
FT                   /estimated_length=489
FT                   /gap_type="unknown"
FT   assembly_gap    28478140..28478236
FT                   /estimated_length=97
FT                   /gap_type="unknown"
FT   assembly_gap    28494519..28494538
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    28515228..28515267
FT                   /estimated_length=40
FT                   /gap_type="unknown"
FT   assembly_gap    28524278..28524348
FT                   /estimated_length=71
FT                   /gap_type="unknown"
FT   assembly_gap    28539505..28543889
FT                   /estimated_length=4385
FT                   /gap_type="unknown"
FT   assembly_gap    28545000..28545019
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    28546254..28546273
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    28554306..28554655
FT                   /estimated_length=350
FT                   /gap_type="unknown"
FT   assembly_gap    28591706..28593343
FT                   /estimated_length=1638
FT                   /gap_type="unknown"
FT   assembly_gap    28600681..28602422
FT                   /estimated_length=1742
FT                   /gap_type="unknown"
FT   assembly_gap    28617958..28619049
FT                   /estimated_length=1092
FT                   /gap_type="unknown"
FT   assembly_gap    28640027..28640046
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    28641558..28641577
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    28651303..28651322
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    28658970..28658989
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    28713468..28713487
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    28766742..28766803
FT                   /estimated_length=62
FT                   /gap_type="unknown"
FT   assembly_gap    28791939..28791958
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            28797286..28797780
FT                   /pseudo
FT                   /locus_tag="mCG_146385"
FT                   /note="gene_id=mCG146385.0"
FT   mRNA            28797286..28797780
FT                   /pseudo
FT                   /locus_tag="mCG_146385"
FT                   /note="gene_id=mCG146385.0 transcript_id=mCT186592.0
FT                   created on 18-JUL-2003"
FT   assembly_gap    28816780..28816799
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    28825063..28825082
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    28852824..28852843
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    28895716..28898114
FT                   /estimated_length=2399
FT                   /gap_type="unknown"
FT   assembly_gap    28909792..28914481
FT                   /estimated_length=4690
FT                   /gap_type="unknown"
FT   assembly_gap    28919446..28919577
FT                   /estimated_length=132
FT                   /gap_type="unknown"
FT   assembly_gap    28931654..28931673
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    28940462..28942884
FT                   /estimated_length=2423
FT                   /gap_type="unknown"
FT   assembly_gap    28943960..28943979
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    28946395..28946414
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    28948369..28948561
FT                   /estimated_length=193
FT                   /gap_type="unknown"
FT   assembly_gap    28949714..28949733
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    28954993..28955281
FT                   /estimated_length=289
FT                   /gap_type="unknown"
FT   assembly_gap    28988664..28988683
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    29019783..29019898
FT                   /estimated_length=116
FT                   /gap_type="unknown"
FT   assembly_gap    29034974..29035205
FT                   /estimated_length=232
FT                   /gap_type="unknown"
FT   assembly_gap    29068983..29069002
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    29070454..29070473
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    29074885..29074904
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    29082737..29082883
FT                   /estimated_length=147
FT                   /gap_type="unknown"
FT   assembly_gap    29106442..29106798
FT                   /estimated_length=357
FT                   /gap_type="unknown"
FT   assembly_gap    29112325..29112344
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    29114274..29118756
FT                   /estimated_length=4483
FT                   /gap_type="unknown"
FT   assembly_gap    29127082..29132192
FT                   /estimated_length=5111
FT                   /gap_type="unknown"
FT   assembly_gap    29137440..29137459
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    29145877..29146034
FT                   /estimated_length=158
FT                   /gap_type="unknown"
FT   gene            complement(29194744..29314430)
FT                   /gene="Elavl2"
FT                   /locus_tag="mCG_7069"
FT                   /note="gene_id=mCG7069.1"
FT   mRNA            complement(join(29194744..29196069,29196640..29196678,
FT                   29203260..29203485,29206492..29206645,29223815..29223918,
FT                   29251092..29251337,29314377..29314430))
FT                   /gene="Elavl2"
FT                   /locus_tag="mCG_7069"
FT                   /product="ELAV (embryonic lethal, abnormal vision,
FT                   Drosophila)-like 2 (Hu antigen B)"
FT                   /note="gene_id=mCG7069.1 transcript_id=mCT6331.1 created on
FT                   27-SEP-2002"
FT   CDS             complement(join(29195739..29196069,29196640..29196678,
FT                   29203260..29203485,29206492..29206645,29223815..29223918,
FT                   29251092..29251320))
FT                   /codon_start=1
FT                   /gene="Elavl2"
FT                   /locus_tag="mCG_7069"
FT                   /product="ELAV (embryonic lethal, abnormal vision,
FT                   Drosophila)-like 2 (Hu antigen B)"
FT                   /note="gene_id=mCG7069.1 transcript_id=mCT6331.1
FT                   protein_id=mCP4115.2"
FT                   /db_xref="GOA:Q564D8"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR002343"
FT                   /db_xref="InterPro:IPR006548"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="MGI:MGI:1100887"
FT                   /db_xref="UniProtKB/TrEMBL:Q564D8"
FT                   /protein_id="EDL30947.1"
FT                   /translation="METQLSNGPTCNNTANGPTTVNNNCSSPVDSGNTEDSKTNLIVNY
FT                   LPQNMTQEELKSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINTLNGLR
FT                   LQTKTIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTG
FT                   ISRGVGFIRFDKRIEAEEAIKGLNGQKPPGATEPITVKFANNPSQKTNQAILSQLYQSP
FT                   NRRYPGPLAQQAQRFRLDNLLNMAYGVKSRFSPMTIDGMTSLAGINIPGHPGTGWCIFV
FT                   YNLAPDADESILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNG
FT                   YRLGDRVLQVSFKTNKTHKA"
FT   assembly_gap    29218944..29218963
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(29295404..29299668)
FT                   /locus_tag="mCG_148071"
FT                   /note="gene_id=mCG148071.0"
FT   mRNA            complement(29295404..29299668)
FT                   /locus_tag="mCG_148071"
FT                   /product="mCG148071"
FT                   /note="gene_id=mCG148071.0 transcript_id=mCT188334.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(29298179..29298439)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148071"
FT                   /product="mCG148071"
FT                   /note="gene_id=mCG148071.0 transcript_id=mCT188334.0
FT                   protein_id=mCP109413.0"
FT                   /protein_id="EDL30948.1"
FT                   /translation="MSSSKQPTLKELSSSFWKFLSPSALSGLFFPACISFAYIFFYFVF
FT                   FYGFSLFVKVCVSVFLYIFLHYGLPPPPHILFCSILDFSIF"
FT   assembly_gap    29314011..29314376
FT                   /estimated_length=366
FT                   /gap_type="unknown"
FT   assembly_gap    29332306..29332859
FT                   /estimated_length=554
FT                   /gap_type="unknown"
FT   assembly_gap    29342636..29342678
FT                   /estimated_length=43
FT                   /gap_type="unknown"
FT   assembly_gap    29376984..29377948
FT                   /estimated_length=965
FT                   /gap_type="unknown"
FT   assembly_gap    29381971..29382247
FT                   /estimated_length=277
FT                   /gap_type="unknown"
FT   assembly_gap    29391082..29391101
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    29408047..29408256
FT                   /estimated_length=210
FT                   /gap_type="unknown"
FT   assembly_gap    29410328..29412771
FT                   /estimated_length=2444
FT                   /gap_type="unknown"
FT   assembly_gap    29414387..29417553
FT                   /estimated_length=3167
FT                   /gap_type="unknown"
FT   assembly_gap    29432317..29437123
FT                   /estimated_length=4807
FT                   /gap_type="unknown"
FT   assembly_gap    29457719..29457738
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    29490821..29491452
FT                   /estimated_length=632
FT                   /gap_type="unknown"
FT   assembly_gap    29515418..29516225
FT                   /estimated_length=808
FT                   /gap_type="unknown"
FT   assembly_gap    29524728..29524747
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    29551554..29551802
FT                   /estimated_length=249
FT                   /gap_type="unknown"
FT   assembly_gap    29555026..29555045
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    29571040..29571059
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    29573192..29573211
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    29578222..29583202
FT                   /estimated_length=4981
FT                   /gap_type="unknown"
FT   assembly_gap    29593374..29593500
FT                   /estimated_length=127
FT                   /gap_type="unknown"
FT   assembly_gap    29600618..29600637
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    29605941..29605960
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    29633652..29633671
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    29634858..29634877
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    29637173..29637192
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    29638948..29638967
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    29640032..29640051
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    29649887..29649906
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    29674270..29674289
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    29701604..29701728
FT                   /estimated_length=125
FT                   /gap_type="unknown"
FT   assembly_gap    29719661..29719680
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    29720877..29725449
FT                   /estimated_length=4573
FT                   /gap_type="unknown"
FT   assembly_gap    29730440..29730459
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    29734610..29739870
FT                   /estimated_length=5261
FT                   /gap_type="unknown"
FT   gene            complement(29740501..29741732)
FT                   /pseudo
FT                   /locus_tag="mCG_142400"
FT                   /note="gene_id=mCG142400.0"
FT   mRNA            complement(29740501..29741732)
FT                   /pseudo
FT                   /locus_tag="mCG_142400"
FT                   /note="gene_id=mCG142400.0 transcript_id=mCT180383.0
FT                   created on 11-FEB-2003"
FT   assembly_gap    29773536..29773742
FT                   /estimated_length=207
FT                   /gap_type="unknown"
FT   gene            complement(29786746..29788001)
FT                   /pseudo
FT                   /locus_tag="mCG_142399"
FT                   /note="gene_id=mCG142399.1"
FT   mRNA            complement(29786746..29788001)
FT                   /pseudo
FT                   /locus_tag="mCG_142399"
FT                   /note="gene_id=mCG142399.1 transcript_id=mCT180382.1
FT                   created on 23-MAY-2003"
FT   assembly_gap    29804292..29804505
FT                   /estimated_length=214
FT                   /gap_type="unknown"
FT   assembly_gap    29829025..29829044
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(29868250..29869350)
FT                   /locus_tag="mCG_148053"
FT                   /note="gene_id=mCG148053.0"
FT   mRNA            complement(join(29868250..29868883,29869193..29869350))
FT                   /locus_tag="mCG_148053"
FT                   /product="mCG148053"
FT                   /note="gene_id=mCG148053.0 transcript_id=mCT188316.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(29868587..29868787)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148053"
FT                   /product="mCG148053"
FT                   /note="gene_id=mCG148053.0 transcript_id=mCT188316.0
FT                   protein_id=mCP109395.0"
FT                   /protein_id="EDL30946.1"
FT                   /translation="MLAKDSSKLKSDKQGKKEVQLDTFKLFKVSRKPCRWRTLNLKGIY
FT                   LLPGDSPAGNRQQSNNTNSWD"
FT   assembly_gap    29898678..29899105
FT                   /estimated_length=428
FT                   /gap_type="unknown"
FT   assembly_gap    29901693..29908571
FT                   /estimated_length=6879
FT                   /gap_type="unknown"
FT   assembly_gap    29995035..29995243
FT                   /estimated_length=209
FT                   /gap_type="unknown"
FT   gene            complement(<30035568..>30035825)
FT                   /locus_tag="mCG_49595"
FT                   /note="gene_id=mCG49595.0"
FT   mRNA            complement(<30035568..>30035825)
FT                   /locus_tag="mCG_49595"
FT                   /product="mCG49595"
FT                   /note="gene_id=mCG49595.0 transcript_id=mCT49778.0 created
FT                   on 20-FEB-2003"
FT   CDS             complement(30035568..30035825)
FT                   /codon_start=1
FT                   /locus_tag="mCG_49595"
FT                   /product="mCG49595"
FT                   /note="gene_id=mCG49595.0 transcript_id=mCT49778.0
FT                   protein_id=mCP27126.0"
FT                   /protein_id="EDL30945.1"
FT                   /translation="MDEEDEDFEEESDEDETAALLAELEKIKKERAEEQARKEQEEKAE
FT                   EERICVENILSGNPLLNLTGPSQPQANFKVKRRWGHDVVF"
FT   assembly_gap    30035862..30035955
FT                   /estimated_length=94
FT                   /gap_type="unknown"
FT   assembly_gap    30043752..30043771
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(30073027..>30075924)
FT                   /locus_tag="mCG_13299"
FT                   /note="gene_id=mCG13299.1"
FT   mRNA            complement(join(30073027..30073442,30073669..30073759,
FT                   30074289..30074369,30074967..30075074,30075220..30075294,
FT                   30075901..>30075924))
FT                   /locus_tag="mCG_13299"
FT                   /product="mCG13299"
FT                   /note="gene_id=mCG13299.1 transcript_id=mCT12957.2 created
FT                   on 25-OCT-2002"
FT   CDS             complement(join(30073328..30073442,30073669..30073759,
FT                   30074289..30074369,30074967..30075074,30075220..30075294,
FT                   30075901..>30075922))
FT                   /codon_start=1
FT                   /locus_tag="mCG_13299"
FT                   /product="mCG13299"
FT                   /note="gene_id=mCG13299.1 transcript_id=mCT12957.2
FT                   protein_id=mCP4113.1"
FT                   /protein_id="EDL30944.1"
FT                   /translation="VFYTQNSAVRNVIKLREWLKDEFYRLGNETWKGVFIIQGNLLEIR
FT                   QNLEKKLTQIIKNFSEVGNETFLLVIEGPVLDCWNCLRMTTRCFKGDYCQDEDPKTAEN
FT                   REISLYLIFIAEAVILASAVLLQIPCLHLTSEENEGNTKNFEDIFGEETRRTSGDDIQR
FT                   "
FT   assembly_gap    30091571..30091590
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(30119418..>30120437)
FT                   /locus_tag="mCG_13300"
FT                   /note="gene_id=mCG13300.2"
FT   mRNA            complement(join(30119418..30119573,30119649..30120005,
FT                   30120079..30120172,30120267..>30120437))
FT                   /locus_tag="mCG_13300"
FT                   /product="mCG13300"
FT                   /note="gene_id=mCG13300.2 transcript_id=mCT12958.2 created
FT                   on 27-NOV-2002"
FT   CDS             complement(join(30119422..30119573,30119649..30120005,
FT                   30120079..30120172,30120267..>30120437))
FT                   /codon_start=1
FT                   /locus_tag="mCG_13300"
FT                   /product="mCG13300"
FT                   /note="gene_id=mCG13300.2 transcript_id=mCT12958.2
FT                   protein_id=mCP4116.2"
FT                   /protein_id="EDL30943.1"
FT                   /translation="LQELLPKNVTHSWIERVFGKCGNVVYISIPHYKSTGDPKGFAFVE
FT                   FETKEQAAKAIEFLNNPPEEAPRKPGIFPKTVKNKPIPSLRVAEEKKKKKKKKGRIKKE
FT                   ESVQAKESAVDSSSSGVCKARKRPRKASEGSEAETPEAPKQPAKKKKKQDKVEASSLPE
FT                   ARAGKRERCSAEDEDCLPPRPKAKKRAQKDGVGQAASEVSKESRDLEFCSTEEEKETGD
FT                   RKGDSLSKVKRKHMKKHKERHKMGEEVIPLRVLSK"
FT   assembly_gap    30160377..30166469
FT                   /estimated_length=6093
FT                   /gap_type="unknown"
FT   assembly_gap    30180761..30180780
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    30211306..30211325
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    30215445..30215464
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    30248296..30248318
FT                   /estimated_length=23
FT                   /gap_type="unknown"
FT   assembly_gap    30257720..30258527
FT                   /estimated_length=808
FT                   /gap_type="unknown"
FT   assembly_gap    30281892..30282094
FT                   /estimated_length=203
FT                   /gap_type="unknown"
FT   assembly_gap    30310062..30310081
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    30312974..30312993
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    30320798..30320864
FT                   /estimated_length=67
FT                   /gap_type="unknown"
FT   assembly_gap    30332752..30332771
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    30335594..30335739
FT                   /estimated_length=146
FT                   /gap_type="unknown"
FT   assembly_gap    30341145..30342649
FT                   /estimated_length=1505
FT                   /gap_type="unknown"
FT   assembly_gap    30344298..30344317
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    30345546..30345565
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    30391097..30391116
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    30399507..30399559
FT                   /estimated_length=53
FT                   /gap_type="unknown"
FT   assembly_gap    30429821..30429943
FT                   /estimated_length=123
FT                   /gap_type="unknown"
FT   assembly_gap    30440429..30442663
FT                   /estimated_length=2235
FT                   /gap_type="unknown"
FT   assembly_gap    30444116..30445670
FT                   /estimated_length=1555
FT                   /gap_type="unknown"
FT   assembly_gap    30465160..30465179
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    30472179..30472198
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    30483661..30484476
FT                   /estimated_length=816
FT                   /gap_type="unknown"
FT   assembly_gap    30500360..30500504
FT                   /estimated_length=145
FT                   /gap_type="unknown"
FT   assembly_gap    30516687..30516909
FT                   /estimated_length=223
FT                   /gap_type="unknown"
FT   assembly_gap    30531070..30531089
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    30534199..30534389
FT                   /estimated_length=191
FT                   /gap_type="unknown"
FT   assembly_gap    30541954..30542052
FT                   /estimated_length=99
FT                   /gap_type="unknown"
FT   assembly_gap    30567216..30567243
FT                   /estimated_length=28
FT                   /gap_type="unknown"
FT   assembly_gap    30599249..30599285
FT                   /estimated_length=37
FT                   /gap_type="unknown"
FT   assembly_gap    30618243..30618262
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    30636624..30641850
FT                   /estimated_length=5227
FT                   /gap_type="unknown"
FT   assembly_gap    30643538..30643748
FT                   /estimated_length=211
FT                   /gap_type="unknown"
FT   assembly_gap    30681835..30681854
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    30683896..30683915
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    30685137..30685610
FT                   /estimated_length=474
FT                   /gap_type="unknown"
FT   assembly_gap    30687036..30687055
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    30705805..30705824
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    30706859..30706878
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    30708282..30708301
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    30737567..30740878
FT                   /estimated_length=3312
FT                   /gap_type="unknown"
FT   assembly_gap    30801358..30801377
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    30826213..30826232
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    30829867..30830276
FT                   /estimated_length=410
FT                   /gap_type="unknown"
FT   assembly_gap    30890807..30890826
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    30914219..30919128
FT                   /estimated_length=4910
FT                   /gap_type="unknown"
FT   assembly_gap    30924529..30924548
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    30933355..30934992
FT                   /estimated_length=1638
FT                   /gap_type="unknown"
FT   assembly_gap    30944165..30945123
FT                   /estimated_length=959
FT                   /gap_type="unknown"
FT   assembly_gap    30959923..30960773
FT                   /estimated_length=851
FT                   /gap_type="unknown"
FT   assembly_gap    30962093..30963888
FT                   /estimated_length=1796
FT                   /gap_type="unknown"
FT   assembly_gap    30968557..30968576
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    30973584..30973959
FT                   /estimated_length=376
FT                   /gap_type="unknown"
FT   assembly_gap    31001029..31001048
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    31002620..31002639
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    31035913..31036028
FT                   /estimated_length=116
FT                   /gap_type="unknown"
FT   assembly_gap    31039801..31039820
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    31065658..31065825
FT                   /estimated_length=168
FT                   /gap_type="unknown"
FT   assembly_gap    31086980..31086999
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    31089901..31090062
FT                   /estimated_length=162
FT                   /gap_type="unknown"
FT   assembly_gap    31092400..31092582
FT                   /estimated_length=183
FT                   /gap_type="unknown"
FT   assembly_gap    31106740..31106759
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    31111523..31111634
FT                   /estimated_length=112
FT                   /gap_type="unknown"
FT   assembly_gap    31112520..31112541
FT                   /estimated_length=22
FT                   /gap_type="unknown"
FT   assembly_gap    31235231..31235250
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    31253112..31253180
FT                   /estimated_length=69
FT                   /gap_type="unknown"
FT   assembly_gap    31315096..31317173
FT                   /estimated_length=2078
FT                   /gap_type="unknown"
FT   assembly_gap    31318048..31319539
FT                   /estimated_length=1492
FT                   /gap_type="unknown"
FT   assembly_gap    31339247..31339266
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    31358217..31359295
FT                   /estimated_length=1079
FT                   /gap_type="unknown"
FT   assembly_gap    31383255..31383274
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    31394369..31394388
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    31396091..31396110
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    31399806..31401187
FT                   /estimated_length=1382
FT                   /gap_type="unknown"
FT   assembly_gap    31428332..31428821
FT                   /estimated_length=490
FT                   /gap_type="unknown"
FT   assembly_gap    31448498..31448742
FT                   /estimated_length=245
FT                   /gap_type="unknown"
FT   assembly_gap    31450126..31451176
FT                   /estimated_length=1051
FT                   /gap_type="unknown"
FT   assembly_gap    31462763..31462782
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    31475084..31475103
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    31476579..31476598
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    31477609..31477628
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    31508519..31508538
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    31509955..31510846
FT                   /estimated_length=892
FT                   /gap_type="unknown"
FT   assembly_gap    31513248..31513267
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    31515678..31515697
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    31516902..31516921
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    31550140..31550159
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    31567141..31567160
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    31591040..31591059
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    31599086..31599105
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    31611117..31614738
FT                   /estimated_length=3622
FT                   /gap_type="unknown"
FT   assembly_gap    31616224..31616520
FT                   /estimated_length=297
FT                   /gap_type="unknown"
FT   assembly_gap    31617606..31618196
FT                   /estimated_length=591
FT                   /gap_type="unknown"
FT   assembly_gap    31623351..31624799
FT                   /estimated_length=1449
FT                   /gap_type="unknown"
FT   assembly_gap    31720924..31720943
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    31732538..31732557
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    31741014..31741765
FT                   /estimated_length=752
FT                   /gap_type="unknown"
FT   assembly_gap    31773526..31773545
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    31784178..31784467
FT                   /estimated_length=290
FT                   /gap_type="unknown"
FT   assembly_gap    31787156..31792575
FT                   /estimated_length=5420
FT                   /gap_type="unknown"
FT   assembly_gap    31801953..31801972
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    31803073..31803092
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    31811431..31812826
FT                   /estimated_length=1396
FT                   /gap_type="unknown"
FT   assembly_gap    31815404..31815423
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    31832678..31832697
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    31867632..31868023
FT                   /estimated_length=392
FT                   /gap_type="unknown"
FT   assembly_gap    31946005..31946036
FT                   /estimated_length=32
FT                   /gap_type="unknown"
FT   assembly_gap    31997687..31997706
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    32069803..32069959
FT                   /estimated_length=157
FT                   /gap_type="unknown"
FT   assembly_gap    32070659..32070799
FT                   /estimated_length=141
FT                   /gap_type="unknown"
FT   assembly_gap    32134400..32134855
FT                   /estimated_length=456
FT                   /gap_type="unknown"
FT   assembly_gap    32141608..32141951
FT                   /estimated_length=344
FT                   /gap_type="unknown"
FT   assembly_gap    32193944..32193963
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    32198985..32199165
FT                   /estimated_length=181
FT                   /gap_type="unknown"
FT   assembly_gap    32207178..32207197
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    32251093..32252273
FT                   /estimated_length=1181
FT                   /gap_type="unknown"
FT   assembly_gap    32330815..32330834
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    32333984..32334003
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    32335893..32336441
FT                   /estimated_length=549
FT                   /gap_type="unknown"
FT   gene            complement(32358464..>32374713)
FT                   /locus_tag="mCG_1043585"
FT                   /note="gene_id=mCG1043585.1"
FT   mRNA            complement(join(32358464..32358883,32361961..32362086,
FT                   32362948..32363071,32365317..32365398,32374545..>32374713))
FT                   /locus_tag="mCG_1043585"
FT                   /product="mCG1043585"
FT                   /note="gene_id=mCG1043585.1 transcript_id=mCT161289.1
FT                   created on 29-JAN-2003"
FT   CDS             complement(join(32365327..32365398,32374545..>32374655))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1043585"
FT                   /product="mCG1043585"
FT                   /note="gene_id=mCG1043585.1 transcript_id=mCT161289.1
FT                   protein_id=mCP76310.1"
FT                   /protein_id="EDL30942.1"
FT                   /translation="VAFQHFCSGFAILKIHPSQTLSHAPSPSVALCHGSEKCLSPDGSL
FT                   DPRSNSLSLIISASI"
FT   assembly_gap    32376147..32376166
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(32397594..32454679)
FT                   /gene="5830433M19Rik"
FT                   /locus_tag="mCG_11650"
FT                   /note="gene_id=mCG11650.3"
FT   mRNA            complement(join(32397594..32398927,32418626..32418699,
FT                   32446725..32446800,32448031..32448115,32448874..32449074,
FT                   32454063..32454679))
FT                   /gene="5830433M19Rik"
FT                   /locus_tag="mCG_11650"
FT                   /product="RIKEN cDNA 5830433M19, transcript variant
FT                   mCT174846"
FT                   /note="gene_id=mCG11650.3 transcript_id=mCT174846.1 created
FT                   on 19-MAR-2004"
FT   CDS             complement(join(32398536..32398927,32418626..32418699,
FT                   32446725..32446800,32448031..32448115,32448874..32449074,
FT                   32454063..32454305))
FT                   /codon_start=1
FT                   /gene="5830433M19Rik"
FT                   /locus_tag="mCG_11650"
FT                   /product="RIKEN cDNA 5830433M19, isoform CRA_b"
FT                   /note="gene_id=mCG11650.3 transcript_id=mCT174846.1
FT                   protein_id=mCP97765.1 isoform=CRA_b"
FT                   /protein_id="EDL30941.1"
FT                   /translation="MTGKKSSREKRRKRSGQEAAASLAAPDLVPVLSGSAGGCGSGGCC
FT                   GVAGGGTSVAGGAERSERRKRRSTDSSSSVSGSLQQETKYLLPSLEKELFLAEHSDLEE
FT                   GGLDLNVSLKPVSFYISDKKEMLQQCFCIIGEKKLQKMLPDVLKNCSVEEIKKLCQEQL
FT                   ELLSEKQILKILEGDNGLDSDMEEEADDGCKVAPDLISQQDTCVDSTSSLRENKQPEGL
FT                   ESKQGKGEDSDVLSINADAYDSDIEGPSIDEAAAAATATPAATAVATAASEVPENTVQS
FT                   EAGQIDDLERDIEKSVNEILGLAESSPKEPKVATLTVPPAEDVQPSAQQLELLELEMRA
FT                   RAIKALMKAGDIKKPV"
FT   assembly_gap    32404774..32404876
FT                   /estimated_length=103
FT                   /gap_type="unknown"
FT   assembly_gap    32424747..32424842
FT                   /estimated_length=96
FT                   /gap_type="unknown"
FT   mRNA            complement(join(32447306..32448115,32448874..32449074,
FT                   32454063..32454679))
FT                   /gene="5830433M19Rik"
FT                   /locus_tag="mCG_11650"
FT                   /product="RIKEN cDNA 5830433M19, transcript variant
FT                   mCT12085"
FT                   /note="gene_id=mCG11650.3 transcript_id=mCT12085.2 created
FT                   on 19-MAR-2004"
FT   CDS             complement(join(32447993..32448115,32448874..32449074,
FT                   32454063..32454305))
FT                   /codon_start=1
FT                   /gene="5830433M19Rik"
FT                   /locus_tag="mCG_11650"
FT                   /product="RIKEN cDNA 5830433M19, isoform CRA_a"
FT                   /note="gene_id=mCG11650.3 transcript_id=mCT12085.2
FT                   protein_id=mCP17172.3 isoform=CRA_a"
FT                   /protein_id="EDL30940.1"
FT                   /translation="MTGKKSSREKRRKRSGQEAAASLAAPDLVPVLSGSAGGCGSGGCC
FT                   GVAGGGTSVAGGAERSERRKRRSTDSSSSVSGSLQQETKYLLPSLEKELFLAEHSDLEE
FT                   GGLDLNVSLKPVSFYISDKKEMLQQCFCIIGEKKLQKMLPDVLKNCSVEEIKKLCQEQL
FT                   ELLSEKQILKILEGKNEHFSVLPTY"
FT   assembly_gap    32460314..32460333
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    32461387..32461406
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(32467708..32502390)
FT                   /gene="Plaa"
FT                   /locus_tag="mCG_11651"
FT                   /note="gene_id=mCG11651.1"
FT   mRNA            complement(join(32467708..32468997,32470775..32470939,
FT                   32473087..32473188,32474270..32474338,32477484..32477552,
FT                   32481644..32481863,32482577..32482734,32482996..32483165,
FT                   32485458..32485593,32485916..32486083,32486444..32486564,
FT                   32486650..32486750,32489050..32489243,32502013..32502273,
FT                   32502329..32502390))
FT                   /gene="Plaa"
FT                   /locus_tag="mCG_11651"
FT                   /product="phospholipase A2, activating protein, transcript
FT                   variant mCT12086"
FT                   /note="gene_id=mCG11651.1 transcript_id=mCT12086.2 created
FT                   on 25-OCT-2002"
FT   mRNA            complement(join(32468258..32468997,32470775..32470939,
FT                   32473087..32473188,32474270..32474338,32481644..32481863,
FT                   32482577..32482734,32482996..32483165,32485458..32485593,
FT                   32485916..32486083,32486444..32486564,32486650..32486750,
FT                   32489050..32489243,32502013..32502389))
FT                   /gene="Plaa"
FT                   /locus_tag="mCG_11651"
FT                   /product="phospholipase A2, activating protein, transcript
FT                   variant mCT174847"
FT                   /note="gene_id=mCG11651.1 transcript_id=mCT174847.0 created
FT                   on 25-OCT-2002"
FT   mRNA            complement(join(32468258..32468997,32470775..32470939,
FT                   32473087..32473188,32474270..32474338,32477484..32477552,
FT                   32481644..32481863,32482577..32482734,32482996..32483165,
FT                   32485458..32485593,32485916..32486083,32486444..32486564,
FT                   32486650..32486750,32489050..32489243,32502013..>32502315))
FT                   /gene="Plaa"
FT                   /locus_tag="mCG_11651"
FT                   /product="phospholipase A2, activating protein, transcript
FT                   variant mCT192837"
FT                   /note="gene_id=mCG11651.1 transcript_id=mCT192837.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(32468435..32468997,32470775..32470939,
FT                   32473087..32473188,32474270..32474338,32477484..32477552,
FT                   32481644..32481863,32482577..32482734,32482996..32483165,
FT                   32485458..32485593,32485916..32486083,32486444..32486564,
FT                   32486650..32486750,32489050..32489243,32502013..>32502314))
FT                   /codon_start=1
FT                   /gene="Plaa"
FT                   /locus_tag="mCG_11651"
FT                   /product="phospholipase A2, activating protein, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG11651.1 transcript_id=mCT192837.0
FT                   protein_id=mCP113780.0 isoform=CRA_c"
FT                   /protein_id="EDL30938.1"
FT                   /translation="AVLPHRLTGSSGLRRPSPAGGSRAAAWRTPARACGRVSRCARGPG
FT                   SGSTLAMASGASRYRLSCSLPGHELDVRGLVCCLYPPGAFVSVSRDRTTRLWAPDSPNR
FT                   GFTEMHCMSGHSNFVSCVCIIPSSDIYPHGLIATGGNDHNICIFSLDSPMPLYILKGHK
FT                   DTVCSLSSGKFGTLLSGSWDTTAKVWLNDKCMMTLQGHTAAVWAVKILPEQGLMLTGSA
FT                   DKTIKLWKAGRCERTFLGHEDCVRGLAILSETEFLSCANDASIRRWQITGECLEVYFGH
FT                   TNYIYSISVFPNSKDFVTTAEDRSLRIWKHGECAQTIRLPAQSIWCCCVLENGDIVVGA
FT                   SDGIIRVFTESEERTASAEEIKAFERELSQATIDSKTGDLGDINAEQLPGREHLSEPGT
FT                   REGQTRLIRDGERVEAYQWSVSDGRWIKIGDVVGSSGANQQTSGKVLYEGKEFDYVFSI
FT                   DVNEGGPSYKLPYNVSDDPWLVAYNFLQKNDLNPMFLDQVAKFIIDNTKGQTLGLGNTS
FT                   FSDPFTGGGRYVPGTSGPSNTVQTADPFTGAGRYMPGSAGMDTTMTGVDPFTGNSAYRS
FT                   AASKTVNIYFPKKEALTFDQANPTQILGKLKELNGTAPEEKKLTEDDLVLLEKILSLIC
FT                   NNSSEKPTAQQLQILWKAINWPEDIVFPALDILRLSIKHPNVNENFCNEKGDQFSSHLI
FT                   NLLNPKGKPANQLLALRTFCNCFVSQAGQKLMMSQRESLMSHAIELKSGSNKNIHIALA
FT                   TLTLNYSVCFHKDHNIEGKAQCLSVISTILEVVQDLEATFRLLVALGTLISDDSNAIQL
FT                   AKSLGVDSQIKKYVSVSEPAKVSECCRLVLHLL"
FT   CDS             complement(join(32468435..32468997,32470775..32470939,
FT                   32473087..32473188,32474270..32474338,32481644..32481863,
FT                   32482577..32482734,32482996..32483165,32485458..32485593,
FT                   32485916..32486083,32486444..32486564,32486650..32486750,
FT                   32489050..32489243,32502013..32502161))
FT                   /codon_start=1
FT                   /gene="Plaa"
FT                   /locus_tag="mCG_11651"
FT                   /product="phospholipase A2, activating protein, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG11651.1 transcript_id=mCT174847.0
FT                   protein_id=mCP97766.0 isoform=CRA_b"
FT                   /protein_id="EDL30937.1"
FT                   /translation="MASGASRYRLSCSLPGHELDVRGLVCCLYPPGAFVSVSRDRTTRL
FT                   WAPDSPNRGFTEMHCMSGHSNFVSCVCIIPSSDIYPHGLIATGGNDHNICIFSLDSPMP
FT                   LYILKGHKDTVCSLSSGKFGTLLSGSWDTTAKVWLNDKCMMTLQGHTAAVWAVKILPEQ
FT                   GLMLTGSADKTIKLWKAGRCERTFLGHEDCVRGLAILSETEFLSCANDASIRRWQITGE
FT                   CLEVYFGHTNYIYSISVFPNSKDFVTTAEDRSLRIWKHGECAQTIRLPAQSIWCCCVLE
FT                   NGDIVVGASDGIIRVFTESEERTASAEEIKAFERELSQATIDSKTGDLGDINAEQLPGR
FT                   EHLSEPGTREGQTRLIRDGERVEAYQWSVSDGRWIKIGDVVGSSGANQQTSGKVLYEGK
FT                   EFDYVFSIDVNEGGPSYKLPYNVSDDPWLVAYNFLQKNDLNPMFLDQVAKFIIDNTKGQ
FT                   TLGLGNTSFSDPFTGAGRYMPGSAGMDTTMTGVDPFTGNSAYRSAASKTVNIYFPKKEA
FT                   LTFDQANPTQILGKLKELNGTAPEEKKLTEDDLVLLEKILSLICNNSSEKPTAQQLQIL
FT                   WKAINWPEDIVFPALDILRLSIKHPNVNENFCNEKGDQFSSHLINLLNPKGKPANQLLA
FT                   LRTFCNCFVSQAGQKLMMSQRESLMSHAIELKSGSNKNIHIALATLTLNYSVCFHKDHN
FT                   IEGKAQCLSVISTILEVVQDLEATFRLLVALGTLISDDSNAIQLAKSLGVDSQIKKYVS
FT                   VSEPAKVSECCRLVLHLL"
FT   CDS             complement(join(32468435..32468997,32470775..32470939,
FT                   32473087..32473188,32474270..32474338,32477484..32477552,
FT                   32481644..32481863,32482577..32482734,32482996..32483165,
FT                   32485458..32485593,32485916..32486083,32486444..32486564,
FT                   32486650..32486750,32489050..32489243,32502013..32502161))
FT                   /codon_start=1
FT                   /gene="Plaa"
FT                   /locus_tag="mCG_11651"
FT                   /product="phospholipase A2, activating protein, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG11651.1 transcript_id=mCT12086.2
FT                   protein_id=mCP17175.2 isoform=CRA_a"
FT                   /db_xref="GOA:P27612"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR013535"
FT                   /db_xref="InterPro:IPR015155"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="MGI:MGI:104810"
FT                   /db_xref="UniProtKB/Swiss-Prot:P27612"
FT                   /protein_id="EDL30936.1"
FT                   /translation="MASGASRYRLSCSLPGHELDVRGLVCCLYPPGAFVSVSRDRTTRL
FT                   WAPDSPNRGFTEMHCMSGHSNFVSCVCIIPSSDIYPHGLIATGGNDHNICIFSLDSPMP
FT                   LYILKGHKDTVCSLSSGKFGTLLSGSWDTTAKVWLNDKCMMTLQGHTAAVWAVKILPEQ
FT                   GLMLTGSADKTIKLWKAGRCERTFLGHEDCVRGLAILSETEFLSCANDASIRRWQITGE
FT                   CLEVYFGHTNYIYSISVFPNSKDFVTTAEDRSLRIWKHGECAQTIRLPAQSIWCCCVLE
FT                   NGDIVVGASDGIIRVFTESEERTASAEEIKAFERELSQATIDSKTGDLGDINAEQLPGR
FT                   EHLSEPGTREGQTRLIRDGERVEAYQWSVSDGRWIKIGDVVGSSGANQQTSGKVLYEGK
FT                   EFDYVFSIDVNEGGPSYKLPYNVSDDPWLVAYNFLQKNDLNPMFLDQVAKFIIDNTKGQ
FT                   TLGLGNTSFSDPFTGGGRYVPGTSGPSNTVQTADPFTGAGRYMPGSAGMDTTMTGVDPF
FT                   TGNSAYRSAASKTVNIYFPKKEALTFDQANPTQILGKLKELNGTAPEEKKLTEDDLVLL
FT                   EKILSLICNNSSEKPTAQQLQILWKAINWPEDIVFPALDILRLSIKHPNVNENFCNEKG
FT                   DQFSSHLINLLNPKGKPANQLLALRTFCNCFVSQAGQKLMMSQRESLMSHAIELKSGSN
FT                   KNIHIALATLTLNYSVCFHKDHNIEGKAQCLSVISTILEVVQDLEATFRLLVALGTLIS
FT                   DDSNAIQLAKSLGVDSQIKKYVSVSEPAKVSECCRLVLHLL"
FT   assembly_gap    32495406..32495460
FT                   /estimated_length=55
FT                   /gap_type="unknown"
FT   gene            <32498513..>32498923
FT                   /locus_tag="mCG_142395"
FT                   /note="gene_id=mCG142395.0"
FT   mRNA            <32498513..>32498923
FT                   /locus_tag="mCG_142395"
FT                   /product="mCG142395"
FT                   /note="gene_id=mCG142395.0 transcript_id=mCT180378.0
FT                   created on 11-FEB-2003"
FT   CDS             32498513..32498923
FT                   /codon_start=1
FT                   /locus_tag="mCG_142395"
FT                   /product="mCG142395"
FT                   /note="gene_id=mCG142395.0 transcript_id=mCT180378.0
FT                   protein_id=mCP103300.0"
FT                   /protein_id="EDL30939.1"
FT                   /translation="MARTKQTARKSTGGNSPRKQLATKAARKSAPSTGGVKKPHRYRPG
FT                   TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASGAFLVGL
FT                   FEDTNLCAIHAKRVTIMPKDIQLARRIRGERA"
FT   gene            32513584..32592947
FT                   /gene="Ift74"
FT                   /locus_tag="mCG_11647"
FT                   /note="gene_id=mCG11647.2"
FT   mRNA            join(32513584..32513715,32517013..32517147,
FT                   32521413..32521548,32524298..32524346,32526544..32526642,
FT                   32526819..32526879,32532284..32532343,32535379..32535440,
FT                   32552521..32552659,32554418..32554480,32558096..32558239,
FT                   32560541..32560581,32562180..32562259,32577906..32577959,
FT                   32578821..32578918,32579575..32579701,32585222..32585385,
FT                   32586542..32586667,32591438..32591498,32592669..32592947)
FT                   /gene="Ift74"
FT                   /locus_tag="mCG_11647"
FT                   /product="intraflagellar transport 74 homolog
FT                   (Chlamydomonas)"
FT                   /note="gene_id=mCG11647.2 transcript_id=mCT12081.2 created
FT                   on 04-OCT-2002"
FT   assembly_gap    32514887..32514906
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(32517028..32517147,32521413..32521548,
FT                   32524298..32524346,32526544..32526642,32526819..32526879,
FT                   32532284..32532343,32535379..32535440,32552521..32552659,
FT                   32554418..32554480,32558096..32558239,32560541..32560581,
FT                   32562180..32562259,32577906..32577959,32578821..32578918,
FT                   32579575..32579701,32585222..32585385,32586542..32586667,
FT                   32591438..32591498,32592669..32592787)
FT                   /codon_start=1
FT                   /gene="Ift74"
FT                   /locus_tag="mCG_11647"
FT                   /product="intraflagellar transport 74 homolog
FT                   (Chlamydomonas)"
FT                   /note="gene_id=mCG11647.2 transcript_id=mCT12081.2
FT                   protein_id=mCP17167.1"
FT                   /protein_id="EDL30933.1"
FT                   /translation="MASNHKSSAPRPISRGGIGLTGRPPSGIRPPSGNVRVATAMPPTT
FT                   ARPGSRGGPLGTGGVLSSQIKVADRPVTQQGLSGMKTGMKGPQRQILDKSYYLGLLRSK
FT                   ISELTTEINKLQKEIEMYNQENSVYLSYEKRAETLAVEIKDFQGQLADYNMLVDKLNTN
FT                   TEMEEVMSDYNMLKAQNDRETQSMDVIFTERQAKEKQIRSVEEEVEQEKQAADGIIKNM
FT                   SPEKQVKYIEMKTTNEKLLQELDTLQQQLDSLNMKKESLETEIAHSQVKQEAVLLYEKL
FT                   YELESHRDQMIAEDKSMGSPMEERERLLKQVKEDNQEIASMERQLTDIKEKINQFSEEI
FT                   RQLDMDLEEHQGEMNQKYKELKKREENMDAFIETFEETKNQELERKAQIEASIITLLEH
FT                   CSRNINRMKQISSITNQELKMMQDDLSFKSTEMQKSQTTARNLTSDSQRLQLDLQKMEL
FT                   LESKMTEEQQSLKNKIKQMTADLETYSDLAALKSSAEEKKKKLHQERTVLSTHRNAFKK
FT                   IMEKLTSDYDTLKTQLQDNETHAQLTNLERKWQHLEQNNFVMKEFIATKSQESDYQPVI
FT                   KNVMKQIAEYNKTIMDALHNASRS"
FT   assembly_gap    32518925..32519333
FT                   /estimated_length=409
FT                   /gap_type="unknown"
FT   assembly_gap    32530511..32530560
FT                   /estimated_length=50
FT                   /gap_type="unknown"
FT   gene            complement(32537748..>32549729)
FT                   /gene="Lrrc19"
FT                   /locus_tag="mCG_11652"
FT                   /note="gene_id=mCG11652.2"
FT   mRNA            complement(join(32537748..32538159,32538814..32538990,
FT                   32540062..32540575,32542904..32542987,32549623..>32549713))
FT                   /gene="Lrrc19"
FT                   /locus_tag="mCG_11652"
FT                   /product="leucine rich repeat containing 19, transcript
FT                   variant mCT176327"
FT                   /note="gene_id=mCG11652.2 transcript_id=mCT176327.0 created
FT                   on 27-NOV-2002"
FT   mRNA            complement(join(32537749..32538159,32538814..32538990,
FT                   32540062..32540575,32542904..32542987,32547905..32547972,
FT                   32549623..>32549729))
FT                   /gene="Lrrc19"
FT                   /locus_tag="mCG_11652"
FT                   /product="leucine rich repeat containing 19, transcript
FT                   variant mCT12084"
FT                   /note="gene_id=mCG11652.2 transcript_id=mCT12084.1 created
FT                   on 27-NOV-2002"
FT   CDS             complement(join(32537831..32538159,32538814..32538990,
FT                   32540062..32540575,32542904..32542987,32549623..>32549679))
FT                   /codon_start=1
FT                   /gene="Lrrc19"
FT                   /locus_tag="mCG_11652"
FT                   /product="leucine rich repeat containing 19, isoform CRA_b"
FT                   /note="gene_id=mCG11652.2 transcript_id=mCT176327.0
FT                   protein_id=mCP99249.0 isoform=CRA_b"
FT                   /protein_id="EDL30935.1"
FT                   /translation="KKQSKLAHTALRYKKEKGKAFDMKVTRFMFWLFSMLLPSVKSQAS
FT                   ETEVPCNFSRRNYTLIPEGISTNVTILDLSYNRITLNAADSRVLQMYSLLTELYLMENN
FT                   IIALYNSSFRNLLNLEILNICGNSISVIQQGSFVGLNELKQLFLCQNKILQLNPDTFVP
FT                   LNNLKVLNLQGNLIRLFDAPQLPHLEILTLDGNPWNCTCGLLELHNWLNTSNVTLENEN
FT                   MTMCSYPDELKHDSIKSAPFTTECHSTFISTITEDFQSARNSSFDSSSHNLTWTSEHEP
FT                   LGKSWAFLVGVVATVLLTSLLIFIAIKCPVWYNILLSYNHHRLEEHEAETYENGLTRNP
FT                   SSLSQITDTNSEDTTVIFEQLHAFVVDDDGFIEDRYIDINEVHEEK"
FT   CDS             complement(join(32537831..32538159,32538814..32538990,
FT                   32540062..32540575,32542904..32542987,32547905..>32547949))
FT                   /codon_start=1
FT                   /gene="Lrrc19"
FT                   /locus_tag="mCG_11652"
FT                   /product="leucine rich repeat containing 19, isoform CRA_a"
FT                   /note="gene_id=mCG11652.2 transcript_id=mCT12084.1
FT                   protein_id=mCP17182.1 isoform=CRA_a"
FT                   /protein_id="EDL30934.1"
FT                   /translation="KVQAIKDVIKLFLEQAFDMKVTRFMFWLFSMLLPSVKSQASETEV
FT                   PCNFSRRNYTLIPEGISTNVTILDLSYNRITLNAADSRVLQMYSLLTELYLMENNIIAL
FT                   YNSSFRNLLNLEILNICGNSISVIQQGSFVGLNELKQLFLCQNKILQLNPDTFVPLNNL
FT                   KVLNLQGNLIRLFDAPQLPHLEILTLDGNPWNCTCGLLELHNWLNTSNVTLENENMTMC
FT                   SYPDELKHDSIKSAPFTTECHSTFISTITEDFQSARNSSFDSSSHNLTWTSEHEPLGKS
FT                   WAFLVGVVATVLLTSLLIFIAIKCPVWYNILLSYNHHRLEEHEAETYENGLTRNPSSLS
FT                   QITDTNSEDTTVIFEQLHAFVVDDDGFIEDRYIDINEVHEEK"
FT   assembly_gap    32571150..32571169
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    32574783..32574890
FT                   /estimated_length=108
FT                   /gap_type="unknown"
FT   assembly_gap    32585533..32585727
FT                   /estimated_length=195
FT                   /gap_type="unknown"
FT   assembly_gap    32598995..32599014
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    32601898..32607002
FT                   /estimated_length=5105
FT                   /gap_type="unknown"
FT   assembly_gap    32618941..32618960
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    32631318..32631386
FT                   /estimated_length=69
FT                   /gap_type="unknown"
FT   gene            <32638621..32761056
FT                   /gene="Tek"
FT                   /locus_tag="mCG_122568"
FT                   /note="gene_id=mCG122568.2"
FT   mRNA            join(<32638621..32639018,32679684..32679995,
FT                   32691201..32691311,32696873..32697004,32697401..32697541,
FT                   32703868..32703996,32706380..32706531,32713555..32713699,
FT                   32713969..32714124,32716184..32716318,32723416..32723703,
FT                   32735794..32736093,32737899..32738053,32739545..32739755,
FT                   32741444..32741554,32745030..32745220,32745715..32745828,
FT                   32749731..32749801,32750723..32750763,32751543..32751639,
FT                   32759162..32759261,32760042..32761054)
FT                   /gene="Tek"
FT                   /locus_tag="mCG_122568"
FT                   /product="endothelial-specific receptor tyrosine kinase,
FT                   transcript variant mCT192880"
FT                   /note="gene_id=mCG122568.2 transcript_id=mCT192880.0
FT                   created on 09-MAR-2004"
FT   mRNA            join(32638626..32639018,32679684..32679995,
FT                   32691201..32691311,32691716..32691868,32696873..32697004,
FT                   32697401..32697541,32703868..32703996,32706380..32706531,
FT                   32713555..32713699,32713969..32714124,32716184..32716318,
FT                   32723416..32723703,32735794..32736093,32737899..32738053,
FT                   32739545..32739755,32741444..32741554,32745030..32745220,
FT                   32745715..32745828,32749731..32749801,32750723..32750763,
FT                   32751543..32751639,32759162..32759261,32760042..32761056)
FT                   /gene="Tek"
FT                   /locus_tag="mCG_122568"
FT                   /product="endothelial-specific receptor tyrosine kinase,
FT                   transcript variant mCT123790"
FT                   /note="gene_id=mCG122568.2 transcript_id=mCT123790.1
FT                   created on 27-SEP-2002"
FT   CDS             join(<32638901..32639018,32679684..32679995,
FT                   32691201..32691311,32696873..32697004,32697401..32697541,
FT                   32703868..32703996,32706380..32706531,32713555..32713699,
FT                   32713969..32714124,32716184..32716318,32723416..32723703,
FT                   32735794..32736093,32737899..32738053,32739545..32739755,
FT                   32741444..32741554,32745030..32745220,32745715..32745828,
FT                   32749731..32749801,32750723..32750763,32751543..32751639,
FT                   32759162..32759261,32760042..32760116)
FT                   /codon_start=1
FT                   /gene="Tek"
FT                   /locus_tag="mCG_122568"
FT                   /product="endothelial-specific receptor tyrosine kinase,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG122568.2 transcript_id=mCT192880.0
FT                   protein_id=mCP113832.0 isoform=CRA_b"
FT                   /protein_id="EDL30932.1"
FT                   /translation="VVESFPGTHAHLWTLDGEIWGSMDSLAGLVLCGVSLLLYGVVEGA
FT                   MDLILINSLPLVSDAETSLTCIASGWHPHEPITIGRDFEALMNQHQDPLEVTQDVTREW
FT                   AKKVVWKREKASKINGAYFCEGRVRGQAIRIRTMKMRQQASFLPATLTMTVDRGDNVNI
FT                   SFKKVLIKEEDAVIYKNGCEAQKWGPDCSRPCTTCKNNGVCHEDTGECICPPGFMGRTC
FT                   EKACEPHTFGRTCKERCSGPEGCKSYVFCLPDPYGCSCATGWRGLQCNEACPSGYYGPD
FT                   CKLRCHCTNEEICDRFQGCLCSQGWQGLQCEKEGRPRMTPQIEDLPDHIEVNSGKFNPI
FT                   CKASGWPLPTSEEMTLVKPDGTVLQPNDFNYTDRFSVAIFTVNRVLPPDSGVWVCSVNT
FT                   VAGMVEKPFNISVKVLPEPLHAPNVIDTGHNFAIINISSEPYFGDGPIKSKKLFYKPVN
FT                   QAWKYIEVTNEIFTLNYLEPRTDYELCVQLARPGEGGEGHPGPVRRFTTASIGLPPPRG
FT                   LSLLPKSQTALNLTWQPIFTNSEDEFYVEVERRSLQTTSDQQNIKVPGNLTSVLLSNLV
FT                   PREQYTVRARVNTKAQGEWSEELRAWTLSDILPPQPENIKISNITDSTAMVSWTIVDGY
FT                   SISSIIIRYKVQGKNEDQHIDVKIKNATVTQYQLKGLEPETTYHVDIFAENNIGSSNPA
FT                   FSHELRTLPHSPASADLGGGKMLLIAILGSAGMTCITVLLAFLIMLQLKRANVQRRMAQ
FT                   AFQNVREEPAVQFNSGTLALNRKAKNNPDPTIYPVLDWNDIKFQDVIGEGNFGQVLKAR
FT                   IKKDGLRMDAAIKRMKEYASKDDHRDFAGELEVLCKLGHHPNIINLLGACEHRGYLYLA
FT                   IEYAPHGNLLDFLRKSRVLETDPAFAIANSTASTLSSQQLLHFAADVARGMDYLSQKQF
FT                   IHRDLAARNILVGENYIAKIADFGLSRGQEVYVKKTMGRLPVRWMAIESLNYSVYTTNS
FT                   DVWSYGVLLWEIVSLGGTPYCGMTCAELYEKLPQGYRLEKPLNCDDEVYDLMRQCWREK
FT                   PYERPSFAQILVSLNRMLEERKTYVNTTLYEKFTYAGIDCSAEEAA"
FT   CDS             join(32638967..32639018,32679684..32679995,
FT                   32691201..32691311,32691716..32691868,32696873..32697004,
FT                   32697401..32697541,32703868..32703996,32706380..32706531,
FT                   32713555..32713699,32713969..32714124,32716184..32716318,
FT                   32723416..32723703,32735794..32736093,32737899..32738053,
FT                   32739545..32739755,32741444..32741554,32745030..32745220,
FT                   32745715..32745828,32749731..32749801,32750723..32750763,
FT                   32751543..32751639,32759162..32759261,32760042..32760116)
FT                   /codon_start=1
FT                   /gene="Tek"
FT                   /locus_tag="mCG_122568"
FT                   /product="endothelial-specific receptor tyrosine kinase,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG122568.2 transcript_id=mCT123790.1
FT                   protein_id=mCP76323.1 isoform=CRA_a"
FT                   /db_xref="GOA:B1AWS8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR002049"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR008266"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR013032"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR018941"
FT                   /db_xref="InterPro:IPR020635"
FT                   /db_xref="MGI:MGI:98664"
FT                   /db_xref="UniProtKB/TrEMBL:B1AWS8"
FT                   /protein_id="EDL30931.1"
FT                   /translation="MDSLAGLVLCGVSLLLYGVVEGAMDLILINSLPLVSDAETSLTCI
FT                   ASGWHPHEPITIGRDFEALMNQHQDPLEVTQDVTREWAKKVVWKREKASKINGAYFCEG
FT                   RVRGQAIRIRTMKMRQQASFLPATLTMTVDRGDNVNISFKKVLIKEEDAVIYKNGSFIH
FT                   SVPRHEVPDILEVHLPHAQPQDAGVYSARYIGGNLFTSAFTRLIVRRCEAQKWGPDCSR
FT                   PCTTCKNNGVCHEDTGECICPPGFMGRTCEKACEPHTFGRTCKERCSGPEGCKSYVFCL
FT                   PDPYGCSCATGWRGLQCNEACPSGYYGPDCKLRCHCTNEEICDRFQGCLCSQGWQGLQC
FT                   EKEGRPRMTPQIEDLPDHIEVNSGKFNPICKASGWPLPTSEEMTLVKPDGTVLQPNDFN
FT                   YTDRFSVAIFTVNRVLPPDSGVWVCSVNTVAGMVEKPFNISVKVLPEPLHAPNVIDTGH
FT                   NFAIINISSEPYFGDGPIKSKKLFYKPVNQAWKYIEVTNEIFTLNYLEPRTDYELCVQL
FT                   ARPGEGGEGHPGPVRRFTTASIGLPPPRGLSLLPKSQTALNLTWQPIFTNSEDEFYVEV
FT                   ERRSLQTTSDQQNIKVPGNLTSVLLSNLVPREQYTVRARVNTKAQGEWSEELRAWTLSD
FT                   ILPPQPENIKISNITDSTAMVSWTIVDGYSISSIIIRYKVQGKNEDQHIDVKIKNATVT
FT                   QYQLKGLEPETTYHVDIFAENNIGSSNPAFSHELRTLPHSPASADLGGGKMLLIAILGS
FT                   AGMTCITVLLAFLIMLQLKRANVQRRMAQAFQNVREEPAVQFNSGTLALNRKAKNNPDP
FT                   TIYPVLDWNDIKFQDVIGEGNFGQVLKARIKKDGLRMDAAIKRMKEYASKDDHRDFAGE
FT                   LEVLCKLGHHPNIINLLGACEHRGYLYLAIEYAPHGNLLDFLRKSRVLETDPAFAIANS
FT                   TASTLSSQQLLHFAADVARGMDYLSQKQFIHRDLAARNILVGENYIAKIADFGLSRGQE
FT                   VYVKKTMGRLPVRWMAIESLNYSVYTTNSDVWSYGVLLWEIVSLGGTPYCGMTCAELYE
FT                   KLPQGYRLEKPLNCDDEVYDLMRQCWREKPYERPSFAQILVSLNRMLEERKTYVNTTLY
FT                   EKFTYAGIDCSAEEAA"
FT   assembly_gap    32657222..32657241
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    32666877..32667064
FT                   /estimated_length=188
FT                   /gap_type="unknown"
FT   assembly_gap    32687613..32687632
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    32725711..32725788
FT                   /estimated_length=78
FT                   /gap_type="unknown"
FT   assembly_gap    32728728..32730963
FT                   /estimated_length=2236
FT                   /gap_type="unknown"
FT   assembly_gap    32740032..32740051
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    32769664..32772753
FT                   /estimated_length=3090
FT                   /gap_type="unknown"
FT   gene            complement(32786817..32801361)
FT                   /gene="4930579C15Rik"
FT                   /locus_tag="mCG_11649"
FT                   /note="gene_id=mCG11649.2"
FT   mRNA            complement(join(32786817..32787148,32787272..32787345,
FT                   32792457..32792610,32796182..32796241,32797438..32797482,
FT                   32798078..32798140,32799458..32799541,32800836..32800994,
FT                   32801193..32801361))
FT                   /gene="4930579C15Rik"
FT                   /locus_tag="mCG_11649"
FT                   /product="RIKEN cDNA 4930579C15, transcript variant
FT                   mCT12083"
FT                   /note="gene_id=mCG11649.2 transcript_id=mCT12083.2 created
FT                   on 27-FEB-2003"
FT   mRNA            complement(join(32786955..32787345,32792457..32792610,
FT                   32796182..32796241,32797438..32797482,32798078..32798140,
FT                   32799458..32799541,32800836..32800994,32801193..32801310))
FT                   /gene="4930579C15Rik"
FT                   /locus_tag="mCG_11649"
FT                   /product="RIKEN cDNA 4930579C15, transcript variant
FT                   mCT180722"
FT                   /note="gene_id=mCG11649.2 transcript_id=mCT180722.0 created
FT                   on 27-FEB-2003"
FT   CDS             complement(join(32786973..32787148,32787272..32787345,
FT                   32792457..32792610,32796182..32796241,32797438..32797482,
FT                   32798078..32798140,32799458..32799541,32800836..32800994,
FT                   32801193..32801268))
FT                   /codon_start=1
FT                   /gene="4930579C15Rik"
FT                   /locus_tag="mCG_11649"
FT                   /product="RIKEN cDNA 4930579C15, isoform CRA_a"
FT                   /note="gene_id=mCG11649.2 transcript_id=mCT12083.2
FT                   protein_id=mCP17171.2 isoform=CRA_a"
FT                   /db_xref="GOA:B7SXT6"
FT                   /db_xref="InterPro:IPR029282"
FT                   /db_xref="MGI:MGI:1915003"
FT                   /db_xref="UniProtKB/TrEMBL:B7SXT6"
FT                   /protein_id="EDL30929.1"
FT                   /translation="MDFILLIILSGVFLPDIISLQPIVGQEPGVTLSDEEQYYADEENN
FT                   TDGNSVALHKLEENEMDTPANEKTGNYYKDIKQYVFTTPNIKGSEVSVTATTNLEFAVK
FT                   KNYKASKPTASGEEEKPSESSRKTSTPNIPAFWTILSKAVNETAVSMDDKDQFFQPIPA
FT                   SDLNATNEDKLSELEEIKLKLMLGISLMTLVLLIPLLIFCFATLYKLRHLRDKSYESQY
FT                   SVNPELATLSYFHPTEGSNQTVLTDESSFLPPEETRFLLPEEPGKELIVERGPMQAMNE
FT                   IDAQLLLNKEGSPSN"
FT   CDS             complement(join(32786973..32787345,32792457..32792610,
FT                   32796182..32796241,32797438..32797482,32798078..32798140,
FT                   32799458..32799541,32800836..32800994,32801193..32801268))
FT                   /codon_start=1
FT                   /gene="4930579C15Rik"
FT                   /locus_tag="mCG_11649"
FT                   /product="RIKEN cDNA 4930579C15, isoform CRA_b"
FT                   /note="gene_id=mCG11649.2 transcript_id=mCT180722.0
FT                   protein_id=mCP103644.0 isoform=CRA_b"
FT                   /db_xref="GOA:B7SXT5"
FT                   /db_xref="InterPro:IPR029282"
FT                   /db_xref="MGI:MGI:1915003"
FT                   /db_xref="UniProtKB/TrEMBL:B7SXT5"
FT                   /protein_id="EDL30930.1"
FT                   /translation="MDFILLIILSGVFLPDIISLQPIVGQEPGVTLSDEEQYYADEENN
FT                   TDGNSVALHKLEENEMDTPANEKTGNYYKDIKQYVFTTPNIKGSEVSVTATTNLEFAVK
FT                   KNYKASKPTASGEEEKPSESSRKTSTPNIPAFWTILSKAVNETAVSMDDKDQFFQPIPA
FT                   SDLNATNEDKLSELEEIKLKLMLGISLMTLVLLIPLLIFCFATLYKLRHLRDKSYESQY
FT                   SVNPELATLSYFHPTEGVSDTSFSKSADSNSYWVHNSSEMRRSRTRRSKSKPMDFSAGS
FT                   NQTVLTDESSFLPPEETRFLLPEEPGKELIVERGPMQAMNEIDAQLLLNKEGSPSN"
FT   assembly_gap    32806065..32813322
FT                   /estimated_length=7258
FT                   /gap_type="unknown"
FT   assembly_gap    32816112..32822965
FT                   /estimated_length=6854
FT                   /gap_type="unknown"
FT   gene            complement(<32823629..32852428)
FT                   /locus_tag="mCG_11654"
FT                   /note="gene_id=mCG11654.1"
FT   mRNA            complement(join(<32823629..32823761,32825458..32825646,
FT                   32826147..32826221,32826775..32826825,32833615..32833718,
FT                   32834990..32835120,32838417..32839159,32841140..32841238,
FT                   32842281..32842359,32843624..32843834,32843923..32844000,
FT                   32846228..32846298,32848527..32848602,32852329..32852428))
FT                   /locus_tag="mCG_11654"
FT                   /product="mCG11654"
FT                   /note="gene_id=mCG11654.1 transcript_id=mCT12088.2 created
FT                   on 27-NOV-2002"
FT   CDS             complement(join(<32823629..32823761,32825458..32825646,
FT                   32826147..32826221,32826775..32826825,32833615..32833718,
FT                   32834990..32835120,32838417..32838901))
FT                   /codon_start=1
FT                   /locus_tag="mCG_11654"
FT                   /product="mCG11654"
FT                   /note="gene_id=mCG11654.1 transcript_id=mCT12088.2
FT                   protein_id=mCP17174.2"
FT                   /protein_id="EDL30928.1"
FT                   /translation="MYTTNQGELCQEGPLAKSSGESLQNVKQGEGEACSSSEIASWAEK
FT                   QKSTDKNSAELNEKYNKVVEEHTLHRGEVREEAKHSPSPEPCERQDSSGNEMLLPPCQI
FT                   EEENHEGEELKPPEQEVEIDRNVIQEEEKQAIPEFFEGRQTKTPERYLKIRNYILDQWE
FT                   ICKPKYLNKTSVRPGLKNCGDVNCIGRIHTYLELIGAINFGCEQAVYNRPQPLDKVRAA
FT                   DRKDAEAAYQLAWRLQSMEPFQVKVAAEALLIMNLHAHVSMAEVIGLLGGRYSEADKVL
FT                   EVCAAEPCNSLSTGLQCEMDPVSQTQASETLALRGYSVIGWYHSHPAFDPNPSLRDIDT
FT                   QAKYQSYFSRGGAKFIGMIVSPYNRSNPLPYSQITCLVISEEVSPDGTY"
FT   assembly_gap    32824246..32824265
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    32850541..32850569
FT                   /estimated_length=29
FT                   /gap_type="unknown"
FT   assembly_gap    32854092..32854111
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    32855834..32855853
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    32857104..32857123
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    32861702..32861721
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    32871154..32871173
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    32872461..32872480
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    32891277..32891297
FT                   /estimated_length=21
FT                   /gap_type="unknown"
FT   gene            complement(32907357..32925786)
FT                   /locus_tag="mCG_148073"
FT                   /note="gene_id=mCG148073.0"
FT   mRNA            complement(join(32907357..32909253,32925643..32925786))
FT                   /locus_tag="mCG_148073"
FT                   /product="mCG148073"
FT                   /note="gene_id=mCG148073.0 transcript_id=mCT188336.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(32907947..32908324)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148073"
FT                   /product="mCG148073"
FT                   /note="gene_id=mCG148073.0 transcript_id=mCT188336.0
FT                   protein_id=mCP109416.0"
FT                   /db_xref="MGI:MGI:3650667"
FT                   /db_xref="UniProtKB/TrEMBL:Q8C3B6"
FT                   /protein_id="EDL30927.1"
FT                   /translation="MVPIHPSIHLSIYLFIYLSIHPSIQQFIHLSIYPLSYTPRDLQDI
FT                   PDRFLSTSGSAPHTIDLTSFPPPDGVYTTCPLPPQKGISSSSELQRQLPKRPLPPILFC
FT                   SVHFHFPKQKVYKLSQRKPEN"
FT   assembly_gap    32933321..32933340
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    32948464..32948530
FT                   /estimated_length=67
FT                   /gap_type="unknown"
FT   gene            <32953129..33033712
FT                   /locus_tag="mCG_122573"
FT                   /note="gene_id=mCG122573.1"
FT   mRNA            join(<32953129..32953339,33024542..33024637,
FT                   33027557..33027712,33031026..33031069,33033347..33033712)
FT                   /locus_tag="mCG_122573"
FT                   /product="mCG122573"
FT                   /note="gene_id=mCG122573.1 transcript_id=mCT123795.1
FT                   created on 27-NOV-2002"
FT   CDS             join(<32953131..32953339,33024542..33024637,
FT                   33027557..33027626)
FT                   /codon_start=1
FT                   /locus_tag="mCG_122573"
FT                   /product="mCG122573"
FT                   /note="gene_id=mCG122573.1 transcript_id=mCT123795.1
FT                   protein_id=mCP76038.1"
FT                   /protein_id="EDL30924.1"
FT                   /translation="WGKSLLGSEKVKKPVWGSSRVGVGWALPGTLQQDQFPLLPDRMQG
FT                   CDPGGDQRILPGSAPIGSSERRLQGLSIRGFHYHSKSVIGLRCLLLHQPMIDQPNKWSC
FT                   HGHGASSVRRTLTEGEEQIF"
FT   gene            complement(32966542..32968891)
FT                   /locus_tag="mCG_148070"
FT                   /note="gene_id=mCG148070.0"
FT   mRNA            complement(join(32966542..32966785,32968056..32968174,
FT                   32968543..32968891))
FT                   /locus_tag="mCG_148070"
FT                   /product="mCG148070"
FT                   /note="gene_id=mCG148070.0 transcript_id=mCT188333.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(join(32968129..32968174,32968543..32968679))
FT                   /codon_start=1
FT                   /locus_tag="mCG_148070"
FT                   /product="mCG148070"
FT                   /note="gene_id=mCG148070.0 transcript_id=mCT188333.0
FT                   protein_id=mCP109412.0"
FT                   /protein_id="EDL30926.1"
FT                   /translation="MGTYTVCIRPSTFLLHTLQPTDLKKAHTASGGKPRALTIDPTDCH
FT                   SNKTVTTTRNIKEKI"
FT   gene            32974655..32978338
FT                   /locus_tag="mCG_148057"
FT                   /note="gene_id=mCG148057.0"
FT   mRNA            join(32974655..32977236,32977254..32978338)
FT                   /locus_tag="mCG_148057"
FT                   /product="mCG148057"
FT                   /note="gene_id=mCG148057.0 transcript_id=mCT188320.0
FT                   created on 13-JAN-2004"
FT   CDS             32975662..32975883
FT                   /codon_start=1
FT                   /locus_tag="mCG_148057"
FT                   /product="mCG148057"
FT                   /note="gene_id=mCG148057.0 transcript_id=mCT188320.0
FT                   protein_id=mCP109401.0"
FT                   /protein_id="EDL30925.1"
FT                   /translation="MSSHSQDLEICHTGSETNPSVTRSRFPLGQGLSYGVPIACRVASS
FT                   LRSTLPVGLPINAVLSLAGNHPHFHFRR"
FT   assembly_gap    32983293..32983312
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    32984643..32984900
FT                   /estimated_length=258
FT                   /gap_type="unknown"
FT   assembly_gap    33013065..33013164
FT                   /estimated_length=100
FT                   /gap_type="unknown"
FT   assembly_gap    33036888..33037124
FT                   /estimated_length=237
FT                   /gap_type="unknown"
FT   assembly_gap    33040777..33041023
FT                   /estimated_length=247
FT                   /gap_type="unknown"
FT   gene            <33070996..33087252
FT                   /locus_tag="mCG_145488"
FT                   /note="gene_id=mCG145488.0"
FT   mRNA            join(<33070996..33071090,33083715..33083812,
FT                   33086397..33087252)
FT                   /locus_tag="mCG_145488"
FT                   /product="mCG145488"
FT                   /note="gene_id=mCG145488.0 transcript_id=mCT184912.0
FT                   created on 05-JUN-2003"
FT   assembly_gap    33071805..33071845
FT                   /estimated_length=41
FT                   /gap_type="unknown"
FT   assembly_gap    33072312..33072441
FT                   /estimated_length=130
FT                   /gap_type="unknown"
FT   CDS             <33086931..33087188
FT                   /codon_start=1
FT                   /locus_tag="mCG_145488"
FT                   /product="mCG145488"
FT                   /note="gene_id=mCG145488.0 transcript_id=mCT184912.0
FT                   protein_id=mCP105841.0"
FT                   /protein_id="EDL30923.1"
FT                   /translation="LPRGVYTSTQQLLLGLNLTSPMKPSWTFQRVSLMCANIITHSCPY
FT                   APTQPPKPADAKLSFKMGKYLPTLPLAQPLLYLTQSPGYS"
FT   assembly_gap    33089916..33090123
FT                   /estimated_length=208
FT                   /gap_type="unknown"
FT   assembly_gap    33101415..33101434
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    33102921..33102940
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    33108341..33108360
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    33109582..33109601
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    33110771..33110790
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    33120537..33120556
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    33134116..33141050
FT                   /estimated_length=6935
FT                   /gap_type="unknown"
FT   assembly_gap    33178127..33178646
FT                   /estimated_length=520
FT                   /gap_type="unknown"
FT   assembly_gap    33193594..33193808
FT                   /estimated_length=215
FT                   /gap_type="unknown"
FT   assembly_gap    33195108..33195381
FT                   /estimated_length=274
FT                   /gap_type="unknown"
FT   assembly_gap    33249870..33249889
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    33266724..33266743
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    33280295..33280314
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    33285914..33285933
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    33300611..33300752
FT                   /estimated_length=142
FT                   /gap_type="unknown"
FT   assembly_gap    33307309..33307328
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    33354063..33354082
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    33363288..33363316
FT                   /estimated_length=29
FT                   /gap_type="unknown"
FT   gene            33427253..33796606
FT                   /gene="2310009E04Rik"
FT                   /locus_tag="mCG_141361"
FT                   /note="gene_id=mCG141361.0"
FT   mRNA            join(33427253..33427336,33449120..33449217,
FT                   33455198..33455413,33467406..33467517,33470736..33470910,
FT                   33566645..33566760,33608072..33608200,33638772..33638875,
FT                   33669886..33669993,33681399..33681460,33690977..33691124,
FT                   33707338..33707412,33713787..33713907,33719296..33719390,
FT                   33792586..33792647,33796384..33796606)
FT                   /gene="2310009E04Rik"
FT                   /locus_tag="mCG_141361"
FT                   /product="RIKEN cDNA 2310009E04, transcript variant
FT                   mCT174848"
FT                   /note="gene_id=mCG141361.0 transcript_id=mCT174848.0
FT                   created on 25-OCT-2002"
FT   mRNA            join(<33427263..33427336,33467406..33467517,
FT                   33470736..33470887,33566645..33566760,33608072..33608200,
FT                   33669886..33669993,33681399..33681460,33689881..33691124,
FT                   33707338..33707412,33713787..33713907,33719296..33719390,
FT                   33792586..33792647,33796384..33796596)
FT                   /gene="2310009E04Rik"
FT                   /locus_tag="mCG_141361"
FT                   /product="RIKEN cDNA 2310009E04, transcript variant
FT                   mCT192874"
FT                   /note="gene_id=mCG141361.0 transcript_id=mCT192874.0
FT                   created on 09-MAR-2004"
FT   CDS             join(33455210..33455413,33467406..33467517,
FT                   33470736..33470910,33566645..33566760,33608072..33608200,
FT                   33638772..33638875,33669886..33669993,33681399..33681460,
FT                   33690977..33691124,33707338..33707412,33713787..33713907,
FT                   33719296..33719390,33792586..33792647,33796384..33796465)
FT                   /codon_start=1
FT                   /gene="2310009E04Rik"
FT                   /locus_tag="mCG_141361"
FT                   /product="RIKEN cDNA 2310009E04, isoform CRA_a"
FT                   /note="gene_id=mCG141361.0 transcript_id=mCT174848.0
FT                   protein_id=mCP97767.0 isoform=CRA_a"
FT                   /protein_id="EDL30921.1"
FT                   /translation="MMSGRDQEPSRYYVGIDVGTGSVRAALVDQRGLLLAFAEQPIKKW
FT                   EPQFNHHEQSSEDIWAACCLVTKEVVQGIDAHRIRGLGFDATCSLVVLDKEFHPLPVNH
FT                   EGDSSRNVIMWLDHRAVSQVHRINETKHRVLQYVGGVMSVEMQAPKLLWLKEVSVAGEG
FT                   RSLCSLVCKWTYSAEKGWDDSFWKMIGLEDLIDDNYSKIGNLVLLPGAALGIGLTPEAA
FT                   RELGLPSGIAVAASLIDAHAGGLGVIGADVRGHGLTCEGQPVTSRLAVICGTSSCHMGI
FT                   SKDPVFVPGVWGPYYSAMVPGFWLNEGGQSVTGKLIDHMVQGHPAFPELQAKATARCQS
FT                   IYAYLNSHLDLIKKAQPVGFLTVDLHVWPDFHGNRSPLADLTLKGMVTGLTLSQDLDDL
FT                   AILYLATVQAIAFGTRFIIETMEAAGHSLSTLFLCGGLSKNPLFVQMHADITGMPVVLS
FT                   QEVESVLVGAAILGACASGDFTSVQEAMARMSKVGKVVFPEHADKKYYDKKYQVFLRMV
FT                   EHQKEYSAIMNGS"
FT   assembly_gap    33458090..33458109
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    33462624..33463479
FT                   /estimated_length=856
FT                   /gap_type="unknown"
FT   assembly_gap    33464620..33464932
FT                   /estimated_length=313
FT                   /gap_type="unknown"
FT   assembly_gap    33512134..33512508
FT                   /estimated_length=375
FT                   /gap_type="unknown"
FT   assembly_gap    33533108..33533205
FT                   /estimated_length=98
FT                   /gap_type="unknown"
FT   assembly_gap    33543289..33543647
FT                   /estimated_length=359
FT                   /gap_type="unknown"
FT   assembly_gap    33604230..33604249
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    33627412..33627431
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    33672951..33672970
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(<33690798..33691124,33707338..33707412,
FT                   33713787..33713907,33719296..33719390,33792586..33792647,
FT                   33796384..33796465)
FT                   /codon_start=1
FT                   /gene="2310009E04Rik"
FT                   /locus_tag="mCG_141361"
FT                   /product="RIKEN cDNA 2310009E04, isoform CRA_b"
FT                   /note="gene_id=mCG141361.0 transcript_id=mCT192874.0
FT                   protein_id=mCP113835.0 isoform=CRA_b"
FT                   /protein_id="EDL30922.1"
FT                   /translation="QCVVRVQGLVSYKSSCFAQAFESPLCFPGSDIEVQMVSFCRIICF
FT                   STLSPFKIKIHFFSRCQSIYAYLNSHLDLIKKAQPVGFLTVDLHVWPDFHGNRSPLADL
FT                   TLKGMVTGLTLSQDLDDLAILYLATVQAIAFGTRFIIETMEAAGHSLSTLFLCGGLSKN
FT                   PLFVQMHADITGMPVVLSQEVESVLVGAAILGACASGDFTSVQEAMARMSKVGKVVFPE
FT                   HADKKYYDKKYQVFLRMVEHQKEYSAIMNGS"
FT   assembly_gap    33702804..33702823
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    33703955..33703974
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    33712311..33712406
FT                   /estimated_length=96
FT                   /gap_type="unknown"
FT   assembly_gap    33720410..33720639
FT                   /estimated_length=230
FT                   /gap_type="unknown"
FT   assembly_gap    33748140..33748159
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    33811027..33811115
FT                   /estimated_length=89
FT                   /gap_type="unknown"
FT   assembly_gap    33818448..33818467
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    33835866..33836030
FT                   /estimated_length=165
FT                   /gap_type="unknown"
FT   gene            33837013..33895172
FT                   /gene="Hook1"
FT                   /locus_tag="mCG_15469"
FT                   /note="gene_id=mCG15469.1"
FT   mRNA            join(33837013..33837328,33844148..33844233,
FT                   33859402..33859474,33861913..33861963,33862830..33862962,
FT                   33865528..33865595,33866523..33866585,33868459..33868542,
FT                   33870934..33871100,33872208..33872348,33873246..33873447,
FT                   33874061..33874171,33879062..33879149,33879229..33879289,
FT                   33882958..33883098,33884568..33884661,33886169..33886203,
FT                   33886703..33886785,33887348..33887448,33889363..33889464,
FT                   33891328..33891396,33891927..33895172)
FT                   /gene="Hook1"
FT                   /locus_tag="mCG_15469"
FT                   /product="hook homolog 1 (Drosophila), transcript variant
FT                   mCT17337"
FT                   /note="gene_id=mCG15469.1 transcript_id=mCT17337.2 created
FT                   on 25-OCT-2002"
FT   mRNA            join(<33837134..33837328,33844148..33844233,
FT                   33859402..33859474,33861913..33861963,33862830..33862962,
FT                   33865528..33865595,33866523..33866585,33868459..33868542,
FT                   33870934..33871100,33872208..33872348,33873246..33873447,
FT                   33874061..33874171,33879062..33879149,33879229..33879289,
FT                   33882958..33883098,33884568..33885238)
FT                   /gene="Hook1"
FT                   /locus_tag="mCG_15469"
FT                   /product="hook homolog 1 (Drosophila), transcript variant
FT                   mCT192822"
FT                   /note="gene_id=mCG15469.1 transcript_id=mCT192822.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<33837242..33837328,33844148..33844233,
FT                   33859402..33859474,33861913..33861963,33862830..33862962,
FT                   33865528..33865595,33866523..33866585,33868459..33868542,
FT                   33870934..33871100,33872208..33872348,33873246..33873447,
FT                   33874061..33874171,33879062..33879149,33879229..33879289,
FT                   33882958..33883098,33884568..33884688)
FT                   /codon_start=1
FT                   /gene="Hook1"
FT                   /locus_tag="mCG_15469"
FT                   /product="hook homolog 1 (Drosophila), isoform CRA_b"
FT                   /note="gene_id=mCG15469.1 transcript_id=mCT192822.0
FT                   protein_id=mCP113794.0 isoform=CRA_b"
FT                   /protein_id="EDL30920.1"
FT                   /translation="ARRRGSRTMEDPQPLPQSELPLCDSLIIWLQTFKTASPCQDVKQL
FT                   TNGVTMAQVLHQIDVAWFSESWLSRIKDDVGDNWRIKASNLKKVLHGITSYYHEFLGQQ
FT                   ISEELIPDLNQITECADPVELGRLLQLILGCAVNCEKKQEHIKNIMTLEESVQHVVMTA
FT                   IQELMSKEIVISPASDTVGELEQQLKRALEELQEAIAEKEELKQRCQELDMQVTTLQDE
FT                   KNSLVSENEMMNEKLDQLDGSFDDPNTMVAKKYFHVQLQLEQLQEENYRLEAAKDDYRV
FT                   HCEELEKQLIEFQHRNDELTSLAEETRALKDEIDVLRATSDKANKLESTVEVYRQKLQD
FT                   LNDLRKQVKSLQETNMMYMHNTVSLEEELKKANAARAQLETYKRQVQDLHTKLSSESKR
FT                   ADTLAFEMKRLEEKHETLLKEKERLIEQRDTLKETNEELRCSKAQQDHLNQADASATKS
FT                   YENLAAEIMPVEYREVFIRLQHENKMLRLQQEGTENERIEQLQEQLEQKHRKMNELETE
FT                   QRLSKERIGELQQQIEDLQKSLQEQGSKSEGESVSNRVHNL"
FT   CDS             join(33837266..33837328,33844148..33844233,
FT                   33859402..33859474,33861913..33861963,33862830..33862962,
FT                   33865528..33865595,33866523..33866585,33868459..33868542,
FT                   33870934..33871100,33872208..33872348,33873246..33873447,
FT                   33874061..33874171,33879062..33879149,33879229..33879289,
FT                   33882958..33883098,33884568..33884661,33886169..33886203,
FT                   33886703..33886785,33887348..33887448,33889363..33889464,
FT                   33891328..33891396,33891927..33892097)
FT                   /codon_start=1
FT                   /gene="Hook1"
FT                   /locus_tag="mCG_15469"
FT                   /product="hook homolog 1 (Drosophila), isoform CRA_a"
FT                   /note="gene_id=mCG15469.1 transcript_id=mCT17337.2
FT                   protein_id=mCP17169.2 isoform=CRA_a"
FT                   /protein_id="EDL30919.1"
FT                   /translation="MEDPQPLPQSELPLCDSLIIWLQTFKTASPCQDVKQLTNGVTMAQ
FT                   VLHQIDVAWFSESWLSRIKDDVGDNWRIKASNLKKVLHGITSYYHEFLGQQISEELIPD
FT                   LNQITECADPVELGRLLQLILGCAVNCEKKQEHIKNIMTLEESVQHVVMTAIQELMSKE
FT                   IVISPASDTVGELEQQLKRALEELQEAIAEKEELKQRCQELDMQVTTLQDEKNSLVSEN
FT                   EMMNEKLDQLDGSFDDPNTMVAKKYFHVQLQLEQLQEENYRLEAAKDDYRVHCEELEKQ
FT                   LIEFQHRNDELTSLAEETRALKDEIDVLRATSDKANKLESTVEVYRQKLQDLNDLRKQV
FT                   KSLQETNMMYMHNTVSLEEELKKANAARAQLETYKRQVQDLHTKLSSESKRADTLAFEM
FT                   KRLEEKHETLLKEKERLIEQRDTLKETNEELRCSKAQQDHLNQADASATKSYENLAAEI
FT                   MPVEYREVFIRLQHENKMLRLQQEGTENERIEQLQEQLEQKHRKMNELETEQRLSKERI
FT                   GELQQQIEDLQKSLQEQGSKSEGESSSKLKQKLEAHMEKLTEVHEELQKKQELIEDLQP
FT                   DISQNAQKISELEAALQKKDEDMKAMEERYKMYLEKARNVIKTLDPKLNPASAEIMLLR
FT                   KQLAEKERRIEILESECKVAKLRDYEEKLIVSAWYNKSLAFQKLGMESRLVSGASACKD
FT                   SVAAAPARSFLAQQRHITNTRRNLSVKVPAAASD"
FT   gene            complement(33914216..33947025)
FT                   /gene="Cyp2j13"
FT                   /locus_tag="mCG_15472"
FT                   /note="gene_id=mCG15472.1"
FT   mRNA            complement(join(33914216..33915386,33926008..33926146,
FT                   33926223..33926410,33928498..33928639,33931413..33931589,
FT                   33937698..33937861,33938244..33938393,33940980..33941142,
FT                   33946751..33947025))
FT                   /gene="Cyp2j13"
FT                   /locus_tag="mCG_15472"
FT                   /product="cytochrome P450, family 2, subfamily j,
FT                   polypeptide 13, transcript variant mCT17339"
FT                   /note="gene_id=mCG15472.1 transcript_id=mCT17339.1 created
FT                   on 27-NOV-2002"
FT   mRNA            complement(join(33914992..33915386,33926223..33926410,
FT                   33928498..33928639,33937698..33937861,33938244..33938393,
FT                   33940980..33941142,33946751..>33947022))
FT                   /gene="Cyp2j13"
FT                   /locus_tag="mCG_15472"
FT                   /product="cytochrome P450, family 2, subfamily j,
FT                   polypeptide 13, transcript variant mCT192857"
FT                   /note="gene_id=mCG15472.1 transcript_id=mCT192857.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(33915208..33915386,33926008..33926146,
FT                   33926223..33926410,33928498..33928639,33931413..33931589,
FT                   33937698..33937861,33938244..33938393,33940980..33941142,
FT                   33946751..33946960))
FT                   /codon_start=1
FT                   /gene="Cyp2j13"
FT                   /locus_tag="mCG_15472"
FT                   /product="cytochrome P450, family 2, subfamily j,
FT                   polypeptide 13, isoform CRA_a"
FT                   /note="gene_id=mCG15472.1 transcript_id=mCT17339.1
FT                   protein_id=mCP17181.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q3UNV4"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR008071"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="MGI:MGI:2385197"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UNV4"
FT                   /protein_id="EDL30917.1"
FT                   /translation="MLEAADSLAAAFWAALHLRTLLLAAVTFLFLADYLKSRRPKNYPP
FT                   RPPRLPFVGNSFQMDLTQSHLAVQKFVKKYGNVISLDFGIKSAVIISSLPLIKEAFSHL
FT                   DENFINRRIFPLQRQIFNGNGLIFSSGQTWKEQRRFALMTLRNFGLGKKSLEHRIQEEA
FT                   SHLVEAIGEEEGQPFDPHFKIYSAVSNIICSITFGERFEYHDSQFQELLQLLDKAMYLG
FT                   TTSLMVHLYNIFPWITKHLPGQHQTLLATWRKLKSYIADIIDNHRKDWNPDEPRDFIDA
FT                   FLNEMAKYPGKTTTSFNEENLICSTLDLFLAGTETTSSTLRWALLYMALYPEVQENVQA
FT                   EIDRVIGQSKHPSLADRDSMPYTNAVVHEILRMGNSVPLNIPREVAVDTTLAGFHLPKR
FT                   SVVMTNLTALHMDPKEWATPDIFNPEHFLENGQFKKRESFLPFSMGKRACLGEQLARSE
FT                   LFIFFTALVQKFTFKPPANENLSLKFRLGITISPVSYRIGAVPRQ"
FT   CDS             complement(join(33915279..33915386,33926223..33926410,
FT                   33928498..33928639,33937698..33937861,33938244..33938393,
FT                   33940980..33941142,33946751..>33947020))
FT                   /codon_start=1
FT                   /gene="Cyp2j13"
FT                   /locus_tag="mCG_15472"
FT                   /product="cytochrome P450, family 2, subfamily j,
FT                   polypeptide 13, isoform CRA_b"
FT                   /note="gene_id=mCG15472.1 transcript_id=mCT192857.0
FT                   protein_id=mCP113795.0 isoform=CRA_b"
FT                   /protein_id="EDL30918.1"
FT                   /translation="AQTLIPLESLLKCSSAQVPAMLEAADSLAAAFWAALHLRTLLLAA
FT                   VTFLFLADYLKSRRPKNYPPRPPRLPFVGNSFQMDLTQSHLAVQKFVKKYGNVISLDFG
FT                   IKSAVIISSLPLIKEAFSHLDENFINRRIFPLQRQIFNGNGLIFSSGQTWKEQRRFALM
FT                   TLRNFGLGKKSLEHRIQEEASHLVEAIGEEEGQPFDPHFKIYSAVSNIICSITFGERFE
FT                   YHDSQFQELLQLLDKAMYLGTTSLMVHYPGKTTTSFNEENLICSTLDLFLAGTETTSST
FT                   LRWALLYMALYPEVQENVQAEIDRVIGQSKHPSLADRDSMPYTNAVVHEILRMGNSVPL
FT                   NIPREVAVDTTLAGFHLPKESELASENNWPGLSSLFSSLPLCKNLPSSHQPMRT"
FT   assembly_gap    33920063..33920438
FT                   /estimated_length=376
FT                   /gap_type="unknown"
FT   assembly_gap    33927843..33928073
FT                   /estimated_length=231
FT                   /gap_type="unknown"
FT   gene            complement(<33969112..>34009022)
FT                   /locus_tag="mCG_15468"
FT                   /note="gene_id=mCG15468.2"
FT   mRNA            complement(join(<33969112..33969290,33971468..33971606,
FT                   33980885..33981025,33983535..33983711,33989455..33989615,
FT                   33990491..33990640,34000975..34001137,34008813..>34009022))
FT                   /locus_tag="mCG_15468"
FT                   /product="mCG15468"
FT                   /note="gene_id=mCG15468.2 transcript_id=mCT17335.2 created
FT                   on 27-NOV-2002"
FT   CDS             complement(join(33969112..33969290,33971468..33971606,
FT                   33980885..33981025,33983535..33983711,33989455..33989615,
FT                   33990491..33990640,34000975..34001137,34008813..34009022))
FT                   /codon_start=1
FT                   /locus_tag="mCG_15468"
FT                   /product="mCG15468"
FT                   /note="gene_id=mCG15468.2 transcript_id=mCT17335.2
FT                   protein_id=mCP17168.2"
FT                   /protein_id="EDL30916.1"
FT                   /translation="MLATEDTFETAIWALLHFKTLVLAAVTFMLLAHYLKTQRPKNYPP
FT                   GPWRLPFVGNLFQLDLEQPHVVIQQFVKKYGNLTSLDFGNIPSVIITGLPLIKEVFTNM
FT                   EQNFLNRPITPIRKRVFNNNGLIISNGQTWKEQRRFALMTLKNFGLGKKSLEQRIQKEA
FT                   DCLVEAIGEEKGQPFDPHFKINSAVSNIICTFAFGERFEYEDSHFHELLRLLDEATCLE
FT                   ASMMCQLYNVFPSIIQYVPGSHQTVLRNWEKLKLFIYQMMESHRKDWNPDEPRDFIDAF
FT                   LTEMSKYGDKTTTSFNEENLINSTLDLFFAGSETTTNTLRWALLYITTNPEVQGTMVLT
FT                   NLTALHRDPKEWATPNTFNPEHFLENGQFKKRESFLPFSLGKRACPGEQLARSELFIFF
FT                   TALMQKFTFKPPINEKLSLKFRNGLTLSPVSHCICAVPRH"
FT   assembly_gap    33974633..33975436
FT                   /estimated_length=804
FT                   /gap_type="unknown"
FT   assembly_gap    33989691..33989710
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    34021642..34021661
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    34024236..34024255
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    34028489..34028508
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    34036627..34036646
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<34059549..>34098129)
FT                   /locus_tag="mCG_15473"
FT                   /note="gene_id=mCG15473.2"
FT   mRNA            complement(join(<34059549..34059727,34063689..34063827,
FT                   34066384..34066529,34076760..34076901,34078877..34079053,
FT                   34088990..34089150,34090031..34090180,34091446..34091608,
FT                   34097914..>34098129))
FT                   /locus_tag="mCG_15473"
FT                   /product="mCG15473"
FT                   /note="gene_id=mCG15473.2 transcript_id=mCT17340.2 created
FT                   on 27-NOV-2002"
FT   CDS             complement(join(34059549..34059727,34063689..34063827,
FT                   34066384..34066529,34076760..34076901,34078877..34079053,
FT                   34088990..34089150,34090031..34090180,34091446..34091608,
FT                   34097914..34098129))
FT                   /codon_start=1
FT                   /locus_tag="mCG_15473"
FT                   /product="mCG15473"
FT                   /note="gene_id=mCG15473.2 transcript_id=mCT17340.2
FT                   protein_id=mCP17183.2"
FT                   /protein_id="EDL30915.1"
FT                   /translation="MLSTVGSLVARIWSAIHLWTLLLTLLVFRLLADYLKNRRPKNYPP
FT                   GPWRLPFVGNLFQFDLDVSQLHLRIQLFVKKYGNLISIDFGNISSVVITGLPLIKEAFT
FT                   DMEQNLLKRPIIPSRKHVFKDNGIIFSSGQKWKEQRRFALMILKSFGLGKKSLEQRIQE
FT                   EAYHLVKAMEEEKGQPFDPHFRINSAVSNIICSINFGERFEYGDNKFQELLKITNETLS
FT                   AETSMMLVLYNALPSIMKYLPGPHQTVFRNWERLKMIVYHMMESHRKDWNPDEPRDFID
FT                   AFLTEMTKYPDKTTTSFNEENLICSCLDLFIAGTETSSTALRWALLYMTLNPEVQERVH
FT                   SEIDGVIGQWRQPSTGDRDSMPYTNAVIHEVLRMGNIVPLNVPREGKMILTNLTALHRD
FT                   PKEWATPDIFNPEHFLENGQFKKRESFLPFSMGKRACPGEQLARTELFIFFTALMQKFT
FT                   FKAPVNEKLSLKFRMSVPISPVSYCICAVPRQ"
FT   assembly_gap    34074514..34074533
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    34106443..34106503
FT                   /estimated_length=61
FT                   /gap_type="unknown"
FT   assembly_gap    34126253..34128790
FT                   /estimated_length=2538
FT                   /gap_type="unknown"
FT   gene            complement(34153950..34207810)
FT                   /gene="Cyp2j11"
FT                   /locus_tag="mCG_8009"
FT                   /note="gene_id=mCG8009.1"
FT   mRNA            complement(join(34153950..34154422,34157040..34157178,
FT                   34166348..34166535,34175386..34175527,34178299..34178475,
FT                   34198215..34198375,34198979..34199128,34204208..34204370,
FT                   34207481..34207810))
FT                   /gene="Cyp2j11"
FT                   /locus_tag="mCG_8009"
FT                   /product="cytochrome P450, family 2, subfamily j,
FT                   polypeptide 11"
FT                   /note="gene_id=mCG8009.1 transcript_id=mCT7200.1 created on
FT                   25-NOV-2002"
FT   CDS             complement(join(34154244..34154422,34157040..34157178,
FT                   34166348..34166535,34175386..34175527,34178299..34178475,
FT                   34198215..34198375,34198979..34199128,34204208..34204370,
FT                   34207481..34207696))
FT                   /codon_start=1
FT                   /gene="Cyp2j11"
FT                   /locus_tag="mCG_8009"
FT                   /product="cytochrome P450, family 2, subfamily j,
FT                   polypeptide 11"
FT                   /note="gene_id=mCG8009.1 transcript_id=mCT7200.1
FT                   protein_id=mCP18369.1"
FT                   /protein_id="EDL30914.1"
FT                   /translation="MLAIATCLVANICSAIHLWTLLLTLLTLLLLADYLKNRRPKNYPP
FT                   GPRRLPFVGNLFQFDLDVSRLHLGIQPFVKKYGNVISVNFGYISSVIISGLPLIKEAIT
FT                   GMEQNFLKRPSLAARQHVFKNNGIVFSSGQTWKEQRKFALTILKNFGLGKKSLEQCIQE
FT                   EAYHLVKAIGEEKGQPFDPHFRINNAVGNIICSIIFGERFEYDDNQFQELLKLADEIIC
FT                   SEASMMSVLYNVFPSIFKYLPGPQQKLFSNWEKLKLFVSRMMDSHREDWNPSAPRDFID
FT                   AFLTEMTKYPDKTTTSFNEENLICTALDLFFAGTETTSNTLRWALLYITVNPEVQEKVH
FT                   SEIDRVIGHGRHPTLDDRDSMPYTNAVIHEVLRMGNIIPLNVPREVTADSTLAGFYLPK
FT                   GTMVLINLTDLHRDPKEWDTPNVFNPEHFLENGQFKKKESFLPFSMGKRACPGEQLASC
FT                   ELFIFFTALMQKFTFKSPINEKPSLKFRMGLTLAPVSYRICAVPRL"
FT   assembly_gap    34161362..34163168
FT                   /estimated_length=1807
FT                   /gap_type="unknown"
FT   assembly_gap    34164290..34165392
FT                   /estimated_length=1103
FT                   /gap_type="unknown"
FT   assembly_gap    34196026..34196245
FT                   /estimated_length=220
FT                   /gap_type="unknown"
FT   assembly_gap    34197806..34198005
FT                   /estimated_length=200
FT                   /gap_type="unknown"
FT   assembly_gap    34210372..34210554
FT                   /estimated_length=183
FT                   /gap_type="unknown"
FT   assembly_gap    34230921..34231808
FT                   /estimated_length=888
FT                   /gap_type="unknown"
FT   assembly_gap    34238077..34238313
FT                   /estimated_length=237
FT                   /gap_type="unknown"
FT   assembly_gap    34291508..34291556
FT                   /estimated_length=49
FT                   /gap_type="unknown"
FT   assembly_gap    34306083..34307938
FT                   /estimated_length=1856
FT                   /gap_type="unknown"
FT   assembly_gap    34360565..34360584
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(34376934..34412804)
FT                   /gene="Cyp2j6"
FT                   /locus_tag="mCG_8007"
FT                   /note="gene_id=mCG8007.1"
FT   mRNA            complement(join(34376934..34377381,34382879..34383017,
FT                   34384979..34385166,34388552..34388690,34390799..34390975,
FT                   34394613..34394773,34395163..34395312,34404866..34405028,
FT                   34412409..34412804))
FT                   /gene="Cyp2j6"
FT                   /locus_tag="mCG_8007"
FT                   /product="cytochrome P450, family 2, subfamily j,
FT                   polypeptide 6"
FT                   /note="gene_id=mCG8007.1 transcript_id=mCT7204.1 created on
FT                   27-SEP-2002"
FT   CDS             complement(join(34377203..34377381,34382879..34383017,
FT                   34384979..34385166,34388552..34388690,34390799..34390975,
FT                   34394613..34394773,34395163..34395312,34404866..34405028,
FT                   34412409..34412618))
FT                   /codon_start=1
FT                   /gene="Cyp2j6"
FT                   /locus_tag="mCG_8007"
FT                   /product="cytochrome P450, family 2, subfamily j,
FT                   polypeptide 6"
FT                   /note="gene_id=mCG8007.1 transcript_id=mCT7204.1
FT                   protein_id=mCP18367.2"
FT                   /db_xref="GOA:O54750"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR008071"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="MGI:MGI:1270148"
FT                   /db_xref="UniProtKB/Swiss-Prot:O54750"
FT                   /protein_id="EDL30913.1"
FT                   /translation="MLAATGSLLATIWAALHPRTLLVAAVTFLLLADYFKNRRPKNYPP
FT                   GPWGLPFVGNIFQLDFGQPHLSIQPLVKKYGNIFSLNLGDITSVVITGLPLIKEALTQM
FT                   EQNIMNRPLSVMQERISNKNGLIFSSGQIWKEQRRFALMTLRNFGLGKKSLEERMQEEA
FT                   SHLVEAIREEEGKPFNPHFSINNAVSNIICSVTFGERFDYHDSRFQEMLRLLDEVMYLE
FT                   TTMISQLYNIFPWIMKYIPGSHQKVFRNWEKLKLFVSCMIDDHRKDWNPDEPRDFIDAF
FT                   LKEMTKYPEKTTSFNEENLICSTLDLFFAGTETTSTTLRWALLYMALYPEVQEKVQAEI
FT                   DRVIGQKRAARLADRESMPYTNAVIHEVQRMGNIIPLNVPREVAMDTNLNGFHLPKGTM
FT                   VLTNLTALHRDPKEWATPDVFNPEHFLENGQFKKRESFLPFSMGKRACLGEQLARSELF
FT                   IFFTSLMQKFTFNPPINEKLSPKFRNGLTLSPVSHRICAVPRQ"
FT   assembly_gap    34415206..34415264
FT                   /estimated_length=59
FT                   /gap_type="unknown"
FT   gene            complement(34427604..>34450657)
FT                   /gene="Cyp2j9"
FT                   /locus_tag="mCG_144028"
FT                   /note="gene_id=mCG144028.0"
FT   mRNA            complement(join(34427604..34428075,34431108..34431246,
FT                   34433025..34433212,34436765..34436906,34438560..34438736,
FT                   34442580..34442740,34443148..34443297,34445001..34445163,
FT                   34450308..>34450657))
FT                   /gene="Cyp2j9"
FT                   /locus_tag="mCG_144028"
FT                   /product="cytochrome P450, family 2, subfamily j,
FT                   polypeptide 9"
FT                   /note="gene_id=mCG144028.0 transcript_id=mCT183452.0
FT                   created on 04-JUN-2003"
FT   CDS             complement(join(34427897..34428075,34431108..34431246,
FT                   34433025..34433212,34436765..34436906,34438560..34438736,
FT                   34442580..34442740,34443148..34443297,34445001..34445163,
FT                   34450308..>34450655))
FT                   /codon_start=1
FT                   /gene="Cyp2j9"
FT                   /locus_tag="mCG_144028"
FT                   /product="cytochrome P450, family 2, subfamily j,
FT                   polypeptide 9"
FT                   /note="gene_id=mCG144028.0 transcript_id=mCT183452.0
FT                   protein_id=mCP105821.0"
FT                   /protein_id="EDL30912.1"
FT                   /translation="TDWRGPVAIWGFKPQAWFILGTTGSVLGELPQFRFSFLQEPALIS
FT                   AMLAAAGSLVAAIWAALHLRILLLSAVTFLFLADFLKNRRPKNYPPGPMRLPFVGCLFH
FT                   LDPKQPHLSLQQFVKKYGNVLSLDFANIPSVVITGMPLIKEIFTQMEHNFMNRPVTLLR
FT                   KHLFNKNGLIFSSDQTWKEQRRFALMTLRNFGLGKRSLEERIQEEAHYLVEAIRDEGGQ
FT                   PFDPHFNISNAVSNIICSITFGERFDYHDSQFQEMLRLLDEAMCLESSMMCQLYNIFPR
FT                   ILQYLPGSHQTLFRNWRKLQLFVSDIVNNHRRDWDPDEPRDFIDAFLTEMTKYPDKTTT
FT                   SFNEENLICSTLDLFFAGTETTSTTLRWALLCMALYPEVQEKMQAEIDRVIGQARQPNL
FT                   ADRDSMPYTNAVIHEVQRMGNIIPFNVPREVAVDTQLAGFNLPKGIMVLSNLTALHRDP
FT                   SEWTTPDTFNPEHFLENGQFKKRESFLPFSMGKRACLGEQLARSELFIFITTLFQKFTF
FT                   KPPVNEKLSLQFRMAATVSPVSHRLCAIPRL"
FT   assembly_gap    34457742..34457765
FT                   /estimated_length=24
FT                   /gap_type="unknown"
FT   gene            complement(34488305..34523126)
FT                   /gene="Cyp2j5"
FT                   /locus_tag="mCG_8008"
FT                   /note="gene_id=mCG8008.1"
FT   mRNA            complement(join(34488305..34488804,34489869..34490007,
FT                   34493306..34493493,34494950..34495088,34500428..34500604,
FT                   34517649..34517809,34518538..34518687,34522187..34522349,
FT                   34522876..34523126))
FT                   /gene="Cyp2j5"
FT                   /locus_tag="mCG_8008"
FT                   /product="cytochrome P450, family 2, subfamily j,
FT                   polypeptide 5"
FT                   /note="gene_id=mCG8008.1 transcript_id=mCT7199.1 created on
FT                   25-NOV-2002"
FT   CDS             complement(join(34488626..34488804,34489869..34490007,
FT                   34493306..34493493,34494950..34495088,34500428..34500604,
FT                   34517649..34517809,34518538..34518687,34522187..34522349,
FT                   34522876..34523085))
FT                   /codon_start=1
FT                   /gene="Cyp2j5"
FT                   /locus_tag="mCG_8008"
FT                   /product="cytochrome P450, family 2, subfamily j,
FT                   polypeptide 5"
FT                   /note="gene_id=mCG8008.1 transcript_id=mCT7199.1
FT                   protein_id=mCP18368.1"
FT                   /db_xref="GOA:Q3TNC5"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR008071"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="MGI:MGI:1270149"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TNC5"
FT                   /protein_id="EDL30911.1"
FT                   /translation="MIMFLSSLVTTFWEALHLKTLVLAVVTFLFLINILRSRHPKNYPP
FT                   GPWRLPFVGNFFQIDTKQTHLVLQQFVKKYGNVFSLELGQSPVVVVSGLPLIKEMFTHL
FT                   DQNFVNRFMTPVRERITGKNGLVVSNGQTWKEQRRLALMALRNFGLGKKSLEERIQEET
FT                   HHLVEAIREEGGQPFNPHLKLINAVSNIICSVTFGERFDYEDCQFQELLQLLDETMHLM
FT                   GSSAGQLYNGFPCIMKYLPGPHQKIFRNWGKLKLFVSHIVKKHEKDWNPDEPRDFIDAF
FT                   LIEMQKDPDRTTSFNEENLISTTLDLFLGGTETTSSTLRWALLYMSSYPEIQENVQAEI
FT                   DRVIGHKRQVSLSDRESMPYTNAVIHEVQRMGNIVPLNSSREVTVDTKFNGFHLPKGTM
FT                   ILTNLTALHRDPKEWATPEVFNPEHFLENGQFKKRESFLPFSMGKRACLGEQLAKSELF
FT                   IFFSALMQKFTFKPPINEKLSLKFRMGLILSPASYRICAIPRV"
FT   assembly_gap    34501545..34501564
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    34513974..34514073
FT                   /estimated_length=100
FT                   /gap_type="unknown"
FT   assembly_gap    34514883..34515203
FT                   /estimated_length=321
FT                   /gap_type="unknown"
FT   assembly_gap    34519605..34519729
FT                   /estimated_length=125
FT                   /gap_type="unknown"
FT   assembly_gap    34538268..34538287
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    34559878..34560139
FT                   /estimated_length=262
FT                   /gap_type="unknown"
FT   assembly_gap    34592400..34592419
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    34618565..34618584
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    34698689..34698708
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    34707675..34707694
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    34799904..34799923
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    34802080..34802099
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    34803451..34803727
FT                   /estimated_length=277
FT                   /gap_type="unknown"
FT   assembly_gap    34806533..34812066
FT                   /estimated_length=5534
FT                   /gap_type="unknown"
FT   assembly_gap    34817160..34817179
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    34840471..34840490
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    34848961..34848980
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    34926529..34926548
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    34938397..34938754
FT                   /estimated_length=358
FT                   /gap_type="unknown"
FT   assembly_gap    34986629..34986648
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    35012037..35012056
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    35120779..35121033
FT                   /estimated_length=255
FT                   /gap_type="unknown"
FT   assembly_gap    35122606..35122711
FT                   /estimated_length=106
FT                   /gap_type="unknown"
FT   assembly_gap    35170494..35172408
FT                   /estimated_length=1915
FT                   /gap_type="unknown"
FT   assembly_gap    35179745..35179796
FT                   /estimated_length=52
FT                   /gap_type="unknown"
FT   assembly_gap    35202225..35202244
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    35203414..35203433
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    35205433..35205452
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    35247168..35247187
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    35248521..35248992
FT                   /estimated_length=472
FT                   /gap_type="unknown"
FT   assembly_gap    35263949..35263968
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    35273992..35274138
FT                   /estimated_length=147
FT                   /gap_type="unknown"
FT   assembly_gap    35292177..35298062
FT                   /estimated_length=5886
FT                   /gap_type="unknown"
FT   assembly_gap    35313949..35314249
FT                   /estimated_length=301
FT                   /gap_type="unknown"
FT   assembly_gap    35327937..35327956
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    35338275..35338386
FT                   /estimated_length=112
FT                   /gap_type="unknown"
FT   assembly_gap    35348973..35349572
FT                   /estimated_length=600
FT                   /gap_type="unknown"
FT   gene            complement(35359196..>35374751)
FT                   /locus_tag="mCG_4530"
FT                   /note="gene_id=mCG4530.2"
FT   mRNA            complement(join(35359196..35359297,35371866..35373433,
FT                   35374118..35374143,35374658..>35374751))
FT                   /locus_tag="mCG_4530"
FT                   /product="mCG4530"
FT                   /note="gene_id=mCG4530.2 transcript_id=mCT3453.1 created on
FT                   25-NOV-2002"
FT   CDS             complement(35372732..>35373418)
FT                   /codon_start=1
FT                   /locus_tag="mCG_4530"
FT                   /product="mCG4530"
FT                   /note="gene_id=mCG4530.2 transcript_id=mCT3453.1
FT                   protein_id=mCP15821.0"
FT                   /protein_id="EDL30910.1"
FT                   /translation="ETSSSKEMASNVTNKTDSRSMNSRVFIGNLNTRVVKKCDVEAIFS
FT                   KYGKIVGCSVHKGFAFVQYVNERNARAAVAGEDGRMIAGQVLDINLAAEPKVNRGKAGV
FT                   KRSAAEMYGSSFDLDYDFQRDYYDRMYSYPARVPPPPPIARAVVPSKRQRVSGNTSRRG
FT                   KSGFNSKSGQRGSSSKSGKLKGDDLQTTKKELTQIKQKVDSLLESLEKKLKKNKASKQT
FT                   CPSHPQ"
FT   gene            complement(35417926..>35629436)
FT                   /gene="E130114P18Rik"
FT                   /locus_tag="mCG_4531"
FT                   /note="gene_id=mCG4531.3"
FT   mRNA            complement(join(35417926..35419987,35420205..35420301,
FT                   35425889..35425991,35541797..35541910,35571441..35571539,
FT                   35629349..>35629436))
FT                   /gene="E130114P18Rik"
FT                   /locus_tag="mCG_4531"
FT                   /product="RIKEN cDNA E130114P18, transcript variant
FT                   mCT179334"
FT                   /note="gene_id=mCG4531.3 transcript_id=mCT179334.1 created
FT                   on 13-JUN-2003"
FT   mRNA            complement(join(35417926..35419987,35420205..35420301,
FT                   35425871..35425991,35435741..35435823))
FT                   /gene="E130114P18Rik"
FT                   /locus_tag="mCG_4531"
FT                   /product="RIKEN cDNA E130114P18, transcript variant
FT                   mCT3454"
FT                   /note="gene_id=mCG4531.3 transcript_id=mCT3454.2 created on
FT                   13-JUN-2003"
FT   CDS             complement(join(35420213..35420301,35425889..35425991,
FT                   35541797..35541910,35571441..35571539,35629349..>35629435))
FT                   /codon_start=1
FT                   /gene="E130114P18Rik"
FT                   /locus_tag="mCG_4531"
FT                   /product="RIKEN cDNA E130114P18, isoform CRA_a"
FT                   /note="gene_id=mCG4531.3 transcript_id=mCT179334.1
FT                   protein_id=mCP102256.1 isoform=CRA_a"
FT                   /protein_id="EDL30907.1"
FT                   /translation="HARAHTETRADTAPAEAHGRPAPPQLLTWGCREASADAHQSRWMD
FT                   LLPVQRTRVLGSPSVHLAEAWHKSQPSSRAARYMTLHCAACHPGTASLSKVCLCLVIDT
FT                   LPGAQDSKGKDSGLPSRCTLALAEEAGTGAGYQKITMQDAKIERQLIVLPSCDTFQPWQ
FT                   "
FT   CDS             complement(join(35420213..35420301,35425871..35425991,
FT                   35435741..35435752))
FT                   /codon_start=1
FT                   /gene="E130114P18Rik"
FT                   /locus_tag="mCG_4531"
FT                   /product="RIKEN cDNA E130114P18, isoform CRA_b"
FT                   /note="gene_id=mCG4531.3 transcript_id=mCT3454.2
FT                   protein_id=mCP15822.3 isoform=CRA_b"
FT                   /db_xref="GOA:A2AK51"
FT                   /db_xref="MGI:MGI:2442873"
FT                   /db_xref="UniProtKB/TrEMBL:A2AK51"
FT                   /protein_id="EDL30908.1"
FT                   /translation="MTQEVIDTLPGAQDSKGKDSGLPSRCTLALAEEAGTGAGMYFAFG
FT                   YQKITMQDAKIERQLIVLPSCDTFQPWQ"
FT   assembly_gap    35423729..35423833
FT                   /estimated_length=105
FT                   /gap_type="unknown"
FT   assembly_gap    35426507..35427754
FT                   /estimated_length=1248
FT                   /gap_type="unknown"
FT   assembly_gap    35431918..35431937
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    35526146..35526252
FT                   /estimated_length=107
FT                   /gap_type="unknown"
FT   assembly_gap    35588267..35588286
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(35605261..>35608567)
FT                   /locus_tag="mCG_1043563"
FT                   /note="gene_id=mCG1043563.1"
FT   mRNA            complement(join(35605261..35606012,35608398..>35608567))
FT                   /locus_tag="mCG_1043563"
FT                   /product="mCG1043563"
FT                   /note="gene_id=mCG1043563.1 transcript_id=mCT161267.1
FT                   created on 29-JAN-2003"
FT   CDS             complement(join(35605816..35606012,35608398..>35608434))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1043563"
FT                   /product="mCG1043563"
FT                   /note="gene_id=mCG1043563.1 transcript_id=mCT161267.1
FT                   protein_id=mCP76538.0"
FT                   /protein_id="EDL30909.1"
FT                   /translation="GTVCKDWLFCRQRPDTRRCCPVNGNCSASASEHPCGDFVMLRVFT
FT                   DSEENFKENLSINSVLPLTLILTHPEHGNVPL"
FT   assembly_gap    35608126..35608145
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    35628490..35628977
FT                   /estimated_length=488
FT                   /gap_type="unknown"
FT   gene            35629054..35963397
FT                   /gene="Nfia"
FT                   /locus_tag="mCG_122380"
FT                   /note="gene_id=mCG122380.2"
FT   mRNA            join(35629054..35629352,35634271..35634802,
FT                   35807578..35807646,35851233..35851307,35865257..35865374,
FT                   35871871..35871998,35892088..35892216,35913613..35913791,
FT                   35915882..35916047,35932459..35932550,35962214..35963388)
FT                   /gene="Nfia"
FT                   /locus_tag="mCG_122380"
FT                   /product="nuclear factor I/A, transcript variant mCT123596"
FT                   /note="gene_id=mCG122380.2 transcript_id=mCT123596.1
FT                   created on 27-SEP-2002"
FT   mRNA            join(<35629162..35629352,35634271..35634802,
FT                   35807581..35807646,35851233..35851307,35865257..35865374,
FT                   35871871..35871998,35892088..35892216,35913613..35913791,
FT                   35915882..35916047,35932459..35932550,35962214..35963397)
FT                   /gene="Nfia"
FT                   /locus_tag="mCG_122380"
FT                   /product="nuclear factor I/A, transcript variant mCT192871"
FT                   /note="gene_id=mCG122380.2 transcript_id=mCT192871.0
FT                   created on 09-MAR-2004"
FT   CDS             join(<35629233..35629352,35634271..35634802,
FT                   35807581..35807646,35851233..35851307,35865257..35865374,
FT                   35871871..35871998,35892088..35892216,35913613..35913791,
FT                   35915882..35916047,35932459..35932550,35962214..35962231)
FT                   /codon_start=1
FT                   /gene="Nfia"
FT                   /locus_tag="mCG_122380"
FT                   /product="nuclear factor I/A, isoform CRA_b"
FT                   /note="gene_id=mCG122380.2 transcript_id=mCT192871.0
FT                   protein_id=mCP113781.0 isoform=CRA_b"
FT                   /protein_id="EDL30906.1"
FT                   /translation="LSPPLSPSRTHTHAHLQPAHRRARTPRRPAVMYSPLCLTQDEFHP
FT                   FIEALLPHVRAFAYTWFNLQARKRKYFKKHEKRMSKEEERAVKDELLSEKPEVKQKWAS
FT                   RLLAKLRKDIRPEYREDFVLTVTGKKPPCCVLSNPDQKGKMRRIDCLRQADKVWRLDLV
FT                   MVILFKGIPLESTDGERLVKSPQCSNPGLCVQPHHIGVSVKELDLYLAYFVHAADSSQS
FT                   ESPSQPSEADIKDQPENGHLGFQDSFVTSGVFSVTELVRVSQTPIAAGTGPNFSLSDLE
FT                   SSSYYSMSPGAMRRSLPSTSSTSSTKRLKSVEDEMDSPGEEPFYTGQGRSPGSGSQSSG
FT                   WHEVEPGLPSPSTLKKSEKSGFSSPSPSQTSSLGTAFTQHHRPVITGPRASPHATPSTL
FT                   HFPTSPIIQQPGPYFSHPAIRYHPQETLKEFVQLVCPDAGQQAGQVGFLNPNGSSQGKV
FT                   HNPFLPTPMLPPPPPPPMARPVPLPMPDTKPPTTSTEGGAASPTSPTYSTPSTSPANRF
FT                   VSVGPRDPSFVNIPQQTQSWYLG"
FT   CDS             join(35629326..35629352,35634271..35634802,
FT                   35807578..35807646,35851233..35851307,35865257..35865374,
FT                   35871871..35871998,35892088..35892216,35913613..35913791,
FT                   35915882..35916047,35932459..35932550,35962214..35962231)
FT                   /codon_start=1
FT                   /gene="Nfia"
FT                   /locus_tag="mCG_122380"
FT                   /product="nuclear factor I/A, isoform CRA_a"
FT                   /note="gene_id=mCG122380.2 transcript_id=mCT123596.1
FT                   protein_id=mCP75837.1 isoform=CRA_a"
FT                   /protein_id="EDL30905.1"
FT                   /translation="MYSPLCLTQDEFHPFIEALLPHVRAFAYTWFNLQARKRKYFKKHE
FT                   KRMSKEEERAVKDELLSEKPEVKQKWASRLLAKLRKDIRPEYREDFVLTVTGKKPPCCV
FT                   LSNPDQKGKMRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLVKSPQCSNPGLCV
FT                   QPHHIGVSVKELDLYLAYFVHAAADSSQSESPSQPSEADIKDQPENGHLGFQDSFVTSG
FT                   VFSVTELVRVSQTPIAAGTGPNFSLSDLESSSYYSMSPGAMRRSLPSTSSTSSTKRLKS
FT                   VEDEMDSPGEEPFYTGQGRSPGSGSQSSGWHEVEPGLPSPSTLKKSEKSGFSSPSPSQT
FT                   SSLGTAFTQHHRPVITGPRASPHATPSTLHFPTSPIIQQPGPYFSHPAIRYHPQETLKE
FT                   FVQLVCPDAGQQAGQVGFLNPNGSSQGKVHNPFLPTPMLPPPPPPPMARPVPLPMPDTK
FT                   PPTTSTEGGAASPTSPTYSTPSTSPANRFVSVGPRDPSFVNIPQQTQSWYLG"
FT   assembly_gap    35629847..35629956
FT                   /estimated_length=110
FT                   /gap_type="unknown"
FT   assembly_gap    35640593..35640612
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    35686769..35686788
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    35742010..35742029
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    35759633..35759684
FT                   /estimated_length=52
FT                   /gap_type="unknown"
FT   assembly_gap    35792426..35792445
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    35808685..35808738
FT                   /estimated_length=54
FT                   /gap_type="unknown"
FT   assembly_gap    35826660..35826786
FT                   /estimated_length=127
FT                   /gap_type="unknown"
FT   assembly_gap    35850421..35850845
FT                   /estimated_length=425
FT                   /gap_type="unknown"
FT   assembly_gap    35863617..35863903
FT                   /estimated_length=287
FT                   /gap_type="unknown"
FT   assembly_gap    35910995..35911014
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    35928160..35928179
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    35929267..35929286
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    35931579..35931598
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    35941990..35942222
FT                   /estimated_length=233
FT                   /gap_type="unknown"
FT   assembly_gap    35947896..35947915
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    35961479..35961498
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    35999164..36001223
FT                   /estimated_length=2060
FT                   /gap_type="unknown"
FT   assembly_gap    36004050..36004069
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    36007316..36007335
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    36008680..36008699
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    36010168..36010187
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    36047705..36048165
FT                   /estimated_length=461
FT                   /gap_type="unknown"
FT   assembly_gap    36050925..36051425
FT                   /estimated_length=501
FT                   /gap_type="unknown"
FT   assembly_gap    36054849..36055651
FT                   /estimated_length=803
FT                   /gap_type="unknown"
FT   assembly_gap    36058916..36058975
FT                   /estimated_length=60
FT                   /gap_type="unknown"
FT   assembly_gap    36060015..36060034
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    36060980..36061371
FT                   /estimated_length=392
FT                   /gap_type="unknown"
FT   assembly_gap    36068921..36068940
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    36073779..36073798
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    36090578..36090872
FT                   /estimated_length=295
FT                   /gap_type="unknown"
FT   assembly_gap    36095715..36096046
FT                   /estimated_length=332
FT                   /gap_type="unknown"
FT   assembly_gap    36117986..36118466
FT                   /estimated_length=481
FT                   /gap_type="unknown"
FT   assembly_gap    36139454..36141873
FT                   /estimated_length=2420
FT                   /gap_type="unknown"
FT   gene            <36169763..36180043
FT                   /locus_tag="mCG_14767"
FT                   /note="gene_id=mCG14767.1"
FT   mRNA            join(<36169763..36169872,36170674..36170851,
FT                   36179574..36180043)
FT                   /locus_tag="mCG_14767"
FT                   /product="mCG14767"
FT                   /note="gene_id=mCG14767.1 transcript_id=mCT20152.1 created
FT                   on 25-OCT-2002"
FT   CDS             join(<36169763..36169872,36170674..36170851,
FT                   36179574..36179630)
FT                   /codon_start=1
FT                   /locus_tag="mCG_14767"
FT                   /product="mCG14767"
FT                   /note="gene_id=mCG14767.1 transcript_id=mCT20152.1
FT                   protein_id=mCP15840.1"
FT                   /protein_id="EDL30904.1"
FT                   /translation="GEGIGRFSGRLLPHLSPGTADTAAAEGDSQSFQGKKWPRFERNLA
FT                   ASPSLARDRLRRTRLLRRRSAKHRTRRAEPSQRGAAQRLPPGRLPPPTGDQETFRRAAV
FT                   AVTAWASNGN"
FT   assembly_gap    36189588..36189607
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    36202462..36204950
FT                   /estimated_length=2489
FT                   /gap_type="unknown"
FT   gene            complement(36206777..36249739)
FT                   /gene="Tm2d1"
FT                   /locus_tag="mCG_122382"
FT                   /note="gene_id=mCG122382.0"
FT   mRNA            complement(join(36206777..36207130,36214591..36214664,
FT                   36224163..36224254,36228591..36228699,36234289..36234360,
FT                   36236739..36236907,36249334..36249739))
FT                   /gene="Tm2d1"
FT                   /locus_tag="mCG_122382"
FT                   /product="TM2 domain containing 1"
FT                   /note="gene_id=mCG122382.0 transcript_id=mCT123599.1
FT                   created on 25-NOV-2002"
FT   CDS             complement(join(36207020..36207130,36214591..36214664,
FT                   36224163..36224254,36228591..36228699,36234289..36234360,
FT                   36236739..36236907))
FT                   /codon_start=1
FT                   /gene="Tm2d1"
FT                   /locus_tag="mCG_122382"
FT                   /product="TM2 domain containing 1"
FT                   /note="gene_id=mCG122382.0 transcript_id=mCT123599.1
FT                   protein_id=mCP76209.1"
FT                   /protein_id="EDL30903.1"
FT                   /translation="MAAAWPAGRASPAAGPPGLLRTLWLVTVAAGHCGAAASGAVGGEE
FT                   TPKCEDLRVGQYICKEPKINDATQEPVNCTNYTAHVQCFPAPKITCKDLSGNETHFTGS
FT                   EVGFLKPISCRNVNGYSYKVAVALSLFLGWLGADRFYLGYPALGLLKFCTVGFCGIGSL
FT                   IDFILISMQIVGPSDGSSYIIDYYGTRLTRLSITNETFRKTQLYP"
FT   assembly_gap    36208284..36208303
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    36215376..36215395
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    36216976..36216995
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    36220582..36220601
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            36249323..36565084
FT                   /gene="Inadl"
FT                   /locus_tag="mCG_14765"
FT                   /note="gene_id=mCG14765.2"
FT   mRNA            join(36249323..36249593,36261740..36261881,
FT                   36263719..36263914,36267346..36267474,36274991..36275209,
FT                   36276728..36276827,36279650..36279741,36282459..36282600,
FT                   36288040..36288180,36291764..36291852,36294461..36294517,
FT                   36306842..36306976,36315744..36315905,36320183..36320314,
FT                   36342245..36342454,36345732..36345845,36347579..36347986,
FT                   36356357..36356480,36364274..36364448,36369668..36369739,
FT                   36371480..36371657,36374128..36374238,36386253..36386330,
FT                   36389702..36389801,36419743..36419939,36442744..36442835,
FT                   36461954..36462026,36474502..36474588,36489596..36489667,
FT                   36496863..36496980,36498899..36499053,36514061..36514144,
FT                   36520679..36520872,36522665..36522812,36523733..36523819,
FT                   36527642..36527750,36528595..36528632,36533885..36534007,
FT                   36534678..36534782,36550591..36550697,36563390..36565084)
FT                   /gene="Inadl"
FT                   /locus_tag="mCG_14765"
FT                   /product="InaD-like (Drosophila), transcript variant
FT                   mCT20154"
FT                   /note="gene_id=mCG14765.2 transcript_id=mCT20154.1 created
FT                   on 23-SEP-2002"
FT   assembly_gap    36254051..36257480
FT                   /estimated_length=3430
FT                   /gap_type="unknown"
FT   assembly_gap    36258733..36258770
FT                   /estimated_length=38
FT                   /gap_type="unknown"
FT   assembly_gap    36259854..36260088
FT                   /estimated_length=235
FT                   /gap_type="unknown"
FT   CDS             join(36275051..36275209,36276728..36276827,
FT                   36279650..36279741,36282459..36282600,36288040..36288180,
FT                   36291764..36291852,36294461..36294517,36306842..36306976,
FT                   36315744..36315905,36320183..36320314,36342245..36342454,
FT                   36345732..36345845,36347579..36347986,36356357..36356480,
FT                   36364274..36364448,36369668..36369739,36371480..36371657,
FT                   36374128..36374238,36386253..36386330,36389702..36389801,
FT                   36419743..36419939,36442744..36442835,36461954..36462026,
FT                   36474502..36474588,36489596..36489667,36496863..36496980,
FT                   36498899..36499053,36514061..36514144,36520679..36520872,
FT                   36522665..36522812,36523733..36523819,36527642..36527750,
FT                   36528595..36528632,36533885..36534007,36534678..36534782,
FT                   36550591..36550697,36563390..36563417)
FT                   /codon_start=1
FT                   /gene="Inadl"
FT                   /locus_tag="mCG_14765"
FT                   /product="InaD-like (Drosophila), isoform CRA_b"
FT                   /note="gene_id=mCG14765.2 transcript_id=mCT20154.1
FT                   protein_id=mCP15824.1 isoform=CRA_b"
FT                   /protein_id="EDL30902.1"
FT                   /translation="MTSEQVAQVLRNCGNSVRMLVARDPVGEIAVTPPTPVSLPVALPA
FT                   VATRTLDSDRSPFETYSVELVKKDGQSLGIRIVGYVGTAHPGEASGIYVKSIIPGSAAY
FT                   HNGQIQVNDKIVAVDGVNIQGFANQDVVEVLRNAGQVVHLTLVRRKTSLSASPFEHSSS
FT                   RETVAEPPKVPERAGSPKPEANLSVEAEEIGERLDNLKNNTVQALEKPDVYPEKVPGSP
FT                   ENELKSRWENLLGPDYEVMVATLDAQIADDEELQKYSKLLPIHTLRLGMEVDSFDGHHY
FT                   ISSVAPGGPVDTLNLLQPEDELLEVNGMQLYGKSRREAVSFLKEVPPPFTLVCCRRLFD
FT                   DEASVDEPRTMEPALLEAEVDHSVDVNIEDDDDGELALWSPEVKTVELVKDCKGLGFSI
FT                   LDYQDPLDPTRSVIVIRSLVADGVAERSGELLPGDRLVSVNEFSLDNATLAEAVEVLKA
FT                   VPPGVVHLGICKPLVEDEKEERFSLHSNNNGDSSEPADAVHEIHSSLILEAPQGFRDEP
FT                   YLEELVDEPFLDLGKSLQFQQKDVDSSSEAWEMHEFLSPPLDGRGEEREMLVDEEYELY
FT                   QDHLRAMESNPPPPHIREAAPASPVLELQAGTQWLHANLSGGERLECHDAESMMSAYPQ
FT                   EMQQYSYSTADMMEETFGLDSRAPIPSSEGNGQHGRFDDMGHLHSLTSSSLDLGMMIPS
FT                   DLQGPGVLVDLPAVAQRREQEDLPLYRLPSARVVTKPSSHMGLVSSRHANAACELPERE
FT                   EGEGEETPNFSHWGPPRIVEIFREPNVSLGISIVGGQTVIKRLKNGEELKGIFIKQVLE
FT                   DSPAGKTNALKTGDKILEVSGVDLQNASHAEAVEAIKSAGNPVVFVVQSLSSTPRVIPT
FT                   VNNKGKTPAPNQDQNTQERKAKRHGTAPPPMKLPPPYRAPSADMEGSEEDCALTDKKIR
FT                   QRYADLPGELHIIELEKDKNGLGLSLAGNKDRSRMSIFVVGINPEGPAAADGRMRIGDE
FT                   LLEINNQILYGRSHQNASAIIKTAPTRVKLVFIRNEDAVSQMAVAPFPELSHSPSPVED
FT                   LGGTELVSSEEESSVDAKHLPEPESSKPEDLSQVVDDNMVAEQQKESESPDSAACQIKQ
FT                   QTYSTQVSSSSQDSPSSPAPLCQSAHADVTGSGNFQAPLPVDPAPLSVDPATCPIVPGQ
FT                   EMIIEISKGRSGLGLSIVGGKDTPLDAIVIHEVYEEGAAARDGRLWAGDQILEVNGVDL
FT                   RSSSHEEAITALRQTPQKVRLVVYRDEAQYRDEENLEVFLVDLQKKTGRGLGLSIVGKR
FT                   SGSGVFISDIVKGGAADLDGRLIRGDQILSVNGEDMRHASQETVATILKCVQGLVQLEI
FT                   GRLRAGSWAASRKTSQNSQGDQHSAHSSCRPSFAPVITSLQNLVGTKRSSDPPQKCTEE
FT                   EPRTVEIIRELSDALGISIAGGKGSPLGDIPIFIAMIQANGVAARTQKLKVGDRIVSIN
FT                   GQPLDGLSHTDAVNLLKNAFGRIILQVVADTNISAIATQLEIMSAGSQLGSPTADRHPE
FT                   DTEEQMQRTAD"
FT   mRNA            join(<36301282..36301385,36306842..36306976,
FT                   36315744..36315905,36320183..36320314,36342245..36342454,
FT                   36345732..36345845,36347579..36347986,36356357..36356480,
FT                   36364274..36364448,36369668..36369739,36371480..36371657,
FT                   36374128..36374238,36386253..36386330,36389702..36389801,
FT                   36419743..36419939,36442744..36442835,36461954..36462026,
FT                   36474502..36474588,36489596..36489667,36496863..36496980,
FT                   36498899..36499053,36514061..36514144,36520679..36520872,
FT                   36522665..36522812,36523733..36523819,36527642..36527750,
FT                   36528595..36528632,36533885..36534007,36534678..36534782,
FT                   36550591..36550697,36563390..36563839)
FT                   /gene="Inadl"
FT                   /locus_tag="mCG_14765"
FT                   /product="InaD-like (Drosophila), transcript variant
FT                   mCT192863"
FT                   /note="gene_id=mCG14765.2 transcript_id=mCT192863.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<36301368..36301385,36306842..36306976,
FT                   36315744..36315905,36320183..36320314,36342245..36342454,
FT                   36345732..36345845,36347579..36347986,36356357..36356480,
FT                   36364274..36364448,36369668..36369739,36371480..36371657,
FT                   36374128..36374238,36386253..36386330,36389702..36389801,
FT                   36419743..36419939,36442744..36442835,36461954..36462026,
FT                   36474502..36474588,36489596..36489667,36496863..36496980,
FT                   36498899..36499053,36514061..36514144,36520679..36520872,
FT                   36522665..36522812,36523733..36523819,36527642..36527750,
FT                   36528595..36528632,36533885..36534007,36534678..36534782,
FT                   36550591..36550697,36563390..36563417)
FT                   /codon_start=1
FT                   /gene="Inadl"
FT                   /locus_tag="mCG_14765"
FT                   /product="InaD-like (Drosophila), isoform CRA_a"
FT                   /note="gene_id=mCG14765.2 transcript_id=mCT192863.0
FT                   protein_id=mCP113793.0 isoform=CRA_a"
FT                   /protein_id="EDL30901.1"
FT                   /translation="VSPPSVLLPIHTLRLGMEVDSFDGHHYISSVAPGGPVDTLNLLQP
FT                   EDELLEVNGMQLYGKSRREAVSFLKEVPPPFTLVCCRRLFDDEASVDEPRTMEPALLEA
FT                   EVDHSVDVNIEDDDDGELALWSPEVKTVELVKDCKGLGFSILDYQDPLDPTRSVIVIRS
FT                   LVADGVAERSGELLPGDRLVSVNEFSLDNATLAEAVEVLKAVPPGVVHLGICKPLVEDE
FT                   KEERFSLHSNNNGDSSEPADAVHEIHSSLILEAPQGFRDEPYLEELVDEPFLDLGKSLQ
FT                   FQQKDVDSSSEAWEMHEFLSPPLDGRGEEREMLVDEEYELYQDHLRAMESNPPPPHIRE
FT                   AAPASPVLELQAGTQWLHANLSGGERLECHDAESMMSAYPQEMQQYSYSTADMMEETFG
FT                   LDSRAPIPSSEGNGQHGRFDDMGHLHSLTSSSLDLGMMIPSDLQGPGVLVDLPAVAQRR
FT                   EQEDLPLYRLPSARVVTKPSSHMGLVSSRHANAACELPEREEGEGEETPNFSHWGPPRI
FT                   VEIFREPNVSLGISIVGGQTVIKRLKNGEELKGIFIKQVLEDSPAGKTNALKTGDKILE
FT                   VSGVDLQNASHAEAVEAIKSAGNPVVFVVQSLSSTPRVIPTVNNKGKTPAPNQDQNTQE
FT                   RKAKRHGTAPPPMKLPPPYRAPSADMEGSEEDCALTDKKIRQRYADLPGELHIIELEKD
FT                   KNGLGLSLAGNKDRSRMSIFVVGINPEGPAAADGRMRIGDELLEINNQILYGRSHQNAS
FT                   AIIKTAPTRVKLVFIRNEDAVSQMAVAPFPELSHSPSPVEDLGGTELVSSEEESSVDAK
FT                   HLPEPESSKPEDLSQVVDDNMVAEQQKESESPDSAACQIKQQTYSTQVSSSSQDSPSSP
FT                   APLCQSAHADVTGSGNFQAPLPVDPAPLSVDPATCPIVPGQEMIIEISKGRSGLGLSIV
FT                   GGKDTPLDAIVIHEVYEEGAAARDGRLWAGDQILEVNGVDLRSSSHEEAITALRQTPQK
FT                   VRLVVYRDEAQYRDEENLEVFLVDLQKKTGRGLGLSIVGKRSGSGVFISDIVKGGAADL
FT                   DGRLIRGDQILSVNGEDMRHASQETVATILKCVQGLVQLEIGRLRAGSWAASRKTSQNS
FT                   QGDQHSAHSSCRPSFAPVITSLQNLVGTKRSSDPPQKCTEEEPRTVEIIRELSDALGIS
FT                   IAGGKGSPLGDIPIFIAMIQANGVAARTQKLKVGDRIVSINGQPLDGLSHTDAVNLLKN
FT                   AFGRIILQVVADTNISAIATQLEIMSAGSQLGSPTADRHPEDTEEQMQRTAD"
FT   assembly_gap    36368826..36369013
FT                   /estimated_length=188
FT                   /gap_type="unknown"
FT   assembly_gap    36408542..36408870
FT                   /estimated_length=329
FT                   /gap_type="unknown"
FT   assembly_gap    36436768..36436787
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    36446244..36447276
FT                   /estimated_length=1033
FT                   /gap_type="unknown"
FT   assembly_gap    36455383..36455402
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    36491776..36494098
FT                   /estimated_length=2323
FT                   /gap_type="unknown"
FT   assembly_gap    36525997..36526016
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    36545008..36545513
FT                   /estimated_length=506
FT                   /gap_type="unknown"
FT   assembly_gap    36555717..36555736
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    36566880..36567434
FT                   /estimated_length=555
FT                   /gap_type="unknown"
FT   gene            36572444..>36583590
FT                   /locus_tag="mCG_14769"
FT                   /note="gene_id=mCG14769.2"
FT   mRNA            join(36572444..36572477,36573032..36573107,
FT                   36578658..36579593,36581950..>36583590)
FT                   /locus_tag="mCG_14769"
FT                   /product="mCG14769"
FT                   /note="gene_id=mCG14769.2 transcript_id=mCT20157.2 created
FT                   on 25-NOV-2002"
FT   CDS             join(36578718..36579593,36581950..36583590)
FT                   /codon_start=1
FT                   /locus_tag="mCG_14769"
FT                   /product="mCG14769"
FT                   /note="gene_id=mCG14769.2 transcript_id=mCT20157.2
FT                   protein_id=mCP15829.2"
FT                   /protein_id="EDL30900.1"
FT                   /translation="MSGVQSKAARLQKERKEKLSADRERKTATSLCLKHSEVPASMMKQ
FT                   FNALMEMQEVMFAEMRETYKNDIKEMLLKRTAPWVKHLEERIGQQEGDAISERPKPGEK
FT                   VEELSSGTDEDTENLTVRSKKGKQDKAKPLNSSHVLKSSLEREGEALHGEHGRCGESSN
FT                   LVDWKNANEKPAREPSCQSEENRLKAPKESPPEGGAGATLRLAADFSAATLDVGRQWSQ
FT                   VFRLLKEKELEPELQCSVKLAFKCDGEANVFSDLHSLRQFTSRKPFLRELLKDVFPQNE
FT                   GGKRNELRERLGKTLGDTKHEARRIASDSLSFLFIKEVEVASPEVKTYKEETLDWKNKG
FT                   TLKKQEGEEEEISETQGEETSEGETSELGEEEGSESEEEEESSESEEESSESGEEEEDS
FT                   GEEEEEEEEEEEENSEMGKKEVASIRSEVLGSAFQGLAVAGECGVGKITRSAEEIGFIS
FT                   LVVDSESEEEVNRKTASQTKKKETFHGLKELAFSYLVWDSKKKKLVRCQEGGAAAASTQ
FT                   RIGMPCLTLYLTSPSESLGAGSDGPKSHSCTKLSALSQVTPLLTNIEKGRYKVPQTEEP
FT                   TAKEADLILETEENFRRGVISVIRQMQREVDKIKNIYVSDVLNMKSALDDLNSLACTIE
FT                   ARVSEQEDAVEGLTKDTMQLAREIVDKERLREREDRFRSSNIRVIGIPEKENRENGAVD
FT                   IIKEVIEENFAELEDQSLEIVSAHRVPNSVDEHRLTPRHILVKFGSASDKQRVLKASRA
FT                   KQEITYRGSKIRLTADLSPGTIDARSQWCGIIKILQDEGFQPRILYPAKLAFDFKGKTK
FT                   IFFDIEEFKKFISDIPYLKDLLNNIH"
FT   assembly_gap    36590042..36592496
FT                   /estimated_length=2455
FT                   /gap_type="unknown"
FT   gene            complement(36605378..36668049)
FT                   /gene="Ankrd38"
FT                   /locus_tag="mCG_142389"
FT                   /note="gene_id=mCG142389.0"
FT   mRNA            complement(join(36605378..36606066,36610884..36611084,
FT                   36614975..36615117,36620774..36620993,36622901..36622988,
FT                   36624696..36624914,36627034..36627145,36628299..36630227,
FT                   36635701..36635783,36667999..36668049))
FT                   /gene="Ankrd38"
FT                   /locus_tag="mCG_142389"
FT                   /product="ankyrin repeat domain 38"
FT                   /note="gene_id=mCG142389.0 transcript_id=mCT180371.0
FT                   created on 10-FEB-2003"
FT   CDS             complement(join(36605944..36606066,36610884..36611084,
FT                   36614975..36615117,36620774..36620993,36622901..36622988,
FT                   36624696..36624914,36627034..36627145,36628299..36630227,
FT                   36635701..36635716))
FT                   /codon_start=1
FT                   /gene="Ankrd38"
FT                   /locus_tag="mCG_142389"
FT                   /product="ankyrin repeat domain 38"
FT                   /note="gene_id=mCG142389.0 transcript_id=mCT180371.0
FT                   protein_id=mCP103293.0"
FT                   /protein_id="EDL30898.1"
FT                   /translation="MEKIDGKDQSSQGDEEKEPPKSYPYSVETPYGFHLDLDFLKYVDD
FT                   IEKGHTIKRIPIHRRAKQAKFSTLPRNFSLPNSGDRTYAVPPQQNWSPVVPRKISLGTQ
FT                   EPSQPLPLGDLPQASVQGSELNYHRKALLAKDARQAEAGSLEDVGSGRPQLLRASSMPA
FT                   TLLQNQVPEEPSLTSGPSTLLALPLLQDEGSVCDGAFDPAEGLMGFQASAQSVDRELGE
FT                   LEPAIPEQVWEGAEPEEGDLKASSHLSQPGPSSAVQSVPMDLEEVEIEHHMREAELVLT
FT                   PGSATPSPPPLPSPILENDLSLDEIELSISEIPPPPPIEVDVRSIGIRVTEESLGLLET
FT                   DTSSISSLKNQVLALEDKLSGRTEELARVRAALEQQEEETKAREQRIQELECTVAHLEE
FT                   KLSQERASEAPDRTDATVNTDPLQELTPRESHDKNIGVNLLNTPDPECRAPRAEKNGFP
FT                   WVQNNHKQSYPSPEEPVLPPQLSLPRGPEQILASSLCSCLSMELRIEEEGSEQEGGQEE
FT                   GAGGLSRAAGESSWSTRESAPVIREEATSELPGAERPGRPASSPQDATIGQYVKKIQEL
FT                   LHEQWNCLEHGYPELASAIKQPASKLSSIQNQLLSSLNLLLSAYSAQAPEPEPKETPAP
FT                   PPSTPPPPPPPPPEISPSTSLKSIMKKKDYGFRAGGNGTKKNLQFVGVNGGYETTSSEE
FT                   TSGEDSSPEDLSDSETEKKQDCSESREDRDLHPSCEAGQGVPEGTRNSGHTSDRGEEVS
FT                   HLRAERYKPSEEFLNACQTLSQHLPETGDTTKQLLRQSLNTISQEWFRVSSRKLSSPEA
FT                   VAAYLLEVQPHSPYLLKLLVNLADRSGNTALHYSVSHSNFAIVKLLLDTGVCNVDHQNK
FT                   AGYTAVMITPLASAETKEDMAVVWKLLREGNVNIQATQGGQTALMLGVSHDREDMVQAL
FT                   LSCQADVNLQDNDGSSALMLACHQGNADLVRLLLAHPACNSSLTDKAGRTALSLVLNSP
FT                   AHVEIAELLRAHSEPGRSLGPKELQKN"
FT   assembly_gap    36642079..36642319
FT                   /estimated_length=241
FT                   /gap_type="unknown"
FT   gene            36643857..36649257
FT                   /locus_tag="mCG_148065"
FT                   /note="gene_id=mCG148065.0"
FT   mRNA            join(36643857..36643972,36646099..36646176,
FT                   36646933..36648614,36648885..36649257)
FT                   /locus_tag="mCG_148065"
FT                   /product="mCG148065"
FT                   /note="gene_id=mCG148065.0 transcript_id=mCT188328.0
FT                   created on 13-JAN-2004"
FT   CDS             join(36646110..36646176,36646933..36647036)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148065"
FT                   /product="mCG148065"
FT                   /note="gene_id=mCG148065.0 transcript_id=mCT188328.0
FT                   protein_id=mCP109409.0"
FT                   /protein_id="EDL30899.1"
FT                   /translation="MKSLCKGQHLALRCPGPEHHESAPGALEVLTPLQMRQRWLPRDPV
FT                   RAQRRIQRNSS"
FT   assembly_gap    36654930..36655108
FT                   /estimated_length=179
FT                   /gap_type="unknown"
FT   assembly_gap    36663410..36663429
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    36673963..36673982
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    36676148..36676185
FT                   /estimated_length=38
FT                   /gap_type="unknown"
FT   assembly_gap    36690951..36691032
FT                   /estimated_length=82
FT                   /gap_type="unknown"
FT   assembly_gap    36713948..36714181
FT                   /estimated_length=234
FT                   /gap_type="unknown"
FT   assembly_gap    36714722..36716058
FT                   /estimated_length=1337
FT                   /gap_type="unknown"
FT   assembly_gap    36718019..36718693
FT                   /estimated_length=675
FT                   /gap_type="unknown"
FT   assembly_gap    36735350..36735938
FT                   /estimated_length=589
FT                   /gap_type="unknown"
FT   assembly_gap    36739736..36739902
FT                   /estimated_length=167
FT                   /gap_type="unknown"
FT   assembly_gap    36753101..36753152
FT                   /estimated_length=52
FT                   /gap_type="unknown"
FT   assembly_gap    36762316..36763492
FT                   /estimated_length=1177
FT                   /gap_type="unknown"
FT   assembly_gap    36764232..36769150
FT                   /estimated_length=4919
FT                   /gap_type="unknown"
FT   assembly_gap    36771241..36771260
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            36780611..36792512
FT                   /gene="Usp1"
FT                   /locus_tag="mCG_114635"
FT                   /note="gene_id=mCG114635.0"
FT   mRNA            join(36780611..36781218,36783430..36783649,
FT                   36785192..36785312,36785822..36785926,36786652..36786812,
FT                   36787818..36788506,36789144..36789314,36789794..36789995,
FT                   36791041..36792512)
FT                   /gene="Usp1"
FT                   /locus_tag="mCG_114635"
FT                   /product="ubiquitin specific peptidase 1, transcript
FT                   variant mCT115729"
FT                   /note="gene_id=mCG114635.0 transcript_id=mCT115729.1
FT                   created on 25-NOV-2002"
FT   mRNA            join(36780905..36781218,36785192..36785312,
FT                   36785822..36785926,36786652..36786812,36787818..36788506,
FT                   36789144..36789314,36789794..36789995,36791041..36792507)
FT                   /gene="Usp1"
FT                   /locus_tag="mCG_114635"
FT                   /product="ubiquitin specific peptidase 1, transcript
FT                   variant mCT176326"
FT                   /note="gene_id=mCG114635.0 transcript_id=mCT176326.0
FT                   created on 25-NOV-2002"
FT   mRNA            join(<36780952..36781218,36783411..36783649,
FT                   36785192..36785312,36785822..36785926,36786652..36786812,
FT                   36787818..36788506,36789144..36789314,36789794..36789995,
FT                   36791041..36792507)
FT                   /gene="Usp1"
FT                   /locus_tag="mCG_114635"
FT                   /product="ubiquitin specific peptidase 1, transcript
FT                   variant mCT192875"
FT                   /note="gene_id=mCG114635.0 transcript_id=mCT192875.0
FT                   created on 09-MAR-2004"
FT   CDS             join(36781211..36781218,36785192..36785312,
FT                   36785822..36785926,36786652..36786812,36787818..36788506,
FT                   36789144..36789314,36789794..36789995,36791041..36791776)
FT                   /codon_start=1
FT                   /gene="Usp1"
FT                   /locus_tag="mCG_114635"
FT                   /product="ubiquitin specific peptidase 1, isoform CRA_b"
FT                   /note="gene_id=mCG114635.0 transcript_id=mCT176326.0
FT                   protein_id=mCP99248.0 isoform=CRA_b"
FT                   /protein_id="EDL30896.1"
FT                   /translation="MTGDQVVPAAQSSPVSCEKRENLLPFVGLNNLGNTCYLNSILQVL
FT                   YFCPGFKTGVKHLFNIISRKKEALKDDSNQKDKGSCKEESLASYELICSLQSLIISVEQ
FT                   LQASFLLNPEKYTDELATQPRRLLNTLRELNPMYEGFLQHDAQEVLQCILGNIQETCQL
FT                   LKKEEIKNLAELSGKVEEQSLQKEETGGITSTEIDSMRNTEDVKEQLPKGNWKRKSDSE
FT                   SSNVKKKVKLSRESQPLEENQRQTRSKRKAIGDTLEAAPKIIPKCVSESESAKPSQKKS
FT                   KVKINWLKPSTKQPSILSKFCSLGKITTNQRSKGQPKEKEGDVEEDLEKYGSDHTANGG
FT                   PESPGSSVTPVDSSEAKSGNKGAEQIGFELVEKLFQGQLVLRTRCLECESLTERREDFQ
FT                   DISVPVQEDELSKVEESSEISPEPKTEMKTLRWAISQFASVERIVGEDKYFCENCHHYT
FT                   EAERSLLFDKMPEVITIHLKCFAASGLEFDCYGGGLSKINTPLLTPLKLSLEEWSTKPT
FT                   NDSYGLFAVVMHSGITISSGHYTASVKVTDLNSLELDEGNFVVDQMCELGKPEPLTEEQ
FT                   ARGTAGNYDDEVSIRVGGNAQPSKVLNKKNVEGIGLLGGQKSKADYELYNKASNPDKVV
FT                   GTPFTDNRNSETNDTTNGTHESDRNKESSDQTGVNMNGLENKISYVVQSLKEYEGKWLL
FT                   FDDSEVKVTEEKDFLNSLSPSTSPTSTPYLLFYKKL"
FT   CDS             join(<36783474..36783649,36785192..36785312,
FT                   36785822..36785926,36786652..36786812,36787818..36788506,
FT                   36789144..36789314,36789794..36789995,36791041..36791776)
FT                   /codon_start=1
FT                   /gene="Usp1"
FT                   /locus_tag="mCG_114635"
FT                   /product="ubiquitin specific peptidase 1, isoform CRA_c"
FT                   /note="gene_id=mCG114635.0 transcript_id=mCT192875.0
FT                   protein_id=mCP113831.0 isoform=CRA_c"
FT                   /protein_id="EDL30897.1"
FT                   /translation="KKMPGVIPSESNGLSRGSPSKKNRLSLKFFQKKETKRALDFTDSQ
FT                   ENEEKTSEYRGSEIDQVVPAAQSSPVSCEKRENLLPFVGLNNLGNTCYLNSILQVLYFC
FT                   PGFKTGVKHLFNIISRKKEALKDDSNQKDKGSCKEESLASYELICSLQSLIISVEQLQA
FT                   SFLLNPEKYTDELATQPRRLLNTLRELNPMYEGFLQHDAQEVLQCILGNIQETCQLLKK
FT                   EEIKNLAELSGKVEEQSLQKEETGGITSTEIDSMRNTEDVKEQLPKGNWKRKSDSESSN
FT                   VKKKVKLSRESQPLEENQRQTRSKRKAIGDTLEAAPKIIPKCVSESESAKPSQKKSKVK
FT                   INWLKPSTKQPSILSKFCSLGKITTNQRSKGQPKEKEGDVEEDLEKYGSDHTANGGPES
FT                   PGSSVTPVDSSEAKSGNKGAEQIGFELVEKLFQGQLVLRTRCLECESLTERREDFQDIS
FT                   VPVQEDELSKVEESSEISPEPKTEMKTLRWAISQFASVERIVGEDKYFCENCHHYTEAE
FT                   RSLLFDKMPEVITIHLKCFAASGLEFDCYGGGLSKINTPLLTPLKLSLEEWSTKPTNDS
FT                   YGLFAVVMHSGITISSGHYTASVKVTDLNSLELDEGNFVVDQMCELGKPEPLTEEQARG
FT                   TAGNYDDEVSIRVGGNAQPSKVLNKKNVEGIGLLGGQKSKADYELYNKASNPDKVVGTP
FT                   FTDNRNSETNDTTNGTHESDRNKESSDQTGVNMNGLENKISYVVQSLKEYEGKWLLFDD
FT                   SEVKVTEEKDFLNSLSPSTSPTSTPYLLFYKKL"
FT   CDS             join(36783480..36783649,36785192..36785312,
FT                   36785822..36785926,36786652..36786812,36787818..36788506,
FT                   36789144..36789314,36789794..36789995,36791041..36791776)
FT                   /codon_start=1
FT                   /gene="Usp1"
FT                   /locus_tag="mCG_114635"
FT                   /product="ubiquitin specific peptidase 1, isoform CRA_a"
FT                   /note="gene_id=mCG114635.0 transcript_id=mCT115729.1
FT                   protein_id=mCP76489.1 isoform=CRA_a"
FT                   /protein_id="EDL30895.1"
FT                   /translation="MPGVIPSESNGLSRGSPSKKNRLSLKFFQKKETKRALDFTDSQEN
FT                   EEKTSEYRGSEIDQVVPAAQSSPVSCEKRENLLPFVGLNNLGNTCYLNSILQVLYFCPG
FT                   FKTGVKHLFNIISRKKEALKDDSNQKDKGSCKEESLASYELICSLQSLIISVEQLQASF
FT                   LLNPEKYTDELATQPRRLLNTLRELNPMYEGFLQHDAQEVLQCILGNIQETCQLLKKEE
FT                   IKNLAELSGKVEEQSLQKEETGGITSTEIDSMRNTEDVKEQLPKGNWKRKSDSESSNVK
FT                   KKVKLSRESQPLEENQRQTRSKRKAIGDTLEAAPKIIPKCVSESESAKPSQKKSKVKIN
FT                   WLKPSTKQPSILSKFCSLGKITTNQRSKGQPKEKEGDVEEDLEKYGSDHTANGGPESPG
FT                   SSVTPVDSSEAKSGNKGAEQIGFELVEKLFQGQLVLRTRCLECESLTERREDFQDISVP
FT                   VQEDELSKVEESSEISPEPKTEMKTLRWAISQFASVERIVGEDKYFCENCHHYTEAERS
FT                   LLFDKMPEVITIHLKCFAASGLEFDCYGGGLSKINTPLLTPLKLSLEEWSTKPTNDSYG
FT                   LFAVVMHSGITISSGHYTASVKVTDLNSLELDEGNFVVDQMCELGKPEPLTEEQARGTA
FT                   GNYDDEVSIRVGGNAQPSKVLNKKNVEGIGLLGGQKSKADYELYNKASNPDKVVGTPFT
FT                   DNRNSETNDTTNGTHESDRNKESSDQTGVNMNGLENKISYVVQSLKEYEGKWLLFDDSE
FT                   VKVTEEKDFLNSLSPSTSPTSTPYLLFYKKL"
FT   assembly_gap    36784393..36784575
FT                   /estimated_length=183
FT                   /gap_type="unknown"
FT   gene            complement(36793830..36943831)
FT                   /gene="Dock7"
FT                   /locus_tag="mCG_17693"
FT                   /note="gene_id=mCG17693.2"
FT   mRNA            complement(join(36793830..36794270,36797947..36798114,
FT                   36799643..36799749,36801696..36801839,36802184..36802420,
FT                   36802541..36802630,36803685..36803819,36812367..36812498,
FT                   36815113..36815256,36816028..36816220,36818267..36818367,
FT                   36819131..36819289,36823224..36823376,36824155..36824289,
FT                   36826562..36826658,36827727..36827823,36830059..36830194,
FT                   36830295..36830477,36832805..36832959,36834796..36834965,
FT                   36845301..36845440,36847942..36848112,36849787..36849900,
FT                   36850001..36850141,36852148..36852243,36853153..36853242,
FT                   36854430..36854519,36861816..36861985,36864456..36864620,
FT                   36868636..36868867,36869957..36870043,36876516..36876617,
FT                   36877447..36877585,36880841..36880911,36884162..36884279,
FT                   36916136..36916298,36917615..36917708,36921856..36921999,
FT                   36924642..36924782,36926041..36926121,36930828..36930977,
FT                   36933052..36933118,36939509..36939594,36940063..36940275,
FT                   36940363..36940506,36943342..36943411,36943656..36943831))
FT                   /gene="Dock7"
FT                   /locus_tag="mCG_17693"
FT                   /product="dedicator of cytokinesis 7"
FT                   /note="gene_id=mCG17693.2 transcript_id=mCT15002.1 created
FT                   on 30-OCT-2002"
FT   CDS             complement(join(36794228..36794270,36797947..36798114,
FT                   36799643..36799749,36801696..36801839,36802184..36802420,
FT                   36802541..36802630,36803685..36803819,36812367..36812498,
FT                   36815113..36815256,36816028..36816220,36818267..36818367,
FT                   36819131..36819289,36823224..36823376,36824155..36824289,
FT                   36826562..36826658,36827727..36827823,36830059..36830194,
FT                   36830295..36830477,36832805..36832959,36834796..36834965,
FT                   36845301..36845440,36847942..36848112,36849787..36849900,
FT                   36850001..36850141,36852148..36852243,36853153..36853242,
FT                   36854430..36854519,36861816..36861985,36864456..36864620,
FT                   36868636..36868867,36869957..36870043,36876516..36876617,
FT                   36877447..36877585,36880841..36880911,36884162..36884279,
FT                   36916136..36916298,36917615..36917708,36921856..36921999,
FT                   36924642..36924782,36926041..36926121,36930828..36930977,
FT                   36933052..36933118,36939509..36939594,36940063..36940275,
FT                   36940363..36940506,36943342..36943407))
FT                   /codon_start=1
FT                   /gene="Dock7"
FT                   /locus_tag="mCG_17693"
FT                   /product="dedicator of cytokinesis 7"
FT                   /note="gene_id=mCG17693.2 transcript_id=mCT15002.1
FT                   protein_id=mCP15832.1"
FT                   /protein_id="EDL30893.1"
FT                   /translation="MDPHVRDCIRSYTEDWAVVVRKIIFNRYHKLGTGFNPNTLDKQKE
FT                   RQKGLPRQVFESDEAPDGSSYQDEQDDLKRRSMSIDDTPRGSWACSIFDLKNSLPDALL
FT                   PNLLDRTPNEEIDHQNDDQRKSNRHKELFALHPSPDEEEPIERLSVPDVPKEHFGQRLL
FT                   VKCLSLKFEIEIEPIFASLALYDVKEKKKISENFYFDLNSEQMKGLLRPHVPPAAITTL
FT                   ARSAIFSITYPSQDVFLVIKLEKVLQQGDIGECAEPYMIFKEADATKNKEKLEKLKSQA
FT                   DQFCQRLGKYRMPFAWTAIHLMNIVSSAGSLERDSERKGSWSERRNSSLVGRRSLERTT
FT                   SGDDACNLTSFRPATLTVANFFKQEGDRLSDEDLYKFLADMRRPSSVLRRLRPITAQLK
FT                   IDISPAPENPHYCLTPELLQVKLYPDSRVRPTREILEFPARDVYVPNTTYRNLLYIYPQ
FT                   SLNFANRQGSARNITVKVQFMYGEDPSNAMPVIFGKSSCSEFSKEAYTAVVYHNRSPDF
FT                   HEEIKVKLPATLTDHHHLLFTFYHVSCQQKQNTPLETPVGYTWIPMLQNGRLKTGQFCL
FT                   PVSLEKPPQAYSVLSPEVPLPGMKWVDNHKGVFNVEVVAVSSIHTQDPYLDKFFALVNA
FT                   LDEHMFPVRIGDMRIMENNLESELKSSISALNSSQLEPVVRFLHLLLDKLILLVVRPPV
FT                   IAGQIVNLGQASFEAMASIINRLHKNLEGNHDQHGRNNLLASYIYYVFRLPNTYPNSPS
FT                   PGPGGLGGSVHYATMARSAVRPASLNLNRSRSLSNSNPDISGTPTSPDDEVRSIIGSKG
FT                   LDRSNSWVNTGPKAAPWGSNPSPSAESTQAMDRSCNRMSSHTETSSFLQTLTGRLPTKK
FT                   LFHEELALQWVVCSGSVRESALQQAWFFFELMVKSMVHHLYFNDKLDAPRKSRFPERFM
FT                   DDIAALVSTIAGDVVSRFQKDTEMVERLNTSLAFFLNDLLSVMDRGFVFSLIKSCYKQV
FT                   SAKLYSLPNPSVLVSLRLDFLRIICSHEHYVTLNLPCSLLTPPASPSPSVSSATSQSSG
FT                   FSTSVQDQKIANMFELSLPFRQQHYLAGLVLTELALILDPDAEGLFGLHKKVINMVHNL
FT                   LSTHDSDPRYSDPQIKARVAMLYLPLIGIIMETVPQLYDFTESHNQRGRPICIAPDDYD
FT                   SESGSMISQTVAMAIAGTSVPQLTRPGSFLLTSTSGRQHTTFSAESSRSLLICLLWVLK
FT                   NADETVLQKWFTDLSVLQLNRLLDLLYLCVSCFEYKGKKVFERMNSLTFKKSKDMRAKL
FT                   EEAILGSIGARQEMVRRSRGQLERSPSGSAFGSQENLRWRKDMTHWRQNSEKLDKSRAE
FT                   IEHEALIDGNLATEANLIILDTLEIIVQTVSVTESKESILGGVLKVLLQSMACNQSAVY
FT                   LQHCFATQRALVSKFPELLFEEETEQCADLCLRLLRHCSSSISTIRSHASASLYLLMRQ
FT                   NFEIGNNFARVKMQVTMSLSSLVGTSQNFNEEFLRRSLKTILTYAEEDLELRETTFPDQ
FT                   VQDLVFNLHMILSDTVKMKEHQEDPEMLIDLMYRIAKGYQTSPDLRLTWLQNMAGKHSE
FT                   RSNHAEAAQCLVHSAALVAEYLSMLEDRKYLPVGCVTFQNISSNVLEESAVSDDVVSPD
FT                   EEGICSGKYFTESGLVGLLEQAAASFSMAGMYEAVNEVYKVLIPIHEANRDAKKLSTIH
FT                   GKLQEAFSKIVHQDGKRMFGTYFRVGFYGTKFGDLDEQEFVYKEPAITKLAEISHRLEG
FT                   FYGERFGEDVLEVIKDSNPVDKCKLDPNKAYIQITYVEPFFDTYEMKDRITYFDKNYNL
FT                   RRFMYCTPFTLDGRAHGELHEQFKRKTILTTSHAFPYIKTRVNVTHKEEIILTPIEVAI
FT                   EDMQKKTQELAFATHQDPADPKMLQMVLQGSVGTTVNQGPLEVAQVFLSEIPGDPKLFR
FT                   HHNKLRLCFKDFTKRCEDALRKNKSLIGPDQKEYQRELERNYHRLKEALQPLINRKIPQ
FT                   LYKAVLPVTCHRDSFSRMSLRKMEL"
FT   assembly_gap    36816620..36816639
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    36835523..36835542
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    36837362..36837381
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    36838807..36838826
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    36863662..36863888
FT                   /estimated_length=227
FT                   /gap_type="unknown"
FT   assembly_gap    36870720..36870923
FT                   /estimated_length=204
FT                   /gap_type="unknown"
FT   gene            36891766..36899014
FT                   /gene="Angptl3"
FT                   /locus_tag="mCG_17692"
FT                   /note="gene_id=mCG17692.1"
FT   mRNA            join(36891766..36892318,36892905..36893015,
FT                   36894072..36894186,36895264..36895377,36895648..36895743,
FT                   36898191..36898457,36898654..36899014)
FT                   /gene="Angptl3"
FT                   /locus_tag="mCG_17692"
FT                   /product="angiopoietin-like 3"
FT                   /note="gene_id=mCG17692.1 transcript_id=mCT15004.2 created
FT                   on 25-NOV-2002"
FT   CDS             join(36891824..36892318,36892905..36893015,
FT                   36894072..36894186,36895264..36895377,36895648..36895743,
FT                   36898191..36898457,36898654..36898823)
FT                   /codon_start=1
FT                   /gene="Angptl3"
FT                   /locus_tag="mCG_17692"
FT                   /product="angiopoietin-like 3"
FT                   /note="gene_id=mCG17692.1 transcript_id=mCT15004.2
FT                   protein_id=mCP15835.1"
FT                   /db_xref="GOA:Q3UEF5"
FT                   /db_xref="InterPro:IPR002181"
FT                   /db_xref="InterPro:IPR014715"
FT                   /db_xref="InterPro:IPR014716"
FT                   /db_xref="MGI:MGI:1353627"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UEF5"
FT                   /protein_id="EDL30894.1"
FT                   /translation="MHTIKLFLFVVPLVIASRVDPDLSSFDSAPSEPKSRFAMLDDVKI
FT                   LANGLLQLGHGLKDFVHKTKGQINDIFQKLNIFDQSFYDLSLRTNEIKEEEKELRRTTS
FT                   TLQVKNEEVKNMSVELNSKLESLLEEKTALQHKVRALEEQLTNLILSPAGAQEHPEVTS
FT                   LKSFVEQQDNSIRELLQSVEEQYKQLSQQHMQIKEIEKQLRKTGIQEPSENSLSSKSRA
FT                   PRTTPPLQLNETENTEQDDLPADCSAVYNRGEHTSGVYTIKPRNSQGFNVYCDTQSGSP
FT                   WTLIQHRKDGSQDFNETWENYEKGFGRLDGEFWLGLEKIYAIVQQSNYILRLELQDWKD
FT                   SKHYVEYSFHLGSHETNYTLHVAEIAGNIPGALPEHTDLMFSTWNHRAKGQLYCPESYS
FT                   GGWWWNDICGENNLNGKYNKPRTKSRPERRRGIYWRPQSRKLYAIKSSKMMLQPTT"
FT   assembly_gap    36920322..36920341
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    36925155..36925174
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    36947468..36947755
FT                   /estimated_length=288
FT                   /gap_type="unknown"
FT   assembly_gap    36952828..36952847
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    36978329..36978356
FT                   /estimated_length=28
FT                   /gap_type="unknown"
FT   assembly_gap    36989504..36989523
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    36994709..36994728
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    36996259..36996278
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    37006891..37006910
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    37021103..37021122
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    37037830..37037891
FT                   /estimated_length=62
FT                   /gap_type="unknown"
FT   assembly_gap    37043336..37043355
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            37063538..37129775
FT                   /gene="Atg4c"
FT                   /locus_tag="mCG_17696"
FT                   /note="gene_id=mCG17696.3"
FT   mRNA            join(37063538..37063915,37085858..37085992,
FT                   37089159..37089242,37091246..37091479,37094846..37095176,
FT                   37096544..37096614,37098089..37098225,37102228..37102306,
FT                   37103155..37103231,37108664..37108783,37128217..37128908)
FT                   /gene="Atg4c"
FT                   /locus_tag="mCG_17696"
FT                   /product="autophagy-related 4C (yeast), transcript variant
FT                   mCT15007"
FT                   /note="gene_id=mCG17696.3 transcript_id=mCT15007.2 created
FT                   on 25-NOV-2002"
FT   mRNA            join(<37063566..37064084,37085858..37085992,
FT                   37089159..37089242,37091246..37091479,37094846..37095176,
FT                   37096544..37096614,37098089..37098225,37102228..37102306,
FT                   37103155..37103231,37108664..37108783,37128217..37129508,
FT                   37129720..37129775)
FT                   /gene="Atg4c"
FT                   /locus_tag="mCG_17696"
FT                   /product="autophagy-related 4C (yeast), transcript variant
FT                   mCT192872"
FT                   /note="gene_id=mCG17696.3 transcript_id=mCT192872.0 created
FT                   on 09-MAR-2004"
FT   assembly_gap    37072590..37072609
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    37073971..37073990
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    37076512..37076531
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    37080671..37080690
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    37081944..37081963
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(<37085893..37085992,37089159..37089242,
FT                   37091246..37091479,37094846..37095176,37096544..37096614,
FT                   37098089..37098225,37102228..37102306,37103155..37103231,
FT                   37108664..37108783,37128217..37128384)
FT                   /codon_start=1
FT                   /gene="Atg4c"
FT                   /locus_tag="mCG_17696"
FT                   /product="autophagy-related 4C (yeast), isoform CRA_b"
FT                   /note="gene_id=mCG17696.3 transcript_id=mCT192872.0
FT                   protein_id=mCP113839.0 isoform=CRA_b"
FT                   /protein_id="EDL30892.1"
FT                   /translation="WLFLKNLNMEASGTDEVDKLKTKFISAWNNMKYSWVLKTKTYFSR
FT                   NSPVLLLGKCYHFKYEDESKMLPARSGCAIEDHVIAGNVEEFRKDFISRIWLTYREEFP
FT                   QIEASALTTDCGWGCTLRTGQMLLAQGLILHFLGRAWTWPDALHIENADSDSWTSNTVK
FT                   KFTASFEASLSGDRELRTPAVSLKETSGKCPDDHTVRNEAYHRKIISWFGDSPVAVFGL
FT                   HRLIEFGKKSGKKAGDWYGPAVVAHILRKAVEEARHPDLQGLTIYVAQDCTVYNSDVID
FT                   KQTDSVTAGDARDKAVIILVPVRLGGERTNTDYLEFVKGVLSLEYCVGIIGGKPKQSYY
FT                   FAGFQDDSLIYMDPHYCQSFVDVSIKDFPLETFHCPSPKKMSFRKMDPSCTIGFYCRNV
FT                   QDFERASEEITKMLKISSKEKYPLFTFVNGHSKDFDFTSTAASEEDLFSEDERKNFKRF
FT                   STEEFVLL"
FT   CDS             join(37085917..37085992,37089159..37089242,
FT                   37091246..37091479,37094846..37095176,37096544..37096614,
FT                   37098089..37098225,37102228..37102306,37103155..37103231,
FT                   37108664..37108783,37128217..37128384)
FT                   /codon_start=1
FT                   /gene="Atg4c"
FT                   /locus_tag="mCG_17696"
FT                   /product="autophagy-related 4C (yeast), isoform CRA_a"
FT                   /note="gene_id=mCG17696.3 transcript_id=mCT15007.2
FT                   protein_id=mCP15836.2 isoform=CRA_a"
FT                   /protein_id="EDL30891.1"
FT                   /translation="MEASGTDEVDKLKTKFISAWNNMKYSWVLKTKTYFSRNSPVLLLG
FT                   KCYHFKYEDESKMLPARSGCAIEDHVIAGNVEEFRKDFISRIWLTYREEFPQIEASALT
FT                   TDCGWGCTLRTGQMLLAQGLILHFLGRAWTWPDALHIENADSDSWTSNTVKKFTASFEA
FT                   SLSGDRELRTPAVSLKETSGKCPDDHTVRNEAYHRKIISWFGDSPVAVFGLHRLIEFGK
FT                   KSGKKAGDWYGPAVVAHILRKAVEEARHPDLQGLTIYVAQDCTVYNSDVIDKQTDSVTA
FT                   GDARDKAVIILVPVRLGGERTNTDYLEFVKGVLSLEYCVGIIGGKPKQSYYFAGFQDDS
FT                   LIYMDPHYCQSFVDVSIKDFPLETFHCPSPKKMSFRKMDPSCTIGFYCRNVQDFERASE
FT                   EITKMLKISSKEKYPLFTFVNGHSKDFDFTSTAASEEDLFSEDERKNFKRFSTEEFVLL
FT                   "
FT   assembly_gap    37094172..37094191
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    37155981..37156263
FT                   /estimated_length=283
FT                   /gap_type="unknown"
FT   assembly_gap    37157867..37158238
FT                   /estimated_length=372
FT                   /gap_type="unknown"
FT   assembly_gap    37162849..37162904
FT                   /estimated_length=56
FT                   /gap_type="unknown"
FT   gene            37165997..37166788
FT                   /locus_tag="mCG_148052"
FT                   /note="gene_id=mCG148052.0"
FT   mRNA            37165997..37166788
FT                   /locus_tag="mCG_148052"
FT                   /product="mCG148052"
FT                   /note="gene_id=mCG148052.0 transcript_id=mCT188315.0
FT                   created on 13-JAN-2004"
FT   CDS             37166009..37166362
FT                   /codon_start=1
FT                   /locus_tag="mCG_148052"
FT                   /product="mCG148052"
FT                   /note="gene_id=mCG148052.0 transcript_id=mCT188315.0
FT                   protein_id=mCP109394.0"
FT                   /protein_id="EDL30890.1"
FT                   /translation="MCSISIYSGNAPGTPSPPAAADFSTAAGPRYFPERPGALPVEKPV
FT                   IGWCSLPDPGAPASSSGRWWGDGVKTRVEGQEEISYAQTITMGSKPQNIYLFQPNDSIK
FT                   WTPAMFLSMNHCT"
FT   assembly_gap    37171895..37171914
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    37247577..37247596
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    37283972..37284202
FT                   /estimated_length=231
FT                   /gap_type="unknown"
FT   assembly_gap    37290327..37290403
FT                   /estimated_length=77
FT                   /gap_type="unknown"
FT   assembly_gap    37302659..37308208
FT                   /estimated_length=5550
FT                   /gap_type="unknown"
FT   assembly_gap    37324282..37324301
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    37326767..37326975
FT                   /estimated_length=209
FT                   /gap_type="unknown"
FT   assembly_gap    37377936..37377955
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    37394451..37394470
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    37420769..37420869
FT                   /estimated_length=101
FT                   /gap_type="unknown"
FT   assembly_gap    37422959..37423071
FT                   /estimated_length=113
FT                   /gap_type="unknown"
FT   assembly_gap    37425629..37425648
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    37437601..37437620
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    37444361..37444780
FT                   /estimated_length=420
FT                   /gap_type="unknown"
FT   assembly_gap    37446793..37446812
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    37451726..37452383
FT                   /estimated_length=658
FT                   /gap_type="unknown"
FT   assembly_gap    37478043..37478371
FT                   /estimated_length=329
FT                   /gap_type="unknown"
FT   assembly_gap    37484445..37484464
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    37493852..37493871
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    37498675..37498694
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    37505526..37505605
FT                   /estimated_length=80
FT                   /gap_type="unknown"
FT   assembly_gap    37508481..37508530
FT                   /estimated_length=50
FT                   /gap_type="unknown"
FT   assembly_gap    37511784..37511958
FT                   /estimated_length=175
FT                   /gap_type="unknown"
FT   assembly_gap    37515464..37515483
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    37523451..37523992
FT                   /estimated_length=542
FT                   /gap_type="unknown"
FT   gene            <37523993..37526335
FT                   /locus_tag="mCG_114630"
FT                   /note="gene_id=mCG114630.0"
FT   mRNA            join(<37523993..37525093,37526114..37526335)
FT                   /locus_tag="mCG_114630"
FT                   /product="mCG114630"
FT                   /note="gene_id=mCG114630.0 transcript_id=mCT115724.0
FT                   created on 16-SEP-2002"
FT   CDS             join(<37524048..37525093,37526114..37526129)
FT                   /codon_start=1
FT                   /locus_tag="mCG_114630"
FT                   /product="mCG114630"
FT                   /note="gene_id=mCG114630.0 transcript_id=mCT115724.0
FT                   protein_id=mCP76403.0"
FT                   /protein_id="EDL30889.1"
FT                   /translation="LSPRREASRHRKSSRSAAAERSARTARCQASSCELTRQGPELPVP
FT                   SPPPPAFFRGTLTPPLPELRGRPSRPPSLSARSWPPPPTPRRDDPLRQRQRQRYVRPDG
FT                   ADGRGRGHRCGGRGRRRAGGEGQRRRVRQPRGASGPAPGRGGRRATGERSSRPVSTASP
FT                   GTAHRGDRAGERHGSSGGRRLQGRRGRGDRRRWARRGQRGDGRSDPEQAQEQPGEATLL
FT                   LHRAHHHGHPAEPAEEADPERHLRVHQQPFSVLPGEVPRLAEQHPPQPVAQRLLRQDPP
FT                   RAGQPGQGQLLDPGPPVRGHVRQRQLPAAPEALQAPPAGAPARADGADDAELRSLQPGG
FT                   GGGRKTLRPFLFF"
FT   assembly_gap    37525111..37526113
FT                   /estimated_length=1003
FT                   /gap_type="unknown"
FT   assembly_gap    37531432..37531451
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    37537796..37538018
FT                   /estimated_length=223
FT                   /gap_type="unknown"
FT   assembly_gap    37539152..37539267
FT                   /estimated_length=116
FT                   /gap_type="unknown"
FT   assembly_gap    37541016..37541466
FT                   /estimated_length=451
FT                   /gap_type="unknown"
FT   gene            37583606..>37628250
FT                   /locus_tag="mCG_114634"
FT                   /note="gene_id=mCG114634.1"
FT   mRNA            join(37583606..37583693,37587018..37587220,
FT                   37594844..37594928,37604281..37604370,37605371..37605459,
FT                   37607692..37607774,37608513..37608577,37609913..37610098,
FT                   37610648..37610783,37612485..37612570,37614849..37614933,
FT                   37616892..37616962,37618999..37619067,37619175..37619373,
FT                   37628053..>37628250)
FT                   /locus_tag="mCG_114634"
FT                   /product="mCG114634"
FT                   /note="gene_id=mCG114634.1 transcript_id=mCT115728.1
FT                   created on 25-NOV-2002"
FT   CDS             join(37587139..37587220,37594844..37594928,
FT                   37604281..37604370,37605371..37605459,37607692..37607774,
FT                   37608513..37608577,37609913..37610098,37610648..37610783,
FT                   37612485..37612570,37614849..37614933,37616892..37616962,
FT                   37618999..37619067,37619175..37619373,37628053..37628250)
FT                   /codon_start=1
FT                   /locus_tag="mCG_114634"
FT                   /product="mCG114634"
FT                   /note="gene_id=mCG114634.1 transcript_id=mCT115728.1
FT                   protein_id=mCP76486.1"
FT                   /protein_id="EDL30888.1"
FT                   /translation="MESWPWMAVVVLLGLTVRWTVSLSSYSGAGKPPMFGDYEAQRHWQ
FT                   EITLNLPVKQWYFNSSDNNLLYWGLDYPPLTAYHSLLCAYVAKFINPDWVALHTSRGYE
FT                   SQAHKLFMRATVLAADLLIYVPAVLLYCYSLKEISPKRKIASALCILLYPGLILIDYGH
FT                   FQYNSVSLGFALWGVLGVSWDWDLLGSLAFCLALNYKQMELYHSLPFFCFLLGKCFKKG
FT                   LKGKGLALFIRIACTVLASFLLCWLPFLTEREHALQVVRRLFPVDRGLFEDKVANIWCS
FT                   VNVFLKIKDTLPRHIQIAISFCFTLLSLLPACIKLTVRPSCKGFRFTLVSCALSFFLFS
FT                   FQVHEKSILLVSLPVCLVLTEIPFMSTWFLLVSTFSMLPLLLKDELLLPSVVTVMAFVI
FT                   ACGTFFPMLENTSEEQLQLKSFAVSVRRHLPGFTFLPRIMQCLFLSSVITMVLLTILSV
FT                   TLDPPQKLPDLFPVLICFVSCVNFVFFLVYFNIVIMWDSKNGRNRKKIE"
FT   assembly_gap    37601490..37604015
FT                   /estimated_length=2526
FT                   /gap_type="unknown"
FT   assembly_gap    37611222..37611241
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    37617541..37617709
FT                   /estimated_length=169
FT                   /gap_type="unknown"
FT   gene            complement(37632389..37695318)
FT                   /locus_tag="mCG_10700"
FT                   /note="gene_id=mCG10700.2"
FT   mRNA            complement(join(37632389..37633759,37635677..37635724,
FT                   37646945..37647004,37648060..37648153,37655784..37655862,
FT                   37668282..37668417,37680493..37680535,37695241..37695318))
FT                   /locus_tag="mCG_10700"
FT                   /product="mCG10700, transcript variant mCT173440"
FT                   /note="gene_id=mCG10700.2 transcript_id=mCT173440.0 created
FT                   on 16-SEP-2002"
FT   mRNA            complement(join(37632389..37633759,37635677..37635724,
FT                   37646945..37647004,37648060..37648153,37655784..37655862,
FT                   37664881..37664947,37668282..37668417,37680493..37680535,
FT                   37695241..37695318))
FT                   /locus_tag="mCG_10700"
FT                   /product="mCG10700, transcript variant mCT10520"
FT                   /note="gene_id=mCG10700.2 transcript_id=mCT10520.2 created
FT                   on 16-SEP-2002"
FT   mRNA            complement(join(37632389..37633759,37635677..37635724,
FT                   37646945..37647004,37648060..37648153,37655784..37655862,
FT                   37680493..37680535,37695241..37695314))
FT                   /locus_tag="mCG_10700"
FT                   /product="mCG10700, transcript variant mCT173441"
FT                   /note="gene_id=mCG10700.2 transcript_id=mCT173441.0 created
FT                   on 16-SEP-2002"
FT   mRNA            complement(join(37633590..37633759,37635677..37635724,
FT                   37646945..37647004,37648060..37648153,37655784..37655862,
FT                   37664881..37664947,37668282..37668417,37695241..>37695292))
FT                   /locus_tag="mCG_10700"
FT                   /product="mCG10700, transcript variant mCT192821"
FT                   /note="gene_id=mCG10700.2 transcript_id=mCT192821.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(37635678..37635724,37646945..37647004,
FT                   37648060..37648153,37655784..37655862,37664881..37664947,
FT                   37668282..37668417,37695241..>37695291))
FT                   /codon_start=1
FT                   /locus_tag="mCG_10700"
FT                   /product="mCG10700, isoform CRA_d"
FT                   /note="gene_id=mCG10700.2 transcript_id=mCT192821.0
FT                   protein_id=mCP113778.0 isoform=CRA_d"
FT                   /protein_id="EDL30886.1"
FT                   /translation="RLRFLSWFCPATESRNASFSPSKIVRKKSITAYSPTTGTYQLSPF
FT                   SSPATPKEQEHRNGPSNETRKRSNLSSPVRQESTVKDRDGFMVLLSKIEISSEKTMEIM
FT                   KNLSSIQALEGNRQLEDLIGVSLVPCSLKSEARKTKELMTKVIKQKLFEKKKSRITPKD
FT                   HHLDSFEFLKAILN"
FT   CDS             complement(join(37635678..37635724,37646945..37647004,
FT                   37648060..37648153,37655784..37655862,37664881..37664947,
FT                   37668282..37668417,37680493..37680535,37695241..37695245))
FT                   /codon_start=1
FT                   /locus_tag="mCG_10700"
FT                   /product="mCG10700, isoform CRA_e"
FT                   /note="gene_id=mCG10700.2 transcript_id=mCT10520.2
FT                   protein_id=mCP16334.2 isoform=CRA_e"
FT                   /protein_id="EDL30887.1"
FT                   /translation="MPVKRSLKLDDQFEKNSFSPSKIVRKKSITAYSPTTGTYQLSPFS
FT                   SPATPKEQEHRNGPSNETRKRSNLSSPVRQESTVKDRDGFMVLLSKIEISSEKTMEIMK
FT                   NLSSIQALEGNRQLEDLIGVSLVPCSLKSEARKTKELMTKVIKQKLFEKKKSRITPKDH
FT                   HLDSFEFLKAILN"
FT   CDS             complement(join(37635678..37635724,37646945..37647004,
FT                   37648060..37648153,37655784..37655862,37680493..37680512))
FT                   /codon_start=1
FT                   /locus_tag="mCG_10700"
FT                   /product="mCG10700, isoform CRA_b"
FT                   /note="gene_id=mCG10700.2 transcript_id=mCT173441.0
FT                   protein_id=mCP96359.0 isoform=CRA_b"
FT                   /protein_id="EDL30884.1"
FT                   /translation="MISLKKIFMVLLSKIEISSEKTMEIMKNLSSIQALEGNRQLEDLI
FT                   GVSLVPCSLKSEARKTKELMTKVIKQKLFEKKKSRITPKDHHLDSFEFLKAILN"
FT   CDS             complement(join(37635678..37635724,37646945..37647004,
FT                   37648060..37648153,37655784..37655858))
FT                   /codon_start=1
FT                   /locus_tag="mCG_10700"
FT                   /product="mCG10700, isoform CRA_a"
FT                   /note="gene_id=mCG10700.2 transcript_id=mCT173440.0
FT                   protein_id=mCP96360.0 isoform=CRA_a"
FT                   /protein_id="EDL30883.1"
FT                   /translation="MVLLSKIEISSEKTMEIMKNLSSIQALEGNRQLEDLIGVSLVPCS
FT                   LKSEARKTKELMTKVIKQKLFEKKKSRITPKDHHLDSFEFLKAILN"
FT   mRNA            complement(join(<37638491..37638572,37646945..37647004,
FT                   37648060..37648153,37655784..37655862,37664881..37664947,
FT                   37668282..37668417,37680493..37680535,37695241..>37695301))
FT                   /locus_tag="mCG_10700"
FT                   /product="mCG10700, transcript variant mCT192820"
FT                   /note="gene_id=mCG10700.2 transcript_id=mCT192820.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(<37638491..37638572,37646945..37647004,
FT                   37648060..37648153,37655784..37655862,37664881..37664947,
FT                   37668282..37668417,37680493..37680535,37695241..>37695299))
FT                   /codon_start=1
FT                   /locus_tag="mCG_10700"
FT                   /product="mCG10700, isoform CRA_c"
FT                   /note="gene_id=mCG10700.2 transcript_id=mCT192820.0
FT                   protein_id=mCP113777.0 isoform=CRA_c"
FT                   /protein_id="EDL30885.1"
FT                   /translation="CFRVCGFSVGSVQQRSPEMPVKRSLKLDDQFEKNSFSPSKIVRKK
FT                   SITAYSPTTGTYQLSPFSSPATPKEQEHRNGPSNETRKRSNLSSPVRQESTVKDRDGFM
FT                   VLLSKIEISSEKTMEIMKNLSSIQALEGNRQLEDLIGVSLVPCSLKSEARKTKELMTKV
FT                   IKQKLFEKKKSRITPKGTGQADPCADTIEKFNVALPLHSGHHRG"
FT   assembly_gap    37679507..37680158
FT                   /estimated_length=652
FT                   /gap_type="unknown"
FT   assembly_gap    37681172..37681191
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    37688464..37688483
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            37695604..37747198
FT                   /gene="BC020077"
FT                   /locus_tag="mCG_1562"
FT                   /note="gene_id=mCG1562.1"
FT   mRNA            join(37695604..37695712,37697551..37697738,
FT                   37709192..37709403,37710344..37710430,37712306..37712501,
FT                   37712925..37713043,37723301..37723442,37731840..37731949,
FT                   37734957..37735114,37736064..37736197,37739093..37739241,
FT                   37743987..37744196,37745331..37745438,37746943..37747198)
FT                   /gene="BC020077"
FT                   /locus_tag="mCG_1562"
FT                   /product="cDNA sequence BC020077"
FT                   /note="gene_id=mCG1562.1 transcript_id=mCT7831.2 created on
FT                   25-NOV-2002"
FT   CDS             join(37697552..37697738,37709192..37709403,
FT                   37710344..37710430,37712306..37712501,37712925..37713043,
FT                   37723301..37723442,37731840..37731949,37734957..37735114,
FT                   37736064..37736197,37739093..37739241,37743987..37744196,
FT                   37745331..37745438,37746943..37747017)
FT                   /codon_start=1
FT                   /gene="BC020077"
FT                   /locus_tag="mCG_1562"
FT                   /product="cDNA sequence BC020077"
FT                   /note="gene_id=mCG1562.1 transcript_id=mCT7831.2
FT                   protein_id=mCP16331.2"
FT                   /protein_id="EDL30882.1"
FT                   /translation="MASNPGSDAALGTQNPLLSGSPRTKKFPLTEQEVFYMNCRAAYLT
FT                   IFKSSLENIISKDQLYLALQHAGRNPSQKTINKYWTPQTAKLNFDDFCIILSKEKPTSK
FT                   AELLKSFKKLDVNDDGAILHSDLQKYLTKRGEKMTQEEVNAVINLADINANGKFDYVKF
FT                   CKLYMTTSEQCLKTTLERLEADSKLRRQQFGSHMEGSPERGPSPAPKPSPRVIRKNDQE
FT                   TFSSKGDTSHALLSTTRKFKTSVSFTMTMSANSNQDSTLTEPNLKDWQCAQSKGCFFLE
FT                   EDGEVVSHQYKMHIAQRSVLYLTIKPLYLSQVEGKRCPWLSVDTALYILKKNENPAEPQ
FT                   LMCFTELRNREVFGWTGELEAGIYWLIPSTTGCRLKKETKPVTEEAQLVHRDETGELSL
FT                   TSEFRSTLSEIFEVIDLDGNGLISLEEYNFFELRTSGEKCDEDAWAVCRENFDTKKNEL
FT                   TRQGFMDLHLMEANDREGDPLDLWVTLHSMGYNKALELTEACPFVINIYAERCKPRIKV
FT                   VHMEACSGQLEKAICKSVLDRSDAKVMDGYENIIVHTCNYDTWITSIIENKSDNKVIIH
FT                   INNELSKNCVNNRGLNIFAVEVAPRSTMVCQHVMPLNEQEEWIYCCVYSLVA"
FT   assembly_gap    37718598..37718804
FT                   /estimated_length=207
FT                   /gap_type="unknown"
FT   assembly_gap    37733112..37733131
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    37751450..37751469
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            37763659..37822117
FT                   /gene="Pgm2"
FT                   /locus_tag="mCG_1561"
FT                   /note="gene_id=mCG1561.1"
FT   mRNA            join(37763659..37764228,37795713..37795875,
FT                   37796301..37796447,37797775..37797900,37798932..37799122,
FT                   37801316..37801470,37804245..37804360,37813122..37813257,
FT                   37816141..37816324,37818226..37818360,37821497..37822117)
FT                   /gene="Pgm2"
FT                   /locus_tag="mCG_1561"
FT                   /product="phosphoglucomutase 2"
FT                   /note="gene_id=mCG1561.1 transcript_id=mCT7830.2 created on
FT                   24-OCT-2002"
FT   CDS             join(37763725..37764228,37795713..37795875,
FT                   37796301..37796447,37797775..37797900,37798932..37799122,
FT                   37801316..37801470,37804245..37804360,37813122..37813257,
FT                   37816141..37816324,37818226..37818360,37821497..37821586)
FT                   /codon_start=1
FT                   /gene="Pgm2"
FT                   /locus_tag="mCG_1561"
FT                   /product="phosphoglucomutase 2"
FT                   /note="gene_id=mCG1561.1 transcript_id=mCT7830.2
FT                   protein_id=mCP16330.2"
FT                   /protein_id="EDL30880.1"
FT                   /translation="MKLCSPVKELVSLYRPLAQVEMCQSGRLRPSRPRDPSLFPGSRTL
FT                   AKWAGRGQALGHRFQGKSRADPEPSAAARAAATVASQPTATMVKIVTVKTQAYPDQKPG
FT                   TSGLRKRVKVFQSNANYAENFIQSIVSTVEPALRQEATLVVGGDGRFYMTEAIQLIVRI
FT                   AAANGIGRLVIGQNGILSTPAVSCIIRKIKAIGGIILTASHNPGGPNGDFGIKFNISNG
FT                   GPAPEAITDKIFQISKTIEEYAICPDLKVDLGVLGKQQFDLENKFKPFTVEIVDSVEAY
FT                   ATMLRNIFDFNALKELLSGPNRLKIRIDAMHGVVGPYVKKILCEELGAPANSAVNCVPL
FT                   EDFGGHHPDPNLTYAADLVETMKSGEHDFGAAFDGDGDRNMILGKHGFFVNPSDSVAVI
FT                   AANIFSIPYFQQTGVRGFARSMPTSGALDRVANATKIALYETPTGWKFFGNLMDASKLS
FT                   LCGEESFGTGSDHIREKDGLWAVLAWLSILATRKQSVEDILKDHWQKFGRNFFTRYDYE
FT                   EVEAEGANKMMKDLEALMLDRSFVGKQFSANDKVYTVEKADNFEYSDPVDGSISKNQGL
FT                   RLIFADGSRIIFRLSGTGSAGATIRLYIDSYEKDVAKINQDPQVMLAPLISIALKVSQL
FT                   QERTGRTAPTVIT"
FT   assembly_gap    37786619..37786642
FT                   /estimated_length=24
FT                   /gap_type="unknown"
FT   gene            complement(37804042..>37820225)
FT                   /locus_tag="mCG_146279"
FT                   /note="gene_id=mCG146279.0"
FT   mRNA            complement(join(37804042..37805441,37805658..37806683,
FT                   37809946..37810022,37820154..>37820225))
FT                   /locus_tag="mCG_146279"
FT                   /product="mCG146279"
FT                   /note="gene_id=mCG146279.0 transcript_id=mCT186382.0
FT                   created on 14-JUL-2003"
FT   CDS             complement(37805907..>37806392)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146279"
FT                   /product="mCG146279"
FT                   /note="gene_id=mCG146279.0 transcript_id=mCT186382.0
FT                   protein_id=mCP107596.0"
FT                   /protein_id="EDL30881.1"
FT                   /translation="LSGLFSISQCHTLLLGSDPPCTMNASYMGPWDKILVHVVCVYICL
FT                   YVYISVYVCLCVSMCALCVFVYICMHICVCIFVRVCVCVCVCMYVCMYVCRGMSKTVST
FT                   GFLYRNILDLSNANISMTNQTSQTSFQETSILLQICPLGNLALDPSLSSRLSANSVH"
FT   assembly_gap    37819500..37819519
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    37830392..37830481
FT                   /estimated_length=90
FT                   /gap_type="unknown"
FT   assembly_gap    37834836..37835104
FT                   /estimated_length=269
FT                   /gap_type="unknown"
FT   assembly_gap    37851296..37855379
FT                   /estimated_length=4084
FT                   /gap_type="unknown"
FT   assembly_gap    37863843..37863862
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    37871717..37871894
FT                   /estimated_length=178
FT                   /gap_type="unknown"
FT   assembly_gap    37877914..37877952
FT                   /estimated_length=39
FT                   /gap_type="unknown"
FT   assembly_gap    37880712..37881098
FT                   /estimated_length=387
FT                   /gap_type="unknown"
FT   assembly_gap    37887177..37887196
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    37906456..37907033
FT                   /estimated_length=578
FT                   /gap_type="unknown"
FT   assembly_gap    37919531..37919676
FT                   /estimated_length=146
FT                   /gap_type="unknown"
FT   assembly_gap    37930506..37930525
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            37930742..38293582
FT                   /gene="Ror1"
FT                   /locus_tag="mCG_1564"
FT                   /note="gene_id=mCG1564.2"
FT   mRNA            join(37930742..37931123,38138558..38138629,
FT                   38169537..38169824,38170412..38170442,38259153..38259280,
FT                   38261077..38261400,38263298..38263543,38277274..38277485,
FT                   38292155..38293582)
FT                   /gene="Ror1"
FT                   /locus_tag="mCG_1564"
FT                   /product="receptor tyrosine kinase-like orphan receptor 1"
FT                   /note="gene_id=mCG1564.2 transcript_id=mCT7833.2 created on
FT                   13-SEP-2002"
FT   CDS             join(37931033..37931123,38138558..38138629,
FT                   38169537..38169824,38170412..38170442,38259153..38259280,
FT                   38261077..38261174)
FT                   /codon_start=1
FT                   /gene="Ror1"
FT                   /locus_tag="mCG_1564"
FT                   /product="receptor tyrosine kinase-like orphan receptor 1"
FT                   /note="gene_id=mCG1564.2 transcript_id=mCT7833.2
FT                   protein_id=mCP16337.2"
FT                   /protein_id="EDL30879.1"
FT                   /translation="MHRPRRRGTRPPPLALLAALLLAARGADAQETELSVSAELVPTSS
FT                   WNTSSEIDKGSYLTLDEPMNNITTSLGQTAELHCKVSGNPPPSIRWFKNDAPVVQEPRR
FT                   ISFRATNYGSRLRIRNLDTTDTGYFQCVATNGKKVVSTTGVLFVKFGPPPTASPGSSDE
FT                   YEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCFSV
FT                   RHPFLVPLRLPVL"
FT   assembly_gap    37946224..37946489
FT                   /estimated_length=266
FT                   /gap_type="unknown"
FT   assembly_gap    37954073..37954768
FT                   /estimated_length=696
FT                   /gap_type="unknown"
FT   assembly_gap    37981361..37981461
FT                   /estimated_length=101
FT                   /gap_type="unknown"
FT   assembly_gap    38000902..38000997
FT                   /estimated_length=96
FT                   /gap_type="unknown"
FT   assembly_gap    38015599..38015805
FT                   /estimated_length=207
FT                   /gap_type="unknown"
FT   assembly_gap    38027649..38027719
FT                   /estimated_length=71
FT                   /gap_type="unknown"
FT   assembly_gap    38029062..38029239
FT                   /estimated_length=178
FT                   /gap_type="unknown"
FT   assembly_gap    38038234..38038323
FT                   /estimated_length=90
FT                   /gap_type="unknown"
FT   assembly_gap    38046153..38046327
FT                   /estimated_length=175
FT                   /gap_type="unknown"
FT   assembly_gap    38073712..38073737
FT                   /estimated_length=26
FT                   /gap_type="unknown"
FT   assembly_gap    38082317..38083786
FT                   /estimated_length=1470
FT                   /gap_type="unknown"
FT   assembly_gap    38092151..38092170
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    38145893..38146475
FT                   /estimated_length=583
FT                   /gap_type="unknown"
FT   assembly_gap    38157183..38157265
FT                   /estimated_length=83
FT                   /gap_type="unknown"
FT   assembly_gap    38162538..38162929
FT                   /estimated_length=392
FT                   /gap_type="unknown"
FT   assembly_gap    38164118..38164207
FT                   /estimated_length=90
FT                   /gap_type="unknown"
FT   assembly_gap    38187141..38187160
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    38188286..38188305
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    38189701..38189720
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    38192769..38200266
FT                   /estimated_length=7498
FT                   /gap_type="unknown"
FT   assembly_gap    38202147..38202166
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    38204401..38204420
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    38206421..38206440
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    38209792..38209811
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    38211621..38211640
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    38225597..38225836
FT                   /estimated_length=240
FT                   /gap_type="unknown"
FT   assembly_gap    38256203..38256235
FT                   /estimated_length=33
FT                   /gap_type="unknown"
FT   assembly_gap    38259743..38259804
FT                   /estimated_length=62
FT                   /gap_type="unknown"
FT   assembly_gap    38263105..38263124
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    38298127..38298146
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    38308746..38308765
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    38321449..38321553
FT                   /estimated_length=105
FT                   /gap_type="unknown"
FT   assembly_gap    38327848..38327867
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    38345106..38345125
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    38346132..38346151
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    38362563..38362613
FT                   /estimated_length=51
FT                   /gap_type="unknown"
FT   assembly_gap    38363746..38363765
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    38365428..38367114
FT                   /estimated_length=1687
FT                   /gap_type="unknown"
FT   gene            complement(38373708..38378266)
FT                   /locus_tag="mCG_148074"
FT                   /note="gene_id=mCG148074.0"
FT   mRNA            complement(join(38373708..38374109,38378057..38378266))
FT                   /locus_tag="mCG_148074"
FT                   /product="mCG148074"
FT                   /note="gene_id=mCG148074.0 transcript_id=mCT188337.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(join(38374081..38374109,38378057..38378210))
FT                   /codon_start=1
FT                   /locus_tag="mCG_148074"
FT                   /product="mCG148074"
FT                   /note="gene_id=mCG148074.0 transcript_id=mCT188337.0
FT                   protein_id=mCP109415.0"
FT                   /protein_id="EDL30878.1"
FT                   /translation="MKVSWGEKQAPPDAGGCLVCLLTATSTRKPPLSAAQHAARCSQLA
FT                   GIPFLERRIKHRNGD"
FT   assembly_gap    38388964..38389446
FT                   /estimated_length=483
FT                   /gap_type="unknown"
FT   assembly_gap    38395979..38396069
FT                   /estimated_length=91
FT                   /gap_type="unknown"
FT   assembly_gap    38406729..38406748
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    38407503..38408743
FT                   /estimated_length=1241
FT                   /gap_type="unknown"
FT   assembly_gap    38438719..38439382
FT                   /estimated_length=664
FT                   /gap_type="unknown"
FT   assembly_gap    38440169..38440532
FT                   /estimated_length=364
FT                   /gap_type="unknown"
FT   assembly_gap    38457012..38457031
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    38492829..38492973
FT                   /estimated_length=145
FT                   /gap_type="unknown"
FT   assembly_gap    38494079..38494098
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    38496174..38497454
FT                   /estimated_length=1281
FT                   /gap_type="unknown"
FT   assembly_gap    38500849..38500868
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    38501970..38502519
FT                   /estimated_length=550
FT                   /gap_type="unknown"
FT   assembly_gap    38504005..38504024
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    38532988..38533166
FT                   /estimated_length=179
FT                   /gap_type="unknown"
FT   assembly_gap    38556620..38557032
FT                   /estimated_length=413
FT                   /gap_type="unknown"
FT   assembly_gap    38568382..38568493
FT                   /estimated_length=112
FT                   /gap_type="unknown"
FT   assembly_gap    38578505..38578524
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    38579724..38579743
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    38591122..38591141
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    38606401..38606532
FT                   /estimated_length=132
FT                   /gap_type="unknown"
FT   assembly_gap    38607906..38609158
FT                   /estimated_length=1253
FT                   /gap_type="unknown"
FT   assembly_gap    38611806..38611825
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    38613415..38613434
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    38614941..38614960
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    38619100..38619229
FT                   /estimated_length=130
FT                   /gap_type="unknown"
FT   assembly_gap    38619973..38620135
FT                   /estimated_length=163
FT                   /gap_type="unknown"
FT   gene            38620345..38846767
FT                   /gene="Cachd1"
FT                   /locus_tag="mCG_119950"
FT                   /note="gene_id=mCG119950.1"
FT   mRNA            join(38620345..38620495,38710573..38710635,
FT                   38743331..38743479,38763628..38763734,38789645..38789771,
FT                   38792586..38792730,38793616..38793832,38801547..38801696,
FT                   38806528..38806761,38808287..38808436,38809048..38809171,
FT                   38810159..38810276,38812983..38813151,38816106..38816248,
FT                   38816879..38817060,38818446..38818556,38823071..38823193,
FT                   38825399..38825498,38825588..38825704,38830176..38830336,
FT                   38830651..38830737,38831471..38831587,38832915..38833066,
FT                   38834820..38834981,38836126..38836203,38836835..38836936,
FT                   38845079..38846767)
FT                   /gene="Cachd1"
FT                   /locus_tag="mCG_119950"
FT                   /product="cache domain containing 1"
FT                   /note="gene_id=mCG119950.1 transcript_id=mCT121129.1
FT                   created on 24-OCT-2002"
FT   CDS             join(38620451..38620495,38710573..38710635,
FT                   38743331..38743479,38763628..38763734,38789645..38789771,
FT                   38792586..38792730,38793616..38793832,38801547..38801696,
FT                   38806528..38806761,38808287..38808436,38809048..38809171,
FT                   38810159..38810276,38812983..38813151,38816106..38816248,
FT                   38816879..38817060,38818446..38818556,38823071..38823193,
FT                   38825399..38825498,38825588..38825704,38830176..38830336,
FT                   38830651..38830737,38831471..38831587,38832915..38833066,
FT                   38834820..38834981,38836126..38836203,38836835..38836936,
FT                   38845079..38845317)
FT                   /codon_start=1
FT                   /gene="Cachd1"
FT                   /locus_tag="mCG_119950"
FT                   /product="cache domain containing 1"
FT                   /note="gene_id=mCG119950.1 transcript_id=mCT121129.1
FT                   protein_id=mCP76292.1"
FT                   /protein_id="EDL30877.1"
FT                   /translation="MRRLAAEELGVVTMQRIFNSLVYTEKISNGESEVQQLAKKIREKF
FT                   NRYLDVVNRNKQVVEASYTAHLTSPLTAIQDCCTIPPSMMEFDGNFNTNVSRTVSCDRL
FT                   STTVNSRAFNPGRDLNSVLADNLKSNPGIKWQYFSSEEGIFTVFPAHKFRCKGSYEHRS
FT                   RPIYVSTVRPQSKHIVVILDHGASVTDTQLQIAKDAAQVILSAIDEHDKISVLTVADAV
FT                   RTCSLDQCYKTYLSPATSETKRKMSTFVSSVKPSDSPTQHAVGFHRAFQLIRSTSNSTR
FT                   FQANTDMVIIYLSAGITSKDSSEEDKKATLRVINEENGFLNNSVMILTYALMNDGVTGL
FT                   KELAFLRDLAEQNSGKYGIPDRTALPVIKGSMMVLNQLSNLETTVGRFYTNLPNRMIDE
FT                   AVFSLPFSDEMGDGLIMTVSKPCYFGNLLLGIVGVDVNLAYILEDVTYYQDSLASYTFL
FT                   IDDKGYTLMHPSLTRPYLLSEPPLHTDIIHYENIPKFELVRQNILSLPLGSQIITVPVN
FT                   SSLSWHINKLRETGKEAYNVSYAWKMVQDTSFILCIVVIQPEIPVKQLKNLNTVPSSKL
FT                   LYHRLDLLGQPSACLHFKQLATLESPTVMLSAGSFSSPYEHLSQPETKRMVEHYTAYLS
FT                   DNTRLIANPGLKFSVRNEVMATSHVTDEWMTQMEMSSLNTYIVRRYIATPNGVLRIYPG
FT                   SLMDKAFDPTRRQWYLHAVANPGLISLTGPYLDVGGAGYVVTISHTIHSSSTQLSSGHT
FT                   VAVMGIDFTLRYFYKVLMDLLPVCNQDGGNKIRCFIMEDRGYLVAHPTLVDPKGHAPLE
FT                   QQHITHKEPLVANDILNHPNFVKKNLCNSFSDRTVQRSYKFNTSLVGDLTNLVHGSHCS
FT                   KYRLTRIPGTNAFVGIVNETCDSLAFCACSMVDRLCLNCHRMEQNECECPCECPLEVNE
FT                   CTGNLTNAENRNPSCEVHQEPVTYTAIDPGLQDALQQCVNSRCNQRMESGDCFGVLDCE
FT                   WCVVDSDGKTHLDKSYCAPQKECFGGIVGAKSPYVDDMGAIGDEVITLNMIKSAPVGPV
FT                   AGGIMGCIMVLVLAVYAYRHQIHRRSHQHMSPLAAQEMSVRMSNLENDRDERDDDSHED
FT                   RGIISNTRFIAAVMERHVHSPERRRRYWGRSGTESDHGYSTMSPQEDSENPPCNNDPLS
FT                   AGVDVGNHDDDLDLDTPPQTAALLSHKFHHYRPHHPTLHHSHHLQAAVTVHTVDAEC"
FT   assembly_gap    38629219..38629238
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    38630244..38631715
FT                   /estimated_length=1472
FT                   /gap_type="unknown"
FT   assembly_gap    38662825..38662963
FT                   /estimated_length=139
FT                   /gap_type="unknown"
FT   assembly_gap    38671302..38671321
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    38678414..38678934
FT                   /estimated_length=521
FT                   /gap_type="unknown"
FT   assembly_gap    38684536..38684675
FT                   /estimated_length=140
FT                   /gap_type="unknown"
FT   assembly_gap    38687904..38688136
FT                   /estimated_length=233
FT                   /gap_type="unknown"
FT   assembly_gap    38706640..38706945
FT                   /estimated_length=306
FT                   /gap_type="unknown"
FT   assembly_gap    38712203..38712222
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    38730832..38730851
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    38739412..38739431
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    38796149..38796168
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    38797262..38797281
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    38839721..38839794
FT                   /estimated_length=74
FT                   /gap_type="unknown"
FT   assembly_gap    38852873..38852892
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    38876002..38876138
FT                   /estimated_length=137
FT                   /gap_type="unknown"
FT   assembly_gap    38877792..38877833
FT                   /estimated_length=42
FT                   /gap_type="unknown"
FT   assembly_gap    38892094..38897494
FT                   /estimated_length=5401
FT                   /gap_type="unknown"
FT   gene            <38904346..38983427
FT                   /gene="Raver2"
FT                   /locus_tag="mCG_21711"
FT                   /note="gene_id=mCG21711.2"
FT   mRNA            join(<38904346..38904693,38931587..38931653,
FT                   38937875..38938344,38942470..38942661,38955708..38955834,
FT                   38963871..38963953,38966194..38966298,38966462..38967963)
FT                   /gene="Raver2"
FT                   /locus_tag="mCG_21711"
FT                   /product="ribonucleoprotein, PTB-binding 2, transcript
FT                   variant mCT192869"
FT                   /note="gene_id=mCG21711.2 transcript_id=mCT192869.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<38904346..38904693,38931587..38931653,
FT                   38937875..38938344,38942470..38942661,38955708..38955834,
FT                   38963871..38963953,38966194..38966298,38966462..38966581)
FT                   /codon_start=1
FT                   /gene="Raver2"
FT                   /locus_tag="mCG_21711"
FT                   /product="ribonucleoprotein, PTB-binding 2, isoform CRA_a"
FT                   /note="gene_id=mCG21711.2 transcript_id=mCT192869.0
FT                   protein_id=mCP113809.0 isoform=CRA_a"
FT                   /protein_id="EDL30875.1"
FT                   /translation="RRLRRLPRPRALAPRPARLAPARPLRFLSRFAPASPSLQRGAGKM
FT                   AARGGGAGGAGSGSGPSAGTAGEAAEPALRPGEVAALHPQEVAARLQRMRRELSNRRKI
FT                   LVKNLPQDSSSQEVHELLQDYELKYCYVDRNKRTAFVTLLNGEQAQSAIQRFHQFSFRG
FT                   RELTVQLQPTDALLCITNLPISFTLEEFEELVRAYGNIERCFLVYSEVTGHSKGYGFVE
FT                   YMKKDFAAKARLELLGRQMGASALFAQWMDVNLLASELIHSKCLCIDKLPSDYSDSEEL
FT                   LQLFSGIHKPVFCQLAQDEGSHGGGFAVVEYSTAEHAEEVQQVADGITIKGSQVQLSFC
FT                   APGAPGRSTLAVLIAAQRAMHSNQKGLLPEPNPVQIMKSLNNPAMLQVLLQPQLCGRAM
FT                   KPVLGVAPSLSHLLSPSLPSAILHFSKAQQSSAVGNTSSLILQNLSPLPLIQQQLMKFD
FT                   NAHTNNKPGLLGEPPAMVLQPALAIGPPLPLKTDLGHHGEAHKSK"
FT   mRNA            join(38904601..38904693,38931587..38931653,
FT                   38937875..38938344,38942470..38942661,38966194..38966298,
FT                   38966462..38966573,38968604..38968860,38970318..38970426,
FT                   38971703..38971839,38982938..38983427)
FT                   /gene="Raver2"
FT                   /locus_tag="mCG_21711"
FT                   /product="ribonucleoprotein, PTB-binding 2, transcript
FT                   variant mCT20336"
FT                   /note="gene_id=mCG21711.2 transcript_id=mCT20336.2 created
FT                   on 25-NOV-2002"
FT   CDS             join(38904625..38904693,38931587..38931653,
FT                   38937875..38938344,38942470..38942661,38966194..38966298,
FT                   38966462..38966573,38968604..38968860,38970318..38970426,
FT                   38971703..38971839,38982938..38983084)
FT                   /codon_start=1
FT                   /gene="Raver2"
FT                   /locus_tag="mCG_21711"
FT                   /product="ribonucleoprotein, PTB-binding 2, isoform CRA_b"
FT                   /note="gene_id=mCG21711.2 transcript_id=mCT20336.2
FT                   protein_id=mCP16339.2 isoform=CRA_b"
FT                   /protein_id="EDL30876.1"
FT                   /translation="MRRELSNRRKILVKNLPQDSSSQEVHELLQDYELKYCYVDRNKRT
FT                   AFVTLLNGEQAQSAIQRFHQFSFRGRELTVQLQPTDALLCITNLPISFTLEEFEELVRA
FT                   YGNIERCFLVYSEVTGHSKGYGFVEYMKKDFAAKARLELLGRQMGASALFAQWMDVNLL
FT                   ASELIHSKCLCIDKLPSDYSDSEELLQLFSGIHKPVFCQLAQDEGSHGGGFAVVEYSTA
FT                   EHAEEVQQVADGITIKGSQVQLSFCAPGAPGRSTLAVLIAAQRASSAVGNTSSLILQNL
FT                   SPLPLIQQQLMKFDNAHTNNKPGLLGEPPAMVLQPALAIGPPLPLKTDLGHHGEAHKTS
FT                   NLIPPQTTLAAGLGMLPFFSNQLPAGQAGPGRGTTQEKQSASVSISEASFSGSQHYLQT
FT                   FPGLPAGGPLTGNQKTPQSQPKGTEVASKNQTSLLGEPPKEIRLSKNPYLNLASVLPSV
FT                   CLSTAGKGMPPKTGIASNILDAISQGSESQHALEKCIAYSPSIEDYAQASSLRNEKRGS
FT                   SYLISAPEGGPVELAGQHPQDTGVSYTETYLKKKRVY"
FT   assembly_gap    38909497..38909516
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    38913254..38913358
FT                   /estimated_length=105
FT                   /gap_type="unknown"
FT   assembly_gap    38932306..38932325
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    38943926..38943945
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    38959980..38959999
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(38985652..39090073)
FT                   /gene="Jak1"
FT                   /locus_tag="mCG_21706"
FT                   /note="gene_id=mCG21706.2"
FT   mRNA            complement(join(38985652..38986196,38987144..38987254,
FT                   38987622..38987739,38988999..38989171,38989558..38989682,
FT                   38990360..38990552,38991420..38991514,38991621..38991771,
FT                   38992638..38992789,38994413..38994548,38995455..38995582,
FT                   38996265..38996352,38997065..38997208,38999150..38999256,
FT                   39003842..39004028,39006647..39006770,39007635..39007792,
FT                   39010129..39010317,39012016..39012355,39014341..39014504,
FT                   39016899..39017052,39021641..39021764,39024037..39024235,
FT                   39026345..39026425,39090013..39090073))
FT                   /gene="Jak1"
FT                   /locus_tag="mCG_21706"
FT                   /product="Janus kinase 1"
FT                   /note="gene_id=mCG21706.2 transcript_id=mCT20331.2 created
FT                   on 21-FEB-2003"
FT   CDS             complement(join(38986101..38986196,38987144..38987254,
FT                   38987622..38987739,38988999..38989171,38989558..38989682,
FT                   38990360..38990552,38991420..38991514,38991621..38991771,
FT                   38992638..38992789,38994413..38994548,38995455..38995582,
FT                   38996265..38996352,38997065..38997208,38999150..38999256,
FT                   39003842..39004028,39006647..39006770,39007635..39007792,
FT                   39010129..39010317,39012016..39012355,39014341..39014504,
FT                   39016899..39017052,39021641..39021764,39024037..39024235,
FT                   39026345..39026350))
FT                   /codon_start=1
FT                   /gene="Jak1"
FT                   /locus_tag="mCG_21706"
FT                   /product="Janus kinase 1"
FT                   /note="gene_id=mCG21706.2 transcript_id=mCT20331.2
FT                   protein_id=mCP16342.2"
FT                   /db_xref="GOA:B1ASP2"
FT                   /db_xref="InterPro:IPR000299"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000980"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR008266"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR016251"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR019748"
FT                   /db_xref="InterPro:IPR019749"
FT                   /db_xref="InterPro:IPR020635"
FT                   /db_xref="InterPro:IPR020776"
FT                   /db_xref="MGI:MGI:96628"
FT                   /db_xref="UniProtKB/TrEMBL:B1ASP2"
FT                   /protein_id="EDL30874.1"
FT                   /translation="MQYLNIKEDCNAMAFCAKMRSFKKTEVKQVVPEPGVEVTFYLLDR
FT                   EPLRLGSGEYTAEELCIRAAQECSISPLCHNLFALYDESTKLWYAPNRIITVDDKTSLR
FT                   LHYRMRFYFTNWHGTNDNEQSVWRHSPKKQKNGYEKKRVPEATPLLDASSLEYLFAQGQ
FT                   YDLIKCLAPIRDPKTEQDGHDIENECLGMAVLAISHYAMMKKMQLPELPKDISYKRYIP
FT                   ETLNKSIRQRNLLTRMRINNVFKDFLKEFNNKTICDSSVSTHDLKVKYLATLETLTKHY
FT                   GAEIFETSMLLISSENELSRCHSNDSGNVLYEVMVTGNLGIQWRQKPNVVPVEKEKNKL
FT                   KRKKLEYNKHKKDDERNKLREEWNNFSYFPEITHIVIKESVVSINKQDNKNMELKLSSR
FT                   EEALSFVSLVDGYFRLTADAHHYLCTDVAPPLIVHNIQNGCHGPICTEYAINKLRQEGS
FT                   EEGMYVLRWSCTDFDNILMTVTCFEKSEVLGGQKQFKNFQIEVQKGRYSLHGSMDHFPS
FT                   LRDLMNHLKKQILRTDNISFVLKRCCQPKPREISNLLVATKKAQEWQPVYSMSQLSFDR
FT                   ILKKDIIQGEHLGRGTRTHIYSGTLLDYKDEEGIAEEKKIKVILKVLDPSHRDISLAFF
FT                   EAASMMRQVSHKHIVYLYGVCVRDVENIMVEEFVEGGPLDLFMHRKSDALTTPWKFKVA
FT                   KQLASALSYLEDKDLVHGNVCTKNLLLAREGIDSDIGPFIKLSDPGIPVSVLTRQECIE
FT                   RIPWIAPECVEDSKNLSVAADKWSFGTTLWEICYNGEIPLKDKTLIEKERFYESRCRPV
FT                   TPSCKELADLMTRCMNYDPNQRPFFRAIMRDINKLEEQNPDIVSEKQPTTEVDPTHFEK
FT                   RFLKRIRDLGEGHFGKVELCRYDPEGDNTGEQVAVKSLKPESGGNHIADLKKEIEILRN
FT                   LYHENIVKYKGICMEDGGNGIKLIMEFLPSGSLKEYLPKNKNKINLKQQLKYAIQICKG
FT                   MDYLGSRQYVHRDLAARNVLVESEHQVKIGDFGLTKAIETDKEYYTVKDDRDSPVFWYA
FT                   PECLIQCKFYIASDVWSFGVTLHELLTYCDSDFSPMALFLKMIGPTHGQMTVTRLVNTL
FT                   KEGKRLPCPPNCPDEVYQLMRKCWEFQPSNRTTFQNLIEGFEALLK"
FT   assembly_gap    39004289..39004545
FT                   /estimated_length=257
FT                   /gap_type="unknown"
FT   assembly_gap    39045657..39045701
FT                   /estimated_length=45
FT                   /gap_type="unknown"
FT   assembly_gap    39055160..39055179
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    39082958..39083200
FT                   /estimated_length=243
FT                   /gap_type="unknown"
FT   assembly_gap    39097500..39098050
FT                   /estimated_length=551
FT                   /gap_type="unknown"
FT   assembly_gap    39115447..39115466
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    39117997..39118559
FT                   /estimated_length=563
FT                   /gap_type="unknown"
FT   assembly_gap    39145026..39145795
FT                   /estimated_length=770
FT                   /gap_type="unknown"
FT   assembly_gap    39154845..39156383
FT                   /estimated_length=1539
FT                   /gap_type="unknown"
FT   gene            complement(39178096..39187778)
FT                   /locus_tag="mCG_148069"
FT                   /note="gene_id=mCG148069.0"
FT   mRNA            complement(join(39178096..39178668,39187649..39187778))
FT                   /locus_tag="mCG_148069"
FT                   /product="mCG148069"
FT                   /note="gene_id=mCG148069.0 transcript_id=mCT188332.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(39178268..39178519)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148069"
FT                   /product="mCG148069"
FT                   /note="gene_id=mCG148069.0 transcript_id=mCT188332.0
FT                   protein_id=mCP109408.0"
FT                   /protein_id="EDL30873.1"
FT                   /translation="MAAILPSSREVSSQQAKGMGSRTPGQDQTHFTPLLCSPLFQAPFG
FT                   NKEQNNVAACTGYEDGYAEDKQGLWNLSCLGRLTLRKS"
FT   gene            <39185349..39229323
FT                   /locus_tag="mCG_144801"
FT                   /note="gene_id=mCG144801.0"
FT   mRNA            join(<39185349..39185455,39198608..39198757,
FT                   39205871..39205936,39229026..39229323)
FT                   /locus_tag="mCG_144801"
FT                   /product="mCG144801"
FT                   /note="gene_id=mCG144801.0 transcript_id=mCT184225.0
FT                   created on 05-JUN-2003"
FT   assembly_gap    39187874..39188082
FT                   /estimated_length=209
FT                   /gap_type="unknown"
FT   assembly_gap    39194803..39194939
FT                   /estimated_length=137
FT                   /gap_type="unknown"
FT   CDS             join(<39198630..39198757,39205871..39205936,
FT                   39229026..39229161)
FT                   /codon_start=1
FT                   /locus_tag="mCG_144801"
FT                   /product="mCG144801"
FT                   /note="gene_id=mCG144801.0 transcript_id=mCT184225.0
FT                   protein_id=mCP105822.0"
FT                   /protein_id="EDL30872.1"
FT                   /translation="EHWEYGLTAEEESGEVTSRGVDGEKRERKLIEKYIVSAGKPDRVI
FT                   GHQATRTKGAESMNRISDGRKRKKAGSNTTSSEESLANRWNEMEEKMSSLEDKVEKWID
FT                   HPKTM"
FT   assembly_gap    39211557..39211635
FT                   /estimated_length=79
FT                   /gap_type="unknown"
FT   assembly_gap    39217270..39217289
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    39220164..39220806
FT                   /estimated_length=643
FT                   /gap_type="unknown"
FT   assembly_gap    39226360..39226468
FT                   /estimated_length=109
FT                   /gap_type="unknown"
FT   assembly_gap    39226836..39226855
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    39228157..39228231
FT                   /estimated_length=75
FT                   /gap_type="unknown"
FT   assembly_gap    39235549..39235594
FT                   /estimated_length=46
FT                   /gap_type="unknown"
FT   assembly_gap    39238093..39243127
FT                   /estimated_length=5035
FT                   /gap_type="unknown"
FT   assembly_gap    39249611..39250741
FT                   /estimated_length=1131
FT                   /gap_type="unknown"
FT   assembly_gap    39262953..39263525
FT                   /estimated_length=573
FT                   /gap_type="unknown"
FT   assembly_gap    39273293..39273901
FT                   /estimated_length=609
FT                   /gap_type="unknown"
FT   gene            39277333..39296752
FT                   /locus_tag="mCG_21708"
FT                   /note="gene_id=mCG21708.1"
FT   mRNA            join(39277333..39277456,39290679..39290851,
FT                   39293128..39293246,39293733..39296752)
FT                   /locus_tag="mCG_21708"
FT                   /product="mCG21708"
FT                   /note="gene_id=mCG21708.1 transcript_id=mCT20333.1 created
FT                   on 13-SEP-2002"
FT   CDS             join(39277408..39277456,39290679..39290851,
FT                   39293128..39293246,39293733..39293847)
FT                   /codon_start=1
FT                   /locus_tag="mCG_21708"
FT                   /product="mCG21708"
FT                   /note="gene_id=mCG21708.1 transcript_id=mCT20333.1
FT                   protein_id=mCP16340.2"
FT                   /protein_id="EDL30871.1"
FT                   /translation="MMSELETRSAQHWLLDGFPRTLVQAEALDGICDVDLVISLNIPFE
FT                   TLKDRLSRRWIHPSSGRVYNLDFNPPQVQGIDDITGEPLVQQEDDKPEAVAARLRRYKD
FT                   AAKPVIELYKSRGVLHQFSGTETNRIWPYVYTLFSNKITPIQSKEAY"
FT   assembly_gap    39298343..39298792
FT                   /estimated_length=450
FT                   /gap_type="unknown"
FT   assembly_gap    39311831..39311850
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    39313422..39313441
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    39315732..39317159
FT                   /estimated_length=1428
FT                   /gap_type="unknown"
FT   assembly_gap    39326333..39327114
FT                   /estimated_length=782
FT                   /gap_type="unknown"
FT   gene            39341272..39476367
FT                   /gene="Dnajc6"
FT                   /locus_tag="mCG_21709"
FT                   /note="gene_id=mCG21709.2"
FT   mRNA            join(39341272..39341583,39431360..39431510,
FT                   39432510..39432559,39432654..39432802,39440156..39440278,
FT                   39444792..39444925,39446429..39446623,39447740..39447857,
FT                   39449148..39449227,39450053..39450246,39451961..39452395,
FT                   39457230..39457364,39459262..39459330,39461606..39461725,
FT                   39468560..39468823,39470327..39470469,39472835..39473011,
FT                   39474041..39476354)
FT                   /gene="Dnajc6"
FT                   /locus_tag="mCG_21709"
FT                   /product="DnaJ (Hsp40) homolog, subfamily C, member 6,
FT                   transcript variant mCT20334"
FT                   /note="gene_id=mCG21709.2 transcript_id=mCT20334.1 created
FT                   on 24-OCT-2002"
FT   mRNA            join(39341401..39341583,39431360..39431510,
FT                   39432510..39432559,39432654..39432802,39440156..39440278,
FT                   39444792..39444925,39446429..39446623,39447740..39447857,
FT                   39449148..39449227,39450053..39450246,39450352..39450432,
FT                   39451961..39452395,39457230..39457364,39459262..39459330,
FT                   39461606..39461725,39468560..39468823,39470327..39470469,
FT                   39472835..39473011,39474041..39476367)
FT                   /gene="Dnajc6"
FT                   /locus_tag="mCG_21709"
FT                   /product="DnaJ (Hsp40) homolog, subfamily C, member 6,
FT                   transcript variant mCT192844"
FT                   /note="gene_id=mCG21709.2 transcript_id=mCT192844.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(39341487..39341583,39431360..39431510,
FT                   39432510..39432559,39432654..39432802,39440156..39440278,
FT                   39444792..39444925,39446429..39446623,39447740..39447857,
FT                   39449148..39449227,39450053..39450246,39450352..39450432,
FT                   39451961..39452395,39457230..39457364,39459262..39459330,
FT                   39461606..39461725,39468560..39468823,39470327..39470469,
FT                   39472835..39473011,39474041..39474142)
FT                   /codon_start=1
FT                   /gene="Dnajc6"
FT                   /locus_tag="mCG_21709"
FT                   /product="DnaJ (Hsp40) homolog, subfamily C, member 6,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG21709.2 transcript_id=mCT192844.0
FT                   protein_id=mCP113808.0 isoform=CRA_a"
FT                   /protein_id="EDL30869.1"
FT                   /translation="MTNPKSGVAESAGLACSRAAAGENRMKDSENKGASSPDMEPSYGG
FT                   GLFDMVKGGAGRLFSNLKDNLKDTLKDTSSRVIQSVSSYTKGDLDFTYVTSRIIVMSFP
FT                   VDSVDIGFRNQVDDIRSFLDSRHLDHYTVYNLSPKSYRTAKFHSRVSECSWPIRQAPSL
FT                   HNLFAVCRNMYNWLLQNPKNVCVVHCLDGRAASSILVGAMFIFCNLYSTPGPAVRLLYA
FT                   KRPGIGLSPSHRRYLGYMCDLLADKPYRPHFKPLTIKAITVSPVPFFNKQRNGCRPYCD
FT                   VLIGETKIYSTCTDFERMKEYRVQDGKIFIPLNITVQGDVIVSMYHLRSTIGSRLQAKV
FT                   TNTQIFQLQFHSGFIPLDTTVLKFTKPELDACDVPEKYPQLFQVTLDIEVQPQDKVIDL
FT                   TPPWEHYCTKDVNPSILFSSQQEHQDTLALGGQAPADLPPDHPRNLGQGGFFASLCWQD
FT                   QKSEKSRCEEDHAALVNQESEQSDDELLTLSSPHGNAEGDKPHGAKKPGKKQQEPAAPP
FT                   PPEEVDLLGLEGSDVSTNFSSLAAPPSNSELLSDLFGGVGATGPAQAGQAGVEDVFHPS
FT                   GPVSAQSTPRRTATSASASPTLRVGEGATFDPFGAPAKPPGQDLLGSFLNTSSASSDPF
FT                   LQPTRSPSPTVHASSTPAVNIQPDIAGGWDWHTKPGGFGMGSKSAATSPTGSSHGTPTH
FT                   QSKPQTLDPFADLGTLGSSSFASKPTTPTGLGGGFPPLSSPQKASPQPMGGGWQQPAGY
FT                   NWQQTQSKPQSSMPHSSPQNRPNYNVSFSAMPAGQSERGKGSTNLEGKQKAADFEDLLS
FT                   SQGFNAHKDKKGPRTIAEMRKEEMAKEMDPEKLKILEWIEGKERNIRALLSTMHTVLWA
FT                   GETKWKPVGMADLVTPEQVKKVYRRAVLVVHPDKATGQPYEQYAKMIFMELNDAWSEFE
FT                   NQGQKPLY"
FT   CDS             join(39341487..39341583,39431360..39431510,
FT                   39432510..39432559,39432654..39432802,39440156..39440278,
FT                   39444792..39444925,39446429..39446623,39447740..39447857,
FT                   39449148..39449227,39450053..39450246,39451961..39452395,
FT                   39457230..39457364,39459262..39459330,39461606..39461725,
FT                   39468560..39468823,39470327..39470469,39472835..39473011,
FT                   39474041..39474142)
FT                   /codon_start=1
FT                   /gene="Dnajc6"
FT                   /locus_tag="mCG_21709"
FT                   /product="DnaJ (Hsp40) homolog, subfamily C, member 6,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG21709.2 transcript_id=mCT20334.1
FT                   protein_id=mCP16341.1 isoform=CRA_b"
FT                   /protein_id="EDL30870.1"
FT                   /translation="MTNPKSGVAESAGLACSRAAAGENRMKDSENKGASSPDMEPSYGG
FT                   GLFDMVKGGAGRLFSNLKDNLKDTLKDTSSRVIQSVSSYTKGDLDFTYVTSRIIVMSFP
FT                   VDSVDIGFRNQVDDIRSFLDSRHLDHYTVYNLSPKSYRTAKFHSRVSECSWPIRQAPSL
FT                   HNLFAVCRNMYNWLLQNPKNVCVVHCLDGRAASSILVGAMFIFCNLYSTPGPAVRLLYA
FT                   KRPGIGLSPSHRRYLGYMCDLLADKPYRPHFKPLTIKAITVSPVPFFNKQRNGCRPYCD
FT                   VLIGETKIYSTCTDFERMKEYRVQDGKIFIPLNITVQGDVIVSMYHLRSTIGSRLQAKV
FT                   TNTQIFQLQFHSGFIPLDTTVLKFTKPELDACDVPEKYPQLFQVTLDIEVQPQDKVIDL
FT                   TPPWEHYCTKDVNPSILFSSQQEHQDTLALGDQKSEKSRCEEDHAALVNQESEQSDDEL
FT                   LTLSSPHGNAEGDKPHGAKKPGKKQQEPAAPPPPEEVDLLGLEGSDVSTNFSSLAAPPS
FT                   NSELLSDLFGGVGATGPAQAGQAGVEDVFHPSGPVSAQSTPRRTATSASASPTLRVGEG
FT                   ATFDPFGAPAKPPGQDLLGSFLNTSSASSDPFLQPTRSPSPTVHASSTPAVNIQPDIAG
FT                   GWDWHTKPGGFGMGSKSAATSPTGSSHGTPTHQSKPQTLDPFADLGTLGSSSFASKPTT
FT                   PTGLGGGFPPLSSPQKASPQPMGGGWQQPAGYNWQQTQSKPQSSMPHSSPQNRPNYNVS
FT                   FSAMPAGQSERGKGSTNLEGKQKAADFEDLLSSQGFNAHKDKKGPRTIAEMRKEEMAKE
FT                   MDPEKLKILEWIEGKERNIRALLSTMHTVLWAGETKWKPVGMADLVTPEQVKKVYRRAV
FT                   LVVHPDKATGQPYEQYAKMIFMELNDAWSEFENQGQKPLY"
FT   assembly_gap    39351068..39351087
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    39378345..39378574
FT                   /estimated_length=230
FT                   /gap_type="unknown"
FT   gene            <39481348..39493190
FT                   /locus_tag="mCG_146281"
FT                   /note="gene_id=mCG146281.0"
FT   mRNA            join(<39481348..39481394,39486231..39486306,
FT                   39489937..39490123,39491666..39493190)
FT                   /locus_tag="mCG_146281"
FT                   /product="mCG146281, transcript variant mCT186384"
FT                   /note="gene_id=mCG146281.0 transcript_id=mCT186384.0
FT                   created on 14-JUL-2003"
FT   CDS             join(<39481349..39481394,39486231..39486306,
FT                   39489937..39490123,39491666..39491782)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146281"
FT                   /product="mCG146281, isoform CRA_a"
FT                   /note="gene_id=mCG146281.0 transcript_id=mCT186384.0
FT                   protein_id=mCP107598.0 isoform=CRA_a"
FT                   /protein_id="EDL30867.1"
FT                   /translation="GSSDSPSSRDMAGVKALVALSFSGAIGLTFLMLGCALEDYGVYWP
FT                   LFVLIFYVISPIPYFIAKRVTYDSDATSSACRELAYFFTTGIVVSAFGLPVVLARVGVI
FT                   KWGACGLVLAGNAVIFLTIQGFFLVFGRGDDFSWEQW"
FT   mRNA            join(<39481362..39481394,39486231..39486306,
FT                   39490006..39490123,39491666..39493190)
FT                   /locus_tag="mCG_146281"
FT                   /product="mCG146281, transcript variant mCT192867"
FT                   /note="gene_id=mCG146281.0 transcript_id=mCT192867.0
FT                   created on 09-MAR-2004"
FT   CDS             join(<39481364..39481394,39486231..39486306,
FT                   39490006..39490123,39491666..39491782)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146281"
FT                   /product="mCG146281, isoform CRA_b"
FT                   /note="gene_id=mCG146281.0 transcript_id=mCT192867.0
FT                   protein_id=mCP113792.0 isoform=CRA_b"
FT                   /protein_id="EDL30868.1"
FT                   /translation="PSSRDMAGVKALVALSFSGAIGLTFLMLGCALEDYGVTYDSDATS
FT                   SACRELAYFFTTGIVVSAFGLPVVLARVGVIKWGACGLVLAGNAVIFLTIQGFFLVFGR
FT                   GDDFSWEQW"
FT   assembly_gap    39483883..39483902
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    39486877..39486905
FT                   /estimated_length=29
FT                   /gap_type="unknown"
FT   assembly_gap    39507850..39507869
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    39526149..39526341
FT                   /estimated_length=193
FT                   /gap_type="unknown"
FT   gene            39551391..39645645
FT                   /gene="Lepr"
FT                   /locus_tag="mCG_21707"
FT                   /note="gene_id=mCG21707.2"
FT   mRNA            join(39551391..39551890,39561962..39562021,
FT                   39567319..39567648,39569612..39569735,39579508..39579713,
FT                   39584284..39584426,39586058..39586202,39592821..39593111,
FT                   39593264..39593381,39596001..39596200,39601385..39601533,
FT                   39602924..39603083,39604289..39604371,39609995..39610211,
FT                   39612635..39612817,39619353..39619448,39620891..39620996,
FT                   39622085..39622160,39644524..39645645)
FT                   /gene="Lepr"
FT                   /locus_tag="mCG_21707"
FT                   /product="leptin receptor, transcript variant mCT20332"
FT                   /note="gene_id=mCG21707.2 transcript_id=mCT20332.1 created
FT                   on 13-SEP-2002"
FT   mRNA            join(39551391..39551890,39561962..39562021,
FT                   39567319..39567648,39569612..39569735,39579508..39579713,
FT                   39584284..39584426,39586058..39586202,39592821..39593111,
FT                   39593264..39593381,39596001..39596200,39601385..39601533,
FT                   39602924..39603083,39604289..39604371,39609995..39610211,
FT                   39612635..39612817,39619353..39619448,39620891..39620996,
FT                   39622085..39622160,39641424..39641529,39644524..39645428)
FT                   /gene="Lepr"
FT                   /locus_tag="mCG_21707"
FT                   /product="leptin receptor, transcript variant mCT173090"
FT                   /note="gene_id=mCG21707.2 transcript_id=mCT173090.0 created
FT                   on 13-SEP-2002"
FT   mRNA            join(<39551855..39551890,39561962..39562021,
FT                   39567319..39567648,39569612..39569735,39579508..39579713,
FT                   39584284..39584426,39586058..39586202,39592821..39593111,
FT                   39593264..39593381,39596001..39596200,39601385..39601533,
FT                   39602924..39603083,39604289..39604371,39609995..39610211,
FT                   39612635..39612817,39619353..39619448,39620891..39620996,
FT                   39622085..39622160,39641424..39643255)
FT                   /gene="Lepr"
FT                   /locus_tag="mCG_21707"
FT                   /product="leptin receptor, transcript variant mCT192839"
FT                   /note="gene_id=mCG21707.2 transcript_id=mCT192839.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<39561976..39562021,39567319..39567648,
FT                   39569612..39569735,39579508..39579713,39584284..39584426,
FT                   39586058..39586202,39592821..39593111,39593264..39593381,
FT                   39596001..39596200,39601385..39601533,39602924..39603083,
FT                   39604289..39604371,39609995..39610211,39612635..39612817,
FT                   39619353..39619448,39620891..39620996,39622085..39622160,
FT                   39641424..39641441)
FT                   /codon_start=1
FT                   /gene="Lepr"
FT                   /locus_tag="mCG_21707"
FT                   /product="leptin receptor, isoform CRA_b"
FT                   /note="gene_id=mCG21707.2 transcript_id=mCT192839.0
FT                   protein_id=mCP113806.0 isoform=CRA_b"
FT                   /protein_id="EDL30864.1"
FT                   /translation="RKMMCQKFYVVLLHWEFLYVIAALNLAYPISPWKFKLFCGPPNTT
FT                   DDSFLSPAGAPNNASALKGASEAIVEAKFNSSGIYVPELSKTVFHCCFGNEQGQNCSAL
FT                   TDNTEGKTLASVVKASVFRQLGVNWDIECWMKGDLTLFICHMEPLPKNPFKNYDSKVHL
FT                   LYDLPEVIDDSPLPPLKDSFQTVQCNCSLRGCECHVPVPRAKLNYALLMYLEITSAGVS
FT                   FQSPLMSLQPMLVVKPDPPLGLHMEVTDDGNLKISWDSQTMAPFPLQYQVKYLENSTIV
FT                   REAAEIVSATSLLVDSVLPGSSYEVQVRSKRLDGSGVWSDWSSPQVFTTQDVVYFPPKI
FT                   LTSVGSNASFHCIYKNENQIISSKQIVWWRNLAEKIPEIQYSIVSDRVSKVTFSNLKAT
FT                   RPRGKFTYDAVYCCNEQACHHRYAELYVIDVNINISCETDGYLTKMTCRWSPSTIQSLV
FT                   GSTVQLRYHRRSLYCPDSPSIHPTSEPKNCVLQRDGFYECVFQPIFLLSGYTMWIRINH
FT                   SLGSLDSPPTCVLPDSVVKPLPPSNVKAEITVNTGLLKVSWEKPVFPENNLQFQIRYGL
FT                   SGKEIQWKTHEVFDAKSKSASLLVSDLCAVYVVQVRCRRLDGLGYWSNWSSPAYTLVMD
FT                   VKVPMRGPEFWRKMDGDVTKKERNVTLLWKPLTKNDSLCSVRRYVVKHRTAHNGTWSED
FT                   VGNRTNLTFLWTEPAHTVTVLAVNSLGASLVNFNLTFSWPMSKVSAVESLSAYPLSSSC
FT                   VILSWTLSPDDYSLLYLVIEWKILNEDDGMKWLRIPSNVKKFYIHDNFIPIEKYQFSLY
FT                   PVFMEGVGKPKIINGFTKDAIDKQQNDAGLYVIVPIIISSCVLLLGTLLISHQRMKKLF
FT                   WDDVPNPKNCSWAQGLNFQKRTDTL"
FT   CDS             join(39561982..39562021,39567319..39567648,
FT                   39569612..39569735,39579508..39579713,39584284..39584426,
FT                   39586058..39586202,39592821..39593111,39593264..39593381,
FT                   39596001..39596200,39601385..39601533,39602924..39603083,
FT                   39604289..39604371,39609995..39610211,39612635..39612817,
FT                   39619353..39619448,39620891..39620996,39622085..39622160,
FT                   39644524..39645345)
FT                   /codon_start=1
FT                   /gene="Lepr"
FT                   /locus_tag="mCG_21707"
FT                   /product="leptin receptor, isoform CRA_d"
FT                   /note="gene_id=mCG21707.2 transcript_id=mCT20332.1
FT                   protein_id=mCP16333.1 isoform=CRA_d"
FT                   /protein_id="EDL30866.1"
FT                   /translation="MMCQKFYVVLLHWEFLYVIAALNLAYPISPWKFKLFCGPPNTTDD
FT                   SFLSPAGAPNNASALKGASEAIVEAKFNSSGIYVPELSKTVFHCCFGNEQGQNCSALTD
FT                   NTEGKTLASVVKASVFRQLGVNWDIECWMKGDLTLFICHMEPLPKNPFKNYDSKVHLLY
FT                   DLPEVIDDSPLPPLKDSFQTVQCNCSLRGCECHVPVPRAKLNYALLMYLEITSAGVSFQ
FT                   SPLMSLQPMLVVKPDPPLGLHMEVTDDGNLKISWDSQTMAPFPLQYQVKYLENSTIVRE
FT                   AAEIVSATSLLVDSVLPGSSYEVQVRSKRLDGSGVWSDWSSPQVFTTQDVVYFPPKILT
FT                   SVGSNASFHCIYKNENQIISSKQIVWWRNLAEKIPEIQYSIVSDRVSKVTFSNLKATRP
FT                   RGKFTYDAVYCCNEQACHHRYAELYVIDVNINISCETDGYLTKMTCRWSPSTIQSLVGS
FT                   TVQLRYHRRSLYCPDSPSIHPTSEPKNCVLQRDGFYECVFQPIFLLSGYTMWIRINHSL
FT                   GSLDSPPTCVLPDSVVKPLPPSNVKAEITVNTGLLKVSWEKPVFPENNLQFQIRYGLSG
FT                   KEIQWKTHEVFDAKSKSASLLVSDLCAVYVVQVRCRRLDGLGYWSNWSSPAYTLVMDVK
FT                   VPMRGPEFWRKMDGDVTKKERNVTLLWKPLTKNDSLCSVRRYVVKHRTAHNGTWSEDVG
FT                   NRTNLTFLWTEPAHTVTVLAVNSLGASLVNFNLTFSWPMSKVSAVESLSAYPLSSSCVI
FT                   LSWTLSPDDYSLLYLVIEWKILNEDDGMKWLRIPSNVKKFYIHDNFIPIEKYQFSLYPV
FT                   FMEGVGKPKIINGFTKDAIDKQQNDAGLYVIVPIIISSCVLLLGTLLISHQRMKKLFWD
FT                   DVPNPKNCSWAQGLNFQKPETFEHLFTKHAESVIFGPLLLEPEPISEEISVDTAWKNKD
FT                   EMVPAAMVSLLLTTPDPESSSICISDQCNSANFSGSQSTQVTCEDECQRQPSVKYATLV
FT                   SNDKLVETDEEQGFIHSPVSNCISSNHSPLRQSFSSSSWETEAQTFFLLSDQQPTMISP
FT                   QLSFSGLDELLELEGSFPEENHREKSVCYLGVTSVNRRESGVLLTGEAGILCTFPAQCL
FT                   FSDIRILQERCSHFVENNLSLGTSGENFVPYMPQFQTCSTHSHKIMENKMCDLTV"
FT   mRNA            join(<39561982..39562021,39567319..39567648,
FT                   39569612..39569735,39579508..39579713,39584284..39584426,
FT                   39586058..39586202,39592821..39593111,39593264..39593381,
FT                   39596001..39596200,39601385..39601533,39602924..39603083,
FT                   39604289..39604371,39609995..39610211,39612635..39612817,
FT                   39619353..39619448,39620891..39620996,39622085..39622160,
FT                   39643784..39643802,39643880..>39643896)
FT                   /gene="Lepr"
FT                   /locus_tag="mCG_21707"
FT                   /product="leptin receptor, transcript variant mCT192840"
FT                   /note="gene_id=mCG21707.2 transcript_id=mCT192840.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(39561982..39562021,39567319..39567648,
FT                   39569612..39569735,39579508..39579713,39584284..39584426,
FT                   39586058..39586202,39592821..39593111,39593264..39593381,
FT                   39596001..39596200,39601385..39601533,39602924..39603083,
FT                   39604289..39604371,39609995..39610211,39612635..39612817,
FT                   39619353..39619448,39620891..39620996,39622085..39622160,
FT                   39643784..39643802,39643880..39643896)
FT                   /codon_start=1
FT                   /gene="Lepr"
FT                   /locus_tag="mCG_21707"
FT                   /product="leptin receptor, isoform CRA_c"
FT                   /note="gene_id=mCG21707.2 transcript_id=mCT192840.0
FT                   protein_id=mCP113807.0 isoform=CRA_c"
FT                   /protein_id="EDL30865.1"
FT                   /translation="MMCQKFYVVLLHWEFLYVIAALNLAYPISPWKFKLFCGPPNTTDD
FT                   SFLSPAGAPNNASALKGASEAIVEAKFNSSGIYVPELSKTVFHCCFGNEQGQNCSALTD
FT                   NTEGKTLASVVKASVFRQLGVNWDIECWMKGDLTLFICHMEPLPKNPFKNYDSKVHLLY
FT                   DLPEVIDDSPLPPLKDSFQTVQCNCSLRGCECHVPVPRAKLNYALLMYLEITSAGVSFQ
FT                   SPLMSLQPMLVVKPDPPLGLHMEVTDDGNLKISWDSQTMAPFPLQYQVKYLENSTIVRE
FT                   AAEIVSATSLLVDSVLPGSSYEVQVRSKRLDGSGVWSDWSSPQVFTTQDVVYFPPKILT
FT                   SVGSNASFHCIYKNENQIISSKQIVWWRNLAEKIPEIQYSIVSDRVSKVTFSNLKATRP
FT                   RGKFTYDAVYCCNEQACHHRYAELYVIDVNINISCETDGYLTKMTCRWSPSTIQSLVGS
FT                   TVQLRYHRRSLYCPDSPSIHPTSEPKNCVLQRDGFYECVFQPIFLLSGYTMWIRINHSL
FT                   GSLDSPPTCVLPDSVVKPLPPSNVKAEITVNTGLLKVSWEKPVFPENNLQFQIRYGLSG
FT                   KEIQWKTHEVFDAKSKSASLLVSDLCAVYVVQVRCRRLDGLGYWSNWSSPAYTLVMDVK
FT                   VPMRGPEFWRKMDGDVTKKERNVTLLWKPLTKNDSLCSVRRYVVKHRTAHNGTWSEDVG
FT                   NRTNLTFLWTEPAHTVTVLAVNSLGASLVNFNLTFSWPMSKVSAVESLSAYPLSSSCVI
FT                   LSWTLSPDDYSLLYLVIEWKILNEDDGMKWLRIPSNVKKFYIHDNFIPIEKYQFSLYPV
FT                   FMEGVGKPKIINGFTKDAIDKQQNDAGLYVIVPIIISSCVLLLGTLLISHQRMKKLFWD
FT                   DVPNPKNCSWAQGLNFQKDISLHEVFIFR"
FT   CDS             join(39561982..39562021,39567319..39567648,
FT                   39569612..39569735,39579508..39579713,39584284..39584426,
FT                   39586058..39586202,39592821..39593111,39593264..39593381,
FT                   39596001..39596200,39601385..39601533,39602924..39603083,
FT                   39604289..39604371,39609995..39610211,39612635..39612817,
FT                   39619353..39619448,39620891..39620996,39622085..39622160,
FT                   39641424..39641441)
FT                   /codon_start=1
FT                   /gene="Lepr"
FT                   /locus_tag="mCG_21707"
FT                   /product="leptin receptor, isoform CRA_a"
FT                   /note="gene_id=mCG21707.2 transcript_id=mCT173090.0
FT                   protein_id=mCP96009.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q3US58"
FT                   /db_xref="InterPro:IPR003529"
FT                   /db_xref="InterPro:IPR003531"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010457"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015752"
FT                   /db_xref="MGI:MGI:104993"
FT                   /db_xref="UniProtKB/TrEMBL:Q3US58"
FT                   /protein_id="EDL30863.1"
FT                   /translation="MMCQKFYVVLLHWEFLYVIAALNLAYPISPWKFKLFCGPPNTTDD
FT                   SFLSPAGAPNNASALKGASEAIVEAKFNSSGIYVPELSKTVFHCCFGNEQGQNCSALTD
FT                   NTEGKTLASVVKASVFRQLGVNWDIECWMKGDLTLFICHMEPLPKNPFKNYDSKVHLLY
FT                   DLPEVIDDSPLPPLKDSFQTVQCNCSLRGCECHVPVPRAKLNYALLMYLEITSAGVSFQ
FT                   SPLMSLQPMLVVKPDPPLGLHMEVTDDGNLKISWDSQTMAPFPLQYQVKYLENSTIVRE
FT                   AAEIVSATSLLVDSVLPGSSYEVQVRSKRLDGSGVWSDWSSPQVFTTQDVVYFPPKILT
FT                   SVGSNASFHCIYKNENQIISSKQIVWWRNLAEKIPEIQYSIVSDRVSKVTFSNLKATRP
FT                   RGKFTYDAVYCCNEQACHHRYAELYVIDVNINISCETDGYLTKMTCRWSPSTIQSLVGS
FT                   TVQLRYHRRSLYCPDSPSIHPTSEPKNCVLQRDGFYECVFQPIFLLSGYTMWIRINHSL
FT                   GSLDSPPTCVLPDSVVKPLPPSNVKAEITVNTGLLKVSWEKPVFPENNLQFQIRYGLSG
FT                   KEIQWKTHEVFDAKSKSASLLVSDLCAVYVVQVRCRRLDGLGYWSNWSSPAYTLVMDVK
FT                   VPMRGPEFWRKMDGDVTKKERNVTLLWKPLTKNDSLCSVRRYVVKHRTAHNGTWSEDVG
FT                   NRTNLTFLWTEPAHTVTVLAVNSLGASLVNFNLTFSWPMSKVSAVESLSAYPLSSSCVI
FT                   LSWTLSPDDYSLLYLVIEWKILNEDDGMKWLRIPSNVKKFYIHDNFIPIEKYQFSLYPV
FT                   FMEGVGKPKIINGFTKDAIDKQQNDAGLYVIVPIIISSCVLLLGTLLISHQRMKKLFWD
FT                   DVPNPKNCSWAQGLNFQKRTDTL"
FT   assembly_gap    39562406..39562478
FT                   /estimated_length=73
FT                   /gap_type="unknown"
FT   assembly_gap    39565148..39565250
FT                   /estimated_length=103
FT                   /gap_type="unknown"
FT   assembly_gap    39598281..39599916
FT                   /estimated_length=1636
FT                   /gap_type="unknown"
FT   assembly_gap    39627476..39627718
FT                   /estimated_length=243
FT                   /gap_type="unknown"
FT   assembly_gap    39637425..39637871
FT                   /estimated_length=447
FT                   /gap_type="unknown"
FT   assembly_gap    39651626..39651645
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    39661300..39661319
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<39665813..39674382)
FT                   /locus_tag="mCG_55241"
FT                   /note="gene_id=mCG55241.2"
FT   mRNA            complement(join(<39665813..39666383,39667267..39667451,
FT                   39667695..39667839,39668268..39668581,39674301..39674382))
FT                   /locus_tag="mCG_55241"
FT                   /product="mCG55241"
FT                   /note="gene_id=mCG55241.2 transcript_id=mCT55424.2 created
FT                   on 25-NOV-2002"
FT   CDS             complement(join(39665813..39666383,39667267..39667451,
FT                   39667695..39667839,39668268..39668554))
FT                   /codon_start=1
FT                   /locus_tag="mCG_55241"
FT                   /product="mCG55241"
FT                   /note="gene_id=mCG55241.2 transcript_id=mCT55424.2
FT                   protein_id=mCP37069.2"
FT                   /protein_id="EDL30862.1"
FT                   /translation="MSTYNPPTLLQLALDGVLRKDSIDFSDLEYLPITLFPPLFIKAFN
FT                   SRHTEIVKKMVATWPFPCLPVGALLKTAGVEMLQAVLDGIDILLTQNVSLRCKLQVLDL
FT                   RFLHQDFWTGKQNAICPADILIKKQVPEGLPNYPLRQCLQMRNLVKFYLNQIDFYFSVA
FT                   NTVTDGKIGAAKFFSQFSQLNHLQHVYMNGAYISYDNMKKLFRCLKSPLETLFFTFCHL
FT                   SMSDLRHMSDCQRLYQLKHLYLKGVVFSKSYFKSLRVLLENVSATLQTLGLEHCRMKDS
FT                   HLKVLLPALIQCSQLIFVNFFDNHFSSPVLKDLLRCMANLSKLTGERYPVPVECYNDIG
FT                   KVMVERFFQLCPELMDLLTAKRQPKKIFFATVCCPNCLRRCVYDLNTTRLCHCWE"
FT   assembly_gap    39670631..39671054
FT                   /estimated_length=424
FT                   /gap_type="unknown"
FT   assembly_gap    39694478..39694497
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    39701355..39701385
FT                   /estimated_length=31
FT                   /gap_type="unknown"
FT   gene            complement(39712090..>39715839)
FT                   /gene="C130073F10Rik"
FT                   /locus_tag="mCG_21705"
FT                   /note="gene_id=mCG21705.1"
FT   mRNA            complement(join(39712090..39712608,39712754..39713065,
FT                   39715775..>39715839))
FT                   /gene="C130073F10Rik"
FT                   /locus_tag="mCG_21705"
FT                   /product="RIKEN cDNA C130073F10"
FT                   /note="gene_id=mCG21705.1 transcript_id=mCT20330.1 created
FT                   on 25-NOV-2002"
FT   CDS             complement(join(39712290..39712608,39712754..39713065,
FT                   39715775..>39715839))
FT                   /codon_start=1
FT                   /gene="C130073F10Rik"
FT                   /locus_tag="mCG_21705"
FT                   /product="RIKEN cDNA C130073F10"
FT                   /note="gene_id=mCG21705.1 transcript_id=mCT20330.1
FT                   protein_id=mCP16344.1"
FT                   /protein_id="EDL30861.1"
FT                   /translation="RNLGVTSSPYCSRRPVTSVCVWILLPESLRMDFQALPTLQHLTIQ
FT                   FLLNHEDLAVSALKDLPSVFFLPLFKEAFTKRRHKLVKHLVVTWPYRNLYIGPLKHSFN
FT                   LYNFKGVYNGVDWLSNQKVWPRRCRLKEVYLLDANHDFLVIMNPGQDHLCTPQPQREEE
FT                   DPTTVQRKPITVYADSAFMADSLKPYRDLLEESFNERLTTMSVNFKEMEPQKKDQIQGV
FT                   RSLEISWDL"
FT   assembly_gap    39733179..39733198
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <39736396..39741130
FT                   /locus_tag="mCG_64142"
FT                   /note="gene_id=mCG64142.2"
FT   mRNA            join(<39736396..39736532,39740417..39741130)
FT                   /locus_tag="mCG_64142"
FT                   /product="mCG64142"
FT                   /note="gene_id=mCG64142.2 transcript_id=mCT64325.2 created
FT                   on 25-NOV-2002"
FT   CDS             join(<39736510..39736532,39740417..39740984)
FT                   /codon_start=1
FT                   /locus_tag="mCG_64142"
FT                   /product="mCG64142"
FT                   /note="gene_id=mCG64142.2 transcript_id=mCT64325.2
FT                   protein_id=mCP29869.2"
FT                   /protein_id="EDL30860.1"
FT                   /translation="NTCSGKESPLESLSMNRCQLSKSDFKHMSDCQRLYQLKHLQFHGV
FT                   EFPKSGFKSLQILLKNVSETLQTLKFEHCKMNDSQLKVLLPALSQCSQLTMVNFCDNDF
FT                   SNLVLKDLLKCMANLSKLCVEQYPAPLECYDHRRNVVVEEFVQLCSDLMDILIAKRQPK
FT                   TIIFATDTCSHCLRRCIYGRKTSLCLCWQQREV"
FT   assembly_gap    39737088..39737107
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    39740397..39740416
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    39741908..39741927
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    39743945..39743964
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    39749439..39754078
FT                   /estimated_length=4640
FT                   /gap_type="unknown"
FT   assembly_gap    39761274..39765805
FT                   /estimated_length=4532
FT                   /gap_type="unknown"
FT   assembly_gap    39766979..39789904
FT                   /estimated_length=22926
FT                   /gap_type="unknown"
FT   assembly_gap    39801356..39801556
FT                   /estimated_length=201
FT                   /gap_type="unknown"
FT   assembly_gap    39803410..39803633
FT                   /estimated_length=224
FT                   /gap_type="unknown"
FT   assembly_gap    39812561..39814034
FT                   /estimated_length=1474
FT                   /gap_type="unknown"
FT   assembly_gap    39821246..39821397
FT                   /estimated_length=152
FT                   /gap_type="unknown"
FT   assembly_gap    39822602..39822784
FT                   /estimated_length=183
FT                   /gap_type="unknown"
FT   gene            39827872..39831225
FT                   /locus_tag="mCG_5729"
FT                   /note="gene_id=mCG5729.1"
FT   mRNA            join(39827872..39827960,39829102..39829415,
FT                   39829844..39829994,39830971..39831225)
FT                   /locus_tag="mCG_5729"
FT                   /product="mCG5729"
FT                   /note="gene_id=mCG5729.1 transcript_id=mCT5311.1 created on
FT                   25-NOV-2002"
FT   CDS             join(39829129..39829415,39829844..39829994,
FT                   39830971..39831027)
FT                   /codon_start=1
FT                   /locus_tag="mCG_5729"
FT                   /product="mCG5729"
FT                   /note="gene_id=mCG5729.1 transcript_id=mCT5311.1
FT                   protein_id=mCP22361.1"
FT                   /db_xref="GOA:B1AUV7"
FT                   /db_xref="InterPro:IPR026292"
FT                   /db_xref="MGI:MGI:3649399"
FT                   /db_xref="UniProtKB/TrEMBL:B1AUV7"
FT                   /protein_id="EDL30859.1"
FT                   /translation="MSTYNPPTLLQLALDGVLRKDSIDFSDLEYLPITLFPPLFIKAFN
FT                   SRHTEIVKKMVATWPFPCLPVGTLLKTAGVEMLQAVLDGIDILLTQNVSLRCKLQVLEL
FT                   RDVHQHFWDVWAGREDEVHSAETKSEKKVGERISRKPPRGVKEYYVHSYQTDWSVQTFC
FT                   L"
FT   assembly_gap    39836108..39836426
FT                   /estimated_length=319
FT                   /gap_type="unknown"
FT   assembly_gap    39865663..39865682
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    39872202..39872303
FT                   /estimated_length=102
FT                   /gap_type="unknown"
FT   assembly_gap    39886019..39886038
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    39901194..39902920
FT                   /estimated_length=1727
FT                   /gap_type="unknown"
FT   assembly_gap    39906681..39906700
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    39954639..39954725
FT                   /estimated_length=87
FT                   /gap_type="unknown"
FT   assembly_gap    40005903..40006157
FT                   /estimated_length=255
FT                   /gap_type="unknown"
FT   assembly_gap    40014918..40014937
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    40030926..40030945
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    40045666..40045685
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    40047092..40047111
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    40085048..40085067
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    40086472..40086491
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            40098763..40459781
FT                   /gene="Pde4b"
FT                   /locus_tag="mCG_113038"
FT                   /note="gene_id=mCG113038.1"
FT   mRNA            join(40098763..40099216,40340096..40340290,
FT                   40351596..40351632,40351728..40351798,40359967..40360016,
FT                   40424817..40424929,40444796..40444889,40449899..40450077,
FT                   40451424..40451522,40451659..40451823,40453608..40453707,
FT                   40455498..40455652,40455744..40455866,40456552..40456734,
FT                   40458932..40459781)
FT                   /gene="Pde4b"
FT                   /locus_tag="mCG_113038"
FT                   /product="phosphodiesterase 4B, cAMP specific"
FT                   /note="gene_id=mCG113038.1 transcript_id=mCT114115.1
FT                   created on 12-SEP-2002"
FT   CDS             join(40098981..40099216,40340096..40340290,
FT                   40351596..40351632,40351728..40351798,40359967..40360016,
FT                   40424817..40424929,40444796..40444889,40449899..40450077,
FT                   40451424..40451522,40451659..40451823,40453608..40453707,
FT                   40455498..40455652,40455744..40455866,40456552..40456734,
FT                   40458932..40459297)
FT                   /codon_start=1
FT                   /gene="Pde4b"
FT                   /locus_tag="mCG_113038"
FT                   /product="phosphodiesterase 4B, cAMP specific"
FT                   /note="gene_id=mCG113038.1 transcript_id=mCT114115.1
FT                   protein_id=mCP75961.1"
FT                   /db_xref="GOA:Q8VBU5"
FT                   /db_xref="InterPro:IPR002073"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR023088"
FT                   /db_xref="InterPro:IPR023174"
FT                   /db_xref="MGI:MGI:99557"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VBU5"
FT                   /protein_id="EDL30857.1"
FT                   /translation="MTAKNSPKEFTASESEVCIKTFKEQMRLELELPKLPGNRPTSPKI
FT                   SPRSSPRNSPCFFRKLLVNKSIRQRRRFTVAHTCFDVENGPSPGRSPLDPQAGSSSGLV
FT                   LHAAFPGHSQRRESFLYRSDSDYDLSPKAMSRNSSLPSEQHGDDLIVTPFAQVLASLRS
FT                   VRNNFTLLTNLHGAPNKRSPAASQAPVSRVSLQEESYQKLAMETLEELDWCLDQLETIQ
FT                   TYRSVSEMASNKFKRMLNRELTHLSEMSRSGNQVSEYISNTFLDKQNDVEIPSPTQKDR
FT                   EKKKKQQLMTQISGVKKLMHSSSLNNTSISRFGVNTENEDHLAKELEDLNKWGLNIFNV
FT                   AGYSHNRPLTCIMYAIFQERDLLKTFKISSDTFVTYMMTLEDHYHSDVAYHNSLHAADV
FT                   AQSTHVLLSTPALDAVFTDLEILAAIFAAAIHDVDHPGVSNQFLINTNSELALMYNDES
FT                   VLENHHLAVGFKLLQEEHCDIFQNLTKKQRQTLRKMVIDMVLATDMSKHMSLLADLKTM
FT                   VETKKVTSSGVLLLDNYTDRIQVLRNMVHCADLSNPTKSLELYRQWTDRIMEEFFQQGD
FT                   KERERGMEISPMCDKHTASVEKSQVGFIDYIVHPLWETWADLVQPDAQDILDTLEDNRN
FT                   WYQSMIPQSPSPPLDERSRDCQGLMEKFQFELTLEEEDSEGPEKEGEGHSYFSSTKTLC
FT                   VIDPENRDSLEETDIDIATEDKSPIDT"
FT   assembly_gap    40103845..40103864
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    40105584..40105663
FT                   /estimated_length=80
FT                   /gap_type="unknown"
FT   assembly_gap    40111958..40111977
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    40113042..40113061
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    40114249..40114268
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    40122032..40122051
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    40130114..40130177
FT                   /estimated_length=64
FT                   /gap_type="unknown"
FT   assembly_gap    40157679..40157799
FT                   /estimated_length=121
FT                   /gap_type="unknown"
FT   assembly_gap    40212287..40212445
FT                   /estimated_length=159
FT                   /gap_type="unknown"
FT   assembly_gap    40225836..40225855
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    40226916..40226935
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<40231270..>40236530)
FT                   /locus_tag="mCG_144798"
FT                   /note="gene_id=mCG144798.0"
FT   mRNA            complement(join(<40231270..40231288,40231360..40231382,
FT                   40231412..40231544,40234070..40234614,40235148..>40236530))
FT                   /locus_tag="mCG_144798"
FT                   /product="mCG144798"
FT                   /note="gene_id=mCG144798.0 transcript_id=mCT184222.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(<40231270..40231288,40231360..40231382,
FT                   40231412..40231544,40234070..>40234217))
FT                   /codon_start=1
FT                   /locus_tag="mCG_144798"
FT                   /product="mCG144798"
FT                   /note="gene_id=mCG144798.0 transcript_id=mCT184222.0
FT                   protein_id=mCP105825.0"
FT                   /protein_id="EDL30858.1"
FT                   /translation="YTTSIRRNLKYLSIISSLVSKIFGICKILKVNVGIVLNFPFMLFD
FT                   IFLSQMLILSCMHSFSFYVCVCAGVLCVCWNVVCLCLWDVCVHVQGGHVVCVCVCVLCV
FT                   CVCV"
FT   assembly_gap    40232335..40232354
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    40234048..40234067
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    40235117..40235136
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    40280668..40280872
FT                   /estimated_length=205
FT                   /gap_type="unknown"
FT   assembly_gap    40306232..40306258
FT                   /estimated_length=27
FT                   /gap_type="unknown"
FT   assembly_gap    40327321..40327340
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    40426661..40426972
FT                   /estimated_length=312
FT                   /gap_type="unknown"
FT   assembly_gap    40439755..40439774
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    40473045..40473496
FT                   /estimated_length=452
FT                   /gap_type="unknown"
FT   assembly_gap    40474120..40474139
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    40479549..40479568
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    40492237..40492530
FT                   /estimated_length=294
FT                   /gap_type="unknown"
FT   assembly_gap    40499782..40499916
FT                   /estimated_length=135
FT                   /gap_type="unknown"
FT   assembly_gap    40511189..40511208
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    40519508..40519763
FT                   /estimated_length=256
FT                   /gap_type="unknown"
FT   assembly_gap    40546907..40547915
FT                   /estimated_length=1009
FT                   /gap_type="unknown"
FT   assembly_gap    40550360..40550977
FT                   /estimated_length=618
FT                   /gap_type="unknown"
FT   assembly_gap    40553379..40559555
FT                   /estimated_length=6177
FT                   /gap_type="unknown"
FT   assembly_gap    40562062..40562178
FT                   /estimated_length=117
FT                   /gap_type="unknown"
FT   assembly_gap    40563718..40563737
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    40598188..40598593
FT                   /estimated_length=406
FT                   /gap_type="unknown"
FT   assembly_gap    40600722..40601873
FT                   /estimated_length=1152
FT                   /gap_type="unknown"
FT   assembly_gap    40602645..40604684
FT                   /estimated_length=2040
FT                   /gap_type="unknown"
FT   assembly_gap    40611271..40611516
FT                   /estimated_length=246
FT                   /gap_type="unknown"
FT   gene            <40613916..40825825
FT                   /gene="Sgip1"
FT                   /locus_tag="mCG_16070"
FT                   /note="gene_id=mCG16070.2"
FT   mRNA            join(<40613916..40614268,40615155..40615277,
FT                   40708744..40708807,40716549..40716573,40719442..40719513,
FT                   40723420..40723476,40725535..40725594,40726333..40726504,
FT                   40763975..40764026,40765696..40765781,40769296..40769388,
FT                   40773018..40773092,40775252..40775749,40781701..40781825,
FT                   40783026..40783152,40810361..40810472,40816967..40817122,
FT                   40819133..40819265,40820741..40820943,40822253..40822317,
FT                   40822813..40822977,40824706..40825825)
FT                   /gene="Sgip1"
FT                   /locus_tag="mCG_16070"
FT                   /product="SH3-domain GRB2-like (endophilin) interacting
FT                   protein 1, transcript variant mCT15607"
FT                   /note="gene_id=mCG16070.2 transcript_id=mCT15607.2 created
FT                   on 24-OCT-2002"
FT   mRNA            join(<40613916..40614268,40615155..40615277,
FT                   40708744..40708807,40716549..40716573,40723420..40723476,
FT                   40725535..40725594,40726333..40726504,40763975..40764026,
FT                   40765696..40765781,40769296..40769388,40773018..40773092,
FT                   40775252..40775749,40781701..40781825,40783026..40783152,
FT                   40810361..40810472,40816967..40817122,40819133..40819265,
FT                   40820741..40820943,40822253..40822317,40822813..40822977,
FT                   40824706..40825825)
FT                   /gene="Sgip1"
FT                   /locus_tag="mCG_16070"
FT                   /product="SH3-domain GRB2-like (endophilin) interacting
FT                   protein 1, transcript variant mCT174865"
FT                   /note="gene_id=mCG16070.2 transcript_id=mCT174865.0 created
FT                   on 24-OCT-2002"
FT   mRNA            join(<40613916..40614268,40615155..40615277,
FT                   40708744..40708807,40719442..40719513,40723420..40723476,
FT                   40725535..40725594,40726333..40726504,40763975..40764026,
FT                   40765696..40765781,40769296..40769388,40773018..40773092,
FT                   40775252..40775749,40781701..40781825,40783026..40783152,
FT                   40810361..40810472,40816967..40817122,40819133..40819265,
FT                   40820741..40820943,40822253..40822317,40822813..40822977,
FT                   40824706..40825825)
FT                   /gene="Sgip1"
FT                   /locus_tag="mCG_16070"
FT                   /product="SH3-domain GRB2-like (endophilin) interacting
FT                   protein 1, transcript variant mCT174866"
FT                   /note="gene_id=mCG16070.2 transcript_id=mCT174866.0 created
FT                   on 24-OCT-2002"
FT   mRNA            join(<40615075..40615277,40708744..40708807,
FT                   40723420..40723476,40725535..40725594,40726333..40726504,
FT                   40763975..40764026,40765696..40765781,40769296..40769388,
FT                   40773018..40773092,40775252..40775749,40781701..40781825,
FT                   40783026..40783152,40810361..40810472,40816967..40817122,
FT                   40819133..40819265,40820741..40820943,40822253..40822317,
FT                   40822813..40822977,40824706..40825825)
FT                   /gene="Sgip1"
FT                   /locus_tag="mCG_16070"
FT                   /product="SH3-domain GRB2-like (endophilin) interacting
FT                   protein 1, transcript variant mCT174867"
FT                   /note="gene_id=mCG16070.2 transcript_id=mCT174867.0 created
FT                   on 24-OCT-2002"
FT   assembly_gap    40630583..40630647
FT                   /estimated_length=65
FT                   /gap_type="unknown"
FT   assembly_gap    40631785..40632753
FT                   /estimated_length=969
FT                   /gap_type="unknown"
FT   assembly_gap    40680211..40680354
FT                   /estimated_length=144
FT                   /gap_type="unknown"
FT   assembly_gap    40703442..40703559
FT                   /estimated_length=118
FT                   /gap_type="unknown"
FT   CDS             join(<40726459..40726504,40763975..40764026,
FT                   40765696..40765781,40769296..40769388,40773018..40773092,
FT                   40775252..40775749,40781701..40781825,40783026..40783152,
FT                   40810361..40810472,40816967..40817122,40819133..40819265,
FT                   40820741..40820943,40822253..40822317,40822813..40822977,
FT                   40824706..40824728)
FT                   /codon_start=1
FT                   /gene="Sgip1"
FT                   /locus_tag="mCG_16070"
FT                   /product="SH3-domain GRB2-like (endophilin) interacting
FT                   protein 1, isoform CRA_a"
FT                   /note="gene_id=mCG16070.2 transcript_id=mCT174865.0
FT                   protein_id=mCP97785.0 isoform=CRA_a"
FT                   /protein_id="EDL30853.1"
FT                   /translation="AEGFNRQHRTFPFACGEEVARPRRSTPTPELTSKKPLDDTLALAP
FT                   LFGPPLESAFDEQKTEVLLDQPEIWGSGQPMNPSTESPELARPFPTGTPPPLPPKTVPA
FT                   TPPRTGSPLTVATGNDQAATEAKIEKLPSISDLDSIFGPVLSPKSVAVNTEEKWVHFSD
FT                   ASPEHVTPELTPREQVVTPPAASDIPADSPAPAPPGPTGSAGPPGPPGPRHVPSPLNLE
FT                   EVQKKVAEQTFIKDDYLETLSSPKECGLGQRATPPPPPPPTYRTVVSSPGPGSGSGTGT
FT                   TSGASSPARPATPLVPCSTTPPPPPPRPPSRPKLPPGKPGVGDVSRPFSPPIHSSSPPP
FT                   IAPLARAESTSSISSTNSLSAATTPTVGSSRGPSPLTMGAQDTLPVAAAFTETVNAYFK
FT                   GADPSKCIVKITGEMVLSFPAGITRHFANNPSPAALTFRVVNSSRLEHVLPNPQLLCCD
FT                   NTQNDANTKEFWVNMPNLMTHLKKVSEQKPQATYYNVDMLKYQVSAQGIQSTPLNLAVN
FT                   WRCEPASTDLRIDYKYNTDAMSTAVALNNVQFLVPIDGGVTKLQAVLPPAVWNAEQQRI
FT                   LWKIPDISQKSENGGVGSLLARFQLSEGPSKPSPLVVQFTSEGSTLSGCDIELVGAGYR
FT                   FSLIKKRFAAGKYLADN"
FT   CDS             join(<40726459..40726504,40763975..40764026,
FT                   40765696..40765781,40769296..40769388,40773018..40773092,
FT                   40775252..40775749,40781701..40781825,40783026..40783152,
FT                   40810361..40810472,40816967..40817122,40819133..40819265,
FT                   40820741..40820943,40822253..40822317,40822813..40822977,
FT                   40824706..40824728)
FT                   /codon_start=1
FT                   /gene="Sgip1"
FT                   /locus_tag="mCG_16070"
FT                   /product="SH3-domain GRB2-like (endophilin) interacting
FT                   protein 1, isoform CRA_a"
FT                   /note="gene_id=mCG16070.2 transcript_id=mCT174866.0
FT                   protein_id=mCP97786.0 isoform=CRA_a"
FT                   /protein_id="EDL30854.1"
FT                   /translation="AEGFNRQHRTFPFACGEEVARPRRSTPTPELTSKKPLDDTLALAP
FT                   LFGPPLESAFDEQKTEVLLDQPEIWGSGQPMNPSTESPELARPFPTGTPPPLPPKTVPA
FT                   TPPRTGSPLTVATGNDQAATEAKIEKLPSISDLDSIFGPVLSPKSVAVNTEEKWVHFSD
FT                   ASPEHVTPELTPREQVVTPPAASDIPADSPAPAPPGPTGSAGPPGPPGPRHVPSPLNLE
FT                   EVQKKVAEQTFIKDDYLETLSSPKECGLGQRATPPPPPPPTYRTVVSSPGPGSGSGTGT
FT                   TSGASSPARPATPLVPCSTTPPPPPPRPPSRPKLPPGKPGVGDVSRPFSPPIHSSSPPP
FT                   IAPLARAESTSSISSTNSLSAATTPTVGSSRGPSPLTMGAQDTLPVAAAFTETVNAYFK
FT                   GADPSKCIVKITGEMVLSFPAGITRHFANNPSPAALTFRVVNSSRLEHVLPNPQLLCCD
FT                   NTQNDANTKEFWVNMPNLMTHLKKVSEQKPQATYYNVDMLKYQVSAQGIQSTPLNLAVN
FT                   WRCEPASTDLRIDYKYNTDAMSTAVALNNVQFLVPIDGGVTKLQAVLPPAVWNAEQQRI
FT                   LWKIPDISQKSENGGVGSLLARFQLSEGPSKPSPLVVQFTSEGSTLSGCDIELVGAGYR
FT                   FSLIKKRFAAGKYLADN"
FT   CDS             join(<40726459..40726504,40763975..40764026,
FT                   40765696..40765781,40769296..40769388,40773018..40773092,
FT                   40775252..40775749,40781701..40781825,40783026..40783152,
FT                   40810361..40810472,40816967..40817122,40819133..40819265,
FT                   40820741..40820943,40822253..40822317,40822813..40822977,
FT                   40824706..40824728)
FT                   /codon_start=1
FT                   /gene="Sgip1"
FT                   /locus_tag="mCG_16070"
FT                   /product="SH3-domain GRB2-like (endophilin) interacting
FT                   protein 1, isoform CRA_a"
FT                   /note="gene_id=mCG16070.2 transcript_id=mCT174867.0
FT                   protein_id=mCP97784.0 isoform=CRA_a"
FT                   /protein_id="EDL30855.1"
FT                   /translation="AEGFNRQHRTFPFACGEEVARPRRSTPTPELTSKKPLDDTLALAP
FT                   LFGPPLESAFDEQKTEVLLDQPEIWGSGQPMNPSTESPELARPFPTGTPPPLPPKTVPA
FT                   TPPRTGSPLTVATGNDQAATEAKIEKLPSISDLDSIFGPVLSPKSVAVNTEEKWVHFSD
FT                   ASPEHVTPELTPREQVVTPPAASDIPADSPAPAPPGPTGSAGPPGPPGPRHVPSPLNLE
FT                   EVQKKVAEQTFIKDDYLETLSSPKECGLGQRATPPPPPPPTYRTVVSSPGPGSGSGTGT
FT                   TSGASSPARPATPLVPCSTTPPPPPPRPPSRPKLPPGKPGVGDVSRPFSPPIHSSSPPP
FT                   IAPLARAESTSSISSTNSLSAATTPTVGSSRGPSPLTMGAQDTLPVAAAFTETVNAYFK
FT                   GADPSKCIVKITGEMVLSFPAGITRHFANNPSPAALTFRVVNSSRLEHVLPNPQLLCCD
FT                   NTQNDANTKEFWVNMPNLMTHLKKVSEQKPQATYYNVDMLKYQVSAQGIQSTPLNLAVN
FT                   WRCEPASTDLRIDYKYNTDAMSTAVALNNVQFLVPIDGGVTKLQAVLPPAVWNAEQQRI
FT                   LWKIPDISQKSENGGVGSLLARFQLSEGPSKPSPLVVQFTSEGSTLSGCDIELVGAGYR
FT                   FSLIKKRFAAGKYLADN"
FT   CDS             join(<40726459..40726504,40763975..40764026,
FT                   40765696..40765781,40769296..40769388,40773018..40773092,
FT                   40775252..40775749,40781701..40781825,40783026..40783152,
FT                   40810361..40810472,40816967..40817122,40819133..40819265,
FT                   40820741..40820943,40822253..40822317,40822813..40822977,
FT                   40824706..40824728)
FT                   /codon_start=1
FT                   /gene="Sgip1"
FT                   /locus_tag="mCG_16070"
FT                   /product="SH3-domain GRB2-like (endophilin) interacting
FT                   protein 1, isoform CRA_a"
FT                   /note="gene_id=mCG16070.2 transcript_id=mCT15607.2
FT                   protein_id=mCP22446.2 isoform=CRA_a"
FT                   /protein_id="EDL30856.1"
FT                   /translation="AEGFNRQHRTFPFACGEEVARPRRSTPTPELTSKKPLDDTLALAP
FT                   LFGPPLESAFDEQKTEVLLDQPEIWGSGQPMNPSTESPELARPFPTGTPPPLPPKTVPA
FT                   TPPRTGSPLTVATGNDQAATEAKIEKLPSISDLDSIFGPVLSPKSVAVNTEEKWVHFSD
FT                   ASPEHVTPELTPREQVVTPPAASDIPADSPAPAPPGPTGSAGPPGPPGPRHVPSPLNLE
FT                   EVQKKVAEQTFIKDDYLETLSSPKECGLGQRATPPPPPPPTYRTVVSSPGPGSGSGTGT
FT                   TSGASSPARPATPLVPCSTTPPPPPPRPPSRPKLPPGKPGVGDVSRPFSPPIHSSSPPP
FT                   IAPLARAESTSSISSTNSLSAATTPTVGSSRGPSPLTMGAQDTLPVAAAFTETVNAYFK
FT                   GADPSKCIVKITGEMVLSFPAGITRHFANNPSPAALTFRVVNSSRLEHVLPNPQLLCCD
FT                   NTQNDANTKEFWVNMPNLMTHLKKVSEQKPQATYYNVDMLKYQVSAQGIQSTPLNLAVN
FT                   WRCEPASTDLRIDYKYNTDAMSTAVALNNVQFLVPIDGGVTKLQAVLPPAVWNAEQQRI
FT                   LWKIPDISQKSENGGVGSLLARFQLSEGPSKPSPLVVQFTSEGSTLSGCDIELVGAGYR
FT                   FSLIKKRFAAGKYLADN"
FT   assembly_gap    40733121..40736307
FT                   /estimated_length=3187
FT                   /gap_type="unknown"
FT   assembly_gap    40783765..40784093
FT                   /estimated_length=329
FT                   /gap_type="unknown"
FT   assembly_gap    40801717..40801736
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    40812196..40812496
FT                   /estimated_length=301
FT                   /gap_type="unknown"
FT   assembly_gap    40821241..40821260
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(40821906..>40844432)
FT                   /locus_tag="mCG_146032"
FT                   /note="gene_id=mCG146032.0"
FT   mRNA            complement(join(40821906..40823221,40831818..40832019,
FT                   40838605..40838793,40844225..>40844432))
FT                   /locus_tag="mCG_146032"
FT                   /product="mCG146032"
FT                   /note="gene_id=mCG146032.0 transcript_id=mCT186140.0
FT                   created on 04-JUL-2003"
FT   assembly_gap    40833016..40833107
FT                   /estimated_length=92
FT                   /gap_type="unknown"
FT   CDS             complement(join(40838615..40838793,40844225..>40844282))
FT                   /codon_start=1
FT                   /locus_tag="mCG_146032"
FT                   /product="mCG146032"
FT                   /note="gene_id=mCG146032.0 transcript_id=mCT186140.0
FT                   protein_id=mCP107592.0"
FT                   /protein_id="EDL30852.1"
FT                   /translation="EFENDFSEQNNTRKPQTDKRPVMTASVQMLFNVYLRVRFQQVNHQ
FT                   HECLPGLMREKHKISVNKGAMCKLHTDLPLSVQ"
FT   gene            40841053..40859253
FT                   /gene="Tctex1d1"
FT                   /locus_tag="mCG_16074"
FT                   /note="gene_id=mCG16074.2"
FT   mRNA            join(40841053..40841262,40847172..40847263,
FT                   40857141..40857265,40858824..40859253)
FT                   /gene="Tctex1d1"
FT                   /locus_tag="mCG_16074"
FT                   /product="Tctex1 domain containing 1, transcript variant
FT                   mCT180734"
FT                   /note="gene_id=mCG16074.2 transcript_id=mCT180734.0 created
FT                   on 24-FEB-2003"
FT   mRNA            join(40841053..40841262,40843200..40843349,
FT                   40847172..40847263,40857141..40857265,40858824..40859251)
FT                   /gene="Tctex1d1"
FT                   /locus_tag="mCG_16074"
FT                   /product="Tctex1 domain containing 1, transcript variant
FT                   mCT15611"
FT                   /note="gene_id=mCG16074.2 transcript_id=mCT15611.0 created
FT                   on 24-FEB-2003"
FT   mRNA            join(40841053..40841262,40843232..40843349,
FT                   40847172..40847263,40857141..40857265,40858824..40859251)
FT                   /gene="Tctex1d1"
FT                   /locus_tag="mCG_16074"
FT                   /product="Tctex1 domain containing 1, transcript variant
FT                   mCT180735"
FT                   /note="gene_id=mCG16074.2 transcript_id=mCT180735.0 created
FT                   on 24-FEB-2003"
FT   CDS             join(40843249..40843349,40847172..40847263,
FT                   40857141..40857265,40858824..40859027)
FT                   /codon_start=1
FT                   /gene="Tctex1d1"
FT                   /locus_tag="mCG_16074"
FT                   /product="Tctex1 domain containing 1, isoform CRA_b"
FT                   /note="gene_id=mCG16074.2 transcript_id=mCT180735.0
FT                   protein_id=mCP103656.0 isoform=CRA_b"
FT                   /db_xref="GOA:B7ZNE0"
FT                   /db_xref="InterPro:IPR005334"
FT                   /db_xref="MGI:MGI:1914594"
FT                   /db_xref="UniProtKB/TrEMBL:B7ZNE0"
FT                   /protein_id="EDL30850.1"
FT                   /translation="MAQTHGSKQQAQRLEQGAESLRHGAQAQSRENNVSLSTVSHADEP
FT                   SQRDESSRLTVRMENTYQLGPTKPFPVATVNHILEDVLTTYLQEAQYDPEFCRQMTKTI
FT                   SEVIKTQVKELVIPRYKLIVIVYIGQRDDQSIVIGSRCLWNPKSDTVSSYTFKNSTFFA
FT                   LANVYAVYFE"
FT   CDS             join(40843249..40843349,40847172..40847263,
FT                   40857141..40857265,40858824..40859027)
FT                   /codon_start=1
FT                   /gene="Tctex1d1"
FT                   /locus_tag="mCG_16074"
FT                   /product="Tctex1 domain containing 1, isoform CRA_b"
FT                   /note="gene_id=mCG16074.2 transcript_id=mCT15611.0
FT                   protein_id=mCP22404.1 isoform=CRA_b"
FT                   /db_xref="GOA:B7ZNE0"
FT                   /db_xref="InterPro:IPR005334"
FT                   /db_xref="MGI:MGI:1914594"
FT                   /db_xref="UniProtKB/TrEMBL:B7ZNE0"
FT                   /protein_id="EDL30851.1"
FT                   /translation="MAQTHGSKQQAQRLEQGAESLRHGAQAQSRENNVSLSTVSHADEP
FT                   SQRDESSRLTVRMENTYQLGPTKPFPVATVNHILEDVLTTYLQEAQYDPEFCRQMTKTI
FT                   SEVIKTQVKELVIPRYKLIVIVYIGQRDDQSIVIGSRCLWNPKSDTVSSYTFKNSTFFA
FT                   LANVYAVYFE"
FT   CDS             join(40847242..40847263,40857141..40857265,
FT                   40858824..40859027)
FT                   /codon_start=1
FT                   /gene="Tctex1d1"
FT                   /locus_tag="mCG_16074"
FT                   /product="Tctex1 domain containing 1, isoform CRA_a"
FT                   /note="gene_id=mCG16074.2 transcript_id=mCT180734.0
FT                   protein_id=mCP103657.0 isoform=CRA_a"
FT                   /db_xref="GOA:G3UW44"
FT                   /db_xref="InterPro:IPR005334"
FT                   /db_xref="MGI:MGI:1914594"
FT                   /db_xref="UniProtKB/TrEMBL:G3UW44"
FT                   /protein_id="EDL30849.1"
FT                   /translation="MENTYQLGPTKPFPVATVNHILEDVLTTYLQEAQYDPEFCRQMTK
FT                   TISEVIKTQVKELVIPRYKLIVIVYIGQRDDQSIVIGSRCLWNPKSDTVSSYTFKNSTF
FT                   FALANVYAVYFE"
FT   gene            complement(40860247..>40866651)
FT                   /locus_tag="mCG_145487"
FT                   /note="gene_id=mCG145487.0"
FT   mRNA            complement(join(40860247..40861930,40862582..40862904,
FT                   40865013..40865104,40866554..>40866651))
FT                   /locus_tag="mCG_145487"
FT                   /product="mCG145487"
FT                   /note="gene_id=mCG145487.0 transcript_id=mCT184911.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(40861831..40861930,40862582..>40862820))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145487"
FT                   /product="mCG145487"
FT                   /note="gene_id=mCG145487.0 transcript_id=mCT184911.0
FT                   protein_id=mCP105840.0"
FT                   /protein_id="EDL30848.1"
FT                   /translation="REEEESITPSLKRHTLHVCSPSEGRSSKEPRCHVGEVVHTFDPGE
FT                   HLSACDSPRLVDENPIADDGGISETRDDNQITVGCSVFSCLWPKCLTINLNEGAKSNSG
FT                   FYSSNYFH"
FT   assembly_gap    40866841..40867871
FT                   /estimated_length=1031
FT                   /gap_type="unknown"
FT   gene            complement(40872719..>40881440)
FT                   /gene="Insl5"
FT                   /locus_tag="mCG_16072"
FT                   /note="gene_id=mCG16072.2"
FT   mRNA            complement(join(40872719..40873190,40881116..40881291,
FT                   40881412..>40881440))
FT                   /gene="Insl5"
FT                   /locus_tag="mCG_16072"
FT                   /product="insulin-like 5, transcript variant mCT15609"
FT                   /note="gene_id=mCG16072.2 transcript_id=mCT15609.2 created
FT                   on 12-SEP-2002"
FT   mRNA            complement(join(40872719..40873190,40881116..>40881329))
FT                   /gene="Insl5"
FT                   /locus_tag="mCG_16072"
FT                   /product="insulin-like 5, transcript variant mCT192845"
FT                   /note="gene_id=mCG16072.2 transcript_id=mCT192845.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(40872958..40873190,40881116..40881291,
FT                   40881412..40881440))
FT                   /codon_start=1
FT                   /gene="Insl5"
FT                   /locus_tag="mCG_16072"
FT                   /product="insulin-like 5, isoform CRA_b"
FT                   /note="gene_id=mCG16072.2 transcript_id=mCT15609.2
FT                   protein_id=mCP22393.2 isoform=CRA_b"
FT                   /db_xref="GOA:A2AIY3"
FT                   /db_xref="InterPro:IPR016179"
FT                   /db_xref="InterPro:IPR022353"
FT                   /db_xref="MGI:MGI:1346085"
FT                   /db_xref="UniProtKB/TrEMBL:A2AIY3"
FT                   /protein_id="EDL30847.1"
FT                   /translation="MCLVNTVKIRMKGPTLALFLLLVLLAVVEVRSRQTVKLCGLDYVR
FT                   TVIYICASSRWRRHLEGHFHSQQAETRNYLQLLDRHEPSKKTLEHSLPKTDLSGQELVR
FT                   DPQAPKEGLWELKKHSVVSRRDLQALCCREGCSMKELSTLC"
FT   CDS             complement(join(40872958..40873190,40881116..>40881329))
FT                   /codon_start=1
FT                   /gene="Insl5"
FT                   /locus_tag="mCG_16072"
FT                   /product="insulin-like 5, isoform CRA_a"
FT                   /note="gene_id=mCG16072.2 transcript_id=mCT192845.0
FT                   protein_id=mCP113798.0 isoform=CRA_a"
FT                   /protein_id="EDL30846.1"
FT                   /translation="TADHIASHLLSGRMKGPTLALFLLLVLLAVVEVRSRQTVKLCGLD
FT                   YVRTVIYICASSRWRRHLEGHFHSQQAETRNYLQLLDRHEPSKKTLEHSLPKTDLSGQE
FT                   LVRDPQAPKEGLWELKKHSVVSRRDLQALCCREGCSMKELSTLC"
FT   assembly_gap    40875728..40876309
FT                   /estimated_length=582
FT                   /gap_type="unknown"
FT   assembly_gap    40878157..40878651
FT                   /estimated_length=495
FT                   /gap_type="unknown"
FT   gene            complement(40892656..40968703)
FT                   /gene="Wdr78"
FT                   /locus_tag="mCG_113753"
FT                   /note="gene_id=mCG113753.0"
FT   mRNA            complement(join(40892656..40893927,40902789..40902945,
FT                   40903978..40904204,40904678..40904776,40914229..40914350,
FT                   40914483..40914640,40916912..40917063,40919080..40919166,
FT                   40920876..40921102,40927264..40927458,40936782..40936955,
FT                   40941946..40942085,40944818..40944974,40949753..40949865,
FT                   40951015..40951199,40957647..40957824,40968530..40968703))
FT                   /gene="Wdr78"
FT                   /locus_tag="mCG_113753"
FT                   /product="WD repeat domain 78, transcript variant
FT                   mCT114839"
FT                   /note="gene_id=mCG113753.0 transcript_id=mCT114839.0
FT                   created on 22-NOV-2002"
FT   mRNA            complement(join(40892659..40893927,40902789..40902945,
FT                   40904678..40904776,40914483..40914640,40916912..40917063,
FT                   40919080..40919166,40920876..40921102,40927264..40927454,
FT                   40936823..40936955,40941946..40942085,40944818..40944974,
FT                   40949753..40949865,40951015..40951199,40957647..40957824,
FT                   40968530..>40968644))
FT                   /gene="Wdr78"
FT                   /locus_tag="mCG_113753"
FT                   /product="WD repeat domain 78, transcript variant
FT                   mCT192853"
FT                   /note="gene_id=mCG113753.0 transcript_id=mCT192853.0
FT                   created on 09-MAR-2004"
FT   CDS             complement(join(40893877..40893927,40902789..40902945,
FT                   40903978..40904204,40904678..40904776,40914229..40914350,
FT                   40914483..40914640,40916912..40917063,40919080..40919166,
FT                   40920876..40921102,40927264..40927458,40936782..40936955,
FT                   40941946..40942085,40944818..40944974,40949753..40949865,
FT                   40951015..40951199,40957647..40957824,40968530..40968576))
FT                   /codon_start=1
FT                   /gene="Wdr78"
FT                   /locus_tag="mCG_113753"
FT                   /product="WD repeat domain 78, isoform CRA_a"
FT                   /note="gene_id=mCG113753.0 transcript_id=mCT114839.0
FT                   protein_id=mCP76525.1 isoform=CRA_a"
FT                   /protein_id="EDL30844.1"
FT                   /translation="MHSSPTSTRKQASFAASASAQPRKSISFINPSKSSAGKGYAASNP
FT                   NKLAVSRTMGFLTDMKPAEKLNVPSAKTVQVLDSKGVDVTPRPLYHPDPHAASAKPNKL
FT                   LTSQEGSLGSDYISSYSLYQNTLNPSMLGQYTRSVLGSSSVSKSSISTTESMSEDLEDS
FT                   SYKRDRLASFTDVRVLRSTAEAAISKEELEKTIEIILTETETLRFFDLPTVMFSTESEE
FT                   AEKIIEKNKKYETLCRNRLGNDLYVERMMQTFNGAPKNKEVQCEKIILEEKGVVATTWD
FT                   LYDSYNIPETLLAAKRSGYSSKGSLPAKDRDPKIQGKYPGQKPDCIPSLQDSESSSLMD
FT                   IENVILAKVQEDEEDNSEAILKSDKLHQDLFYMERVLMENVFQPKLAAYRQLPVYKEHE
FT                   PEEPEETLQVENLKVAEDEPKKEDEEEVEMELELEIATEQSTIPANLERLWSFSCDLTK
FT                   GLNVSSLSWNKANPDLLAVGYGNFGFREQKKGMACCWSIKNPMWPERIYQSSYGVTSVD
FT                   FSNSSPNLLAVGYHNGTVAIYNVQSSHNIPVLDSSESPQKHLGPVWQVQWIEQDRGTTG
FT                   DDKREILVSISADGRISKWIIRKGLDCHDLMRLKRTTATGGKKGGEKEKKGEALISRQA
FT                   PGMCFAFHPKDTNIYLAGTEEGLIHKCSCSYNEQYLETYRGHKGPVYKVTWNPFCPDVF
FT                   LSCSADWGVMIWHQDTVKPFLSFYPTTYVVYDVSWSPKSAYIFAAANENRVEIWDLQIS
FT                   TLDPLIVNVANPGIKFTTVLFAKETDCLLVGDSDGQVAVYELRNMPTASDTSRGDVINI
FT                   LLGPKTNHTG"
FT   CDS             complement(join(40904709..40904776,40914483..40914640,
FT                   40916912..40917063,40919080..40919166,40920876..40921102,
FT                   40927264..40927454,40936823..40936955,40941946..40942085,
FT                   40944818..40944974,40949753..40949865,40951015..40951199,
FT                   40957647..40957824,40968530..>40968588))
FT                   /codon_start=1
FT                   /gene="Wdr78"
FT                   /locus_tag="mCG_113753"
FT                   /product="WD repeat domain 78, isoform CRA_b"
FT                   /note="gene_id=mCG113753.0 transcript_id=mCT192853.0
FT                   protein_id=mCP113779.0 isoform=CRA_b"
FT                   /protein_id="EDL30845.1"
FT                   /translation="KVTTMHSSPTSTRKQASFAASASAQPRKSISFINPSKSSAGKGYA
FT                   ASNPNKLAVSRTMGFLTDMKPAEKLNVPSAKTVQVLDSKGVDVTPRPLYHPDPHAASAK
FT                   PNKLLTSQEGSLGSDYISSYSLYQNTLNPSMLGQYTRSVLGSSSVSKSSISTTESMSED
FT                   LEDSSYKRDRLASFTDVRVLRSTAEAAISKEELEKTIEIILTETETLRFFDLPTVMFST
FT                   ESEEAEKIIEKNKKYETLCRNRLGNDLYVERMMQTFNGAPKNKEVQCEKIILEEKGVVA
FT                   TTWDLYDSYNIPETLLAAKRSGYSSKGSLPAKDRDPKIQGNESSSLMDIENVILAKVQE
FT                   DEEDNSEAILKSDKLHQDLFYMERVLMENVFQPKLAAYRQLPVYKEHEPEEPEETLQVE
FT                   NLKVAEDEPKKEDEEEVEMELELEIATEQSTIPANLERLWSFSCDLTKGLNVSSLSWNK
FT                   ANPDLLAVGYGNFGFREQKKGMACCWSIKNPMWPERIYQSSYGVTSVDFSNSSPNLLAV
FT                   GYHNGTVAIYNVQSSHNIPVLDSSESPQKHLGPVWQVQWIEQDRGTTGDDKREILVSIS
FT                   ADGRISKWIIRKGLDCHGHEHLSGWYRRRPYSQVFLFIQ"
FT   assembly_gap    40943130..40943291
FT                   /estimated_length=162
FT                   /gap_type="unknown"
FT   gene            40968886..41019125
FT                   /gene="Mier1"
FT                   /locus_tag="mCG_113755"
FT                   /note="gene_id=mCG113755.0"
FT   mRNA            join(40968886..40968939,40969980..40970080,
FT                   40972659..40972735,40981771..40981795,40985464..40985609,
FT                   40993856..40994014,40994609..40994741,40995335..40995399,
FT                   40997630..40997702,41002795..41002946,41003620..41003701,
FT                   41005030..41005124,41009982..41010109,41014177..41014316,
FT                   41016938..41019125)
FT                   /gene="Mier1"
FT                   /locus_tag="mCG_113755"
FT                   /product="mesoderm induction early response 1 homolog
FT                   (Xenopus laevis"
FT                   /note="gene_id=mCG113755.0 transcript_id=mCT114841.1
FT                   created on 23-OCT-2002"
FT   CDS             join(40972676..40972735,40981771..40981795,
FT                   40985464..40985609,40993856..40994014,40994609..40994741,
FT                   40995335..40995399,40997630..40997702,41002795..41002946,
FT                   41003620..41003701,41005030..41005124,41009982..41010109,
FT                   41014177..41014316,41016938..41017266)
FT                   /codon_start=1
FT                   /gene="Mier1"
FT                   /locus_tag="mCG_113755"
FT                   /product="mesoderm induction early response 1 homolog
FT                   (Xenopus laevis"
FT                   /note="gene_id=mCG113755.0 transcript_id=mCT114841.1
FT                   protein_id=mCP75840.1"
FT                   /protein_id="EDL30843.1"
FT                   /translation="MFMFNWFTDCLWILFLSNYKPSVESSSPGGSATSEDHEFDPSADM
FT                   LVHDFDDERTLEEEEMMEGETNFSSEIEDLAREGDMPIHELLSLYGYDSTVRLPEEEEE
FT                   EEEEEEGEDDEDADNDDNSGCSGENKEENIKDSSGQEDETQSSNDDPSQSVTSQDAQEI
FT                   IRPRRCKYFDTNSEIEEESEEDEDYIPSEDWKKEIMVGSMFQAEIPVGVCRYKENEKVY
FT                   ENDDQLLWDPECLPEEKVVVFLKDASRRTGDEKGVEAIPEGSHIKDNEQALYELVKCSF
FT                   DTEEALRRLRFNVKAAREELSVWTEEECRNFEQGLKAYGKDFHLIQANKVRTRSVGECV
FT                   AFYYMWKKSERYDFFAQQTRFGKKKYNLHPGVTDYMDRLLDESESAASSRAPSPPPTAS
FT                   NSSNSQSEKEDGAVSSRNQNGVSSNGPGEILNKEEVKVEGLHVNGPTGGNKKPLLTDMD
FT                   TNGYEANNLTTDPKLAHMTARNENDFDEKNERPAKRRRINSSGKESPGSSEFFQEAVSH
FT                   GKFEEHENTND"
FT   assembly_gap    40973784..40973923
FT                   /estimated_length=140
FT                   /gap_type="unknown"
FT   gene            complement(41028050..41069366)
FT                   /gene="Slc35d1"
FT                   /locus_tag="mCG_16067"
FT                   /note="gene_id=mCG16067.2"
FT   mRNA            complement(join(41028050..41028349,41039391..41039473,
FT                   41044356..41044434,41045401..41045468,41059731..41059823,
FT                   41062735..41062837,41065188..41065256,41065962..41066033,
FT                   41067822..41067889,41068528..41068614,41068716..41068749,
FT                   41069321..41069366))
FT                   /gene="Slc35d1"
FT                   /locus_tag="mCG_16067"
FT                   /product="solute carrier family 35 (UDP-glucuronic
FT                   acid/UDP-N-acetylgalactosamine dual transporter), member
FT                   D1"
FT                   /note="gene_id=mCG16067.2 transcript_id=mCT15331.2 created
FT                   on 09-DEC-2002"
FT   CDS             complement(join(41028241..41028349,41039391..41039473,
FT                   41044356..41044434,41045401..41045468,41059731..41059823,
FT                   41062735..41062837,41065188..41065256,41065962..41066033,
FT                   41067822..41067889,41068528..41068614))
FT                   /codon_start=1
FT                   /gene="Slc35d1"
FT                   /locus_tag="mCG_16067"
FT                   /product="solute carrier family 35 (UDP-glucuronic
FT                   acid/UDP-N-acetylgalactosamine dual transporter), member
FT                   D1"
FT                   /note="gene_id=mCG16067.2 transcript_id=mCT15331.2
FT                   protein_id=mCP22392.2"
FT                   /db_xref="GOA:Q14BE1"
FT                   /db_xref="InterPro:IPR004853"
FT                   /db_xref="MGI:MGI:2140361"
FT                   /db_xref="UniProtKB/TrEMBL:Q14BE1"
FT                   /protein_id="EDL30842.1"
FT                   /translation="MVATVAVLWVGKTLRVVKFPDFDRNVPRKTFPLPLLYFGNQITGL
FT                   FSTKKLNLPMFTVLRRFSILFTMFAEGALLKKTFSWGIKMTVFAMIIGAFVAASSDLAF
FT                   DLEGYVFILINDVLTAANGAYVKQKLDSKELGKYGLLYYNALFMILPTLAIAYFTGDAQ
FT                   KAMEFEGWADTLFLLQFTLSCVMGFILMYATVLCTQYNSALTTTIVGCIKNILITYIGM
FT                   VFGGDYIFTWTNFIGLNISIAGSLVYSYITFTEEQLSKQSEASNKLDTKGKGAV"
FT   assembly_gap    41050307..41050326
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    41057265..41057607
FT                   /estimated_length=343
FT                   /gap_type="unknown"
FT   assembly_gap    41063995..41064014
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    41069367..41069581
FT                   /estimated_length=215
FT                   /gap_type="unknown"
FT   gene            complement(41084973..41138518)
FT                   /locus_tag="mCG_16065"
FT                   /note="gene_id=mCG16065.1"
FT   mRNA            complement(join(41084973..41086038,41090155..41090335,
FT                   41091455..41091524,41097285..41097429,41110020..41110084,
FT                   41120913..41121025,41125279..41125424,41132036..41132127,
FT                   41137956..41138518))
FT                   /locus_tag="mCG_16065"
FT                   /product="mCG16065"
FT                   /note="gene_id=mCG16065.1 transcript_id=mCT15601.2 created
FT                   on 23-OCT-2002"
FT   CDS             complement(join(41085493..41086038,41090155..41090335,
FT                   41091455..41091524,41097285..41097429,41110020..41110084,
FT                   41120913..41121025,41125279..41125424,41132036..41132110))
FT                   /codon_start=1
FT                   /locus_tag="mCG_16065"
FT                   /product="mCG16065"
FT                   /note="gene_id=mCG16065.1 transcript_id=mCT15601.2
FT                   protein_id=mCP22416.1"
FT                   /protein_id="EDL30841.1"
FT                   /translation="MTEKILEKFDALEEKERILEAIRENNTDRHHRQRKKPLITPLLFD
FT                   LHVQFGDTITPSASKIIKNKPHDLKNPKRSVSFKYKPNNSRSDLEESDLRPPILGTMIN
FT                   YEESKLMDHKEENLKSRPISLRYLKDKDETEYANPLPFPQLWSKHLCKKSAESSVPTPK
FT                   LTNESNASKKENVSPPFTDQHESRTKKSMHSTDHSADSSTSRGKCPPKGITKESELTRN
FT                   DEARKPHPVKQSIMLPLDCEDLLKNPKIKTIDLRPAVTVHTSMKQSHANPIIFYDTEYV
FT                   QMLFLTKRFTPYAMKCTERNIVLEKNYEVLKVLFSDEPSAVSEPIQQKHLQVFSAEYAQ
FT                   KSINEKRKKKHDRLVSKKISPNTRYNLSQTFSSLSKKFVGYFDKDVTQGKSYKANRFER
FT                   FSKTKPPPTRKLTTLPIKYDSKPLKNIFEIHKLNNMTPLDNLLGLRA"
FT   assembly_gap    41113335..41113354
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <41138617..41159543
FT                   /locus_tag="mCG_146033"
FT                   /note="gene_id=mCG146033.0"
FT   mRNA            join(<41138617..41139372,41145400..41145478,
FT                   41157223..41157326,41159296..41159543)
FT                   /locus_tag="mCG_146033"
FT                   /product="mCG146033"
FT                   /note="gene_id=mCG146033.0 transcript_id=mCT186141.0
FT                   created on 04-JUL-2003"
FT   CDS             join(<41139284..41139372,41145400..41145478,
FT                   41157223..41157326,41159296..41159527)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146033"
FT                   /product="mCG146033"
FT                   /note="gene_id=mCG146033.0 transcript_id=mCT186141.0
FT                   protein_id=mCP107593.0"
FT                   /protein_id="EDL30840.1"
FT                   /translation="FLLKRFEPQLILSSVLQLICRMSPSGPCHGTWTSLLAAPASQSSA
FT                   TQKHVFPFLLQELKESHLESKLGKDGFWDNHDHGFLGSCLSWNHFCSCGSLCKTCRRPS
FT                   QSMVQHGVEGAQMKTTDSAWELLTAAGGGGSPPHWGGGGRGCSLVGQSLIGFPTPHVCM
FT                   GHIN"
FT   assembly_gap    41139566..41139639
FT                   /estimated_length=74
FT                   /gap_type="unknown"
FT   gene            41161536..41214215
FT                   /gene="Oma1"
FT                   /locus_tag="mCG_16071"
FT                   /note="gene_id=mCG16071.1"
FT   mRNA            join(41161536..41161594,41166838..41167344,
FT                   41169456..41169684,41172816..41172989,41173090..41173197,
FT                   41176649..41176777,41179116..41179190,41201287..41201436,
FT                   41213753..41214215)
FT                   /gene="Oma1"
FT                   /locus_tag="mCG_16071"
FT                   /product="OMA1 homolog, zinc metallopeptidase (S.
FT                   cerevisiae)"
FT                   /note="gene_id=mCG16071.1 transcript_id=mCT15608.2 created
FT                   on 23-OCT-2002"
FT   assembly_gap    41166073..41166541
FT                   /estimated_length=469
FT                   /gap_type="unknown"
FT   CDS             join(41166857..41167344,41169456..41169684,
FT                   41172816..41172989,41173090..41173197,41176649..41176777,
FT                   41179116..41179190,41201287..41201436,41213753..41213965)
FT                   /codon_start=1
FT                   /gene="Oma1"
FT                   /locus_tag="mCG_16071"
FT                   /product="OMA1 homolog, zinc metallopeptidase (S.
FT                   cerevisiae)"
FT                   /note="gene_id=mCG16071.1 transcript_id=mCT15608.2
FT                   protein_id=mCP22427.2"
FT                   /protein_id="EDL30839.1"
FT                   /translation="MSLLYGLQSTRINRFLSGVNNLANRRQWTPPASCPLAPKLRAVNA
FT                   YWGLNTVSHCHSVTLLPRNFLFCRTLNHKKSRCLSSAQSKELGVLTYRCTVRGDSVLRQ
FT                   GARKVAGVPALAASCSPSCPAVIEARSFRTSARVQAAPVPLLLLILKPVQKLLAIIVGR
FT                   GIRKWWQALPPNKKELFKDSVRKNKWRLLLGLSAFGLLFVVFYFTHLEVSPVTGRSKLL
FT                   LVGKEHFRLLSDLEYEVWMEEFKNDLLPERDPRYLTVKEMVYHLTQCNRDVPGISETNW
FT                   VVHVVDSPAVNAFVLPNGQVFIFTGLLNSVTDVHQLSFLLGHEIAHAVLGHAAEKASLV
FT                   HLLDFLGMIFLTMIWAICPRDSLAVLGQWIQSKLQEYMFDRPYSRTLEAEADKVGLQLA
FT                   AKACADVRASSVFWQQMEFSESLHGYPKLPEWLSTHPSHGNRAEYLDRLIPQALKLREV
FT                   CNCPPLSGPDPRLLFRLTVKRFLEDSEKEDLNITVKKQKTDALPMQKQEQIPLTYVLEK
FT                   RTAG"
FT   assembly_gap    41171807..41171843
FT                   /estimated_length=37
FT                   /gap_type="unknown"
FT   assembly_gap    41187846..41187865
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    41212467..41212526
FT                   /estimated_length=60
FT                   /gap_type="unknown"
FT   assembly_gap    41214484..41214540
FT                   /estimated_length=57
FT                   /gap_type="unknown"
FT   assembly_gap    41220651..41220736
FT                   /estimated_length=86
FT                   /gap_type="unknown"
FT   assembly_gap    41221763..41226081
FT                   /estimated_length=4319
FT                   /gap_type="unknown"
FT   assembly_gap    41247382..41247473
FT                   /estimated_length=92
FT                   /gap_type="unknown"
FT   assembly_gap    41260116..41260135
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    41276368..41276387
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    41280082..41280101
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    41325493..41326349
FT                   /estimated_length=857
FT                   /gap_type="unknown"
FT   assembly_gap    41336980..41336999
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    41341133..41341152
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    41348010..41348029
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    41354521..41354640
FT                   /estimated_length=120
FT                   /gap_type="unknown"
FT   assembly_gap    41356312..41356505
FT                   /estimated_length=194
FT                   /gap_type="unknown"
FT   assembly_gap    41372943..41373664
FT                   /estimated_length=722
FT                   /gap_type="unknown"
FT   assembly_gap    41381871..41381890
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    41409128..41409300
FT                   /estimated_length=173
FT                   /gap_type="unknown"
FT   gene            41410807..41411594
FT                   /pseudo
FT                   /locus_tag="mCG_1043323"
FT                   /note="gene_id=mCG1043323.1"
FT   mRNA            41410807..41411594
FT                   /pseudo
FT                   /locus_tag="mCG_1043323"
FT                   /note="gene_id=mCG1043323.1 transcript_id=mCT161027.1
FT                   created on 15-JUL-2003"
FT   assembly_gap    41411595..41413158
FT                   /estimated_length=1564
FT                   /gap_type="unknown"
FT   assembly_gap    41432218..41432269
FT                   /estimated_length=52
FT                   /gap_type="unknown"
FT   assembly_gap    41435033..41435052
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    41512978..41512997
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    41524392..41524411
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    41536880..41537518
FT                   /estimated_length=639
FT                   /gap_type="unknown"
FT   assembly_gap    41545343..41545545
FT                   /estimated_length=203
FT                   /gap_type="unknown"
FT   assembly_gap    41558798..41558835
FT                   /estimated_length=38
FT                   /gap_type="unknown"
FT   assembly_gap    41560824..41561451
FT                   /estimated_length=628
FT                   /gap_type="unknown"
FT   assembly_gap    41570334..41570410
FT                   /estimated_length=77
FT                   /gap_type="unknown"
FT   assembly_gap    41576713..41576732
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    41589243..41589262
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    41599442..41600488
FT                   /estimated_length=1047
FT                   /gap_type="unknown"
FT   assembly_gap    41620576..41620595
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    41623324..41623343
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    41654318..41655557
FT                   /estimated_length=1240
FT                   /gap_type="unknown"
FT   assembly_gap    41674366..41674385
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    41684118..41684137
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    41689013..41689032
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    41732556..41732575
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    41742544..41742686
FT                   /estimated_length=143
FT                   /gap_type="unknown"
FT   assembly_gap    41788445..41788524
FT                   /estimated_length=80
FT                   /gap_type="unknown"
FT   gene            <41800325..42020030
FT                   /locus_tag="mCG_1043521"
FT                   /note="gene_id=mCG1043521.1"
FT   mRNA            join(<41800325..41800490,42003258..42003329,
FT                   42019360..42020030)
FT                   /locus_tag="mCG_1043521"
FT                   /product="mCG1043521"
FT                   /note="gene_id=mCG1043521.1 transcript_id=mCT161225.1
FT                   created on 29-JAN-2003"
FT   assembly_gap    41813353..41813372
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    41829910..41829929
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    41851346..41851365
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    41876636..41876655
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    41903471..41903604
FT                   /estimated_length=134
FT                   /gap_type="unknown"
FT   assembly_gap    41959381..41959400
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    41992664..41992712
FT                   /estimated_length=49
FT                   /gap_type="unknown"
FT   CDS             <42019624..42019812
FT                   /codon_start=1
FT                   /locus_tag="mCG_1043521"
FT                   /product="mCG1043521"
FT                   /note="gene_id=mCG1043521.1 transcript_id=mCT161225.1
FT                   protein_id=mCP76485.0"
FT                   /protein_id="EDL30838.1"
FT                   /translation="SVGYLINKSINRFGKRGSPVIFYGKSKIYANVDRWCLLSQFKMTK
FT                   CIISKAQRGKRLYVGVL"
FT   assembly_gap    42025380..42025564
FT                   /estimated_length=185
FT                   /gap_type="unknown"
FT   assembly_gap    42028400..42028599
FT                   /estimated_length=200
FT                   /gap_type="unknown"
FT   assembly_gap    42045152..42045171
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    42071188..42071207
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    42090575..42094505
FT                   /estimated_length=3931
FT                   /gap_type="unknown"
FT   assembly_gap    42095802..42095821
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    42097448..42097742
FT                   /estimated_length=295
FT                   /gap_type="unknown"
FT   assembly_gap    42114572..42114591
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    42132163..42132182
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    42170126..42170171
FT                   /estimated_length=46
FT                   /gap_type="unknown"
FT   assembly_gap    42175656..42175688
FT                   /estimated_length=33
FT                   /gap_type="unknown"
FT   gene            42208955..42584820
FT                   /gene="Dab1"
FT                   /locus_tag="mCG_119642"
FT                   /note="gene_id=mCG119642.1"
FT   mRNA            join(42208955..42209148,42320736..42320937,
FT                   42447557..42447696,42455426..42455524,42520757..42520888,
FT                   42521508..42521627,42522125..42522163,42523653..42523718,
FT                   42530438..42530497,42546258..42546527,42560295..42560357,
FT                   42562608..42562716,42569646..42570194,42573710..42573837,
FT                   42574155..42574265,42583465..42584820)
FT                   /gene="Dab1"
FT                   /locus_tag="mCG_119642"
FT                   /product="disabled homolog 1 (Drosophila), transcript
FT                   variant mCT120817"
FT                   /note="gene_id=mCG119642.1 transcript_id=mCT120817.1
FT                   created on 25-OCT-2002"
FT   mRNA            join(42209269..42209396,42320736..42320937,
FT                   42447557..42447696,42455426..42455524,42520757..42520888,
FT                   42521508..42521627,42522125..42522163,42523653..42523718,
FT                   42530438..42530497,42560295..42560357,42562608..42562716,
FT                   42569646..42570194,42573710..42573837,42574155..42574265,
FT                   42583465..42584820)
FT                   /gene="Dab1"
FT                   /locus_tag="mCG_119642"
FT                   /product="disabled homolog 1 (Drosophila), transcript
FT                   variant mCT173085"
FT                   /note="gene_id=mCG119642.1 transcript_id=mCT173085.0
FT                   created on 25-OCT-2002"
FT   mRNA            join(42209269..42209396,42320736..42320937,
FT                   42447557..42447696,42455426..42455524,42520757..42520888,
FT                   42521508..42521605,42560249..42560413,42569602..>42570214)
FT                   /gene="Dab1"
FT                   /locus_tag="mCG_119642"
FT                   /product="disabled homolog 1 (Drosophila), transcript
FT                   variant mCT173086"
FT                   /note="gene_id=mCG119642.1 transcript_id=mCT173086.0
FT                   created on 25-OCT-2002"
FT   mRNA            join(42209269..42209396,42320736..42320937,
FT                   42447557..42447696,42455426..42455524,42520757..42520888,
FT                   42521508..42521627,42522125..42522429)
FT                   /gene="Dab1"
FT                   /locus_tag="mCG_119642"
FT                   /product="disabled homolog 1 (Drosophila), transcript
FT                   variant mCT175244"
FT                   /note="gene_id=mCG119642.1 transcript_id=mCT175244.0
FT                   created on 25-OCT-2002"
FT   assembly_gap    42210702..42210721
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    42231565..42231584
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    42259482..42259501
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    42274221..42274240
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(42320871..42320937,42447557..42447696,
FT                   42455426..42455524,42520757..42520888,42521508..42521627,
FT                   42522125..42522163,42523653..42523718,42530438..42530497,
FT                   42560295..42560357,42562608..42562716,42569646..42570194,
FT                   42573710..42573837,42574155..42574250)
FT                   /codon_start=1
FT                   /gene="Dab1"
FT                   /locus_tag="mCG_119642"
FT                   /product="disabled homolog 1 (Drosophila), isoform CRA_a"
FT                   /note="gene_id=mCG119642.1 transcript_id=mCT173085.0
FT                   protein_id=mCP96005.0 isoform=CRA_a"
FT                   /db_xref="GOA:B2RRQ8"
FT                   /db_xref="InterPro:IPR006020"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="MGI:MGI:108554"
FT                   /db_xref="UniProtKB/TrEMBL:B2RRQ8"
FT                   /protein_id="EDL30833.1"
FT                   /translation="MSTETELQVAVKTSAKKDSRKKGQDRSEATLIKRFKGEGVRYKAK
FT                   LIGIDEVSAARGDKLCQDSMMKLKGVVAGARSKGEHKQKIFLTISFGGIKIFDEKTGAL
FT                   QHHHAVHEISYIAKDITDHRAFGYVCGKEGNHRFVAIKTAQAAEPVILDLRDLFQLIYE
FT                   LKQREELEKKAQKDKQCEQAVYQTILEEDVEDPVYQYIVFEAGHEPIRDPETEENIYQV
FT                   PTSQKKEGVYDVPKSQPVSAVTQLELFGDMSTPPDITSPPTPATPGDAFLPSSSQTLPG
FT                   SADVFGSMSFGTAAVPSGYVAMGAVLPSFWGQQPLVQQQIAMGAQPPVAQVIPGAQPIA
FT                   WGQPGLFPATQQAWPTVAGQFPPAAFMPTQTVMPLAAAMFQGPLTPLATVPGTNDSARS
FT                   SPQSDKPRQKMGKESFKDFQMVQPPPVPSRKPDQPSLTCTSEAFSSYFNKVGVAQDTDD
FT                   CDDFDISQLNLTPVTSTTPSTNSPPTPAPRQSSPSKSSASHVSDPTADDIFEEGFESPS
FT                   KSEEQEAPDGSQASSTSDPFGEPSGEPSGDNISPQDGS"
FT   CDS             join(42320871..42320937,42447557..42447696,
FT                   42455426..42455524,42520757..42520888,42521508..42521605,
FT                   42560249..42560413,42569602..42570214)
FT                   /codon_start=1
FT                   /gene="Dab1"
FT                   /locus_tag="mCG_119642"
FT                   /product="disabled homolog 1 (Drosophila), isoform CRA_b"
FT                   /note="gene_id=mCG119642.1 transcript_id=mCT173086.0
FT                   protein_id=mCP96004.0 isoform=CRA_b"
FT                   /protein_id="EDL30834.1"
FT                   /translation="MSTETELQVAVKTSAKKDSRKKGQDRSEATLIKRFKGEGVRYKAK
FT                   LIGIDEVSAARGDKLCQDSMMKLKGVVAGARSKGEHKQKIFLTISFGGIKIFDEKTGAL
FT                   QHHHAVHEISYIAKDITDHRAFGYVCGKEGNHRFVAIKTAQAAEPVILDLRDLFQLIYE
FT                   LKQREELEKKAQKDKHNIGPHAYVIPFVSFQAVTQLELFGDMSTPPDITSPPVSMHHPP
FT                   SEPLLPDPSFKQFFPPGCLILLSPVPGYVAMGAVLPSFWGQQPLVQQQIAMGAQPPVAQ
FT                   VIPGAQPIAWGQPGLFPATQQAWPTVAGQFPPAAFMPTQTVMPLAAAMFQGPLTPLATV
FT                   PGTNDSARSSPQSDKPRQKMGKESFKDFQMVQPPPVPSRKPDQPSLTCTSEAFSSYFNK
FT                   VGVAQDTDDCDDFDISQLNLTPVTSTTPSTNSRELSFH"
FT   CDS             join(42320871..42320937,42447557..42447696,
FT                   42455426..42455524,42520757..42520888,42521508..42521627,
FT                   42522125..42522163,42523653..42523718,42530438..42530497,
FT                   42546258..42546350)
FT                   /codon_start=1
FT                   /gene="Dab1"
FT                   /locus_tag="mCG_119642"
FT                   /product="disabled homolog 1 (Drosophila), isoform CRA_d"
FT                   /note="gene_id=mCG119642.1 transcript_id=mCT120817.1
FT                   protein_id=mCP76020.1 isoform=CRA_d"
FT                   /protein_id="EDL30836.1"
FT                   /translation="MSTETELQVAVKTSAKKDSRKKGQDRSEATLIKRFKGEGVRYKAK
FT                   LIGIDEVSAARGDKLCQDSMMKLKGVVAGARSKGEHKQKIFLTISFGGIKIFDEKTGAL
FT                   QHHHAVHEISYIAKDITDHRAFGYVCGKEGNHRFVAIKTAQAAEPVILDLRDLFQLIYE
FT                   LKQREELEKKAQKDKQCEQAVYQTILEEDVEDPVYQYIVFEAGHEPIRDPETEENIYQV
FT                   PTSQKKEGVYDVPKSQPVSSLVQSPAAERAEAESRTGPAEPGSILRPLG"
FT   CDS             join(42320871..42320937,42447557..42447696,
FT                   42455426..42455524,42520757..42520888,42521508..42521627,
FT                   42522125..42522220)
FT                   /codon_start=1
FT                   /gene="Dab1"
FT                   /locus_tag="mCG_119642"
FT                   /product="disabled homolog 1 (Drosophila), isoform CRA_c"
FT                   /note="gene_id=mCG119642.1 transcript_id=mCT175244.0
FT                   protein_id=mCP98163.0 isoform=CRA_c"
FT                   /protein_id="EDL30835.1"
FT                   /translation="MSTETELQVAVKTSAKKDSRKKGQDRSEATLIKRFKGEGVRYKAK
FT                   LIGIDEVSAARGDKLCQDSMMKLKGVVAGARSKGEHKQKIFLTISFGGIKIFDEKTGAL
FT                   QHHHAVHEISYIAKDITDHRAFGYVCGKEGNHRFVAIKTAQAAEPVILDLRDLFQLIYE
FT                   LKQREELEKKAQKDKQCEQAVYQTILEEDVEDPVYQVISEPRQGFACSCEGSFD"
FT   assembly_gap    42338061..42338080
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            join(42353740..42353932,42447557..42447696,
FT                   42455426..42455524,42520757..42520888,42521508..42521627,
FT                   42522125..42522437)
FT                   /gene="Dab1"
FT                   /locus_tag="mCG_119642"
FT                   /product="disabled homolog 1 (Drosophila), transcript
FT                   variant mCT173087"
FT                   /note="gene_id=mCG119642.1 transcript_id=mCT173087.0
FT                   created on 25-OCT-2002"
FT   CDS             join(42353926..42353932,42447557..42447696,
FT                   42455426..42455524,42520757..42520888,42521508..42521627,
FT                   42522125..42522220)
FT                   /codon_start=1
FT                   /gene="Dab1"
FT                   /locus_tag="mCG_119642"
FT                   /product="disabled homolog 1 (Drosophila), isoform CRA_e"
FT                   /note="gene_id=mCG119642.1 transcript_id=mCT173087.0
FT                   protein_id=mCP96006.0 isoform=CRA_e"
FT                   /protein_id="EDL30837.1"
FT                   /translation="MLCQDRSEATLIKRFKGEGVRYKAKLIGIDEVSAARGDKLCQDSM
FT                   MKLKGVVAGARSKGEHKQKIFLTISFGGIKIFDEKTGALQHHHAVHEISYIAKDITDHR
FT                   AFGYVCGKEGNHRFVAIKTAQAAEPVILDLRDLFQLIYELKQREELEKKAQKDKQCEQA
FT                   VYQTILEEDVEDPVYQVISEPRQGFACSCEGSFD"
FT   assembly_gap    42356274..42356310
FT                   /estimated_length=37
FT                   /gap_type="unknown"
FT   assembly_gap    42357891..42357910
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    42389478..42389497
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    42410090..42410109
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    42417682..42417839
FT                   /estimated_length=158
FT                   /gap_type="unknown"
FT   assembly_gap    42468051..42468152
FT                   /estimated_length=102
FT                   /gap_type="unknown"
FT   assembly_gap    42497598..42497621
FT                   /estimated_length=24
FT                   /gap_type="unknown"
FT   assembly_gap    42507509..42507797
FT                   /estimated_length=289
FT                   /gap_type="unknown"
FT   assembly_gap    42549912..42550083
FT                   /estimated_length=172
FT                   /gap_type="unknown"
FT   assembly_gap    42574442..42574731
FT                   /estimated_length=290
FT                   /gap_type="unknown"
FT   assembly_gap    42598689..42598708
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            42608239..42646324
FT                   /gene="C8b"
FT                   /locus_tag="mCG_7427"
FT                   /note="gene_id=mCG7427.1"
FT   mRNA            join(42608239..42608403,42616205..42616361,
FT                   42622301..42622442,42624612..42624753,42626121..42626253,
FT                   42628580..42628777,42632255..42632495,42633575..42633703,
FT                   42635008..42635171,42642115..42642268,42643118..42643186,
FT                   42645789..42646324)
FT                   /gene="C8b"
FT                   /locus_tag="mCG_7427"
FT                   /product="complement component 8, beta subunit, transcript
FT                   variant mCT6709"
FT                   /note="gene_id=mCG7427.1 transcript_id=mCT6709.2 created on
FT                   23-OCT-2002"
FT   mRNA            join(<42608312..42608403,42616205..42616361,
FT                   42622301..42622442,42624612..42624753,42626121..42626253,
FT                   42632255..42632495,42633575..42633703,42635008..42635171,
FT                   42642115..42642268,42643118..42643186,42645789..42645951)
FT                   /gene="C8b"
FT                   /locus_tag="mCG_7427"
FT                   /product="complement component 8, beta subunit, transcript
FT                   variant mCT192843"
FT                   /note="gene_id=mCG7427.1 transcript_id=mCT192843.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<42608312..42608403,42616205..42616361,
FT                   42622301..42622442,42624612..42624753,42626121..42626253,
FT                   42632255..42632495,42633575..42633703,42635008..42635171,
FT                   42642115..42642268,42643118..42643186,42645789..42645940)
FT                   /codon_start=1
FT                   /gene="C8b"
FT                   /locus_tag="mCG_7427"
FT                   /product="complement component 8, beta subunit, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG7427.1 transcript_id=mCT192843.0
FT                   protein_id=mCP113827.0 isoform=CRA_a"
FT                   /protein_id="EDL30831.1"
FT                   /translation="NMKIGAQVWRALAKSCLLCATLGCLHFPGSRGGKPDFFETKAVNG
FT                   SLVKSRPVRSVAEAPAPIDCELSTWSSWTACDPCQKKRYRHTYLLRPSQFYGELCDLSD
FT                   KEVEDCVTNQPCRSQVRCEGFVCAQTGRCVNRRLLCNGDNDCGDQSDEANCRRIYKNCQ
FT                   REMEQYWAIDRLASGINLFTNTFEGPVLDHRYYAGGCSPHYILDTNFRKPYNVESYTPQ
FT                   QSKFLHARSVLEVAHYKLKSRSLMLHYEFLQRVKSLPLEYSYGEYRDLLRDFGTHFITE
FT                   AVLGGIYEYTLIMNKDAMEQGDYTLSHVTACAGGSFGIGGMVYKVYVKVGVSAKKCSDI
FT                   MKEINERNKRSTMVEDLVVLVRGGTSEDITALAYKELPTPELMEAWGDAVKYNPAIIKI
FT                   KAEPLYELVTATDFAYSSTVKQNLKKALEEFQSEVSSCRCAPCRGNGVPVLKGSRCECI
FT                   CPGGFQGTACEVTYRKDIPIDGKWSCWSDWSACSGGHKTRHRQCNNPAPHKGGSPCSGP
FT                   ASETLNC"
FT   CDS             join(42608315..42608403,42616205..42616361,
FT                   42622301..42622442,42624612..42624753,42626121..42626253,
FT                   42628580..42628777,42632255..42632495,42633575..42633703,
FT                   42635008..42635171,42642115..42642268,42643118..42643186,
FT                   42645789..42645940)
FT                   /codon_start=1
FT                   /gene="C8b"
FT                   /locus_tag="mCG_7427"
FT                   /product="complement component 8, beta subunit, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG7427.1 transcript_id=mCT6709.2
FT                   protein_id=mCP22368.2 isoform=CRA_b"
FT                   /protein_id="EDL30832.1"
FT                   /translation="MKIGAQVWRALAKSCLLCATLGCLHFPGSRGGKPDFFETKAVNGS
FT                   LVKSRPVRSVAEAPAPIDCELSTWSSWTACDPCQKKRYRHTYLLRPSQFYGELCDLSDK
FT                   EVEDCVTNQPCRSQVRCEGFVCAQTGRCVNRRLLCNGDNDCGDQSDEANCRRIYKNCQR
FT                   EMEQYWAIDRLASGINLFTNTFEGPVLDHRYYAGGCSPHYILDTNFRKPYNVESYTPQT
FT                   KCEYEFTLTEYESYSDFERLVIEKKTHMFNFTSGFKVDGVMDLGIKVESNEGKNYVTRT
FT                   KRFAHTQSKFLHARSVLEVAHYKLKSRSLMLHYEFLQRVKSLPLEYSYGEYRDLLRDFG
FT                   THFITEAVLGGIYEYTLIMNKDAMEQGDYTLSHVTACAGGSFGIGGMVYKVYVKVGVSA
FT                   KKCSDIMKEINERNKRSTMVEDLVVLVRGGTSEDITALAYKELPTPELMEAWGDAVKYN
FT                   PAIIKIKAEPLYELVTATDFAYSSTVKQNLKKALEEFQSEVSSCRCAPCRGNGVPVLKG
FT                   SRCECICPGGFQGTACEVTYRKDIPIDGKWSCWSDWSACSGGHKTRHRQCNNPAPHKGG
FT                   SPCSGPASETLNC"
FT   assembly_gap    42609819..42609838
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    42617400..42617778
FT                   /estimated_length=379
FT                   /gap_type="unknown"
FT   assembly_gap    42627621..42627879
FT                   /estimated_length=259
FT                   /gap_type="unknown"
FT   assembly_gap    42650049..42650450
FT                   /estimated_length=402
FT                   /gap_type="unknown"
FT   gene            complement(42657200..>42717171)
FT                   /gene="C8a"
FT                   /locus_tag="mCG_112892"
FT                   /note="gene_id=mCG112892.2"
FT   mRNA            complement(join(42657200..42657427,42659071..42659178,
FT                   42663498..42663729,42668185..42668342,42669471..42669596,
FT                   42687391..42687631,42694717..42694917,42697385..42697574,
FT                   42702268..42702415,42703571..42703715,42706429..42706522,
FT                   42717047..>42717171))
FT                   /gene="C8a"
FT                   /locus_tag="mCG_112892"
FT                   /product="complement component 8, alpha polypeptide,
FT                   transcript variant mCT192883"
FT                   /note="gene_id=mCG112892.2 transcript_id=mCT192883.0
FT                   created on 09-MAR-2004"
FT   mRNA            complement(join(42657204..42659178,42663498..42663729,
FT                   42668185..42668342,42669471..42669596,42687391..42687631,
FT                   42694717..42694917,42697385..42697574,42702268..42702415,
FT                   42703571..42703715,42706429..42706522,42717047..42717162))
FT                   /gene="C8a"
FT                   /locus_tag="mCG_112892"
FT                   /product="complement component 8, alpha polypeptide,
FT                   transcript variant mCT113963"
FT                   /note="gene_id=mCG112892.2 transcript_id=mCT113963.1
FT                   created on 22-NOV-2002"
FT   mRNA            complement(join(42657374..42659178,42663498..42663729,
FT                   42668185..42668342,42669471..42669596,42687391..42687631,
FT                   42694717..42694917,42697385..42697574,42702268..42702415,
FT                   42703571..42703715,42717047..>42717128))
FT                   /gene="C8a"
FT                   /locus_tag="mCG_112892"
FT                   /product="complement component 8, alpha polypeptide,
FT                   transcript variant mCT192882"
FT                   /note="gene_id=mCG112892.2 transcript_id=mCT192882.0
FT                   created on 09-MAR-2004"
FT   CDS             complement(join(42657405..42657427,42659071..42659178,
FT                   42663498..42663729,42668185..42668342,42669471..42669596,
FT                   42687391..42687631,42694717..42694917,42697385..42697574,
FT                   42702268..42702415,42703571..42703715,42706429..42706522,
FT                   42717047..>42717135))
FT                   /codon_start=1
FT                   /gene="C8a"
FT                   /locus_tag="mCG_112892"
FT                   /product="complement component 8, alpha polypeptide,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG112892.2 transcript_id=mCT192883.0
FT                   protein_id=mCP113830.0 isoform=CRA_c"
FT                   /protein_id="EDL30830.1"
FT                   /translation="LLDEMFVVAFFGLSLVAWHPGVTAQEKVNQRVTRAVTPQAVSCQL
FT                   SDWYKWTDCFPCQDKKYRYRSLLQPSKFGGTICSGDIWDEASCDSPTPCLRQAQCGQDF
FT                   QCRETGRCLKRHLVCNGDNDCLDGSDESDCEDVRVTEDDCHQYEPIPGSERAALGYNIL
FT                   TQEEAQSVYDAKYYGGQCETVYNGDWRKLRYDPTCERLYYGEDEKYFRKPYNFLKYHFE
FT                   ALADTSISSEFYDDANDLFFHIKNGKSHSAGVTVGVAPVKSPVSIEVTGSGSKASSFLN
FT                   KLNKYNEKRYGFMRVSTKIQTAQFKMRRNNIVLDEGMLQSLMELPEQFNYGMYAKFIND
FT                   YGTHYITSGTMGGIYEYVMVLDKEKMKTEGTTVDEVQKCIGGGIGIGIKDSTIEGVGIS
FT                   GEFCENSGDGDRDIRKKITGVEDIISRVQGGSSVWGSVLTHNSSAITYQSWGRSLKYNP
FT                   VVIDFEMQPIYQLLRHTNLGPLETKRQNLRRALDQYLMEFNACRCGPCFNNGEPILDGT
FT                   NCRCQCSMGRQGLACERTVIEGLKDFKAAGHWSCWSSWSECRGGSQERRRQCNNPPPKN
FT                   GDQHGGDF"
FT   CDS             complement(join(42659027..42659178,42663498..42663729,
FT                   42668185..42668342,42669471..42669596,42687391..42687631,
FT                   42694717..42694917,42697385..42697574,42702268..42702415,
FT                   42703571..42703715,42717047..>42717124))
FT                   /codon_start=1
FT                   /gene="C8a"
FT                   /locus_tag="mCG_112892"
FT                   /product="complement component 8, alpha polypeptide,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG112892.2 transcript_id=mCT192882.0
FT                   protein_id=mCP113829.0 isoform=CRA_b"
FT                   /protein_id="EDL30829.1"
FT                   /translation="DVCGCFLWLVFGGMAPWGNCTREGEPYRYRSLLQPSKFGGTICSG
FT                   DIWDEASCDSPTPCLRQAQCGQDFQCRETGRCLKRHLVCNGDNDCLDGSDESDCEDVRV
FT                   TEDDCHQYEPIPGSERAALGYNILTQEEAQSVYDAKYYGGQCETVYNGDWRKLRYDPTC
FT                   ERLYYGEDEKYFRKPYNFLKYHFEALADTSISSEFYDDANDLFFHIKNGKSHSAGVTVG
FT                   VAPVKSPVSIEVTGSGSKASSFLNKLNKYNEKRYGFMRVSTKIQTAQFKMRRNNIVLDE
FT                   GMLQSLMELPEQFNYGMYAKFINDYGTHYITSGTMGGIYEYVMVLDKEKMKTEGTTVDE
FT                   VQKCIGGGIGIGIKDSTIEGVGISGEFCENSGDGDRDIRKKITGVEDIISRVQGGSSVW
FT                   GSVLTHNSSAITYQSWGRSLKYNPVVIDFEMQPIYQLLRHTNLGPLETKRQNLRRALDQ
FT                   YLMEFNACRCGPCFNNGEPILDGTNCRCQCSMGRQGLACERTVIEGLKDFKAAGHWSCW
FT                   SSWSECRGGSQERRRQCNNPPPKNGGTPCLGRNLQTQAC"
FT   CDS             complement(join(42659027..42659178,42663498..42663729,
FT                   42668185..42668342,42669471..42669596,42687391..42687631,
FT                   42694717..42694917,42697385..42697574,42702268..42702415,
FT                   42703571..42703715,42706429..42706522,42717047..42717123))
FT                   /codon_start=1
FT                   /gene="C8a"
FT                   /locus_tag="mCG_112892"
FT                   /product="complement component 8, alpha polypeptide,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG112892.2 transcript_id=mCT113963.1
FT                   protein_id=mCP76488.1 isoform=CRA_a"
FT                   /protein_id="EDL30828.1"
FT                   /translation="MFVVAFFGLSLVAWHPGVTAQEKVNQRVTRAVTPQAVSCQLSDWY
FT                   KWTDCFPCQDKKYRYRSLLQPSKFGGTICSGDIWDEASCDSPTPCLRQAQCGQDFQCRE
FT                   TGRCLKRHLVCNGDNDCLDGSDESDCEDVRVTEDDCHQYEPIPGSERAALGYNILTQEE
FT                   AQSVYDAKYYGGQCETVYNGDWRKLRYDPTCERLYYGEDEKYFRKPYNFLKYHFEALAD
FT                   TSISSEFYDDANDLFFHIKNGKSHSAGVTVGVAPVKSPVSIEVTGSGSKASSFLNKLNK
FT                   YNEKRYGFMRVSTKIQTAQFKMRRNNIVLDEGMLQSLMELPEQFNYGMYAKFINDYGTH
FT                   YITSGTMGGIYEYVMVLDKEKMKTEGTTVDEVQKCIGGGIGIGIKDSTIEGVGISGEFC
FT                   ENSGDGDRDIRKKITGVEDIISRVQGGSSVWGSVLTHNSSAITYQSWGRSLKYNPVVID
FT                   FEMQPIYQLLRHTNLGPLETKRQNLRRALDQYLMEFNACRCGPCFNNGEPILDGTNCRC
FT                   QCSMGRQGLACERTVIEGLKDFKAAGHWSCWSSWSECRGGSQERRRQCNNPPPKNGGTP
FT                   CLGRNLQTQAC"
FT   assembly_gap    42671246..42671267
FT                   /estimated_length=22
FT                   /gap_type="unknown"
FT   assembly_gap    42692508..42694487
FT                   /estimated_length=1980
FT                   /gap_type="unknown"
FT   assembly_gap    42714944..42715196
FT                   /estimated_length=253
FT                   /gap_type="unknown"
FT   assembly_gap    42730858..42730996
FT                   /estimated_length=139
FT                   /gap_type="unknown"
FT   assembly_gap    42775325..42775344
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    42784431..42784532
FT                   /estimated_length=102
FT                   /gap_type="unknown"
FT   assembly_gap    42807186..42807254
FT                   /estimated_length=69
FT                   /gap_type="unknown"
FT   gene            42828730..>42854336
FT                   /locus_tag="mCG_2425"
FT                   /note="gene_id=mCG2425.2"
FT   mRNA            join(42828730..42828767,42829068..42829099,
FT                   42829882..42829984,42831116..42831275,42836614..42836728,
FT                   42836817..42836857,42840242..42840305,42841337..42841435,
FT                   42843038..42843069,42844789..42844861,42851367..42851453,
FT                   42854204..>42854336)
FT                   /locus_tag="mCG_2425"
FT                   /product="mCG2425"
FT                   /note="gene_id=mCG2425.2 transcript_id=mCT113966.1 created
FT                   on 18-DEC-2002"
FT   CDS             join(42829910..42829984,42831116..42831275,
FT                   42836614..42836728,42836817..42836857,42840242..42840305,
FT                   42841337..42841435,42843038..42843069,42844789..42844861,
FT                   42851367..42851453,42854204..42854336)
FT                   /codon_start=1
FT                   /locus_tag="mCG_2425"
FT                   /product="mCG2425"
FT                   /note="gene_id=mCG2425.2 transcript_id=mCT113966.1
FT                   protein_id=mCP76526.1"
FT                   /protein_id="EDL30827.1"
FT                   /translation="MEEKESWESEPLEPRKELHPSRPPKVVVYKETPGKTQMAGVHEDR
FT                   RSVPAGNQEAMTDIMQNRLFPEDVTLTRHSQDKSGYVEALEVTKETPSPSTIRSSSSSE
FT                   KTYDAVECSREDVRKWDFSSSFTSDSEENCEEMYEDIYKAKNDDPKTEVAGRTALRKLQ
FT                   QIFRKENVVFRMKKTKSKEIVSNGFSVSLPDLGPRSQDDSQDGIIYDDVDTREKESNDE
FT                   DKVKTWKTKFLIPKGKKWGKGSQGSKSFSPRHFFRTKKQKLEKNRMEKEEKLFRERFQV
FT                   RSLLKVTMNRK"
FT   assembly_gap    42867940..42867959
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(42874527..42950628)
FT                   /gene="Prkaa2"
FT                   /locus_tag="mCG_2430"
FT                   /note="gene_id=mCG2430.1"
FT   mRNA            complement(join(42874527..42877245,42877614..42877740,
FT                   42880573..42881077,42887943..42888167,42890186..42890273,
FT                   42892054..42892198,42892768..42892864,42950535..42950628))
FT                   /gene="Prkaa2"
FT                   /locus_tag="mCG_2430"
FT                   /product="protein kinase, AMP-activated, alpha 2 catalytic
FT                   subunit, transcript variant mCT1845"
FT                   /note="gene_id=mCG2430.1 transcript_id=mCT1845.2 created on
FT                   23-OCT-2002"
FT   mRNA            complement(join(42875920..42877245,42877614..42877740,
FT                   42880573..42881077,42887943..42888167,42890186..42890273,
FT                   42892054..42892198,42892768..42892861,42950535..>42950564))
FT                   /gene="Prkaa2"
FT                   /locus_tag="mCG_2430"
FT                   /product="protein kinase, AMP-activated, alpha 2 catalytic
FT                   subunit, transcript variant mCT192854"
FT                   /note="gene_id=mCG2430.1 transcript_id=mCT192854.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(42877007..42877245,42877614..42877740,
FT                   42880573..42881077,42887943..42888167,42890186..42890273,
FT                   42892054..42892198,42892768..42892861,42950535..>42950563))
FT                   /codon_start=1
FT                   /gene="Prkaa2"
FT                   /locus_tag="mCG_2430"
FT                   /product="protein kinase, AMP-activated, alpha 2 catalytic
FT                   subunit, isoform CRA_b"
FT                   /note="gene_id=mCG2430.1 transcript_id=mCT192854.0
FT                   protein_id=mCP113815.0 isoform=CRA_b"
FT                   /protein_id="EDL30826.1"
FT                   /translation="GRRHLRQSEDYQVISTPTDFFMVMEYVSGGELFDYICKHGRVEEV
FT                   EARRLFQQILSAVDYCHRHMVVHRDLKPENVLLDAQMNAKIADFGLSNMMSDGEFLRTS
FT                   CGSPNYAAPEVISGRLYAGPEVDIWSCGVILYALLCGTLPFDDEHVPTLFKKIRGGVFY
FT                   IPDYLNRSVATLLMHMLQVDPLKRATIKDIREHEWFKQDLPSYLFPEDPSYDANVIDDE
FT                   AVKEVCEKFECTESEVMNSLYSGDPQDQLAVAYHLIIDNRRIMNQASEFYLASSPPSGS
FT                   FMDDSAMHIPPGLKPHPERMPPLIADSPKARCPLDALNTTKPKSLAVKKAKWHLGIRSQ
FT                   SKACDIMAEVYRAMKQLGFEWKVVNAYHLRVRRKNPVTGNYVKMSLQLYLVDSRSYLLD
FT                   FKSIDDEVVEQRSGSSTPQRSCSAAGLHRARSSFDSSTAENHSLSGSLTGSLTGSTLSS
FT                   ASPRLGSHTMDFFEMCASLITALAR"
FT   CDS             complement(join(42877007..42877245,42877614..42877740,
FT                   42880573..42881077,42887943..42888167,42890186..42890273,
FT                   42892054..42892198,42892768..42892827))
FT                   /codon_start=1
FT                   /gene="Prkaa2"
FT                   /locus_tag="mCG_2430"
FT                   /product="protein kinase, AMP-activated, alpha 2 catalytic
FT                   subunit, isoform CRA_a"
FT                   /note="gene_id=mCG2430.1 transcript_id=mCT1845.2
FT                   protein_id=mCP22457.2 isoform=CRA_a"
FT                   /protein_id="EDL30825.1"
FT                   /translation="MVMEYVSGGELFDYICKHGRVEEVEARRLFQQILSAVDYCHRHMV
FT                   VHRDLKPENVLLDAQMNAKIADFGLSNMMSDGEFLRTSCGSPNYAAPEVISGRLYAGPE
FT                   VDIWSCGVILYALLCGTLPFDDEHVPTLFKKIRGGVFYIPDYLNRSVATLLMHMLQVDP
FT                   LKRATIKDIREHEWFKQDLPSYLFPEDPSYDANVIDDEAVKEVCEKFECTESEVMNSLY
FT                   SGDPQDQLAVAYHLIIDNRRIMNQASEFYLASSPPSGSFMDDSAMHIPPGLKPHPERMP
FT                   PLIADSPKARCPLDALNTTKPKSLAVKKAKWHLGIRSQSKACDIMAEVYRAMKQLGFEW
FT                   KVVNAYHLRVRRKNPVTGNYVKMSLQLYLVDSRSYLLDFKSIDDEVVEQRSGSSTPQRS
FT                   CSAAGLHRARSSFDSSTAENHSLSGSLTGSLTGSTLSSASPRLGSHTMDFFEMCASLIT
FT                   ALAR"
FT   assembly_gap    42879962..42879981
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    42906616..42908900
FT                   /estimated_length=2285
FT                   /gap_type="unknown"
FT   assembly_gap    42914719..42918361
FT                   /estimated_length=3643
FT                   /gap_type="unknown"
FT   assembly_gap    42923323..42923342
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    42943538..42943557
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    42987828..42988019
FT                   /estimated_length=192
FT                   /gap_type="unknown"
FT   gene            42998117..43073669
FT                   /gene="Ppap2b"
FT                   /locus_tag="mCG_2422"
FT                   /note="gene_id=mCG2422.1"
FT   mRNA            join(42998117..42998280,42998542..42998723,
FT                   43035568..43035725,43049472..43049752,43050148..43050205,
FT                   43060294..43060410,43071805..43073669)
FT                   /gene="Ppap2b"
FT                   /locus_tag="mCG_2422"
FT                   /product="phosphatidic acid phosphatase type 2B, transcript
FT                   variant mCT1856"
FT                   /note="gene_id=mCG2422.1 transcript_id=mCT1856.1 created on
FT                   24-FEB-2003"
FT   mRNA            join(42998139..42998723,43060234..43060410,
FT                   43071805..43072586)
FT                   /gene="Ppap2b"
FT                   /locus_tag="mCG_2422"
FT                   /product="phosphatidic acid phosphatase type 2B, transcript
FT                   variant mCT173092"
FT                   /note="gene_id=mCG2422.1 transcript_id=mCT173092.0 created
FT                   on 24-FEB-2003"
FT   mRNA            join(42998409..42998723,43035568..43035725,
FT                   43049472..43049752,43050148..43050205,43060234..43060410,
FT                   43071805..43072607)
FT                   /gene="Ppap2b"
FT                   /locus_tag="mCG_2422"
FT                   /product="phosphatidic acid phosphatase type 2B, transcript
FT                   variant mCT180754"
FT                   /note="gene_id=mCG2422.1 transcript_id=mCT180754.0 created
FT                   on 24-FEB-2003"
FT   CDS             join(42998585..42998723,43035568..43035725,
FT                   43049472..43049752,43050148..43050205,43060234..43060410,
FT                   43071805..43071930)
FT                   /codon_start=1
FT                   /gene="Ppap2b"
FT                   /locus_tag="mCG_2422"
FT                   /product="phosphatidic acid phosphatase type 2B, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG2422.1 transcript_id=mCT180754.0
FT                   protein_id=mCP103676.0 isoform=CRA_b"
FT                   /protein_id="EDL30823.1"
FT                   /translation="MQSYKYDKAIVPESKNGGSPALNNNPRKGGSKRVLLICLDLFCLF
FT                   MAALPFLIIETSTIKPYRRGFYCNDESIKYPLKVSETINDAVLCAVGIVIAILAIITGE
FT                   FYRIYYLKEKSRSTTQNPYVAALYKQVGCFLFGCAISQSFTDIAKVSIGRLRPHFLSVC
FT                   DPDFSQINCSEGYIQNYRCRGEDSKVQEARKSFFSGHASFSMFTMLYLVLYLQARFTWR
FT                   GARLLRPLLQFTLLMMAFYTGLSRVSDYKHHPSDVLAGFAQGALVACCIVFFVSDLFKT
FT                   KTSLSLPAPAIRREILSPVDIIDRNNHHNMV"
FT   CDS             join(42998585..42998723,43035568..43035725,
FT                   43049472..43049752,43050148..43050205,43060294..43060410,
FT                   43071805..43071930)
FT                   /codon_start=1
FT                   /gene="Ppap2b"
FT                   /locus_tag="mCG_2422"
FT                   /product="phosphatidic acid phosphatase type 2B, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG2422.1 transcript_id=mCT1856.1
FT                   protein_id=mCP22352.1 isoform=CRA_c"
FT                   /protein_id="EDL30824.1"
FT                   /translation="MQSYKYDKAIVPESKNGGSPALNNNPRKGGSKRVLLICLDLFCLF
FT                   MAALPFLIIETSTIKPYRRGFYCNDESIKYPLKVSETINDAVLCAVGIVIAILAIITGE
FT                   FYRIYYLKEKSRSTTQNPYVAALYKQVGCFLFGCAISQSFTDIAKVSIGRLRPHFLSVC
FT                   DPDFSQINCSEGYIQNYRCRGEDSKVQEARKSFFSGHASFSMFTMLYLVFTLLMMAFYT
FT                   GLSRVSDYKHHPSDVLAGFAQGALVACCIVFFVSDLFKTKTSLSLPAPAIRREILSPVD
FT                   IIDRNNHHNMV"
FT   CDS             join(42998585..42998723,43060234..43060343)
FT                   /codon_start=1
FT                   /gene="Ppap2b"
FT                   /locus_tag="mCG_2422"
FT                   /product="phosphatidic acid phosphatase type 2B, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG2422.1 transcript_id=mCT173092.0
FT                   protein_id=mCP96011.0 isoform=CRA_a"
FT                   /protein_id="EDL30822.1"
FT                   /translation="MQSYKYDKAIVPESKNGGSPALNNNPRKGGSKRVLLICLDLFCLF
FT                   MALPSGPLHLARGPTAPPPPAVHFAHDGLLHGIVTGI"
FT   assembly_gap    43019696..43019715
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    43044134..43045213
FT                   /estimated_length=1080
FT                   /gap_type="unknown"
FT   assembly_gap    43059590..43059609
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    43088192..43088499
FT                   /estimated_length=308
FT                   /gap_type="unknown"
FT   assembly_gap    43094275..43094752
FT                   /estimated_length=478
FT                   /gap_type="unknown"
FT   assembly_gap    43097163..43097182
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    43098362..43098412
FT                   /estimated_length=51
FT                   /gap_type="unknown"
FT   assembly_gap    43106182..43106396
FT                   /estimated_length=215
FT                   /gap_type="unknown"
FT   assembly_gap    43107081..43107191
FT                   /estimated_length=111
FT                   /gap_type="unknown"
FT   assembly_gap    43110906..43110925
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    43129792..43134312
FT                   /estimated_length=4521
FT                   /gap_type="unknown"
FT   assembly_gap    43137798..43137817
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    43139333..43139640
FT                   /estimated_length=308
FT                   /gap_type="unknown"
FT   assembly_gap    43145525..43145628
FT                   /estimated_length=104
FT                   /gap_type="unknown"
FT   assembly_gap    43149207..43149226
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    43170471..43170544
FT                   /estimated_length=74
FT                   /gap_type="unknown"
FT   assembly_gap    43171666..43172024
FT                   /estimated_length=359
FT                   /gap_type="unknown"
FT   assembly_gap    43185752..43185964
FT                   /estimated_length=213
FT                   /gap_type="unknown"
FT   assembly_gap    43190992..43191218
FT                   /estimated_length=227
FT                   /gap_type="unknown"
FT   gene            complement(<43209250..43209742)
FT                   /locus_tag="mCG_2428"
FT                   /note="gene_id=mCG2428.2"
FT   mRNA            complement(<43209250..43209742)
FT                   /locus_tag="mCG_2428"
FT                   /product="mCG2428"
FT                   /note="gene_id=mCG2428.2 transcript_id=mCT1851.2 created on
FT                   22-NOV-2002"
FT   CDS             complement(43209250..43209720)
FT                   /codon_start=1
FT                   /locus_tag="mCG_2428"
FT                   /product="mCG2428"
FT                   /note="gene_id=mCG2428.2 transcript_id=mCT1851.2
FT                   protein_id=mCP22454.2"
FT                   /protein_id="EDL30821.1"
FT                   /translation="MSKNSKLLSTSTKRIQKQRAGITLDPLPNCSVGPKGDNIYEWRST
FT                   ILGPPGSVCEGGGFFLDITFTPEYPFKPPKVTFRTRMYHCNINIQGVICLDILKDNWSP
FT                   ALTISKVLLSICSLFTDCNPADPLVGSIATQYMTNRAEHDRMARQRTQRYAT"
FT   assembly_gap    43238294..43238516
FT                   /estimated_length=223
FT                   /gap_type="unknown"
FT   assembly_gap    43275499..43277651
FT                   /estimated_length=2153
FT                   /gap_type="unknown"
FT   assembly_gap    43283348..43283367
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    43346895..43346914
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    43352802..43352821
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    43366752..43366915
FT                   /estimated_length=164
FT                   /gap_type="unknown"
FT   gene            43413377..43414080
FT                   /pseudo
FT                   /locus_tag="mCG_146382"
FT                   /note="gene_id=mCG146382.0"
FT   mRNA            43413377..43414080
FT                   /pseudo
FT                   /locus_tag="mCG_146382"
FT                   /note="gene_id=mCG146382.0 transcript_id=mCT18658