spacer

EBI Dbfetch

ID   CH466526; SV 2; linear; genomic DNA; CON; MUS; 53230554 BP.
XX
AC   CH466526;
XX
PR   Project:PRJNA11785;
XX
DT   04-AUG-2005 (Rel. 84, Created)
DT   10-JUN-2007 (Rel. 92, Last updated, Version 8)
XX
DE   Mus musculus 232000009830310 genomic scaffold, whole genome shotgun
DE   sequence.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-53230554
RX   DOI; 10.1126/science.1069193.
RX   PUBMED; 12040188.
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Miklos G.L., Wides R.,
RA   Halpern A., Li P.W., Sutton G.G., Nadeau J., Salzberg S.L., Holt R.A.,
RA   Kodira C.D., Lu F., Chen L., Deng Z., Evangelista C.C., Gan W.,
RA   Heiman T.J., Li J., Li Z., Merkulov G.V., Milshina N.V., Naik A.K., Qi R.,
RA   Shue B.C., Wang A., Wang J., Wang X., Yan X., Ye J., Yooseph S., Zhao Q.,
RA   Zheng L., Zhu S.C., Biddick K., Bolanos R., Delcher A.L., Dew I.M.,
RA   Fasulo D., Flanigan M.J., Huson D.H., Kravitz S.A., Miller J.R.,
RA   Mobarry C.M., Reinert K., Remington K.A., Zhang Q., Zheng X.H.,
RA   Nusskern D.R., Lai Z., Lei Y., Zhong W., Yao A., Guan P., Ji R.R., Gu Z.,
RA   Wang Z.Y., Zhong F., Xiao C., Chiang C.C., Yandell M., Wortman J.R.,
RA   Amanatides P.G., Hladun S.L., Pratts E.C., Johnson J.E., Dodson K.L.,
RA   Woodford K.J., Evans C.A., Gropman B., Rusch D.B., Venter E., Wang M.,
RA   Smith T.J., Houck J.T., Tompkins D.E., Haynes C., Jacob D., Chin S.H.,
RA   Allen D.R., Dahlke C.E., Sanders R., Li K., Liu X., Levitsky A.A.,
RA   Majoros W.H., Chen Q., Xia A.C., Lopez J.R., Donnelly M.T., Newman M.H.,
RA   Glodek A., Kraft C.L., Nodell M., Ali F., An H.J., Baldwin-Pitts D.,
RA   Beeson K.Y., Cai S., Carnes M., Carver A., Caulk P.M., Center A.,
RA   Chen Y.H., Cheng M.L., Coyne M.D., Crowder M., Danaher S., Davenport L.B.,
RA   Desilets R., Dietz S.M., Doup L., Dullaghan P., Ferriera S., Fosler C.R.,
RA   Gire H.C., Gluecksmann A., Gocayne J.D., Gray J., Hart B., Haynes J.,
RA   Hoover J., Howland T., Ibegwam C., Jalali M., Johns D., Kline L., Ma D.S.,
RA   MacCawley S., Magoon A., Mann F., May D., McIntosh T.C., Mehta S., Moy L.,
RA   Moy M.C., Murphy B.J., Murphy S.D., Nelson K.A., Nuri Z., Parker K.A.,
RA   Prudhomme A.C., Puri V.N., Qureshi H., Raley J.C., Reardon M.S.,
RA   Regier M.A., Rogers Y.H., Romblad D.L., Schutz J., Scott J.L., Scott R.,
RA   Sitter C.D., Smallwood M., Sprague A.C., Stewart E., Strong R.V., Suh E.,
RA   Sylvester K., Thomas R., Tint N.N., Tsonis C., Wang G., Wang G.,
RA   Williams M.S., Williams S.M., Windsor S.M., Wolfe K., Wu M.M., Zaveri J.,
RA   Chaturvedi K., Gabrielian A.E., Ke Z., Sun J., Subramanian G., Venter J.C.,
RA   Pfannkoch C.M., Barnstead M., Stephenson L.D.;
RT   "A comparison of whole-genome shotgun-derived mouse chromosome 16 and the
RT   human genome";
RL   Science 296(5573):1661-1671(2002).
XX
RN   [2]
RP   1-53230554
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (05-JUL-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
RN   [3]
RP   1-53230554
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (02-SEP-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
DR   MD5; a34d4e3ea5bbc2ab4f6709a7cce32130.
DR   ENA; AAHY010000000; SET.
DR   ENA; AAHY000000000; SET.
DR   ENA-CON; CM000220.
DR   Ensembl-Gn; ENSMUSG00000001627; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020545; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020561; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020644; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020990; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020992; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000021023; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000021054; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000021061; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000021065; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000021087; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000021099; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000034435; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000035431; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000043398; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000044067; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000044573; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000044712; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000047022; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000047446; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000048982; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000054204; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000056459; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000058669; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000059970; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000062198; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000071342; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000079076; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000091396; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000092305; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000001672; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020853; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020877; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020974; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000021377; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000021378; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000021406; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000021411; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000021450; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000021458; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000021519; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000042975; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000044299; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000050649; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000051079; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000057783; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000062740; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000062804; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000067087; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000072631; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000074038; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000078505; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000080449; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000095760; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110560; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110671; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000123498; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000130447; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000134550; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000136441; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000140523; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000144910; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000167011; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000171770; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000172433; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000176102; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000176278; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000177595; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000184766; mus_musculus.
XX
CC   On Sep 6, 2005 this sequence version replaced gi:70980454.
CC   This is the July 2001 combined whole genome shotgun assembly of Mus
CC   musculus. It contains 27 million Celera reads on four Mus musculus
CC   strains (129X1/SvJ, 129S1/SvImJ, DBA/2J and A/J), 13 million reads
CC   on C57BL/6J from the NCBI Trace Archive, 0.4 million BAC end
CC   sequences from TIGR, and unfinished and finished BACs pulled from
CC   NCBI (Nature 2002. 420:520-562). The assembly process relied on
CC   Celera's paired reads and BAC end reads for long range order and
CC   orientation. Its scaffolds were mapped to chromosomes using STS
CC   maps. For more detailed information about whole genome sequencing
CC   and Celera's assembly process, please refer to Venter, J.C. et al.
CC   Science 2001. 291:1304-1351.
CC   This version of genes, transcripts, and proteins was
CC   computationally created in November 2001 from the whole-genome
CC   mapping of transcript and protein sequences on the Celera mouse
CC   genome assembly by Celera Chromosome Team and Content Systems.  The
CC   data sets used by this annotation process were collected in 2001
CC   and include RefSeq (NM_ from mouse and human) sequences, GenBank
CC   mRNA and dbEST sequences, mammalian SwissProt sequences,  and NRAA
CC   sequences (all mouse unless noted otherwise).  The initial gene set
CC   was manually curated between 2002 and 2003. Subsequently, automated
CC   annotation updates were performed.  The CDS of each transcript was
CC   manually or computationally defined by either the longest
CC   ATG-to-Stop or the longest open reading frame. All CDSs
CC   corresponding to the longest open reading frames with no starting
CC   ATG were flagged as partial.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..53230554
FT                   /organism="Mus musculus"
FT                   /chromosome="12"
FT                   /strain="mixed"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   gene            complement(<6327..6727)
FT                   /locus_tag="mCG_1041697"
FT                   /note="gene_id=mCG1041697.1"
FT   mRNA            complement(<6327..6727)
FT                   /locus_tag="mCG_1041697"
FT                   /product="mCG1041697"
FT                   /note="gene_id=mCG1041697.1 transcript_id=mCT159401.1
FT                   created on 18-SEP-2002"
FT   CDS             complement(<6327..6457)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041697"
FT                   /product="mCG1041697"
FT                   /note="gene_id=mCG1041697.1 transcript_id=mCT159401.1
FT                   protein_id=mCP78816.1"
FT                   /protein_id="EDL37002.1"
FT                   /translation="MPDQISVSELVAKTLEDYKAPTASSFTTRTAQCRDTVAAIEEV"
FT   gene            complement(32095..33894)
FT                   /pseudo
FT                   /locus_tag="mCG_126897"
FT                   /note="gene_id=mCG126897.0"
FT   mRNA            complement(join(32095..33802,33863..33894))
FT                   /pseudo
FT                   /locus_tag="mCG_126897"
FT                   /note="gene_id=mCG126897.0 transcript_id=mCT128174.0
FT                   created on 10-SEP-2002"
FT   gene            70465..73749
FT                   /locus_tag="mCG_1041985"
FT                   /note="gene_id=mCG1041985.1"
FT   mRNA            join(70465..70664,72226..73749)
FT                   /locus_tag="mCG_1041985"
FT                   /product="mCG1041985"
FT                   /note="gene_id=mCG1041985.1 transcript_id=mCT159689.1
FT                   created on 18-SEP-2002"
FT   CDS             72385..72633
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041985"
FT                   /product="mCG1041985"
FT                   /note="gene_id=mCG1041985.1 transcript_id=mCT159689.1
FT                   protein_id=mCP79105.1"
FT                   /protein_id="EDL37001.1"
FT                   /translation="MSTFPLPMPVMHSAQVSSLSLFKEKRDFRISIIVDLVATAAIAAS
FT                   ITASALALSATVQTTQTINDLSARVTSALDRQAMANS"
FT   gene            complement(137897..>140025)
FT                   /locus_tag="mCG_18894"
FT                   /note="gene_id=mCG18894.1"
FT   mRNA            complement(join(137897..137952,138129..138394,
FT                   138556..>140025))
FT                   /locus_tag="mCG_18894"
FT                   /product="mCG18894"
FT                   /note="gene_id=mCG18894.1 transcript_id=mCT16269.1 created
FT                   on 10-SEP-2002"
FT   CDS             complement(139400..>139999)
FT                   /codon_start=1
FT                   /locus_tag="mCG_18894"
FT                   /product="mCG18894"
FT                   /note="gene_id=mCG18894.1 transcript_id=mCT16269.1
FT                   protein_id=mCP12115.1"
FT                   /protein_id="EDL37000.1"
FT                   /translation="RRGTAEGQAPVASRSGMPKNTVSSARFRKVDVDEYEENKFVDEED
FT                   GGDGQAGPDEGEVDSCLPQGNMTAALKSPPPPTINTKSQAVKDRAGSYVLKVLISFKAN
FT                   DIEKAVQSLDKNGVDLLMKCIYKGSESPSDNSSDVLLQWHEKALAEGGVGSIVRVLTAR
FT                   KTVQSSWNWTPLDTVHRSGSCWYKDQNNQMAPLPCG"
FT   gene            144663..>205555
FT                   /gene="Taf1b"
FT                   /locus_tag="mCG_126896"
FT                   /note="gene_id=mCG126896.1"
FT   mRNA            join(144663..144942,146716..146814,151665..151763,
FT                   152036..152131,157399..157549,159420..159570,
FT                   165636..165735,191432..191579,194166..194343,
FT                   194723..194769,196576..196666,203170..203240,
FT                   203699..203921,205354..>205555)
FT                   /gene="Taf1b"
FT                   /locus_tag="mCG_126896"
FT                   /product="TATA box binding protein (Tbp)-associated factor,
FT                   RNA polymerase I, B, transcript variant mCT128171"
FT                   /note="gene_id=mCG126896.1 transcript_id=mCT128171.1
FT                   created on 03-SEP-2002"
FT   CDS             join(144925..144942,146716..146814,151665..151763,
FT                   152036..152131,157399..157549,159420..159570,
FT                   165636..165735,191432..191579,194166..194343,
FT                   194723..194769,196576..196666,203170..203240,
FT                   203699..203921,205354..205555)
FT                   /codon_start=1
FT                   /gene="Taf1b"
FT                   /locus_tag="mCG_126896"
FT                   /product="TATA box binding protein (Tbp)-associated factor,
FT                   RNA polymerase I, B, isoform CRA_a"
FT                   /note="gene_id=mCG126896.1 transcript_id=mCT128171.1
FT                   protein_id=mCP78686.0 isoform=CRA_a"
FT                   /protein_id="EDL36998.1"
FT                   /translation="MNVEEVKAFRDRCSQCAAVSWGLTDEGKYYCTSCHNVTDEKGWDW
FT                   YVCEGFQCILYHQAKALETLGVSPELKNEVLHNFWKRYLQKSKQAYCKNPVRTSGRKAK
FT                   VLEDSVQSSDLGSDLELLSDTTCPLESEAEFQSDPQIPKPFPVTKGSPKSASVCSGSVD
FT                   GVEYSERKEKGLVKMTVPRTLALCSLSLLWQRETITVSDLLRFVEEDHIPYINAFKLFP
FT                   EEMKVYGRDKGIFAIESWPDYEDIYKNMIELAIFLDLPRFPDITEDCYLHPNTLCMKYL
FT                   LEVNLPDEMHTLTCQVVKLTGIGEVDFLTFDPIAKTKRTVKYDVQAMAVIVVVLKLLFL
FT                   LDDKLEWSYSDLAEAYNEQHREDTPQFDFRKWYQVMKKTFDEKRRKWEEARARYAWKTK
FT                   RPLYRSHIDKSVAYKRRKMVENLQKQFSALVGSSPVVEKQAPSSFQFNWTEEGTDSPCF
FT                   HGHSLQGLLIMKGQSMITKNSLYWLSTQKFCKSYCKHVTTYEESNFSLSYQFILNIFSF
FT                   LLRIKTSALHEEVSLLEKKLFEKKYNESKKSSGSKKGRRH"
FT   mRNA            join(<145103..145338,146716..146814,151665..151763,
FT                   152036..152131,157399..157549,159420..159570,
FT                   165636..165735,191432..191579,194166..194343,
FT                   194723..194769,196576..196666,203170..203240,
FT                   203699..203921,205354..>205555)
FT                   /gene="Taf1b"
FT                   /locus_tag="mCG_126896"
FT                   /product="TATA box binding protein (Tbp)-associated factor,
FT                   RNA polymerase I, B, transcript variant mCT172852"
FT                   /note="gene_id=mCG126896.1 transcript_id=mCT172852.0
FT                   created on 03-SEP-2002"
FT   CDS             join(<145264..145338,146716..146814,151665..151763,
FT                   152036..152131,157399..157549,159420..159570,
FT                   165636..165735,191432..191579,194166..194343,
FT                   194723..194769,196576..196666,203170..203240,
FT                   203699..203921,205354..205555)
FT                   /codon_start=1
FT                   /gene="Taf1b"
FT                   /locus_tag="mCG_126896"
FT                   /product="TATA box binding protein (Tbp)-associated factor,
FT                   RNA polymerase I, B, isoform CRA_b"
FT                   /note="gene_id=mCG126896.1 transcript_id=mCT172852.0
FT                   protein_id=mCP95771.0 isoform=CRA_b"
FT                   /protein_id="EDL36999.1"
FT                   /translation="CWLRVRKSRTWNLGCLQVIPVSLSRKAFRDRCSQCAAVSWGLTDE
FT                   GKYYCTSCHNVTDEKGWDWYVCEGFQCILYHQAKALETLGVSPELKNEVLHNFWKRYLQ
FT                   KSKQAYCKNPVRTSGRKAKVLEDSVQSSDLGSDLELLSDTTCPLESEAEFQSDPQIPKP
FT                   FPVTKGSPKSASVCSGSVDGVEYSERKEKGLVKMTVPRTLALCSLSLLWQRETITVSDL
FT                   LRFVEEDHIPYINAFKLFPEEMKVYGRDKGIFAIESWPDYEDIYKNMIELAIFLDLPRF
FT                   PDITEDCYLHPNTLCMKYLLEVNLPDEMHTLTCQVVKLTGIGEVDFLTFDPIAKTKRTV
FT                   KYDVQAMAVIVVVLKLLFLLDDKLEWSYSDLAEAYNEQHREDTPQFDFRKWYQVMKKTF
FT                   DEKRRKWEEARARYAWKTKRPLYRSHIDKSVAYKRRKMVENLQKQFSALVGSSPVVEKQ
FT                   APSSFQFNWTEEGTDSPCFHGHSLQGLLIMKGQSMITKNSLYWLSTQKFCKSYCKHVTT
FT                   YEESNFSLSYQFILNIFSFLLRIKTSALHEEVSLLEKKLFEKKYNESKKSSGSKKGRRH
FT                   "
FT   gene            <219323..>229937
FT                   /locus_tag="mCG_18897"
FT                   /note="gene_id=mCG18897.1"
FT   mRNA            join(<219323..219484,222869..223055,224985..225055,
FT                   228317..228707,229857..>229937)
FT                   /locus_tag="mCG_18897"
FT                   /product="mCG18897"
FT                   /note="gene_id=mCG18897.1 transcript_id=mCT16273.1 created
FT                   on 10-SEP-2002"
FT   CDS             join(<219324..219484,222869..223055,224985..225055,
FT                   228317..228707,229857..229937)
FT                   /codon_start=1
FT                   /locus_tag="mCG_18897"
FT                   /product="mCG18897"
FT                   /note="gene_id=mCG18897.1 transcript_id=mCT16273.1
FT                   protein_id=mCP12105.1"
FT                   /protein_id="EDL36997.1"
FT                   /translation="NPTRRGRRSGPTACRRAPPAAASSPRIGCTVPTRKSSSAARQRRA
FT                   SAMTQEYDNKRPVLVLQNEALYPQRRSYTSEDEAWKSFLENPLTAATKAMMSINGDEDS
FT                   AAALGLLYDYYKVPRERRSSAVKPEGEHPEPEHSKRNSIPNVTEQPLISAGENRVQVLK
FT                   NVPFNIVLPHSNQLGIDKRGHLTAPDTTVTVSIATMPTHSIKTEIQPHGFAVGIPPAVY
FT                   HSEPTERVVVFDRSLSTDQFSSGTQPPNAQRRTPDSTFSETFKEGVQEVFFPSELSLRM
FT                   PGMNSEDYVFDNVSG"
FT   gene            <231282..264398
FT                   /locus_tag="mCG_127794"
FT                   /note="gene_id=mCG127794.0"
FT   mRNA            join(<231282..231442,231796..231907,233017..233111,
FT                   249952..250110,255076..255166,255480..255619,
FT                   256756..256793,258875..258966,259207..259292,
FT                   261461..261525,262834..264398)
FT                   /locus_tag="mCG_127794"
FT                   /product="mCG127794, transcript variant mCT129086"
FT                   /note="gene_id=mCG127794.0 transcript_id=mCT129086.0
FT                   created on 10-SEP-2002"
FT   CDS             join(<231284..231442,231796..231907,233017..233111,
FT                   249952..250110,255076..255166,255480..255619,
FT                   256756..256793,258875..258966,259207..259292,
FT                   261461..261525,262834..262948)
FT                   /codon_start=1
FT                   /locus_tag="mCG_127794"
FT                   /product="mCG127794, isoform CRA_a"
FT                   /note="gene_id=mCG127794.0 transcript_id=mCT129086.0
FT                   protein_id=mCP78427.0 isoform=CRA_a"
FT                   /protein_id="EDL36995.1"
FT                   /translation="RNNFEYTLEASKSLRQKQGDSTMTYLNKGQFYPVTLKEGSSNEGI
FT                   HHPISKVRSVIMVVFAEDKSREDQLRHWKYWHSRQHTAKQRCIDIADYKESFNTISNIE
FT                   EIAYNAISFTWDINDEAKVFISVNCLSTDFSSQKGVKGLPLNIQIDTYSYNNRSNKPVH
FT                   RAYCQIKVFCDKGAERKIRDEERKQSKRKGKCADPSSQGMPNVSDVKVQLLPSHKRTDI
FT                   TVFKPFLDLDTQPVLFIPDVHFTNLQRGSHVLSLPSEELEGEGSVLKRGPFGTEDDFGV
FT                   PPPAKLTRTEEPKRVLLYVRKESEEVFDALMLKTPSLKGLMEAISDKYDVPHDKIGKIF
FT                   KKCKKGILVNMDDNIVKHYSNEDTFQLQIEEAGGSYKLTLTEI"
FT   mRNA            join(<233072..233111,249952..250110,255076..255127,
FT                   255480..255619,256756..256793,258875..258966,
FT                   259207..259292,261461..>261507)
FT                   /locus_tag="mCG_127794"
FT                   /product="mCG127794, transcript variant mCT193503"
FT                   /note="gene_id=mCG127794.0 transcript_id=mCT193503.0
FT                   created on 09-MAR-2004"
FT   CDS             join(<233073..233111,249952..250110,255076..255127,
FT                   255480..255619,256756..256793,258875..258966,
FT                   259207..259292,261461..>261507)
FT                   /codon_start=1
FT                   /locus_tag="mCG_127794"
FT                   /product="mCG127794, isoform CRA_b"
FT                   /note="gene_id=mCG127794.0 transcript_id=mCT193503.0
FT                   protein_id=mCP114450.0 isoform=CRA_b"
FT                   /protein_id="EDL36996.1"
FT                   /translation="AISFTWDINDEAKVFISVNCLSTDFSSQKGVKGLPLNIQIDTYSY
FT                   NNRSNKPVHRAYCQIKVFCDKGAERKIRDEERKQSKRKVSDVKVQLLPSHKRTDITVFK
FT                   PFLDLDTQPVLFIPDVHFTNLQRGSHVLSLPSEELEGEGSVLKRGPFGTEDDFGVPPPA
FT                   KLTRTEEPKRVLLYVRKESEEVFDALMLKTPSLKGLMEAISDKYDVPHDKIGKI"
FT   gene            complement(264870..265562)
FT                   /locus_tag="mCG_1041984"
FT                   /note="gene_id=mCG1041984.0"
FT   mRNA            complement(join(264870..265366,265380..265562))
FT                   /locus_tag="mCG_1041984"
FT                   /product="mCG1041984"
FT                   /note="gene_id=mCG1041984.0 transcript_id=mCT159688.0
FT                   created on 18-SEP-2002"
FT   CDS             complement(265094..265306)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041984"
FT                   /product="mCG1041984"
FT                   /note="gene_id=mCG1041984.0 transcript_id=mCT159688.0
FT                   protein_id=mCP79095.1"
FT                   /protein_id="EDL36994.1"
FT                   /translation="MRMPPTWDDSHTVLSWSTWNRRNEEHRIPFQHFQDPASCSYAETH
FT                   SALLFDALPTGVSYSLKPPFPERFS"
FT   gene            <297236..308779
FT                   /gene="Tieg3"
FT                   /locus_tag="mCG_18898"
FT                   /note="gene_id=mCG18898.2"
FT   mRNA            join(<297236..297530,299520..299771,300801..301734,
FT                   306186..308679)
FT                   /gene="Tieg3"
FT                   /locus_tag="mCG_18898"
FT                   /product="TGFB inducible early growth response 3,
FT                   transcript variant mCT193514"
FT                   /note="gene_id=mCG18898.2 transcript_id=mCT193514.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<297237..297530,299520..299771,300801..301734,
FT                   306186..306466)
FT                   /codon_start=1
FT                   /gene="Tieg3"
FT                   /locus_tag="mCG_18898"
FT                   /product="TGFB inducible early growth response 3, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG18898.2 transcript_id=mCT193514.0
FT                   protein_id=mCP114460.0 isoform=CRA_a"
FT                   /protein_id="EDL36992.1"
FT                   /translation="RPCPQQGAVYFGLPARPAQGRSLRGAPPLPRLPGRAEAEPRGKEG
FT                   GGARREQTLGTPPPAAHVQPPPHAGLLPRSIAACRPYGTMHSPGSTGPGDGRAADIMDI
FT                   CESILERKRHDSERSTCSVLEQTDIEAVEALVCMSSWGQRSQMRPLTPVSDSGDVTTAV
FT                   LMDTAAPDLPKDFHSFSTLCITPPQSPELTEPSTGTPVPSQVVNSKGCMVTALPPSPAG
FT                   GPRTLSKREPLEPASGSSCRAVMTSVIRHTGESPAPTRFPTGPTQEQRASDSGEGQERL
FT                   LDHLEALQDTRLANGLLVTNLVSCQPCLHKSGGSFPTDKGQQTGWPAAVQTCLPKNPES
FT                   DLSRKTAPLISVPVSSPPVLCQMIPVAGQNGLFSAFLKPPTQLPAGTIKPILPQAASMS
FT                   QPVFMGPPVPQGTVMLVLPQNTFPQPAACPSSVMAIGNTKLLPLAPAPVFLASSQNCVP
FT                   QVDFSRRRNYVCNFPGCRKTYFKSSHLKAHLRTHTGEKPFTCSWDGCDKKFARSDELSR
FT                   HRRTHTGEKKFVCPVCDRRFMRSDHLTKHARRHMTTKKIPGWQAEVGKLNRITLAESPG
FT                   SILEPLPASG"
FT   mRNA            join(<297489..297530,299520..299771,300819..301734,
FT                   306186..308779)
FT                   /gene="Tieg3"
FT                   /locus_tag="mCG_18898"
FT                   /product="TGFB inducible early growth response 3,
FT                   transcript variant mCT16271"
FT                   /note="gene_id=mCG18898.2 transcript_id=mCT16271.1 created
FT                   on 10-SEP-2002"
FT   CDS             join(297489..297530,299520..299771,300819..301734,
FT                   306186..306466)
FT                   /codon_start=1
FT                   /gene="Tieg3"
FT                   /locus_tag="mCG_18898"
FT                   /product="TGFB inducible early growth response 3, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG18898.2 transcript_id=mCT16271.1
FT                   protein_id=mCP12110.1 isoform=CRA_b"
FT                   /protein_id="EDL36993.1"
FT                   /translation="MHSPGSTGPGDGRAADIMDICESILERKRHDSERSTCSVLEQTDI
FT                   EAVEALVCMSSWGQRSQMRPLTPVSDSGDVTTAVLMDTAAPDLPKDFHSFSTLSPELTE
FT                   PSTGTPVPSQVVNSKGCMVTALPPSPAGGPRTLSKREPLEPASGSSCRAVMTSVIRHTG
FT                   ESPAPTRFPTGPTQEQRASDSGEGQERLLDHLEALQDTRLANGLLVTNLVSCQPCLHKS
FT                   GGSFPTDKGQQTGWPAAVQTCLPKNPESDLSRKTAPLISVPVSSPPVLCQMIPVAGQNG
FT                   LFSAFLKPPTQLPAGTIKPILPQAASMSQPVFMGPPVPQGTVMLVLPQNTFPQPAACPS
FT                   SVMAIGNTKLLPLAPAPVFLASSQNCVPQVDFSRRRNYVCNFPGCRKTYFKSSHLKAHL
FT                   RTHTGEKPFTCSWDGCDKKFARSDELSRHRRTHTGEKKFVCPVCDRRFMRSDHLTKHAR
FT                   RHMTTKKIPGWQAEVGKLNRITLAESPGSILEPLPASG"
FT   gene            complement(311865..>327241)
FT                   /gene="Cys1"
FT                   /locus_tag="mCG_18901"
FT                   /note="gene_id=mCG18901.1"
FT   mRNA            complement(join(311865..312279,312786..312846,
FT                   313109..313251,315695..315747,326074..>327241))
FT                   /gene="Cys1"
FT                   /locus_tag="mCG_18901"
FT                   /product="cystin 1"
FT                   /note="gene_id=mCG18901.1 transcript_id=mCT16276.1 created
FT                   on 03-SEP-2002"
FT   CDS             complement(join(313146..313251,315695..315747,
FT                   326074..>326502))
FT                   /codon_start=1
FT                   /gene="Cys1"
FT                   /locus_tag="mCG_18901"
FT                   /product="cystin 1"
FT                   /note="gene_id=mCG18901.1 transcript_id=mCT16276.1
FT                   protein_id=mCP12119.0"
FT                   /protein_id="EDL36991.1"
FT                   /translation="LSSLPISPSHPPPLTPPESPLLFPRPIWPAALPPQSRPAPRLRAP
FT                   GWVRAMGSGSSRSGRIPRRRRSPDRRQTGPGETASEGGTADQAPTAAGQEESGRDPRPA
FT                   TPSGGREETLRLLDQLLAESEAWGPQELTPRGPARLAPAVSPEKKVKGNPEDSCASEAP
FT                   GNSPKRPEGQSAISYDYSEEELMASIEREYCR"
FT   gene            <349044..355234
FT                   /gene="Rrm2"
FT                   /locus_tag="mCG_18902"
FT                   /note="gene_id=mCG18902.2"
FT   mRNA            join(<349044..349557,349672..349746,350051..350197,
FT                   350437..350553,351471..351604,352569..352663,
FT                   352791..352924,353783..353887,353983..354096,
FT                   354206..355234)
FT                   /gene="Rrm2"
FT                   /locus_tag="mCG_18902"
FT                   /product="ribonucleotide reductase M2"
FT                   /note="gene_id=mCG18902.2 transcript_id=mCT16277.2 created
FT                   on 03-SEP-2002"
FT   CDS             join(<349396..349557,349672..349746,350051..350197,
FT                   350437..350553,351471..351604,352569..352663,
FT                   352791..352924,353783..353887,353983..354096,
FT                   354206..354358)
FT                   /codon_start=1
FT                   /gene="Rrm2"
FT                   /locus_tag="mCG_18902"
FT                   /product="ribonucleotide reductase M2"
FT                   /note="gene_id=mCG18902.2 transcript_id=mCT16277.2
FT                   protein_id=mCP12107.0"
FT                   /protein_id="EDL36990.1"
FT                   /translation="VHRIPAVFACSSPSPPLPSFAMLSVRTPLATIADQQQLQLSPLKR
FT                   LTLADKENTPPTLSSTRVLASKAARRIFQDSAELESKAPTNPSVEDEPLLRENPRRFVV
FT                   FPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWEALKPDERHFISHVLAFFAASDGIV
FT                   NENLVERFSQEVQVTEARCFYGFQIAMENIHSEMYSLLIDTYIKDPKEREYLFNAIETM
FT                   PCVKKKADWALRWIGDKEATYGERVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSN
FT                   ELISRDEGLHCDFACLMFKHLVHKPAEQRVREIITNAVRIEQEFLTEALPVKLIGMNCT
FT                   LMKQYIEFVADRLMLELGFNKIFRVENPFDFMENISLEGKTNFFEKRVGEYQRMGVMSN
FT                   STENSFTLDADF"
FT   gene            <381188..381702
FT                   /locus_tag="mCG_18900"
FT                   /note="gene_id=mCG18900.0"
FT   mRNA            <381188..381702
FT                   /locus_tag="mCG_18900"
FT                   /product="mCG18900"
FT                   /note="gene_id=mCG18900.0 transcript_id=mCT16275.0 created
FT                   on 10-SEP-2002"
FT   CDS             <381189..381626
FT                   /codon_start=1
FT                   /locus_tag="mCG_18900"
FT                   /product="mCG18900"
FT                   /note="gene_id=mCG18900.0 transcript_id=mCT16275.0
FT                   protein_id=mCP12106.0"
FT                   /protein_id="EDL36989.1"
FT                   /translation="ILLSLFPEVHLLVSGEMASRLLRGVGALAAQALRAHGPRGAAVTR
FT                   SMASGGGVPTDEEQATGLEREIMIAAQKGLDPYNMLPPKAASGTKEDPNLVPSISNKRI
FT                   VGCICEEDNCTVIWFWLHKGESQRCPNCGTHYKLVPHQMAH"
FT   gene            400596..401403
FT                   /locus_tag="mCG_1041603"
FT                   /note="gene_id=mCG1041603.0"
FT   mRNA            join(400596..400653,401109..401403)
FT                   /locus_tag="mCG_1041603"
FT                   /product="mCG1041603"
FT                   /note="gene_id=mCG1041603.0 transcript_id=mCT159307.0
FT                   created on 18-SEP-2002"
FT   CDS             401249..401362
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041603"
FT                   /product="mCG1041603"
FT                   /note="gene_id=mCG1041603.0 transcript_id=mCT159307.0
FT                   protein_id=mCP78890.1"
FT                   /protein_id="EDL36988.1"
FT                   /translation="MFVQKNVMRMGFTKQALYVGNLRACYHVQEPMDGQRV"
FT   gene            405244..407785
FT                   /locus_tag="mCG_148249"
FT                   /note="gene_id=mCG148249.0"
FT   mRNA            join(405244..405354,407584..407785)
FT                   /locus_tag="mCG_148249"
FT                   /product="mCG148249"
FT                   /note="gene_id=mCG148249.0 transcript_id=mCT188512.0
FT                   created on 13-JAN-2004"
FT   CDS             407602..407700
FT                   /codon_start=1
FT                   /locus_tag="mCG_148249"
FT                   /product="mCG148249"
FT                   /note="gene_id=mCG148249.0 transcript_id=mCT188512.0
FT                   protein_id=mCP108083.0"
FT                   /protein_id="EDL36987.1"
FT                   /translation="MSSDAGMDHPSLPQIEVEMSGPYLKTVSSDMN"
FT   gene            <474200..599495
FT                   /gene="Mboat2"
FT                   /locus_tag="mCG_127795"
FT                   /note="gene_id=mCG127795.0"
FT   mRNA            join(<474200..474411,562773..562868,573223..573278,
FT                   578880..578934,585456..585636,587192..587384,
FT                   590527..590630,593344..593408,594441..594573,
FT                   596763..596914,598122..599495)
FT                   /gene="Mboat2"
FT                   /locus_tag="mCG_127795"
FT                   /product="membrane bound O-acyltransferase domain
FT                   containing 2, transcript variant mCT129087"
FT                   /note="gene_id=mCG127795.0 transcript_id=mCT129087.0
FT                   created on 10-SEP-2002"
FT   mRNA            join(474204..474364,521537..521682,525961..526038,
FT                   573223..573278,578880..578934,585456..585636,
FT                   587192..587384,590527..590630,593344..593408,
FT                   594441..594573,596763..596914,598122..598880)
FT                   /gene="Mboat2"
FT                   /locus_tag="mCG_127795"
FT                   /product="membrane bound O-acyltransferase domain
FT                   containing 2, transcript variant mCT173189"
FT                   /note="gene_id=mCG127795.0 transcript_id=mCT173189.0
FT                   created on 10-SEP-2002"
FT   mRNA            join(<474207..474364,573223..573278,578880..578934,
FT                   585456..585636,587192..587384,590527..590630,
FT                   593344..593408,594441..594573,596763..596914,
FT                   598122..599494)
FT                   /gene="Mboat2"
FT                   /locus_tag="mCG_127795"
FT                   /product="membrane bound O-acyltransferase domain
FT                   containing 2, transcript variant mCT193504"
FT                   /note="gene_id=mCG127795.0 transcript_id=mCT193504.0
FT                   created on 09-MAR-2004"
FT   CDS             join(<474207..474364,573223..573278,578880..578934,
FT                   585456..585636,587192..587384,590527..590630,
FT                   593344..593408,594441..594573,596763..596914,
FT                   598122..598347)
FT                   /codon_start=1
FT                   /gene="Mboat2"
FT                   /locus_tag="mCG_127795"
FT                   /product="membrane bound O-acyltransferase domain
FT                   containing 2, isoform CRA_c"
FT                   /note="gene_id=mCG127795.0 transcript_id=mCT193504.0
FT                   protein_id=mCP114451.0 isoform=CRA_c"
FT                   /protein_id="EDL36984.1"
FT                   /translation="PRRSSAQSEQASKRRLAGASGRSAEARPWPPPAPRAPPCCSPSAT
FT                   PCNCPSISPMMIITQKITSLAYEIHDGMFRKDEELTPSQRGLAVRRMPSLLEYVSYTCN
FT                   FMGILAGPLCSYKDYIAFIEGRASHVAQPSENGKDEQHGKADPSPNAAVTEKLLVCGLS
FT                   LLFHLTISNMLPVEYNIDEHFQATASWPTKATYLYVSLLAARPKYYFAWTLADAINNAA
FT                   GFGFRGYDKNGVARWDLISNLRIQQIEMSTSFKMFLDNWNIQTALWLKRVCYERATFSP
FT                   TIQTFFLSAIWHGVYPGYYLTFLTGVLMTLAARAVRNNFRHYFLEPPQLKLFYDLITWV
FT                   ATQITISYTVVPFVLLSIKPSFTFYSSWYYCLHVCSILVLLLLPVKKSQRRTSTQENVH
FT                   LSQAKKFDERDNPLGQNSFSTMNNVCNQNRDTGSRHSSLTQ"
FT   mRNA            join(<474213..474364,521537..521682,525961..526038,
FT                   562773..562868,573223..573278,578880..578934,
FT                   585456..585636,587192..587384,590527..590630,
FT                   593344..593408,594441..594573,596763..596914,
FT                   598122..599035)
FT                   /gene="Mboat2"
FT                   /locus_tag="mCG_127795"
FT                   /product="membrane bound O-acyltransferase domain
FT                   containing 2, transcript variant mCT193505"
FT                   /note="gene_id=mCG127795.0 transcript_id=mCT193505.0
FT                   created on 09-MAR-2004"
FT   CDS             join(<474218..474411,562773..562868,573223..573278,
FT                   578880..578934,585456..585636,587192..587384,
FT                   590527..590630,593344..593408,594441..594573,
FT                   596763..596914,598122..598347)
FT                   /codon_start=1
FT                   /gene="Mboat2"
FT                   /locus_tag="mCG_127795"
FT                   /product="membrane bound O-acyltransferase domain
FT                   containing 2, isoform CRA_a"
FT                   /note="gene_id=mCG127795.0 transcript_id=mCT129087.0
FT                   protein_id=mCP78453.0 isoform=CRA_a"
FT                   /protein_id="EDL36982.1"
FT                   /translation="LGTERASKQAAPGRSERTQRRGPAMATTSTTGSTLLQPISNAVQL
FT                   PIDQVPASGASCPGRLCRPRCCFVFALGYLSVCQITRVYIFDYGQYSADFSGPMMIITQ
FT                   KITSLAYEIHDGMFRKDEELTPSQRGLAVRRMPSLLEYVSYTCNFMGILAGPLCSYKDY
FT                   IAFIEGRASHVAQPSENGKDEQHGKADPSPNAAVTEKLLVCGLSLLFHLTISNMLPVEY
FT                   NIDEHFQATASWPTKATYLYVSLLAARPKYYFAWTLADAINNAAGFGFRGYDKNGVARW
FT                   DLISNLRIQQIEMSTSFKMFLDNWNIQTALWLKRVCYERATFSPTIQTFFLSAIWHGVY
FT                   PGYYLTFLTGVLMTLAARAVRNNFRHYFLEPPQLKLFYDLITWVATQITISYTVVPFVL
FT                   LSIKPSFTFYSSWYYCLHVCSILVLLLLPVKKSQRRTSTQENVHLSQAKKFDERDNPLG
FT                   QNSFSTMNNVCNQNRDTGSRHSSLTQ"
FT   CDS             join(<474218..474364,521537..521682,525961..526038,
FT                   562773..562868,573223..573278,578880..578934,
FT                   585456..585636,587192..587384,590527..590630,
FT                   593344..593408,594441..594573,596763..596914,
FT                   598122..598347)
FT                   /codon_start=1
FT                   /gene="Mboat2"
FT                   /locus_tag="mCG_127795"
FT                   /product="membrane bound O-acyltransferase domain
FT                   containing 2, isoform CRA_d"
FT                   /note="gene_id=mCG127795.0 transcript_id=mCT193505.0
FT                   protein_id=mCP114452.0 isoform=CRA_d"
FT                   /protein_id="EDL36985.1"
FT                   /translation="LGTERASKQAAPGRSERTQRRGPAMATTSTTGSTLLQPISNAVQL
FT                   PIDQVNFVVCQLFALLAAVWFRTYLHSSKTSSFIRHVVATLLGLYLAFFCFGWYALHFL
FT                   VQSGISYCIMIIAGVESMQQCCFVFALGYLSVCQITRVYIFDYGQYSADFSGPMMIITQ
FT                   KITSLAYEIHDGMFRKDEELTPSQRGLAVRRMPSLLEYVSYTCNFMGILAGPLCSYKDY
FT                   IAFIEGRASHVAQPSENGKDEQHGKADPSPNAAVTEKLLVCGLSLLFHLTISNMLPVEY
FT                   NIDEHFQATASWPTKATYLYVSLLAARPKYYFAWTLADAINNAAGFGFRGYDKNGVARW
FT                   DLISNLRIQQIEMSTSFKMFLDNWNIQTALWLKRVCYERATFSPTIQTFFLSAIWHGVY
FT                   PGYYLTFLTGVLMTLAARAVRNNFRHYFLEPPQLKLFYDLITWVATQITISYTVVPFVL
FT                   LSIKPSFTFYSSWYYCLHVCSILVLLLLPVKKSQRRTSTQENVHLSQAKKFDERDNPLG
FT                   QNSFSTMNNVCNQNRDTGSRHSSLTQ"
FT   mRNA            join(<474221..474364,562773..562868,578880..578934,
FT                   585456..585636,587192..587384,590527..590630,
FT                   593344..593408,594441..594573,596763..596914,
FT                   598122..599475)
FT                   /gene="Mboat2"
FT                   /locus_tag="mCG_127795"
FT                   /product="membrane bound O-acyltransferase domain
FT                   containing 2, transcript variant mCT193506"
FT                   /note="gene_id=mCG127795.0 transcript_id=mCT193506.0
FT                   created on 09-MAR-2004"
FT   CDS             join(<474223..474364,562773..562868,578880..578934,
FT                   585456..585636,587192..587384,590527..590630,
FT                   593344..593408,594441..594573,596763..596914,
FT                   598122..598347)
FT                   /codon_start=1
FT                   /gene="Mboat2"
FT                   /locus_tag="mCG_127795"
FT                   /product="membrane bound O-acyltransferase domain
FT                   containing 2, isoform CRA_e"
FT                   /note="gene_id=mCG127795.0 transcript_id=mCT193506.0
FT                   protein_id=mCP114453.0 isoform=CRA_e"
FT                   /protein_id="EDL36986.1"
FT                   /translation="HRASKQASGAWPERADAAPRPGHGHHQHHGLHPAAAHQQRRATAH
FT                   RSDVALCLLWDTSQCVRLLESISLIMDNILLIFQGMFRKDEELTPSQRGLAVRRMPSLL
FT                   EYVSYTCNFMGILAGPLCSYKDYIAFIEGRASHVAQPSENGKDEQHGKADPSPNAAVTE
FT                   KLLVCGLSLLFHLTISNMLPVEYNIDEHFQATASWPTKATYLYVSLLAARPKYYFAWTL
FT                   ADAINNAAGFGFRGYDKNGVARWDLISNLRIQQIEMSTSFKMFLDNWNIQTALWLKRVC
FT                   YERATFSPTIQTFFLSAIWHGVYPGYYLTFLTGVLMTLAARAVRNNFRHYFLEPPQLKL
FT                   FYDLITWVATQITISYTVVPFVLLSIKPSFTFYSSWYYCLHVCSILVLLLLPVKKSQRR
FT                   TSTQENVHLSQAKKFDERDNPLGQNSFSTMNNVCNQNRDTGSRHSSLTQ"
FT   CDS             join(474290..474364,521537..521682,525961..526038,
FT                   573223..573278,578880..578934,585456..585636,
FT                   587192..587384,590527..590630,593344..593408,
FT                   594441..594573,596763..596914,598122..598347)
FT                   /codon_start=1
FT                   /gene="Mboat2"
FT                   /locus_tag="mCG_127795"
FT                   /product="membrane bound O-acyltransferase domain
FT                   containing 2, isoform CRA_b"
FT                   /note="gene_id=mCG127795.0 transcript_id=mCT173189.0
FT                   protein_id=mCP96108.0 isoform=CRA_b"
FT                   /protein_id="EDL36983.1"
FT                   /translation="MATTSTTGSTLLQPISNAVQLPIDQVNFVVCQLFALLAAVWFRTY
FT                   LHSSKTSSFIRHVVATLLGLYLAFFCFGWYALHFLVQSGISYCIMIIAGVESMQHPMMI
FT                   ITQKITSLAYEIHDGMFRKDEELTPSQRGLAVRRMPSLLEYVSYTCNFMGILAGPLCSY
FT                   KDYIAFIEGRASHVAQPSENGKDEQHGKADPSPNAAVTEKLLVCGLSLLFHLTISNMLP
FT                   VEYNIDEHFQATASWPTKATYLYVSLLAARPKYYFAWTLADAINNAAGFGFRGYDKNGV
FT                   ARWDLISNLRIQQIEMSTSFKMFLDNWNIQTALWLKRVCYERATFSPTIQTFFLSAIWH
FT                   GVYPGYYLTFLTGVLMTLAARAVRNNFRHYFLEPPQLKLFYDLITWVATQITISYTVVP
FT                   FVLLSIKPSFTFYSSWYYCLHVCSILVLLLLPVKKSQRRTSTQENVHLSQAKKFDERDN
FT                   PLGQNSFSTMNNVCNQNRDTGSRHSSLTQ"
FT   gene            complement(<603065..603587)
FT                   /locus_tag="mCG_1041696"
FT                   /note="gene_id=mCG1041696.1"
FT   mRNA            complement(<603065..603587)
FT                   /locus_tag="mCG_1041696"
FT                   /product="mCG1041696"
FT                   /note="gene_id=mCG1041696.1 transcript_id=mCT159400.1
FT                   created on 27-SEP-2002"
FT   CDS             complement(<603065..603328)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041696"
FT                   /product="mCG1041696"
FT                   /note="gene_id=mCG1041696.1 transcript_id=mCT159400.1
FT                   protein_id=mCP78522.1"
FT                   /protein_id="EDL36981.1"
FT                   /translation="MHNPPHDILRWGRQAETLQALAMGAEAVLKTGDQCSGEREGRFVA
FT                   RHLHLNTMGPSRPRNLCPCHSYCLMRCSFWCGGTFTYIKLTED"
FT   gene            <614095..698652
FT                   /locus_tag="mCG_18896"
FT                   /note="gene_id=mCG18896.1"
FT   mRNA            join(<614095..614229,621369..621509,626057..626155,
FT                   627686..627784,628896..628994,629868..629969,
FT                   631407..631505,634034..634231,636659..636757,
FT                   638125..638223,638680..638778,640980..641157,
FT                   642399..642563,643355..643534,644465..644630,
FT                   647487..647638,647831..648120,649501..649641,
FT                   650319..650562,650924..651012,652675..652819,
FT                   656170..656332,675763..675941,677737..677837,
FT                   679761..679874,690164..690295,691869..691967,
FT                   692873..693109,695690..698652)
FT                   /locus_tag="mCG_18896"
FT                   /product="mCG18896"
FT                   /note="gene_id=mCG18896.1 transcript_id=mCT16272.1 created
FT                   on 10-SEP-2002"
FT   CDS             join(<621390..621509,626057..626155,627686..627784,
FT                   628896..628994,629868..629969,631407..631505,
FT                   634034..634231,636659..636757,638125..638223,
FT                   638680..638778,640980..641157,642399..642563,
FT                   643355..643534,644465..644630,647487..647638,
FT                   647831..648120,649501..649641,650319..650562,
FT                   650924..651012,652675..652819,656170..656332,
FT                   675763..675941,677737..677837,679761..679874,
FT                   690164..690295,691869..691967,692873..693109,
FT                   695690..696949)
FT                   /codon_start=1
FT                   /locus_tag="mCG_18896"
FT                   /product="mCG18896"
FT                   /note="gene_id=mCG18896.1 transcript_id=mCT16272.1
FT                   protein_id=mCP12118.1"
FT                   /protein_id="EDL36980.1"
FT                   /translation="ISVKMSVLISQSVINYVEEENIPALKALLEKCKDVDERNECGQTP
FT                   LMIAAEQGNVEIVKELIKNGANCNLEDLDNWTALISASKEGHIHIVEELLKCGANLEHR
FT                   DMGGWTALMWACYKGRTDVVELLLSHGANPSVTGLQYSVYPIIWAAGRGHADIVHLLLQ
FT                   NGAKVNCSDKYGTTPLVWAARKGHLECVKHLLAMGADVDQEGANSMTALIVAVKGGYTQ
FT                   SVKEILKRNPNVNLTDKDGNTALMIASKEGHIEIVQDLLDAGTYVNIPDRSGDTVLIGA
FT                   VRGGHVEIVRALLQKYADIDIRGQDNKTALYWAVEKGNATMVRDILQCNPDTEICTKDG
FT                   ETPLIKATKMRNIEVVELLLDKGARVSAVDKKGDTPLHVAIRGRSRRLAELLLRNPKDG
FT                   RLLYRPNKAGETPYNIDCSHQKSILTQIFGARHLSPTETDGDMLGYDLYSSALADILSE
FT                   PTMQPPICVGLYAQWGSGKSFLLKKLEDEMKTFAGQQIEPLFQFSWLIVFLTLLLCGGL
FT                   GLVFAFTVDTNLAIAVSLSFLALLYIFFIVIYFGGRQEGESWNWAWALSTRLARHIGYL
FT                   ELLFKLMFVNPPELPEQTTKALPVRFLFTDYNRLSSVGGETSLAEMIATLSDACEREFG
FT                   FLATRLFRVFKTEDSQGKKKWKKTCCLPSFIIFLFIVGCIIAGITLLAIFRVDPKHLTV
FT                   NAILISIASIVGLAFVLNCRTWWQVLDSLLNSQRKRLHSAASKLHKLKSEGFMKVLKCE
FT                   VELMARMAKTIDSFTQNQTRLVVIIDGLDACEQDKVLQMLDTVRVLFSKGPFIAIFASD
FT                   PHIIIKAINQNLNSVLRDSNINGHDYMRNIVHLPVFLNSRGLSNARKFLVTSATNGDIS
FT                   CSEATGVQEDADRRVSQNSLGEMTKLGSKTALNRRDTYRRRQMQRTITRQMSFDLTKLL
FT                   VTEDWFSDISPQTMRRLLNIVSVTGRLLRANQITFNWDRLASWINLTEQWPYRTSWLIL
FT                   YLEETEGLPDQMTLKTIYERISKNIPTTKDVEPLLEIDGDIRNFEVFLSSRTPVLVARD
FT                   VKTFLPCTVNLDPKLREIIAASFNGPFPGGVVSPQPHSSYYSGLSGPQHPFYNRPFFAP
FT                   YLYTPRYYPGGSQHLISRSSVKTSLPRDQNNGLASVPATGTSLLLSSMTVDIVCEKLRQ
FT                   IEGLDQGMLPQYCTTIKKANINGRVLAQCNIDELKKEMAMNFGDWHLFRSMVLEMRSVE
FT                   NQVVPEDPRFLNENSSAPVAHGESARRTSHSELPHTELSSQTPYTLNFSFEELNTLGLD
FT                   EGAPRHSNLSWQSQTRRTPSLSSLNSQDSSIEISKLTDKVQAEYRDAYREYIAQMSQLE
FT                   GGTGSSTISGRSSPHSTYYIGQSSSGGSIHSNLEQERGKESELKQEEGRKSFLMKRGDV
FT                   LDYSSSGVSTNEASPLDPITEEDEKSDQSGSKLLPGKKSSERPSLFQTDLKLKGSGLRY
FT                   QKLPSDEDESGTEESDNTPLLKDDKDKKAEGKAERVAKSPEHSVEPIRTFIKAKEYLSD
FT                   ALLDKKDSSDSGVRSNESSPNHSLHNEAADDSQLEKANLIELEDEGHSGKRGMPHSLSG
FT                   LQDPVIARMSICSEDKKSPSECSLIASSPEESWPSCQKAYNLNRTPSTVTLNNNTAPTN
FT                   RANQNFDEIEGVRETSQVILRPGPSPNPTAVQNENLKSMAHKRSQRSSYTRLSKDASEL
FT                   HAASSDSTGFGEERESIL"
FT   gene            complement(736365..738281)
FT                   /gene="Id2"
FT                   /locus_tag="mCG_3640"
FT                   /note="gene_id=mCG3640.1"
FT   mRNA            complement(join(736365..736779,737513..737576,
FT                   737866..738281))
FT                   /gene="Id2"
FT                   /locus_tag="mCG_3640"
FT                   /product="inhibitor of DNA binding 2"
FT                   /note="gene_id=mCG3640.1 transcript_id=mCT3143.1 created on
FT                   03-SEP-2002"
FT   CDS             complement(join(737520..737576,737866..738213))
FT                   /codon_start=1
FT                   /gene="Id2"
FT                   /locus_tag="mCG_3640"
FT                   /product="inhibitor of DNA binding 2"
FT                   /note="gene_id=mCG3640.1 transcript_id=mCT3143.1
FT                   protein_id=mCP12111.0"
FT                   /db_xref="GOA:Q545T4"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="InterPro:IPR026052"
FT                   /db_xref="MGI:MGI:96397"
FT                   /db_xref="UniProtKB/TrEMBL:Q545T4"
FT                   /protein_id="EDL36979.1"
FT                   /translation="MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSK
FT                   LKELVPSIPQNKKVTKMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLT
FT                   TLNTDISILSLQASEFPSELMSNDSKVLCG"
FT   gene            771090..776837
FT                   /locus_tag="mCG_1051104"
FT                   /note="gene_id=mCG1051104.0"
FT   mRNA            join(771090..771201,773043..773155,773279..776837)
FT                   /locus_tag="mCG_1051104"
FT                   /product="mCG1051104"
FT                   /note="gene_id=mCG1051104.0 transcript_id=mCT194893.0
FT                   created on 27-JAN-2005"
FT   CDS             join(771134..771201,773043..773155,773279..773433)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1051104"
FT                   /product="mCG1051104"
FT                   /note="gene_id=mCG1051104.0 transcript_id=mCT194893.0
FT                   protein_id=mCP115922.0"
FT                   /protein_id="EDL36978.1"
FT                   /translation="MLQEAELLLGRSRLRMQARQSCRKEGVGHTQIVPPRDGSRVWNVA
FT                   STSQGVLLAQLELRRVICCSIPGKTSTEGPGLPFLSVSWTAAEGRKMLSSIQLQGLMGS
FT                   EAQGFDD"
FT   gene            924626..924958
FT                   /pseudo
FT                   /locus_tag="mCG_1041601"
FT                   /note="gene_id=mCG1041601.1"
FT   mRNA            924626..924958
FT                   /pseudo
FT                   /locus_tag="mCG_1041601"
FT                   /note="gene_id=mCG1041601.1 transcript_id=mCT159305.1
FT                   created on 27-SEP-2002"
FT   gene            960089..1030050
FT                   /locus_tag="mCG_145567"
FT                   /note="gene_id=mCG145567.0"
FT   mRNA            join(960089..960356,963200..963353,1020279..1020371,
FT                   1028532..1030050)
FT                   /locus_tag="mCG_145567"
FT                   /product="mCG145567"
FT                   /note="gene_id=mCG145567.0 transcript_id=mCT184991.0
FT                   created on 05-JUN-2003"
FT   CDS             1028680..1028955
FT                   /codon_start=1
FT                   /locus_tag="mCG_145567"
FT                   /product="mCG145567"
FT                   /note="gene_id=mCG145567.0 transcript_id=mCT184991.0
FT                   protein_id=mCP105152.0"
FT                   /protein_id="EDL36977.1"
FT                   /translation="MGLNRELADCDLVPWWLLIQADETGVCLAVLYSHIKIEFSLDPAS
FT                   FLFRNIHRTPGRTLNSLSTGLDSLMVPEPLEPGSVFPPGLPSRTRS"
FT   gene            complement(1874056..1891117)
FT                   /locus_tag="mCG_148248"
FT                   /note="gene_id=mCG148248.0"
FT   mRNA            complement(join(1874056..1874594,1876670..1876919,
FT                   1877440..1877579,1879011..1879099,1889700..1889800,
FT                   1890849..1891117))
FT                   /locus_tag="mCG_148248"
FT                   /product="mCG148248"
FT                   /note="gene_id=mCG148248.0 transcript_id=mCT188511.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(join(1874543..1874594,1876670..1876839))
FT                   /codon_start=1
FT                   /locus_tag="mCG_148248"
FT                   /product="mCG148248"
FT                   /note="gene_id=mCG148248.0 transcript_id=mCT188511.0
FT                   protein_id=mCP108082.0"
FT                   /protein_id="EDL36976.1"
FT                   /translation="MLARMWRKRNTPPLLVGLQACTTTLEISLAVPQKIGHSTTRGSSN
FT                   TSPGHISRCSNHIYVMNRKKFIFIVAEY"
FT   gene            complement(1947968..2057569)
FT                   /gene="Rnf144"
FT                   /locus_tag="mCG_17803"
FT                   /note="gene_id=mCG17803.3"
FT   mRNA            complement(join(1947968..1949233,1952333..1952422,
FT                   1956012..1956159,1959320..1959527,1965696..1965756,
FT                   1965921..1966025,1977882..1978027,2029324..2029505,
FT                   2057408..2057569))
FT                   /gene="Rnf144"
FT                   /locus_tag="mCG_17803"
FT                   /product="ring finger protein 144, transcript variant
FT                   mCT16264"
FT                   /note="gene_id=mCG17803.3 transcript_id=mCT16264.3 created
FT                   on 13-JUN-2003"
FT   mRNA            complement(join(1947968..1949233,1952333..1952422,
FT                   1956012..1956159,1959320..1959527,1965696..1965756,
FT                   1965921..1966025,1977882..1978027,2029324..2029505,
FT                   2047657..2047730,2057408..2057569))
FT                   /gene="Rnf144"
FT                   /locus_tag="mCG_17803"
FT                   /product="ring finger protein 144, transcript variant
FT                   mCT175261"
FT                   /note="gene_id=mCG17803.3 transcript_id=mCT175261.1 created
FT                   on 13-JUN-2003"
FT   mRNA            complement(join(1947968..1949233,1952333..1952422,
FT                   1956012..1956159,1959320..1959527,1965696..1965756,
FT                   1965921..1966025,1977882..1978027,2029324..2029505,
FT                   2047657..2047730,2056068..2056135,2057408..2057569))
FT                   /gene="Rnf144"
FT                   /locus_tag="mCG_17803"
FT                   /product="ring finger protein 144, transcript variant
FT                   mCT172858"
FT                   /note="gene_id=mCG17803.3 transcript_id=mCT172858.1 created
FT                   on 13-JUN-2003"
FT   CDS             complement(join(1949102..1949233,1952333..1952422,
FT                   1956012..1956159,1959320..1959527,1965696..1965756,
FT                   1965921..1966025,1977882..1978016))
FT                   /codon_start=1
FT                   /gene="Rnf144"
FT                   /locus_tag="mCG_17803"
FT                   /product="ring finger protein 144, isoform CRA_a"
FT                   /note="gene_id=mCG17803.3 transcript_id=mCT16264.3
FT                   protein_id=mCP12113.2 isoform=CRA_a"
FT                   /protein_id="EDL36973.1"
FT                   /translation="MTTARYRPTWDLALDPLVSCKLCLGEYPAEQMTTIAQCQCIFCTL
FT                   CLKQYVELLIKEGLETAISCPDAACPKQGHLQENEIECMVAAEIMQRYKKLQFEREVLF
FT                   DPCRTWCPASTCQAVCQLQDIGLQTPQLVQCKACDMEFCSACKARWHPGQGCPETMPIT
FT                   FLPGETSSAFKMEEGDAPIKRCPKCRVYIERDEGCAQMMCKNCKHAFCWYCLESLDDDF
FT                   LLIHYDKGPCRNKLGHSRASVIWHRTQVVGIFAGFGLLLLVASPFLLLATPFVLCCKCK
FT                   CSKGDDDPLPT"
FT   CDS             complement(join(1949102..1949233,1952333..1952422,
FT                   1956012..1956159,1959320..1959527,1965696..1965756,
FT                   1965921..1966025,1977882..1978016))
FT                   /codon_start=1
FT                   /gene="Rnf144"
FT                   /locus_tag="mCG_17803"
FT                   /product="ring finger protein 144, isoform CRA_a"
FT                   /note="gene_id=mCG17803.3 transcript_id=mCT172858.1
FT                   protein_id=mCP95777.0 isoform=CRA_a"
FT                   /protein_id="EDL36974.1"
FT                   /translation="MTTARYRPTWDLALDPLVSCKLCLGEYPAEQMTTIAQCQCIFCTL
FT                   CLKQYVELLIKEGLETAISCPDAACPKQGHLQENEIECMVAAEIMQRYKKLQFEREVLF
FT                   DPCRTWCPASTCQAVCQLQDIGLQTPQLVQCKACDMEFCSACKARWHPGQGCPETMPIT
FT                   FLPGETSSAFKMEEGDAPIKRCPKCRVYIERDEGCAQMMCKNCKHAFCWYCLESLDDDF
FT                   LLIHYDKGPCRNKLGHSRASVIWHRTQVVGIFAGFGLLLLVASPFLLLATPFVLCCKCK
FT                   CSKGDDDPLPT"
FT   CDS             complement(join(1949102..1949233,1952333..1952422,
FT                   1956012..1956159,1959320..1959527,1965696..1965756,
FT                   1965921..1966025,1977882..1978016))
FT                   /codon_start=1
FT                   /gene="Rnf144"
FT                   /locus_tag="mCG_17803"
FT                   /product="ring finger protein 144, isoform CRA_a"
FT                   /note="gene_id=mCG17803.3 transcript_id=mCT175261.1
FT                   protein_id=mCP98180.0 isoform=CRA_a"
FT                   /protein_id="EDL36975.1"
FT                   /translation="MTTARYRPTWDLALDPLVSCKLCLGEYPAEQMTTIAQCQCIFCTL
FT                   CLKQYVELLIKEGLETAISCPDAACPKQGHLQENEIECMVAAEIMQRYKKLQFEREVLF
FT                   DPCRTWCPASTCQAVCQLQDIGLQTPQLVQCKACDMEFCSACKARWHPGQGCPETMPIT
FT                   FLPGETSSAFKMEEGDAPIKRCPKCRVYIERDEGCAQMMCKNCKHAFCWYCLESLDDDF
FT                   LLIHYDKGPCRNKLGHSRASVIWHRTQVVGIFAGFGLLLLVASPFLLLATPFVLCCKCK
FT                   CSKGDDDPLPT"
FT   gene            complement(2088856..>2099890)
FT                   /gene="Rsad2"
FT                   /locus_tag="mCG_17799"
FT                   /note="gene_id=mCG17799.1"
FT   mRNA            complement(join(2088856..2089118,2090705..2090737,
FT                   2092136..2092285,2094102..2094331,2097589..2097750,
FT                   2099533..>2099890))
FT                   /gene="Rsad2"
FT                   /locus_tag="mCG_17799"
FT                   /product="radical S-adenosyl methionine domain containing
FT                   2"
FT                   /note="gene_id=mCG17799.1 transcript_id=mCT16260.0 created
FT                   on 03-SEP-2002"
FT   CDS             complement(join(2088954..2089118,2090705..2090737,
FT                   2092136..2092285,2094102..2094331,2097589..2097750,
FT                   2099533..>2099890))
FT                   /codon_start=1
FT                   /gene="Rsad2"
FT                   /locus_tag="mCG_17799"
FT                   /product="radical S-adenosyl methionine domain containing
FT                   2"
FT                   /note="gene_id=mCG17799.1 transcript_id=mCT16260.0
FT                   protein_id=mCP12104.0"
FT                   /protein_id="EDL36972.1"
FT                   /translation="PITMGMLVPTALAARLLSLFQQQLGSLWSGLAILFCWLRIALGWL
FT                   DPGKEQPQVRGELEETQETQEDGNSTQPTTPVSVNYHFTRQCNYKCGFCFHTAKTSFVL
FT                   PLEEAKRGLLLLKQAGLEKINFSGGEPFLQDRGEYLGKLVRFCKEELALPSVSIVSNGS
FT                   LIQERWFKDYGEYLDILAISCDSFDEQVNALIGRGQGKKNHVENLQKLRRWCRDYKVAF
FT                   KINSVINRFNVDEDMNEHIKALSPVRWKVFQCLLIEGENSGEDALREAERFLISNEEFE
FT                   TFLERHKEVSCLVPESNQKMKDSYLILDEYMRFLNCTGGRKDPSKSILDVGVEEAIKFS
FT                   GFDEKMFLKRGGKYVWSKADLKLDW"
FT   gene            <2112660..2123165
FT                   /gene="Tyki"
FT                   /locus_tag="mCG_17802"
FT                   /note="gene_id=mCG17802.2"
FT   mRNA            join(<2112660..2113327,2114728..2114842,2117333..2117534,
FT                   2120339..2120572,2121345..2123165)
FT                   /gene="Tyki"
FT                   /locus_tag="mCG_17802"
FT                   /product="thymidylate kinase family LPS-inducible member,
FT                   transcript variant mCT16263"
FT                   /note="gene_id=mCG17802.2 transcript_id=mCT16263.2 created
FT                   on 03-SEP-2002"
FT   CDS             join(<2112812..2113327,2114728..2114842,2117333..2117534,
FT                   2120339..2120572,2121345..2121462)
FT                   /codon_start=1
FT                   /gene="Tyki"
FT                   /locus_tag="mCG_17802"
FT                   /product="thymidylate kinase family LPS-inducible member,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG17802.2 transcript_id=mCT16263.2
FT                   protein_id=mCP12109.2 isoform=CRA_a"
FT                   /protein_id="EDL36970.1"
FT                   /translation="ATDHRDARLAELLGPPGRSYALCVPLAPGEGCGPRVQAARVHHRL
FT                   LQQLRRDPLQRCQLSKLLGYGPGDQAGEAQHGFLLRDPCDHPDTRRDLLQLLGSCQEAA
FT                   RPQLAEFQADSQGLLWQRLWELQGDRQVQVDCACVLPAQEPHLHPLLPDLLNSAVFQDR
FT                   DAARAVLEECTSFIPEARAVLDLVDQCPKEVQKGKFQVIAIEGLDATGKTTLTQSVSES
FT                   LKAVLLQSPPPCISQWRKIFDDEPTIIRRAFYSLGNYLVASEIAKESTNFPVIVDRYWH
FT                   STATYAIATEVSGGLQYLPPAHHPVYQWPGDLLKPDLVLLLTVNSEERVRRLQGRGQEK
FT                   TKEEAELEANNVFRQKVEMTYQRMENPSCHLVDASPSRETVLQKVLELIQSSGR"
FT   mRNA            join(<2113831..2114842,2117333..2117534,2120339..2120572,
FT                   2121345..2123165)
FT                   /gene="Tyki"
FT                   /locus_tag="mCG_17802"
FT                   /product="thymidylate kinase family LPS-inducible member,
FT                   transcript variant mCT193423"
FT                   /note="gene_id=mCG17802.2 transcript_id=mCT193423.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<2114578..2114842,2117333..2117534,2120339..2120572,
FT                   2121345..2121462)
FT                   /codon_start=1
FT                   /gene="Tyki"
FT                   /locus_tag="mCG_17802"
FT                   /product="thymidylate kinase family LPS-inducible member,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG17802.2 transcript_id=mCT193423.0
FT                   protein_id=mCP114411.0 isoform=CRA_b"
FT                   /protein_id="EDL36971.1"
FT                   /translation="ILGSHALGIVFNLEQTSLELGSGVFGRCRFSKAPALPCSCTGLFV
FT                   CFSLQCTSFIPEARAVLDLVDQCPKEVQKGKFQVIAIEGLDATGKTTLTQSVSESLKAV
FT                   LLQSPPPCISQWRKIFDDEPTIIRRAFYSLGNYLVASEIAKESTNFPVIVDRYWHSTAT
FT                   YAIATEVSGGLQYLPPAHHPVYQWPGDLLKPDLVLLLTVNSEERVRRLQGRGQEKTKEE
FT                   AELEANNVFRQKVEMTYQRMENPSCHLVDASPSRETVLQKVLELIQSSGR"
FT   gene            complement(2129247..>2131076)
FT                   /locus_tag="mCG_17801"
FT                   /note="gene_id=mCG17801.1"
FT   mRNA            complement(join(2129247..2129688,2130426..2130545,
FT                   2130865..>2131076))
FT                   /locus_tag="mCG_17801"
FT                   /product="mCG17801"
FT                   /note="gene_id=mCG17801.1 transcript_id=mCT16262.1 created
FT                   on 10-SEP-2002"
FT   CDS             complement(join(2129312..2129688,2130426..2130545,
FT                   2130865..>2131012))
FT                   /codon_start=1
FT                   /locus_tag="mCG_17801"
FT                   /product="mCG17801"
FT                   /note="gene_id=mCG17801.1 transcript_id=mCT16262.1
FT                   protein_id=mCP12108.1"
FT                   /protein_id="EDL36969.1"
FT                   /translation="RETYTMSGALDVLRIKEEDVLKFLAAGTHLGGTNLDFQMEQYIYR
FT                   RKSYESPLRYVDIAIPCNNKGAYSVGLMWWMLAREVLCMRGTISQSPLRYVDIAIPCNN
FT                   KGAYSVGLMWWMLAREVLCMRGTISREHPWEVMPYLYFYRDPEGIEKEERAAAEKAVTK
FT                   EEFQSEWTAPAPEFTAAQPEVADWSEGMQVPSVPIQQFPTEDWSVQLATED"
FT   gene            complement(2468458..2490272)
FT                   /locus_tag="mCG_1051105"
FT                   /note="gene_id=mCG1051105.0"
FT   mRNA            complement(join(2468458..2469020,2469151..2469307,
FT                   2470158..2470265,2476182..2476321,2486363..2486515,
FT                   2488683..2488723,2489867..2490272))
FT                   /locus_tag="mCG_1051105"
FT                   /product="mCG1051105"
FT                   /note="gene_id=mCG1051105.0 transcript_id=mCT194894.0
FT                   created on 27-JAN-2005"
FT   CDS             complement(2468607..2468906)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1051105"
FT                   /product="mCG1051105"
FT                   /note="gene_id=mCG1051105.0 transcript_id=mCT194894.0
FT                   protein_id=mCP115923.0"
FT                   /protein_id="EDL36968.1"
FT                   /translation="MVIRKHTFFVIFTQNTVWEASKSVLCSALLWHRVLSLSLSLSLSL
FT                   SSLSAFVYLCNHTHICNQHCMHLENTLPYTMRNKPFILSQNHGYTRIHICASHC"
FT   gene            complement(2750604..2775454)
FT                   /locus_tag="mCG_148273"
FT                   /note="gene_id=mCG148273.0"
FT   mRNA            complement(join(2750604..2751880,2757193..2757387,
FT                   2774955..2775454))
FT                   /locus_tag="mCG_148273"
FT                   /product="mCG148273"
FT                   /note="gene_id=mCG148273.0 transcript_id=mCT188536.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(2751302..2751511)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148273"
FT                   /product="mCG148273"
FT                   /note="gene_id=mCG148273.0 transcript_id=mCT188536.0
FT                   protein_id=mCP108108.0"
FT                   /protein_id="EDL36967.1"
FT                   /translation="MCISSLCLCLSLSLCLSVYVCVCVCVCVCVCVYVCVKKRERNQFS
FT                   PSTMWVPGIELASQPWQQAPLPTY"
FT   gene            complement(2802017..2802677)
FT                   /locus_tag="mCG_1041969"
FT                   /note="gene_id=mCG1041969.1"
FT   mRNA            complement(2802017..2802677)
FT                   /locus_tag="mCG_1041969"
FT                   /product="mCG1041969"
FT                   /note="gene_id=mCG1041969.1 transcript_id=mCT159673.1
FT                   created on 27-SEP-2002"
FT   CDS             complement(2802233..2802298)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041969"
FT                   /product="mCG1041969"
FT                   /note="gene_id=mCG1041969.1 transcript_id=mCT159673.1
FT                   protein_id=mCP79088.1"
FT                   /protein_id="EDL36966.1"
FT                   /translation="MGAKVSGSFQTNKCGCRLSAP"
FT   gene            2924936..2929007
FT                   /locus_tag="mCG_148278"
FT                   /note="gene_id=mCG148278.0"
FT   mRNA            join(2924936..2927429,2927473..2929007)
FT                   /locus_tag="mCG_148278"
FT                   /product="mCG148278"
FT                   /note="gene_id=mCG148278.0 transcript_id=mCT188541.0
FT                   created on 13-JAN-2004"
FT   CDS             2928342..2928536
FT                   /codon_start=1
FT                   /locus_tag="mCG_148278"
FT                   /product="mCG148278"
FT                   /note="gene_id=mCG148278.0 transcript_id=mCT188541.0
FT                   protein_id=mCP108112.0"
FT                   /protein_id="EDL36965.1"
FT                   /translation="MLSPFPDTTPTPTWKPLSHPLSPCFYEGVPPNTHPLPPPWPAIPL
FT                   HWAIEPSQDQGSPFPLMPR"
FT   gene            complement(3001319..3004841)
FT                   /locus_tag="mCG_11193"
FT                   /note="gene_id=mCG11193.2"
FT   mRNA            complement(3001319..3004841)
FT                   /locus_tag="mCG_11193"
FT                   /product="mCG11193"
FT                   /note="gene_id=mCG11193.2 transcript_id=mCT11099.2 created
FT                   on 30-NOV-2004"
FT   CDS             complement(3003353..3004540)
FT                   /codon_start=1
FT                   /locus_tag="mCG_11193"
FT                   /product="mCG11193"
FT                   /note="gene_id=mCG11193.2 transcript_id=mCT11099.2
FT                   protein_id=mCP10270.2"
FT                   /protein_id="EDL36964.1"
FT                   /translation="MVQQAESSEAESNLPRDALDTEEGEFMACSPVALDESDPDWCKTA
FT                   SGHIKRPMNAFMVWSKIERRKIMEQSPDMHNAEISKRLGKRWKMLKDSEKIPFIREAER
FT                   LRLKHMADYPDYKYRPRKKPKTDPAAKPSAGQSPDKSAAGAKAAKGPGKKCAKLKAPAG
FT                   KAGAGKAAQPGDCGAGKAAKCVFLDDDDEDDDEDDELQLRPKPDADDDDDEPAHSHLLP
FT                   PPTQQQPPQLLRRYSVAKVPASPTLSSAAESPEGASLYDEVRAGGRLYYSFKNITKQQP
FT                   PPAPPALSPASSRCVSTSSSSGSSSGSGAEDADDLMFDLSLNFSQGAHSACEQPLGAGA
FT                   AGNLSLSLVDKDLDSFSEGSLGSHFEFPDYCTPELSEMIAGDWLEANFSDLVFTY"
FT   gene            3251752..3267590
FT                   /locus_tag="mCG_1051106"
FT                   /note="gene_id=mCG1051106.0"
FT   mRNA            join(3251752..3251868,3255797..3255844,3257632..3257773,
FT                   3266278..3267590)
FT                   /locus_tag="mCG_1051106"
FT                   /product="mCG1051106"
FT                   /note="gene_id=mCG1051106.0 transcript_id=mCT194895.0
FT                   created on 27-JAN-2005"
FT   CDS             3266926..3267261
FT                   /codon_start=1
FT                   /locus_tag="mCG_1051106"
FT                   /product="mCG1051106"
FT                   /note="gene_id=mCG1051106.0 transcript_id=mCT194895.0
FT                   protein_id=mCP115924.0"
FT                   /protein_id="EDL36963.1"
FT                   /translation="MNTDLEVLYCMCVEGLISAGVCCLFGDPVFERSRGSRLIETAGPP
FT                   TGPQLLSAFPNSTTGISCFCLLVGCKYLHLALSAACWVFWSVVMQGPSFCERSIASVIV
FT                   SDPGTSF"
FT   gene            <3638394..>3675694
FT                   /locus_tag="mCG_1041962"
FT                   /note="gene_id=mCG1041962.0"
FT   mRNA            join(<3638394..3638468,3646624..3646666,3650014..3650223,
FT                   3659781..3659905,3668308..3668437,3669601..3669625,
FT                   3673900..3673997,3675588..>3675694)
FT                   /locus_tag="mCG_1041962"
FT                   /product="mCG1041962"
FT                   /note="gene_id=mCG1041962.0 transcript_id=mCT159666.0
FT                   created on 26-SEP-2002"
FT   CDS             join(3638394..3638468,3646624..3646666,3650014..3650223,
FT                   3659781..3659905,3668308..3668437,3669601..3669625,
FT                   3673900..3673997,3675588..3675694)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041962"
FT                   /product="mCG1041962"
FT                   /note="gene_id=mCG1041962.0 transcript_id=mCT159666.0
FT                   protein_id=mCP79022.0"
FT                   /protein_id="EDL36962.1"
FT                   /translation="MAVVYKSSYPMDRFCEDQQLCLQTQTKALEDELKHTASLAAVHRV
FT                   YCGRLLCLGDPECFLLEEACGPDLDRVQDLQGGNRVMIFHAEQLISAKLQRIKHKSVEG
FT                   EDVWQGFQGPFGGIIILELKDMTSVVTFVLGVCLSSTQCTSRPSWNRVYGFWDMNPKFL
FT                   HIPSARDAKGYEHHRQVTLPKRSLFSPISFLYTLLSGVYGSFGVNALHSTQHGRSSGDD
FT                   QVQSQCHSVDVMSGPSTHYPGFYVLQEMPTQPRMATYVESHPSSKDIF"
FT   gene            complement(4112291..4223310)
FT                   /locus_tag="mCG_148245"
FT                   /note="gene_id=mCG148245.0"
FT   mRNA            complement(join(4112291..4112734,4192700..4192768,
FT                   4200593..4200693,4202602..4202725,4204528..4204570,
FT                   4206224..4206361,4210828..4210956,4222181..4222232,
FT                   4223207..4223310))
FT                   /locus_tag="mCG_148245"
FT                   /product="mCG148245"
FT                   /note="gene_id=mCG148245.0 transcript_id=mCT188508.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(join(4112711..4112734,4192700..4192768,
FT                   4200593..4200693,4202602..4202725,4204528..4204570,
FT                   4206224..4206361,4210828..4210868))
FT                   /codon_start=1
FT                   /locus_tag="mCG_148245"
FT                   /product="mCG148245"
FT                   /note="gene_id=mCG148245.0 transcript_id=mCT188508.0
FT                   protein_id=mCP108078.0"
FT                   /protein_id="EDL36961.1"
FT                   /translation="MIGEKVFPLGGVRKLFTMDGHLLDDSKNLQDNYFYVAAGLETFKS
FT                   IPYWKSSWVPSEVQQRFGGNDKYTQTKKRVESKVKEPLQNDSVPPRSQDSVYYAKEKKQ
FT                   MDTELLVQSGAEGDVYKAQTPAKEAQEALEVKEDPEVKVEVPVDQAPAEIVKEIDEIGD
FT                   SSPGLKSGMHIPASFM"
FT   gene            complement(4228659..4257488)
FT                   /gene="Allc"
FT                   /locus_tag="mCG_126922"
FT                   /note="gene_id=mCG126922.1"
FT   mRNA            complement(join(4228659..4228951,4230172..4230296,
FT                   4232256..4232364,4234134..4234207,4234766..4234921,
FT                   4238838..4238970,4239700..4239779,4240862..4240990,
FT                   4243441..4243528,4246047..4246097,4248384..4248586,
FT                   4257428..4257488))
FT                   /gene="Allc"
FT                   /locus_tag="mCG_126922"
FT                   /product="allantoicase, transcript variant mCT127467"
FT                   /note="gene_id=mCG126922.1 transcript_id=mCT127467.1
FT                   created on 03-SEP-2002"
FT   mRNA            complement(join(4228659..4228951,4230172..4230296,
FT                   4232256..4232364,4234134..4234207,4234766..4234921,
FT                   4238838..4238970,4239700..4239779,4240862..4240990,
FT                   4243441..4243528,4246047..4246097,4248384..4248478,
FT                   4257423..4257478))
FT                   /gene="Allc"
FT                   /locus_tag="mCG_126922"
FT                   /product="allantoicase, transcript variant mCT128198"
FT                   /note="gene_id=mCG126922.1 transcript_id=mCT128198.1
FT                   created on 03-SEP-2002"
FT   mRNA            complement(join(4228660..4228951,4230172..4230296,
FT                   4232256..4232364,4234134..4234207,4234766..4234921,
FT                   4238838..4238970,4239700..4239779,4240862..4240990,
FT                   4243441..4243528,4246047..4246097,4248384..4248478,
FT                   4257428..>4257479))
FT                   /gene="Allc"
FT                   /locus_tag="mCG_126922"
FT                   /product="allantoicase, transcript variant mCT193427"
FT                   /note="gene_id=mCG126922.1 transcript_id=mCT193427.0
FT                   created on 09-MAR-2004"
FT   CDS             complement(join(4228742..4228951,4230172..4230296,
FT                   4232256..4232364,4234134..4234207,4234766..4234921,
FT                   4238838..4238970,4239700..4239779,4240862..4240990,
FT                   4243441..4243528,4246047..4246097,4248384..4248478,
FT                   4257428..>4257449))
FT                   /codon_start=1
FT                   /gene="Allc"
FT                   /locus_tag="mCG_126922"
FT                   /product="allantoicase, isoform CRA_b"
FT                   /note="gene_id=mCG126922.1 transcript_id=mCT193427.0
FT                   protein_id=mCP114402.0 isoform=CRA_b"
FT                   /protein_id="EDL36959.1"
FT                   /translation="RLGSALLGSMADTPKEGKLTRFLDFTQLIDLASECVGGKVLFATD
FT                   DFFGPAENLIKSDSPTFKEHEYTEFGKWVDGWETRRKRIPGHDWCVIQLGIQGIIRGID
FT                   VDISYFSGNHAPRMSIQAANLSEEDTMSNIPPRGVRMGTAATPEEFEAVTELKSHSWDY
FT                   LVPMSELKLGDPDSSHNYYFVNSQQRWTHIRLNIFPDGGVARLRVYGTGQRDWAALGST
FT                   EPVDLVAIAFGGVCVGFSNAHFGHPNNMIGVGEPKSIADGWETARRLDRPPVLEASENG
FT                   LLLVPGCEWAVFRLAHPGVITQIEIDTKYFKGNCPNSCKVDGCILTTLEEEDMIRHNWN
FT                   LPAHKWKSLLPVTKLIPNQNHLLDSLTLELQDVITHAMITIAPDGGVSRLRLKGFPSSI
FT                   CLLRPLREKPLLRFSLKTGFRANL"
FT   CDS             complement(join(4228742..4228951,4230172..4230296,
FT                   4232256..4232364,4234134..4234207,4234766..4234921,
FT                   4238838..4238970,4239700..4239779,4240862..4240990,
FT                   4243441..4243528,4246047..4246097,4248384..4248473))
FT                   /codon_start=1
FT                   /gene="Allc"
FT                   /locus_tag="mCG_126922"
FT                   /product="allantoicase, isoform CRA_a"
FT                   /note="gene_id=mCG126922.1 transcript_id=mCT128198.1
FT                   protein_id=mCP78764.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q32MW4"
FT                   /db_xref="InterPro:IPR005164"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR015908"
FT                   /db_xref="MGI:MGI:2136971"
FT                   /db_xref="UniProtKB/TrEMBL:Q32MW4"
FT                   /protein_id="EDL36958.1"
FT                   /translation="MADTPKEGKLTRFLDFTQLIDLASECVGGKVLFATDDFFGPAENL
FT                   IKSDSPTFKEHEYTEFGKWVDGWETRRKRIPGHDWCVIQLGIQGIIRGIDVDISYFSGN
FT                   HAPRMSIQAANLSEEDTMSNIPPRGVRMGTAATPEEFEAVTELKSHSWDYLVPMSELKL
FT                   GDPDSSHNYYFVNSQQRWTHIRLNIFPDGGVARLRVYGTGQRDWAALGSTEPVDLVAIA
FT                   FGGVCVGFSNAHFGHPNNMIGVGEPKSIADGWETARRLDRPPVLEASENGLLLVPGCEW
FT                   AVFRLAHPGVITQIEIDTKYFKGNCPNSCKVDGCILTTLEEEDMIRHNWNLPAHKWKSL
FT                   LPVTKLIPNQNHLLDSLTLELQDVITHAMITIAPDGGVSRLRLKGFPSSICLLRPLREK
FT                   PLLRFSLKTGFRANL"
FT   CDS             complement(join(4228742..4228951,4230172..4230296,
FT                   4232256..4232364,4234134..4234207,4234766..4234921,
FT                   4238838..4238970,4239700..4239779,4240862..4240990,
FT                   4243441..4243528,4246047..4246097,4248384..4248473))
FT                   /codon_start=1
FT                   /gene="Allc"
FT                   /locus_tag="mCG_126922"
FT                   /product="allantoicase, isoform CRA_a"
FT                   /note="gene_id=mCG126922.1 transcript_id=mCT127467.1
FT                   protein_id=mCP79084.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q32MW4"
FT                   /db_xref="InterPro:IPR005164"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR015908"
FT                   /db_xref="MGI:MGI:2136971"
FT                   /db_xref="UniProtKB/TrEMBL:Q32MW4"
FT                   /protein_id="EDL36960.1"
FT                   /translation="MADTPKEGKLTRFLDFTQLIDLASECVGGKVLFATDDFFGPAENL
FT                   IKSDSPTFKEHEYTEFGKWVDGWETRRKRIPGHDWCVIQLGIQGIIRGIDVDISYFSGN
FT                   HAPRMSIQAANLSEEDTMSNIPPRGVRMGTAATPEEFEAVTELKSHSWDYLVPMSELKL
FT                   GDPDSSHNYYFVNSQQRWTHIRLNIFPDGGVARLRVYGTGQRDWAALGSTEPVDLVAIA
FT                   FGGVCVGFSNAHFGHPNNMIGVGEPKSIADGWETARRLDRPPVLEASENGLLLVPGCEW
FT                   AVFRLAHPGVITQIEIDTKYFKGNCPNSCKVDGCILTTLEEEDMIRHNWNLPAHKWKSL
FT                   LPVTKLIPNQNHLLDSLTLELQDVITHAMITIAPDGGVSRLRLKGFPSSICLLRPLREK
FT                   PLLRFSLKTGFRANL"
FT   gene            complement(4268998..>4298584)
FT                   /locus_tag="mCG_19121"
FT                   /note="gene_id=mCG19121.1"
FT   mRNA            complement(join(4268998..4269872,4270067..4270162,
FT                   4270762..4270815,4273888..4273959,4287892..4287963,
FT                   4292687..4292842,4298527..>4298584))
FT                   /locus_tag="mCG_19121"
FT                   /product="mCG19121, transcript variant mCT17307"
FT                   /note="gene_id=mCG19121.1 transcript_id=mCT17307.2 created
FT                   on 10-SEP-2002"
FT   CDS             complement(join(4269481..4269872,4270067..4270162,
FT                   4270762..4270815,4273888..4273959,4287892..4287963,
FT                   4292687..4292842,4298527..>4298584))
FT                   /codon_start=1
FT                   /locus_tag="mCG_19121"
FT                   /product="mCG19121, isoform CRA_b"
FT                   /note="gene_id=mCG19121.1 transcript_id=mCT17307.2
FT                   protein_id=mCP10281.2 isoform=CRA_b"
FT                   /protein_id="EDL36957.1"
FT                   /translation="QCLCQPVTVRTAPSPSVHPGVGVLPALMMMRDLALAGMLISLAFL
FT                   SLLPSGCPQQTTEDACSVQILVPGLKGDAGEKGDKGAPGRPGRVGPTGEKGDMGDKGQK
FT                   GTVGRHGKIGPIGAKGEKGDSGDIGPPGPSGEPGIPCECSQLRKAIGEMDNQVTQLTTE
FT                   LKFIKNAVAGLRETESKIYLLVKEEKRYADAQLSCQARGGTLSMPKDEAANGLMASYLA
FT                   QAGLARVFIGINDLEKEGAFVYSDRSPMQTFNKWRSGEPNNAYDEEDCVEMVASGGWND
FT                   VACHITMYFMCEFDKENL"
FT   mRNA            complement(join(<4269848..4269890,4270067..4270162,
FT                   4270762..4270815,4273888..4273959,4287892..4287963,
FT                   4292687..4292842,4298527..>4298583))
FT                   /locus_tag="mCG_19121"
FT                   /product="mCG19121, transcript variant mCT193442"
FT                   /note="gene_id=mCG19121.1 transcript_id=mCT193442.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(<4269848..4269890,4270067..4270162,
FT                   4270762..4270815,4273888..4273959,4287892..4287963,
FT                   4292687..4292842,4298527..>4298581))
FT                   /codon_start=1
FT                   /locus_tag="mCG_19121"
FT                   /product="mCG19121, isoform CRA_a"
FT                   /note="gene_id=mCG19121.1 transcript_id=mCT193442.0
FT                   protein_id=mCP114412.0 isoform=CRA_a"
FT                   /protein_id="EDL36956.1"
FT                   /translation="CLCQPVTVRTAPSPSVHPGVGVLPALMMMRDLALAGMLISLAFLS
FT                   LLPSGCPQQTTEDACSVQILVPGLKGDAGEKGDKGAPGRPGRVGPTGEKGDMGDKGQKG
FT                   TVGRHGKIGPIGAKGEKGDSGDIGPPGPSGEPGIPCECSQLRKAIGEMDNQVTQLTTEL
FT                   KFIKNALPSPAAVAGLRET"
FT   gene            complement(4306630..>4311476)
FT                   /locus_tag="mCG_19129"
FT                   /note="gene_id=mCG19129.0"
FT   mRNA            complement(join(4306630..4306725,4307157..4307307,
FT                   4309305..4309369,4309746..4309889,4310967..4311038,
FT                   4311131..4311214,4311407..>4311476))
FT                   /locus_tag="mCG_19129"
FT                   /product="mCG19129"
FT                   /note="gene_id=mCG19129.0 transcript_id=mCT17310.0 created
FT                   on 03-SEP-2002"
FT   CDS             complement(join(4306648..4306725,4307157..4307307,
FT                   4309305..4309369,4309746..4309889,4310967..4311038,
FT                   4311131..4311214,4311407..>4311454))
FT                   /codon_start=1
FT                   /locus_tag="mCG_19129"
FT                   /product="mCG19129"
FT                   /note="gene_id=mCG19129.0 transcript_id=mCT17310.0
FT                   protein_id=mCP10279.0"
FT                   /protein_id="EDL36955.1"
FT                   /translation="AVLARAVPLSKPAIRQGEAMFSSSAKIVKPNGEKPDEFESGISQA
FT                   LLELEMNSDLKAQLRELNITAAKEIEVGGGRKAIIIFVPVPQLKSFQKIQVRLVRELEK
FT                   KFSGKHVVFIAQRRILPKPTRKSRTKNKQKRPRSRTLTAVHDAILEDLVFPSEIVGKRI
FT                   RVKLDGSRLIKVHLDKAQQNNVEHKVETFSGVYKKLTGKDVNFEFPEFQL"
FT   gene            <4326611..4336566
FT                   /gene="Rnaseh1"
FT                   /locus_tag="mCG_19128"
FT                   /note="gene_id=mCG19128.2"
FT   mRNA            join(<4326611..4326805,4329027..4329142,4330043..4330204,
FT                   4332587..4332686,4334621..4334701,4335149..4335273,
FT                   4335970..4336560)
FT                   /gene="Rnaseh1"
FT                   /locus_tag="mCG_19128"
FT                   /product="ribonuclease H1, transcript variant mCT193445"
FT                   /note="gene_id=mCG19128.2 transcript_id=mCT193445.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(<4326629..4326805,4329027..4329142,4330043..4330204,
FT                   4332587..4332686,4334256..4334310,4334617..4334701,
FT                   4335149..4335273,4335970..4336566)
FT                   /gene="Rnaseh1"
FT                   /locus_tag="mCG_19128"
FT                   /product="ribonuclease H1, transcript variant mCT17596"
FT                   /note="gene_id=mCG19128.2 transcript_id=mCT17596.1 created
FT                   on 03-SEP-2002"
FT   CDS             join(<4326675..4326805,4329027..4329142,4330043..4330204,
FT                   4332587..4332686,4334256..4334310,4334617..4334701,
FT                   4335149..4335273,4335970..4336056)
FT                   /codon_start=1
FT                   /gene="Rnaseh1"
FT                   /locus_tag="mCG_19128"
FT                   /product="ribonuclease H1, isoform CRA_a"
FT                   /note="gene_id=mCG19128.2 transcript_id=mCT17596.1
FT                   protein_id=mCP10276.1 isoform=CRA_a"
FT                   /protein_id="EDL36953.1"
FT                   /translation="VMRWLLPLSRTVTLAVVRLRRGICGLGMFYAVRRGRRTGVFLSWS
FT                   ECKAQVDRFPAARFKKFATEDEAWAFVRSSSSPDGSKGQESAHEQKSQAKTSKRPREPL
FT                   GEGEELPEPGPKHTRQDTEPSAVVSKDAFSYMGESVIVYTDGCCSSNGRKRARAGIGVY
FT                   WGPGHPLNVGIRLPGRQTNQRAEIHAACKAIMQAKAQNISKLVLYTDSMFTINGITNWV
FT                   QGWKKNGWRTSTGKDVINKEDFMELDELTQGMDIQWMHIPGHSGFVGNEEADRLAREGA
FT                   KQSED"
FT   CDS             join(<4326675..4326805,4329027..4329142,4330043..4330204,
FT                   4332587..4332686,4334621..4334701,4335149..4335158)
FT                   /codon_start=1
FT                   /gene="Rnaseh1"
FT                   /locus_tag="mCG_19128"
FT                   /product="ribonuclease H1, isoform CRA_b"
FT                   /note="gene_id=mCG19128.2 transcript_id=mCT193445.0
FT                   protein_id=mCP114414.0 isoform=CRA_b"
FT                   /protein_id="EDL36954.1"
FT                   /translation="VMRWLLPLSRTVTLAVVRLRRGICGLGMFYAVRRGRRTGVFLSWS
FT                   ECKAQVDRFPAARFKKFATEDEAWAFVRSSSSPDGSKGQESAHEQKSQAKTSKRPREPL
FT                   GEGEELPEPGPKHTRQDTEPSAVVSKDAFSYMGESVIVYTDGCCSSNGRKRARAGIGVY
FT                   WGPGHPFLQGHHASQGSEHQQAGSVHRQHVHHQWDN"
FT   gene            4351944..4359974
FT                   /gene="Adi1"
FT                   /locus_tag="mCG_19126"
FT                   /note="gene_id=mCG19126.2"
FT   mRNA            join(4351944..4352089,4357546..4357725,4359087..4359974)
FT                   /gene="Adi1"
FT                   /locus_tag="mCG_19126"
FT                   /product="acireductone dioxygenase 1, transcript variant
FT                   mCT17594"
FT                   /note="gene_id=mCG19126.2 transcript_id=mCT17594.2 created
FT                   on 15-JUL-2003"
FT   CDS             join(4351970..4352089,4357546..4357725,4359087..4359206)
FT                   /codon_start=1
FT                   /gene="Adi1"
FT                   /locus_tag="mCG_19126"
FT                   /product="acireductone dioxygenase 1, isoform CRA_b"
FT                   /note="gene_id=mCG19126.2 transcript_id=mCT17594.2
FT                   protein_id=mCP10278.2 isoform=CRA_b"
FT                   /protein_id="EDL36952.1"
FT                   /translation="MVQAWYMDESTADPRKPHRAQPDRPVSLEQLRTLGVLYWKIKMFF
FT                   EEHLHLDEEIRYILEGSGYFDVRDKEDKWIRISMEKGDMITLPAGIYHRFTLDEKNYVK
FT                   AMRLFVGEPVWTPYNRPADHFDARVQYMSFLEGTA"
FT   mRNA            join(4352197..4352266,4357546..4357725,4359087..4359616)
FT                   /gene="Adi1"
FT                   /locus_tag="mCG_19126"
FT                   /product="acireductone dioxygenase 1, transcript variant
FT                   mCT172859"
FT                   /note="gene_id=mCG19126.2 transcript_id=mCT172859.1 created
FT                   on 15-JUL-2003"
FT   CDS             join(4357552..4357725,4359087..4359206)
FT                   /codon_start=1
FT                   /gene="Adi1"
FT                   /locus_tag="mCG_19126"
FT                   /product="acireductone dioxygenase 1, isoform CRA_a"
FT                   /note="gene_id=mCG19126.2 transcript_id=mCT172859.1
FT                   protein_id=mCP95778.1 isoform=CRA_a"
FT                   /protein_id="EDL36951.1"
FT                   /translation="MFFEEHLHLDEEIRYILEGSGYFDVRDKEDKWIRISMEKGDMITL
FT                   PAGIYHRFTLDEKNYVKAMRLFVGEPVWTPYNRPADHFDARVQYMSFLEGTA"
FT   gene            4367501..4368243
FT                   /locus_tag="mCG_1041957"
FT                   /note="gene_id=mCG1041957.0"
FT   mRNA            4367501..4368243
FT                   /locus_tag="mCG_1041957"
FT                   /product="mCG1041957"
FT                   /note="gene_id=mCG1041957.0 transcript_id=mCT159661.1
FT                   created on 26-SEP-2002"
FT   CDS             4367532..4367654
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041957"
FT                   /product="mCG1041957"
FT                   /note="gene_id=mCG1041957.0 transcript_id=mCT159661.1
FT                   protein_id=mCP78982.1"
FT                   /protein_id="EDL36950.1"
FT                   /translation="MFISVAVVMVPLHSNRILRPWECGLGDHWVDLTCRCETIP"
FT   gene            complement(4368745..>4429019)
FT                   /gene="Ttc15"
FT                   /locus_tag="mCG_126920"
FT                   /note="gene_id=mCG126920.0"
FT   mRNA            complement(join(4368745..4369672,4369874..4369961,
FT                   4370596..4370696,4375476..4375574,4379922..4379995,
FT                   4381910..4381982,4390268..4390380,4399365..4399503,
FT                   4400688..4400801,4416577..4416693,4424872..4426109,
FT                   4428744..>4429019))
FT                   /gene="Ttc15"
FT                   /locus_tag="mCG_126920"
FT                   /product="tetratricopeptide repeat domain 15, transcript
FT                   variant mCT128196"
FT                   /note="gene_id=mCG126920.0 transcript_id=mCT128196.0
FT                   created on 10-SEP-2002"
FT   mRNA            complement(join(4369129..4369672,4369874..4369961,
FT                   4370596..4370696,4375476..4375574,4379922..4379995,
FT                   4381910..4381982,4390268..4390380,4399365..4399503,
FT                   4400688..4400801,4416577..4416693,4424872..4426109,
FT                   4428913..>4428972))
FT                   /gene="Ttc15"
FT                   /locus_tag="mCG_126920"
FT                   /product="tetratricopeptide repeat domain 15, transcript
FT                   variant mCT193425"
FT                   /note="gene_id=mCG126920.0 transcript_id=mCT193425.0
FT                   created on 09-MAR-2004"
FT   CDS             complement(join(4369430..4369672,4369874..4369961,
FT                   4370596..4370696,4375476..4375574,4379922..4379995,
FT                   4381910..4381982,4390268..4390380,4399365..4399503,
FT                   4400688..4400801,4416577..4416693,4424872..4426109,
FT                   4428913..>4428970))
FT                   /codon_start=1
FT                   /gene="Ttc15"
FT                   /locus_tag="mCG_126920"
FT                   /product="tetratricopeptide repeat domain 15, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG126920.0 transcript_id=mCT193425.0
FT                   protein_id=mCP114401.0 isoform=CRA_b"
FT                   /protein_id="EDL36949.1"
FT                   /translation="VISSDPFRLWVTRPQGRVADNMETAKDGEQSPSEASPSAQAGPEN
FT                   IPEPMSREEESQPLYHEETIDLGGDEFASEENEPTSEGSHNFGDKLNEHMMESVLISDS
FT                   PNNSEGDVGDLGCLQDVGEPPRGATDHRLPSSTDKEVVDTLSNGSETDGDDTPRDISDM
FT                   TPDSRASLKEDSTQEDVTSMPALENAATEEVGPKDSLAPREEQTSEVSSNQSSSKDEPL
FT                   PVCTIFSQATATPSQPHLFLQDGFESQMVKSPSFSSTSEMSAKTPPPMVQPSPSLSTFF
FT                   GDTMSSNSLASDFFDSFTTSTFISVSNPNAGSPVPEKLSSLTAPVGEKSPDSTSPSYST
FT                   RMDRSESGVSRAPLDVPESPKPFSQIQAVFAGSDDPFATALSMSEMDRRNDAWLPSQAT
FT                   REVLMSVATQQYGTVFIDKENLTMPGLKFDNIQGDAVKDLMLRFLGEKAAAKRQVLNAS
FT                   SVEQSFVGLKQLISCRNWRAAVDLCGRLLTAHGQGYGKNGLPTSHTTDSLQLWFVRLAL
FT                   LVKLGLFQNAEMEFEPFGNLDQPDLYYEYYPHVYPGRRGSMVPFSMRILHAELQQYLGN
FT                   PQESLDRLHRVKTVCSKILANLEQGLAEDGGLSSVTQESRQASVQLWRSRLGRVLYSMA
FT                   NCLLLMKDYVLAVDAYLTVIKYYPEQEPQLLSGIGRILLQIGDIKTAEKYFQDVEKVTQ
FT                   KLDGLQGKIMVLMNRAFLYLGQNNFAEAHKFFTEILRMDPTNAVANNNAAVCLLYLGKL
FT                   KDSLRQLEAMVQQDPRHYLHESVLFNLTTMYELESSRSMQKKQSLLEAVASKEGDSFNT
FT                   QCLKLA"
FT   CDS             complement(join(4369430..4369672,4369874..4369961,
FT                   4370596..4370696,4375476..4375574,4379922..4379995,
FT                   4381910..4381982,4390268..4390380,4399365..4399503,
FT                   4400688..4400801,4416577..4416693,4424872..4426109,
FT                   4428744..>4428777))
FT                   /codon_start=1
FT                   /gene="Ttc15"
FT                   /locus_tag="mCG_126920"
FT                   /product="tetratricopeptide repeat domain 15, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG126920.0 transcript_id=mCT128196.0
FT                   protein_id=mCP78441.0 isoform=CRA_a"
FT                   /protein_id="EDL36948.1"
FT                   /translation="PILCAPCGFGQDNMETAKDGEQSPSEASPSAQAGPENIPEPMSRE
FT                   EESQPLYHEETIDLGGDEFASEENEPTSEGSHNFGDKLNEHMMESVLISDSPNNSEGDV
FT                   GDLGCLQDVGEPPRGATDHRLPSSTDKEVVDTLSNGSETDGDDTPRDISDMTPDSRASL
FT                   KEDSTQEDVTSMPALENAATEEVGPKDSLAPREEQTSEVSSNQSSSKDEPLPVCTIFSQ
FT                   ATATPSQPHLFLQDGFESQMVKSPSFSSTSEMSAKTPPPMVQPSPSLSTFFGDTMSSNS
FT                   LASDFFDSFTTSTFISVSNPNAGSPVPEKLSSLTAPVGEKSPDSTSPSYSTRMDRSESG
FT                   VSRAPLDVPESPKPFSQIQAVFAGSDDPFATALSMSEMDRRNDAWLPSQATREVLMSVA
FT                   TQQYGTVFIDKENLTMPGLKFDNIQGDAVKDLMLRFLGEKAAAKRQVLNASSVEQSFVG
FT                   LKQLISCRNWRAAVDLCGRLLTAHGQGYGKNGLPTSHTTDSLQLWFVRLALLVKLGLFQ
FT                   NAEMEFEPFGNLDQPDLYYEYYPHVYPGRRGSMVPFSMRILHAELQQYLGNPQESLDRL
FT                   HRVKTVCSKILANLEQGLAEDGGLSSVTQESRQASVQLWRSRLGRVLYSMANCLLLMKD
FT                   YVLAVDAYLTVIKYYPEQEPQLLSGIGRILLQIGDIKTAEKYFQDVEKVTQKLDGLQGK
FT                   IMVLMNRAFLYLGQNNFAEAHKFFTEILRMDPTNAVANNNAAVCLLYLGKLKDSLRQLE
FT                   AMVQQDPRHYLHESVLFNLTTMYELESSRSMQKKQSLLEAVASKEGDSFNTQCLKLA"
FT   gene            <4430404..4546858
FT                   /gene="Tssc1"
FT                   /locus_tag="mCG_19124"
FT                   /note="gene_id=mCG19124.1"
FT   mRNA            join(<4430404..4430607,4436781..4436864,4443669..4443801,
FT                   4508343..4508499,4527705..4527804,4538796..4538932,
FT                   4542334..4542501,4544045..4544209,4546283..4546858)
FT                   /gene="Tssc1"
FT                   /locus_tag="mCG_19124"
FT                   /product="tumor suppressing subtransferable candidate 1,
FT                   transcript variant mCT17592"
FT                   /note="gene_id=mCG19124.1 transcript_id=mCT17592.1 created
FT                   on 10-SEP-2002"
FT   mRNA            join(<4430450..4430589,4436781..4436864,4443669..4443801,
FT                   4508343..4508499,4527705..4527804,4538796..4538932,
FT                   4542334..4542501,4544045..4544209,4546283..4546852)
FT                   /gene="Tssc1"
FT                   /locus_tag="mCG_19124"
FT                   /product="tumor suppressing subtransferable candidate 1,
FT                   transcript variant mCT193444"
FT                   /note="gene_id=mCG19124.1 transcript_id=mCT193444.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<4430530..4430607,4436781..4436864,4443669..4443801,
FT                   4508343..4508499,4527705..4527804,4538796..4538932,
FT                   4542334..4542501,4544045..4544209,4546283..4546457)
FT                   /codon_start=1
FT                   /gene="Tssc1"
FT                   /locus_tag="mCG_19124"
FT                   /product="tumor suppressing subtransferable candidate 1,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG19124.1 transcript_id=mCT17592.1
FT                   protein_id=mCP10269.1 isoform=CRA_b"
FT                   /protein_id="EDL36946.1"
FT                   /translation="LGRQSIMEDDAPVIYGLEFQVSMAESARALTPQTAETDAIRFLVG
FT                   TQSLKYDNQIHIIDFDDENNIINKNVLLHQAGEIWHISASPADKGVLATCYNKTTDSRV
FT                   QACAAVWRMPKELESGSHESPDDPASTAQTLELLCHLDNSAQGNVACVVWEPMGDGKKV
FT                   ISLADSHILLWDLQPSSSQAVLASSATLEGRGQLKFTAGRWSPHHNCTQVATASDTTLR
FT                   GWDTRSMSQIYCIENAHGQLVRDLDFNPNKQYYLASCGDDCKVKFWDTRNVTEPVKTLE
FT                   EHSHWVWSVRYNHSHDQLVLTGSSDSRVILSNMVSISSEPFGHLVDDGDISDPEEHHAE
FT                   KSKEPLQDNVIATYEEHEDSVYAVDWASADPWLFASLSYDGRLVINRVPRALKYHILL"
FT   CDS             join(<4430530..4430589,4436781..4436864,4443669..4443801,
FT                   4508343..4508499,4527705..4527804,4538796..4538932,
FT                   4542334..4542501,4544045..4544209,4546283..4546457)
FT                   /codon_start=1
FT                   /gene="Tssc1"
FT                   /locus_tag="mCG_19124"
FT                   /product="tumor suppressing subtransferable candidate 1,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG19124.1 transcript_id=mCT193444.0
FT                   protein_id=mCP114413.0 isoform=CRA_c"
FT                   /protein_id="EDL36947.1"
FT                   /translation="LGRQSIMEDDAPVIYGLEFQARALTPQTAETDAIRFLVGTQSLKY
FT                   DNQIHIIDFDDENNIINKNVLLHQAGEIWHISASPADKGVLATCYNKTTDSRVQACAAV
FT                   WRMPKELESGSHESPDDPASTAQTLELLCHLDNSAQGNVACVVWEPMGDGKKVISLADS
FT                   HILLWDLQPSSSQAVLASSATLEGRGQLKFTAGRWSPHHNCTQVATASDTTLRGWDTRS
FT                   MSQIYCIENAHGQLVRDLDFNPNKQYYLASCGDDCKVKFWDTRNVTEPVKTLEEHSHWV
FT                   WSVRYNHSHDQLVLTGSSDSRVILSNMVSISSEPFGHLVDDGDISDPEEHHAEKSKEPL
FT                   QDNVIATYEEHEDSVYAVDWASADPWLFASLSYDGRLVINRVPRALKYHILL"
FT   mRNA            join(4480367..4480397,4508343..4508499,4527705..4527804,
FT                   4538796..4538932,4542334..4542501,4544045..4544209,
FT                   4546283..4546770)
FT                   /gene="Tssc1"
FT                   /locus_tag="mCG_19124"
FT                   /product="tumor suppressing subtransferable candidate 1,
FT                   transcript variant mCT173190"
FT                   /note="gene_id=mCG19124.1 transcript_id=mCT173190.0 created
FT                   on 10-SEP-2002"
FT   CDS             join(4508384..4508499,4527705..4527804,4538796..4538932,
FT                   4542334..4542501,4544045..4544209,4546283..4546457)
FT                   /codon_start=1
FT                   /gene="Tssc1"
FT                   /locus_tag="mCG_19124"
FT                   /product="tumor suppressing subtransferable candidate 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG19124.1 transcript_id=mCT173190.0
FT                   protein_id=mCP96109.0 isoform=CRA_a"
FT                   /protein_id="EDL36945.1"
FT                   /translation="MPKELESGSHESPDDPASTAQTLELLCHLDNSAQGNVACVVWEPM
FT                   GDGKKVISLADSHILLWDLQPSSSQAVLASSATLEGRGQLKFTAGRWSPHHNCTQVATA
FT                   SDTTLRGWDTRSMSQIYCIENAHGQLVRDLDFNPNKQYYLASCGDDCKVKFWDTRNVTE
FT                   PVKTLEEHSHWVWSVRYNHSHDQLVLTGSSDSRVILSNMVSISSEPFGHLVDDGDISDP
FT                   EEHHAEKSKEPLQDNVIATYEEHEDSVYAVDWASADPWLFASLSYDGRLVINRVPRALK
FT                   YHILL"
FT   gene            <4799832..4857629
FT                   /locus_tag="mCG_145560"
FT                   /note="gene_id=mCG145560.0"
FT   mRNA            join(<4799832..4799984,4822632..4822677,4824982..4825106,
FT                   4855732..4857629)
FT                   /locus_tag="mCG_145560"
FT                   /product="mCG145560"
FT                   /note="gene_id=mCG145560.0 transcript_id=mCT184984.0
FT                   created on 05-JUN-2003"
FT   CDS             <4857271..4857606
FT                   /codon_start=1
FT                   /locus_tag="mCG_145560"
FT                   /product="mCG145560"
FT                   /note="gene_id=mCG145560.0 transcript_id=mCT184984.0
FT                   protein_id=mCP105144.0"
FT                   /protein_id="EDL36944.1"
FT                   /translation="LWVPRPQSSIEHPQSDGVGITICPSLLSIAVVNTMTMEEKIEFQL
FT                   KAYGPPQRKVRARTQGRNWKARTKTEAMAEYATAHWFDPLGSLSWLSYPKLGVASQQWA
FT                   GSSQSHH"
FT   gene            complement(<4968871..>4978093)
FT                   /locus_tag="mCG_48644"
FT                   /note="gene_id=mCG48644.1"
FT   mRNA            complement(join(<4968871..4968983,4972554..4972614,
FT                   4975471..4975516,4977864..>4978093))
FT                   /locus_tag="mCG_48644"
FT                   /product="mCG48644"
FT                   /note="gene_id=mCG48644.1 transcript_id=mCT48827.0 created
FT                   on 26-SEP-2002"
FT   CDS             complement(join(4968871..4968983,4972554..4972614,
FT                   4975471..4975516,4977864..4978093))
FT                   /codon_start=1
FT                   /locus_tag="mCG_48644"
FT                   /product="mCG48644"
FT                   /note="gene_id=mCG48644.1 transcript_id=mCT48827.0
FT                   protein_id=mCP32220.0"
FT                   /protein_id="EDL36943.1"
FT                   /translation="MVEVGVNRFGHIGRLVTRAAICSPHGKVVAINDPFIDLNYMVYRF
FT                   QSDSTHSKFNGTVKAENGKLVINGKPITISQELTFSTNHDNHTLPGYGALAKAQQCLLQ
FT                   EVLVCLLPGAPDQIVVELPEPVPLCLTFLEDVPMGFIEVSASLPS"
FT   gene            complement(<5172694..5173830)
FT                   /locus_tag="mCG_148254"
FT                   /note="gene_id=mCG148254.0"
FT   mRNA            complement(join(<5172694..5173552,5173769..5173830))
FT                   /locus_tag="mCG_148254"
FT                   /product="mCG148254"
FT                   /note="gene_id=mCG148254.0 transcript_id=mCT188517.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(<5172694..5172959)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148254"
FT                   /product="mCG148254"
FT                   /note="gene_id=mCG148254.0 transcript_id=mCT188517.0
FT                   protein_id=mCP108087.0"
FT                   /protein_id="EDL36942.1"
FT                   /translation="MWRLTKTGISSPSLSHRAGGRGSSNACLFGSQPKARSSPGEACSC
FT                   LKLFYQTVSILRISCSIQSEHGKIEATECCSWTKFIANKSHFFS"
FT   gene            5173365..5174732
FT                   /locus_tag="mCG_148271"
FT                   /note="gene_id=mCG148271.0"
FT   mRNA            join(5173365..5173403,5174014..5174732)
FT                   /locus_tag="mCG_148271"
FT                   /product="mCG148271"
FT                   /note="gene_id=mCG148271.0 transcript_id=mCT188534.0
FT                   created on 13-JAN-2004"
FT   CDS             5174163..5174324
FT                   /codon_start=1
FT                   /locus_tag="mCG_148271"
FT                   /product="mCG148271"
FT                   /note="gene_id=mCG148271.0 transcript_id=mCT188534.0
FT                   protein_id=mCP108105.0"
FT                   /protein_id="EDL36941.1"
FT                   /translation="MCHSCPRDIFPPKLLHTKQSEKASPCSLLGGLLVSHPLLVGVFQF
FT                   FDSLDCGL"
FT   gene            <5290486..5570331
FT                   /gene="Myt1l"
FT                   /locus_tag="mCG_7819"
FT                   /note="gene_id=mCG7819.2"
FT   mRNA            join(<5290486..5290593,5376660..5376795,5423481..5423634,
FT                   5431650..5431704,5431884..5431917,5432250..5432312,
FT                   5459521..5459882,5475047..5476018,5480470..5480604,
FT                   5484527..5484617,5486217..5486324,5490556..5490770,
FT                   5497328..5497578,5499594..5499830,5502292..5502413,
FT                   5503274..5503342,5535521..5535583,5542735..5542818,
FT                   5544628..5544849,5560296..5560387,5563769..5563872,
FT                   5569375..5569518,5569821..5570331)
FT                   /gene="Myt1l"
FT                   /locus_tag="mCG_7819"
FT                   /product="myelin transcription factor 1-like, transcript
FT                   variant mCT193512"
FT                   /note="gene_id=mCG7819.2 transcript_id=mCT193512.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(5290487..5290593,5376660..5376795,5423481..5423634,
FT                   5431650..5431704,5431884..5431917,5432250..5432312,
FT                   5459521..5459882,5475050..5476018,5480470..5480604,
FT                   5484527..5484617,5486217..5486324,5490556..5490770,
FT                   5497328..5497578,5499594..5499830,5502292..5502413,
FT                   5503274..5503342,5535521..5535583,5542735..5542818,
FT                   5544628..5544849,5560296..5560387,5563769..5563872,
FT                   5569375..5569518,5569821..5570213)
FT                   /gene="Myt1l"
FT                   /locus_tag="mCG_7819"
FT                   /product="myelin transcription factor 1-like, transcript
FT                   variant mCT6994"
FT                   /note="gene_id=mCG7819.2 transcript_id=mCT6994.2 created on
FT                   08-NOV-2002"
FT   mRNA            join(<5290487..5290593,5376660..5376795,5423481..5423634,
FT                   5431650..5431704,5431884..5431917,5432250..5432312,
FT                   5459521..5459882,5475050..5476012,5480470..5480604,
FT                   5484527..5484617,5486217..5486324,5490556..5490770,
FT                   5497328..5497578,5499594..5499830,5502292..5502413,
FT                   5503274..5503342,5535521..5535583,5542735..5542818,
FT                   5544628..5544849,5560296..5560387,5563769..5563872,
FT                   5569375..5569518,5569821..5570213)
FT                   /gene="Myt1l"
FT                   /locus_tag="mCG_7819"
FT                   /product="myelin transcription factor 1-like, transcript
FT                   variant mCT193511"
FT                   /note="gene_id=mCG7819.2 transcript_id=mCT193511.0 created
FT                   on 09-MAR-2004"
FT   gene            complement(5321565..5332410)
FT                   /locus_tag="mCG_148243"
FT                   /note="gene_id=mCG148243.0"
FT   mRNA            complement(join(5321565..5323656,5324955..5325055,
FT                   5328407..5329197,5332328..5332410))
FT                   /locus_tag="mCG_148243"
FT                   /product="mCG148243"
FT                   /note="gene_id=mCG148243.0 transcript_id=mCT188506.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(5322019..5322354)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148243"
FT                   /product="mCG148243"
FT                   /note="gene_id=mCG148243.0 transcript_id=mCT188506.0
FT                   protein_id=mCP108079.0"
FT                   /protein_id="EDL36940.1"
FT                   /translation="MERICDSNIMGRHFASLTEGFSNSLFREETLPCAPRSPSLRAILY
FT                   AMLPAVSTGSPVCQRAPRKPVLFVRALGLLGAHLGEDYQCIATWLRVQVFRAPAALQVF
FT                   TAPCWKL"
FT   CDS             join(<5423557..5423634,5431650..5431704,5431884..5431917,
FT                   5432250..5432312,5459521..5459882,5475047..5476018,
FT                   5480470..5480604,5484527..5484617,5486217..5486324,
FT                   5490556..5490770,5497328..5497578,5499594..5499830,
FT                   5502292..5502413,5503274..5503342,5535521..5535583,
FT                   5542735..5542818,5544628..5544849,5560296..5560387,
FT                   5563769..5563872,5569375..5569518,5569821..5569961)
FT                   /codon_start=1
FT                   /gene="Myt1l"
FT                   /locus_tag="mCG_7819"
FT                   /product="myelin transcription factor 1-like, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG7819.2 transcript_id=mCT193512.0
FT                   protein_id=mCP114479.0 isoform=CRA_b"
FT                   /protein_id="EDL36938.1"
FT                   /translation="RELALGLHPAHGVTLPPSSGEKASYKMDVDSEEKRHRTRSKGVRV
FT                   PVEPAIQELFSCPTPGCDGSGHVSGKYARHRSVYGCPLAKKRKTQDKQPQEPAPKRKPF
FT                   AVKADSSSVDECYESDGTEDMDDKEEDDDEEFSEDNDEQGDDDDEDEVDREDEEEIEEE
FT                   DDEDDDDDEDGDDVEEEEEDDDEEEEEEEEEEENEDHQMSCTRIMQDTDKDDNNNDEYD
FT                   NYDELVAKSLLNLGKIAEDAAYRARTESEMNSNTSNSLEDDSDKNENLGRKSELSLDLD
FT                   SDVVRETVDSLKLLAQGHGVVLSENISDRSYAEGMSQQDSRNMNYVMLGKPMNNGLMEK
FT                   MVEESDEEVCLSSLECLRNQCFDLARKLSETNPQDRSQPPNMSVRQHVRQEDDFPGRTP
FT                   DRSYSDMMNLMRLEEQLSPRSRTFSSCAKEDGCHERDDDTTSVNSDRSEEVFDMTKGNL
FT                   TLLEKAIALETERAKAMREKMAMDAGRRDNLRSYEDQSPRQLAGEDRKSKSSDSHVKKP
FT                   YYGKDPSRTEKRESKCPTPGCDGTGHVTGLYPHHRSLSGCPHKDRVPPEILAMHENVLK
FT                   CPTPGCTGRGHVNSNRNSHRSLSGCPIAAAEKLAKAQEKHQSCDVSKSNQASDRVLRPM
FT                   CFVKQLEIPQYGYRNNVPTTTPRSNLAKELEKYSKTSFEYNSYDNHTYGKRAIAPKVQT
FT                   RDISPKGYDDAKRYCKNASPSSSTTSSYAPSSSSNLSCGGGSSASSTCSKSSFDYTHDM
FT                   EAAHMAATAILNLSTRCREMPQNLSTKPQDLCTARNPDMEVDENGTLDLSMNKQRPRDS
FT                   CCPVLTPLEPMSPQQQAVMNSRCFQLSEGDCWDLPVDYTKMKPRRVDEDEPKEITPEDL
FT                   DPFQEALEERRYPGEVTIPSPKPKYPQCKESKKDLITLSGCPLADKSIRSMLATSSQEL
FT                   KCPTPGCDGSGHITGNYASHRSLSGCPRAKKSGIRIAQSKEDKEDQEPIRCPVPGCDGQ
FT                   GHITGKYASHRSASGCPLAAKRQKDGYLNGSQFSWKSVKTEGMSCPTPGCDGSGHVSGS
FT                   FLTHRSLSGCPRATSAMKKAKLSGEQMLTIKQRASNGIENDEEIKQLDEEIKELNESNS
FT                   QMEADMIKLRTQITTMESNLKTIEEENKVIEQQNESLLHELANLSQSLIHSLANIQLPH
FT                   MDPINEQNFDAYVTTLTEMYTNQDRYQSPENKALLENIKQAVRGIQV"
FT   CDS             join(<5423557..5423634,5431650..5431704,5431884..5431917,
FT                   5432250..5432312,5459521..5459882,5475050..5476012,
FT                   5480470..5480604,5484527..5484617,5486217..5486324,
FT                   5490556..5490770,5497328..5497578,5499594..5499830,
FT                   5502292..5502413,5503274..5503342,5535521..5535583,
FT                   5542735..5542818,5544628..5544849,5560296..5560387,
FT                   5563769..5563872,5569375..5569518,5569821..5569961)
FT                   /codon_start=1
FT                   /gene="Myt1l"
FT                   /locus_tag="mCG_7819"
FT                   /product="myelin transcription factor 1-like, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG7819.2 transcript_id=mCT193511.0
FT                   protein_id=mCP114478.0 isoform=CRA_a"
FT                   /protein_id="EDL36937.1"
FT                   /translation="RELALGLHPAHGVTLPPSSGEKASYKMDVDSEEKRHRTRSKGVRV
FT                   PVEPAIQELFSCPTPGCDGSGHVSGKYARHRSVYGCPLAKKRKTQDKQPQEPAPKRKPF
FT                   AVKADSSSVDECYESDGTEDMDDKEEDDDEEFSEDNDEQGDDDDEDEVDREDEEEIEEE
FT                   DDEDDDDDEDGDDVEEEEEDDDEEEEEEEEEEENDHQMSCTRIMQDTDKDDNNNDEYDN
FT                   YDELVAKSLLNLGKIAEDAAYRARTESEMNSNTSNSLEDDSDKNENLGRKSELSLDLDS
FT                   DVVRETVDSLKLLAQGHGVVLSENISDRSYAEGMSQQDSRNMNYVMLGKPMNNGLMEKM
FT                   VEESDEEVCLSSLECLRNQCFDLARKLSETNPQDRSQPPNMSVRQHVRQEDDFPGRTPD
FT                   RSYSDMMNLMRLEEQLSPRSRTFSSCAKEDGCHERDDDTTSVNSDRSEEVFDMTKGNLT
FT                   LLEKAIALETERAKAMREKMAMDAGRRDNLRSYEDQSPRQLAGEDRKSKSSDSHVKKPY
FT                   YDPSRTEKRESKCPTPGCDGTGHVTGLYPHHRSLSGCPHKDRVPPEILAMHENVLKCPT
FT                   PGCTGRGHVNSNRNSHRSLSGCPIAAAEKLAKAQEKHQSCDVSKSNQASDRVLRPMCFV
FT                   KQLEIPQYGYRNNVPTTTPRSNLAKELEKYSKTSFEYNSYDNHTYGKRAIAPKVQTRDI
FT                   SPKGYDDAKRYCKNASPSSSTTSSYAPSSSSNLSCGGGSSASSTCSKSSFDYTHDMEAA
FT                   HMAATAILNLSTRCREMPQNLSTKPQDLCTARNPDMEVDENGTLDLSMNKQRPRDSCCP
FT                   VLTPLEPMSPQQQAVMNSRCFQLSEGDCWDLPVDYTKMKPRRVDEDEPKEITPEDLDPF
FT                   QEALEERRYPGEVTIPSPKPKYPQCKESKKDLITLSGCPLADKSIRSMLATSSQELKCP
FT                   TPGCDGSGHITGNYASHRSLSGCPRAKKSGIRIAQSKEDKEDQEPIRCPVPGCDGQGHI
FT                   TGKYASHRSASGCPLAAKRQKDGYLNGSQFSWKSVKTEGMSCPTPGCDGSGHVSGSFLT
FT                   HRSLSGCPRATSAMKKAKLSGEQMLTIKQRASNGIENDEEIKQLDEEIKELNESNSQME
FT                   ADMIKLRTQITTMESNLKTIEEENKVIEQQNESLLHELANLSQSLIHSLANIQLPHMDP
FT                   INEQNFDAYVTTLTEMYTNQDRYQSPENKALLENIKQAVRGIQV"
FT   CDS             join(5431650..5431704,5431884..5431917,5432250..5432312,
FT                   5459521..5459882,5475050..5476018,5480470..5480604,
FT                   5484527..5484617,5486217..5486324,5490556..5490770,
FT                   5497328..5497578,5499594..5499830,5502292..5502413,
FT                   5503274..5503342,5535521..5535583,5542735..5542818,
FT                   5544628..5544849,5560296..5560387,5563769..5563872,
FT                   5569375..5569518,5569821..5569961)
FT                   /codon_start=1
FT                   /gene="Myt1l"
FT                   /locus_tag="mCG_7819"
FT                   /product="myelin transcription factor 1-like, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG7819.2 transcript_id=mCT6994.2
FT                   protein_id=mCP10273.2 isoform=CRA_c"
FT                   /protein_id="EDL36939.1"
FT                   /translation="MDVDSEEKRHRTRSKGVRVPVEPAIQELFSCPTPGCDGSGHVSGK
FT                   YARHRSVYGCPLAKKRKTQDKQPQEPAPKRKPFAVKADSSSVDECYESDGTEDMDDKEE
FT                   DDDEEFSEDNDEQGDDDDEDEVDREDEEEIEEEDDEDDDDDEDGDDVEEEEEDDDEEEE
FT                   EEEEEEENDHQMSCTRIMQDTDKDDNNNDEYDNYDELVAKSLLNLGKIAEDAAYRARTE
FT                   SEMNSNTSNSLEDDSDKNENLGRKSELSLDLDSDVVRETVDSLKLLAQGHGVVLSENIS
FT                   DRSYAEGMSQQDSRNMNYVMLGKPMNNGLMEKMVEESDEEVCLSSLECLRNQCFDLARK
FT                   LSETNPQDRSQPPNMSVRQHVRQEDDFPGRTPDRSYSDMMNLMRLEEQLSPRSRTFSSC
FT                   AKEDGCHERDDDTTSVNSDRSEEVFDMTKGNLTLLEKAIALETERAKAMREKMAMDAGR
FT                   RDNLRSYEDQSPRQLAGEDRKSKSSDSHVKKPYYGKDPSRTEKRESKCPTPGCDGTGHV
FT                   TGLYPHHRSLSGCPHKDRVPPEILAMHENVLKCPTPGCTGRGHVNSNRNSHRSLSGCPI
FT                   AAAEKLAKAQEKHQSCDVSKSNQASDRVLRPMCFVKQLEIPQYGYRNNVPTTTPRSNLA
FT                   KELEKYSKTSFEYNSYDNHTYGKRAIAPKVQTRDISPKGYDDAKRYCKNASPSSSTTSS
FT                   YAPSSSSNLSCGGGSSASSTCSKSSFDYTHDMEAAHMAATAILNLSTRCREMPQNLSTK
FT                   PQDLCTARNPDMEVDENGTLDLSMNKQRPRDSCCPVLTPLEPMSPQQQAVMNSRCFQLS
FT                   EGDCWDLPVDYTKMKPRRVDEDEPKEITPEDLDPFQEALEERRYPGEVTIPSPKPKYPQ
FT                   CKESKKDLITLSGCPLADKSIRSMLATSSQELKCPTPGCDGSGHITGNYASHRSLSGCP
FT                   RAKKSGIRIAQSKEDKEDQEPIRCPVPGCDGQGHITGKYASHRSASGCPLAAKRQKDGY
FT                   LNGSQFSWKSVKTEGMSCPTPGCDGSGHVSGSFLTHRSLSGCPRATSAMKKAKLSGEQM
FT                   LTIKQRASNGIENDEEIKQLDEEIKELNESNSQMEADMIKLRTQITTMESNLKTIEEEN
FT                   KVIEQQNESLLHELANLSQSLIHSLANIQLPHMDPINEQNFDAYVTTLTEMYTNQDRYQ
FT                   SPENKALLENIKQAVRGIQV"
FT   gene            <5587598..5664899
FT                   /gene="Pxdn"
FT                   /locus_tag="mCG_7811"
FT                   /note="gene_id=mCG7811.1"
FT   mRNA            join(<5587598..5587788,5622183..5622254,5623856..5623927,
FT                   5627582..5627653,5630631..5630702,5631033..5631104,
FT                   5632764..5632933,5633174..5633291,5635375..5635544,
FT                   5639044..5639316,5641850..5641966,5642899..5643057,
FT                   5643747..5643859,5644891..5645047,5650366..5651869,
FT                   5654167..5654301,5654977..5655185,5660409..5660529,
FT                   5660791..5660920,5663044..5663157,5664641..5664899)
FT                   /gene="Pxdn"
FT                   /locus_tag="mCG_7811"
FT                   /product="peroxidasin homolog (Drosophila)"
FT                   /note="gene_id=mCG7811.1 transcript_id=mCT6946.1 created on
FT                   10-SEP-2002"
FT   CDS             join(5587598..5587788,5622183..5622254,5623856..5623927,
FT                   5627582..5627653,5630631..5630702,5631033..5631104,
FT                   5632764..5632933,5633174..5633291,5635375..5635544,
FT                   5639044..5639316,5641850..5641966,5642899..5643057,
FT                   5643747..5643859,5644891..5645047,5650366..5651869,
FT                   5654167..5654301,5654977..5655185,5660409..5660529,
FT                   5660791..5660920,5663044..5663157,5664641..5664739)
FT                   /codon_start=1
FT                   /gene="Pxdn"
FT                   /locus_tag="mCG_7811"
FT                   /product="peroxidasin homolog (Drosophila)"
FT                   /note="gene_id=mCG7811.1 transcript_id=mCT6946.1
FT                   protein_id=mCP10268.1"
FT                   /protein_id="EDL36936.1"
FT                   /translation="MAVRPMRRCLLALVLCFAWWAMAVVASKQGAGCPSRCLCFRTTVR
FT                   CMHLLLEAVPAVAPQTSILDLRFNRIREIQPGAFRRLRSLNTLLLNNNQIKKIPNGAFE
FT                   DLENLKYLYLYKNEIQSIDRQAFKGLASLEQLYLHFNQIETLDPESFQHLPKLERLFLH
FT                   NNRITHLVPGTFSQLESMKRLRLDSNALHCDCEILWLADLLKTYAQSGNAQAAATCEYP
FT                   RRIQGRSVATITPEELNCERPRITSEPQDADVTSGNTVYFTCRAEGNPKPEIIWLRNNN
FT                   ELSMKTDSRLNLLDDGTLMIQNTQEADEGVYQCMAKNVAGEAKTQEVTLRYLGSPARPT
FT                   FVIQPQNTEVLVGESVTLECSATGHPLPQITWTRGDRTPLPIDPRVNITPSGGLYIQNV
FT                   AQSDSGEYTCFASNSVDSIHATAFIIVQALPQFTVTPQSRVVIEGQTVDFQCAAKGHPQ
FT                   PVIAWTKGGSQLSVDRRHLVLSSGTLRISGVALHDQGQYECQAVNIIGSQKVVAHLTVQ
FT                   PRVTPVFASIPSDMTVEVGTNVQLPCSSQGEPEPAITWNKDGVQVTESGKFHISPEGFL
FT                   TINDVGTADAGRYECVARNTIGYASVSMVLSVNGYHYNDLVSPQYLSLIANLSGCTAHR
FT                   RVNNCSDMCFHQKYRTHDGTCNNLQHPMWGASLTAFERLLKAVYENGFNTPRGINSQRQ
FT                   YNGHVLPMPRLVSTTLIGTEVITPDEQFTHMLMQWGQFLDHDLDSTVVALSQARFSDGQ
FT                   HCSSVCSNDPPCFSVMIPPNDPRVRSGARCMFFVRSSPVCGSGMTSLLMNSVYPREQIN
FT                   QLTSYIDASNVYGSTDHEARSIRDLASHRGLLRQGIVQRSGKPLLPFATGPPTECMRDE
FT                   NESPIPCFLAGDHRANEQLGLTSMHTLWFREHNRIAAELLKLNPHWDGDTVYHETRKIV
FT                   GAEIQHITYRHWLPKILGEVGMKMLGEYRGYDPSVNAGIFNAFATAAFRFGHTLINPLL
FT                   YRLDENFEPIPQGHVPLHKAFFSPFRIVNEGGIDPLLRGLFGVAGKMRIPSQLLNTELT
FT                   ERLFSMAHTVALDLAAINIQRGRDHGIPPYHDYRVYCNLSAAYTFEDLKNEIKSPVIRE
FT                   KLQRLYGSTLNIDLFPALMVEDLVPGSRLGPTLMCLLSTQFRRLRDGDRLWYENPGVFS
FT                   PAQLTQLKQTSLARILCDNSDNITRVQQDVFRVAEFPHGYSSCEDIPRVDLRVWQDCCE
FT                   DCRTRGQFNAFSYHFRGRRSLEFSYEDDKPTKRARWRKALSVKHGKHLSNATSATHEHL
FT                   EGPATNDLKEFVLEMQKIITDLRKQINSLESRLSTTECVDDSGESHGGNTKWKKDPCTV
FT                   CECKGPSASNNNTNTNLHLATMSTLLHRTVTLSSHS"
FT   gene            complement(5664833..5666217)
FT                   /locus_tag="mCG_1041692"
FT                   /note="gene_id=mCG1041692.1"
FT   mRNA            complement(join(5664833..5664886,5664912..5666217))
FT                   /locus_tag="mCG_1041692"
FT                   /product="mCG1041692"
FT                   /note="gene_id=mCG1041692.1 transcript_id=mCT159396.1
FT                   created on 26-SEP-2002"
FT   CDS             complement(5665242..5665376)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041692"
FT                   /product="mCG1041692"
FT                   /note="gene_id=mCG1041692.1 transcript_id=mCT159396.1
FT                   protein_id=mCP78466.1"
FT                   /protein_id="EDL36935.1"
FT                   /translation="MAPILSFSTSSVFLRSSSLALGQVTLLCSHNGWHVVLGTSVSIG"
FT   gene            complement(5703198..>5771917)
FT                   /gene="Tpo"
FT                   /locus_tag="mCG_7809"
FT                   /note="gene_id=mCG7809.1"
FT   mRNA            complement(join(5703198..5703699,5721527..5721650,
FT                   5722833..5722932,5725067..5725198,5731623..5731793,
FT                   5733087..5733295,5735307..5735544,5738716..5738886,
FT                   5740537..5740795,5743269..5743769,5744121..5744327,
FT                   5745982..5746111,5756881..5757013,5759468..5759619,
FT                   5765281..5765365,5771824..>5771917))
FT                   /gene="Tpo"
FT                   /locus_tag="mCG_7809"
FT                   /product="thyroid peroxidase"
FT                   /note="gene_id=mCG7809.1 transcript_id=mCT6950.0 created on
FT                   03-SEP-2002"
FT   CDS             complement(join(5703661..5703699,5721527..5721650,
FT                   5722833..5722932,5725067..5725198,5731623..5731793,
FT                   5733087..5733295,5735307..5735544,5738716..5738886,
FT                   5740537..5740795,5743269..5743769,5744121..5744327,
FT                   5745982..5746111,5756881..5757013,5759468..5759619,
FT                   5765281..5765365,5771824..5771917))
FT                   /codon_start=1
FT                   /gene="Tpo"
FT                   /locus_tag="mCG_7809"
FT                   /product="thyroid peroxidase"
FT                   /note="gene_id=mCG7809.1 transcript_id=mCT6950.0
FT                   protein_id=mCP10280.0"
FT                   /protein_id="EDL36934.1"
FT                   /translation="MRTLGAMAIMLVVMGTVIFLSFILRSRDILCGKTMKSHVISVVET
FT                   SQLMVDHAVYNTMKRNLKKREVLSPAQLLSFFKLPESTSGAISRAAEIMETSIQVMKRE
FT                   QSQFSTDALSADILGTIANLSGCLPFMLPPRCPDTCLANKYRPITGACNNRDHPRWGAS
FT                   NTALARWLPPVYEDGFSQPKGWNPNFLYHGFPLPPVREVTRHLIQVSNEAVTEDDQYSD
FT                   FLPVWGQYIDHDIALTPQSTSTAAFWGGVDCQLTCENQNPCFPIQLPSNSSGTTACLPF
FT                   YRSSAACGTGDQGALFGNLSAANPRQQMNGLTSFLDASTVYGSSPGVEKQLRNWSSSAG
FT                   LLRVNTLHLDAGRAYLPFATAACAPEPGTPRTNRTPCFLAGDGRASEVPALAAVHTLWL
FT                   REHNRLASAFKAINKHWSANTAYQEARKVVGALHQIITMRDYIPKILGPDAFRQYVGPY
FT                   EGYNPTVNPTVSNIFSTAAFRFGHATVHPLVRRLNTDFQEHTELPRLQLRDVFFRPWRL
FT                   IQEGGLDPIVRGLLARAAKLQVQGQLMNEELTERLFVLSNVGTLDLASLNLQRGRDHGL
FT                   PDYNEWREFCGLSRLETPAELNKAIANRSMVNKIMDLYKHADNIDVWLGGLAEKFLPGA
FT                   RTGPLFACIIGKQMKALRDGDRFWWENTNVFTDAQRQELEKHSLPRVICDNTGLTRVPV
FT                   DAFRIGKFPQDFESCEDIPSMDLELWRETFPQDDKCIFPEEVDNGNFVHCEESGKLVLV
FT                   YSCFHGYKLQGQEQVTCTQNGWDSEPPVCKDVNECADLTHPPCHPSAQCKNTKGSFQCV
FT                   CTDPYVLGEDEKTCIDSGRLPRASWVSIALGALLIGGLASLTWIVICRWTHADKKATLP
FT                   ITERVTTQSGCRKSQGRGISPHKAAAQDTGQEPASGSRVLLCE"
FT   gene            complement(5816461..>6014414)
FT                   /gene="Sntg2"
FT                   /locus_tag="mCG_7810"
FT                   /note="gene_id=mCG7810.2"
FT   mRNA            complement(join(5816461..5817238,5831282..5831392,
FT                   5837052..5837133,5862331..5862537,5865130..5865201,
FT                   5872121..5872237,5878828..5878866,5880595..5880724,
FT                   5893470..5893597,5902515..5902606,5912530..5912617,
FT                   5942903..5942960,5943058..5943109,5951131..5951268,
FT                   6014243..>6014414))
FT                   /gene="Sntg2"
FT                   /locus_tag="mCG_7810"
FT                   /product="syntrophin, gamma 2, transcript variant
FT                   mCT193501"
FT                   /note="gene_id=mCG7810.2 transcript_id=mCT193501.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(5816463..5817238,5831282..5831392,
FT                   5837041..5837133,5862331..5862537,5865130..5865201,
FT                   5872121..5872237,5878828..5878866,5880595..5880724,
FT                   5893470..5893597,5902515..5902606,5912530..5912617,
FT                   5951131..5951268,6014243..>6014395))
FT                   /gene="Sntg2"
FT                   /locus_tag="mCG_7810"
FT                   /product="syntrophin, gamma 2, transcript variant mCT6951"
FT                   /note="gene_id=mCG7810.2 transcript_id=mCT6951.1 created on
FT                   03-SEP-2002"
FT   mRNA            complement(join(5816969..5817238,5831282..5831392,
FT                   5837041..5837133,5862331..5862537,5865130..5865201,
FT                   5872121..5872237,5878828..5878866,5880595..5880724,
FT                   5902515..5902606,5912530..5912617,5942903..5942960,
FT                   5943058..5943114,5951131..5951268,6014243..6014350))
FT                   /gene="Sntg2"
FT                   /locus_tag="mCG_7810"
FT                   /product="syntrophin, gamma 2, transcript variant
FT                   mCT193502"
FT                   /note="gene_id=mCG7810.2 transcript_id=mCT193502.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(5816973..5817238,5831282..5831392,
FT                   5837041..5837133,5862331..5862537,5865130..5865201,
FT                   5872121..5872237,5878828..5878866,5880595..5880724,
FT                   5893470..5893597,5902515..5902606,5912530..5912617,
FT                   5942903..5942960,5943058..5943091,5951131..5951268,
FT                   6014243..>6014394))
FT                   /gene="Sntg2"
FT                   /locus_tag="mCG_7810"
FT                   /product="syntrophin, gamma 2, transcript variant
FT                   mCT193499"
FT                   /note="gene_id=mCG7810.2 transcript_id=mCT193499.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(5816973..5817238,5831282..5831392,
FT                   5837041..5837133,5862331..5862537,5865130..5865201,
FT                   5872121..5872237,5878828..5878866,5880595..5880724,
FT                   5893470..5893597,5902515..5902606,5912530..5912617,
FT                   5942903..5942960,5943058..5943114,5951131..5951268,
FT                   6014243..>6014315))
FT                   /gene="Sntg2"
FT                   /locus_tag="mCG_7810"
FT                   /product="syntrophin, gamma 2, transcript variant
FT                   mCT193500"
FT                   /note="gene_id=mCG7810.2 transcript_id=mCT193500.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(5817107..5817238,5831282..5831392,
FT                   5837041..5837133,5862331..5862537,5865130..5865201,
FT                   5872121..5872237,5878828..5878866,5880595..5880724,
FT                   5893470..5893597,5902515..5902606,5912530..5912617,
FT                   5951131..5951268,6014243..>6014395))
FT                   /codon_start=1
FT                   /gene="Sntg2"
FT                   /locus_tag="mCG_7810"
FT                   /product="syntrophin, gamma 2, isoform CRA_d"
FT                   /note="gene_id=mCG7810.2 transcript_id=mCT6951.1
FT                   protein_id=mCP10282.1 isoform=CRA_d"
FT                   /protein_id="EDL36933.1"
FT                   /translation="TEGRGRRAGAGLRSSGARSARLAAWAAMSAEGSQSLAAPRGRPSH
FT                   LLVPARTKTALALLYDEGLENAYDVRLKLTKEVLTIQKQDVVCIGGAPPGANVHLLRNA
FT                   GDDVTITVEYLREAPSFLKLPLGSPGPSSDHSSRASSPLFDSGLHLNGHCSHTAPSSPS
FT                   SPIANEPKYEKRWLDTLSVPLSMARISRYKAGTEKLRSSALEVLALDGASTGVLQFSTA
FT                   QDCADWLRSISTNISDLTLQHMKMANKCCSPCDQVVHMGWVNERLQGADNSQNFRPKFL
FT                   ALRGSSFYIFGAPPVSTLDWGRAERAYNLCEVLFKVHKFWLSDNYWLQANLYLGLQDFD
FT                   CEDPRSYCFSVLANHGKSHIFSVELGSELAVWEKAFQRATFMEVQRTGSKTYLCSWQGE
FT                   TLCFTVDFALGFTCFDGKTKNVLWRFKFSQLKGSSDDGKTRVKLLFQNLDTKQIETKEL
FT                   EFQDLTAVLHCIHSFIAAKVASLDPVFMDSQSMARRYLCSS"
FT   CDS             complement(join(5817107..5817238,5831282..5831392,
FT                   5837041..5837133,5862331..5862537,5865130..5865201,
FT                   5872121..5872237,5878828..5878866,5880595..5880724,
FT                   5893470..5893597,5902515..5902606,5912530..5912617,
FT                   5942903..5942960,5943058..>5943065))
FT                   /codon_start=1
FT                   /gene="Sntg2"
FT                   /locus_tag="mCG_7810"
FT                   /product="syntrophin, gamma 2, isoform CRA_a"
FT                   /note="gene_id=mCG7810.2 transcript_id=mCT193499.0
FT                   protein_id=mCP114472.0 isoform=CRA_a"
FT                   /protein_id="EDL36929.1"
FT                   /translation="VSREEQSMGSPSSYLKYSKTKQVHLLRNAGDDVTITVEYLREAPS
FT                   FLKLPLGSPGPSSDHSSRASSPLFDSGLHLNGHCSHTAPSSPSSPIANEPKYEKRWLDT
FT                   LSVPLSMARISRYKAGTEKLRSSALEVLALDGASTGVLQFSTAQDCADWLRSISTNISD
FT                   LTLQHMKMANKCCSPCDQVVHMGWVNERLQGADNSQNFRPKFLALRGSSFYIFGAPPVS
FT                   TLDWGRAERAYNLCEVLFKVHKFWLSDNYWLQANLYLGLQDFDCEDPRSYCFSVLANHG
FT                   KSHIFSVELGSELAVWEKAFQRATFMEVQRTGSKTYLCSWQGETLCFTVDFALGFTCFD
FT                   GKTKNVLWRFKFSQLKGSSDDGKTRVKLLFQNLDTKQIETKELEFQDLTAVLHCIHSFI
FT                   AAKVASLDPVFMDSQSMARRYLCSS"
FT   CDS             complement(join(5817107..5817238,5831282..5831392,
FT                   5837041..5837133,5862331..5862537,5865130..5865201,
FT                   5872121..5872237,5878828..5878866,5880595..5880724,
FT                   5893470..5893597,5902515..5902606,5912530..5912617,
FT                   5942903..5942960,5943058..>5943065))
FT                   /codon_start=1
FT                   /gene="Sntg2"
FT                   /locus_tag="mCG_7810"
FT                   /product="syntrophin, gamma 2, isoform CRA_a"
FT                   /note="gene_id=mCG7810.2 transcript_id=mCT193500.0
FT                   protein_id=mCP114473.0 isoform=CRA_a"
FT                   /protein_id="EDL36930.1"
FT                   /translation="VSREEQSMGSPSSYLKYSKTKQVHLLRNAGDDVTITVEYLREAPS
FT                   FLKLPLGSPGPSSDHSSRASSPLFDSGLHLNGHCSHTAPSSPSSPIANEPKYEKRWLDT
FT                   LSVPLSMARISRYKAGTEKLRSSALEVLALDGASTGVLQFSTAQDCADWLRSISTNISD
FT                   LTLQHMKMANKCCSPCDQVVHMGWVNERLQGADNSQNFRPKFLALRGSSFYIFGAPPVS
FT                   TLDWGRAERAYNLCEVLFKVHKFWLSDNYWLQANLYLGLQDFDCEDPRSYCFSVLANHG
FT                   KSHIFSVELGSELAVWEKAFQRATFMEVQRTGSKTYLCSWQGETLCFTVDFALGFTCFD
FT                   GKTKNVLWRFKFSQLKGSSDDGKTRVKLLFQNLDTKQIETKELEFQDLTAVLHCIHSFI
FT                   AAKVASLDPVFMDSQSMARRYLCSS"
FT   CDS             complement(join(5817107..5817238,5831282..5831392,
FT                   5837041..5837133,5862331..5862537,5865130..5865201,
FT                   5872121..5872237,5878828..5878866,5880595..5880724,
FT                   5902515..5902534))
FT                   /codon_start=1
FT                   /gene="Sntg2"
FT                   /locus_tag="mCG_7810"
FT                   /product="syntrophin, gamma 2, isoform CRA_c"
FT                   /note="gene_id=mCG7810.2 transcript_id=mCT193502.0
FT                   protein_id=mCP114475.0 isoform=CRA_c"
FT                   /protein_id="EDL36932.1"
FT                   /translation="MDTAATQSSALEVLALDGASTGVLQFSTAQDCADWLRSISTNISD
FT                   LTLQHMKMANKCCSPCDQVVHMGWVNERLQGADNSQNFRPKFLALRGSSFYIFGAPPVS
FT                   TLDWGRAERAYNLCEVLFKVHKFWLSDNYWLQANLYLGLQDFDCEDPRSYCFSVLANHG
FT                   KSHIFSVELGSELAVWEKAFQRATFMEVQRTGSKTYLCSWQGETLCFTVDFALGFTCFD
FT                   GKTKNVLWRFKFSQLKGSSDDGKTRVKLLFQNLDTKQIETKELEFQDLTAVLHCIHSFI
FT                   AAKVASLDPVFMDSQSMARRYLCSS"
FT   CDS             complement(join(5831358..5831392,5837052..5837133,
FT                   5862331..5862537,5865130..5865201,5872121..5872237,
FT                   5878828..5878866,5880595..5880724,5893470..5893597,
FT                   5902515..5902606,5912530..5912617,5942903..5942960,
FT                   5943058..>5943065))
FT                   /codon_start=1
FT                   /gene="Sntg2"
FT                   /locus_tag="mCG_7810"
FT                   /product="syntrophin, gamma 2, isoform CRA_b"
FT                   /note="gene_id=mCG7810.2 transcript_id=mCT193501.0
FT                   protein_id=mCP114474.0 isoform=CRA_b"
FT                   /protein_id="EDL36931.1"
FT                   /translation="VSREEQSMGSPSSYLKYSKTKQVHLLRNAGDDVTITVEYLREAPS
FT                   FLKLPLGSPGPSSDHSSRASSPLFDSGLHLNGHCSHTAPSSPSSPIANEPKYEKRWLDT
FT                   LSVPLSMARISRYKAGTEKLRSSALEVLALDGASTGVLQFSTAQDCADWLRSISTNISD
FT                   LTLQHMKMANKCCSPCDQVVHMGWVNERLQGADNSQNFRPKFLALRGSSFYIFGAPPVS
FT                   TLDWGRAERAYNLCEVLFKVHKFWLSDNYWLQANLYLGLQDFDCEDPRSYCFSVLANHG
FT                   KSHIFSVELGSELAVWEKAFQRATFMEVQRTGSKTYLCSWQGETLCFTVDFALGFTCFD
FT                   ERTLEIQVLSA"
FT   gene            6235068..6239761
FT                   /gene="Tmem18"
FT                   /locus_tag="mCG_7812"
FT                   /note="gene_id=mCG7812.2"
FT   mRNA            join(6235068..6235170,6236078..6236198,6237807..6237861,
FT                   6239082..6239175,6239260..6239761)
FT                   /gene="Tmem18"
FT                   /locus_tag="mCG_7812"
FT                   /product="transmembrane protein 18"
FT                   /note="gene_id=mCG7812.2 transcript_id=mCT6943.2 created on
FT                   10-SEP-2002"
FT   CDS             join(6235114..6235170,6236078..6236198,6237807..6237861,
FT                   6239082..6239175,6239260..6239355)
FT                   /codon_start=1
FT                   /gene="Tmem18"
FT                   /locus_tag="mCG_7812"
FT                   /product="transmembrane protein 18"
FT                   /note="gene_id=mCG7812.2 transcript_id=mCT6943.2
FT                   protein_id=mCP10274.2"
FT                   /protein_id="EDL36928.1"
FT                   /translation="MSSAYSVRSFPVSIPAVIMETDWTEPWLLGLLAFHLLCLLLTCFS
FT                   SQRYKLQIGHFLCLVVLVYSAEYINEVAAVNWRLFSKYQYFDSRGMFISLVFSAPLLFN
FT                   AMLIVIMWVRKTLTVMTDLKTLQEERKERRRRRKEE"
FT   gene            6522141..6531742
FT                   /locus_tag="mCG_56196"
FT                   /note="gene_id=mCG56196.2"
FT   mRNA            join(6522141..6522839,6524831..6524884,6524965..6525045,
FT                   6527810..6527875,6531179..6531742)
FT                   /locus_tag="mCG_56196"
FT                   /product="mCG56196"
FT                   /note="gene_id=mCG56196.2 transcript_id=mCT56379.2 created
FT                   on 03-JUL-2003"
FT   CDS             join(6522584..6522839,6524831..6524884,6524965..6525045,
FT                   6527810..6527874)
FT                   /codon_start=1
FT                   /locus_tag="mCG_56196"
FT                   /product="mCG56196"
FT                   /note="gene_id=mCG56196.2 transcript_id=mCT56379.2
FT                   protein_id=mCP32233.2"
FT                   /db_xref="GOA:Q80UG6"
FT                   /db_xref="InterPro:IPR029364"
FT                   /db_xref="MGI:MGI:3697448"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q80UG6"
FT                   /protein_id="EDL36927.1"
FT                   /translation="MRVSGRPMLLALLLLLSTVGDRGRAQSRGPADRQTLLRLLVELVQ
FT                   ELKKFHIGDSKRLQLLGESDFALGRREATDYGADQEEQRVEIVPRDLRMKDKFLKHLTG
FT                   PLYFSPKCSKHFHRLYHNTRDCTIPAYYKRCARLLTRLAVSPMCMER"
FT   gene            complement(6531879..6549592)
FT                   /locus_tag="mCG_7808"
FT                   /note="gene_id=mCG7808.2"
FT   mRNA            complement(join(6531879..6533864,6534027..6534132,
FT                   6535665..6535726,6542700..6542813,6543051..6543124,
FT                   6549489..6549592))
FT                   /locus_tag="mCG_7808"
FT                   /product="mCG7808, transcript variant mCT6949"
FT                   /note="gene_id=mCG7808.2 transcript_id=mCT6949.1 created on
FT                   10-JUN-2003"
FT   mRNA            complement(join(6532614..6533864,6534027..6534132,
FT                   6535665..6535726,6542852..6542965,6543051..6543124,
FT                   6549489..6549584))
FT                   /locus_tag="mCG_7808"
FT                   /product="mCG7808, transcript variant mCT185502"
FT                   /note="gene_id=mCG7808.2 transcript_id=mCT185502.0 created
FT                   on 10-JUN-2003"
FT   mRNA            complement(join(6532614..6533864,6534027..6534132,
FT                   6535665..6536031))
FT                   /locus_tag="mCG_7808"
FT                   /product="mCG7808, transcript variant mCT185501"
FT                   /note="gene_id=mCG7808.2 transcript_id=mCT185501.0 created
FT                   on 10-JUN-2003"
FT   CDS             complement(join(6533787..6533864,6534027..6534132,
FT                   6535665..6535726,6542700..6542813,6543051..6543124,
FT                   6549489..6549531))
FT                   /codon_start=1
FT                   /locus_tag="mCG_7808"
FT                   /product="mCG7808, isoform CRA_c"
FT                   /note="gene_id=mCG7808.2 transcript_id=mCT6949.1
FT                   protein_id=mCP10275.1 isoform=CRA_c"
FT                   /db_xref="GOA:Q561M1"
FT                   /db_xref="InterPro:IPR000106"
FT                   /db_xref="InterPro:IPR002115"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="MGI:MGI:87881"
FT                   /db_xref="UniProtKB/TrEMBL:Q561M1"
FT                   /protein_id="EDL36925.1"
FT                   /translation="MAEVGSKSVLFVCLGNICRSPIAEAVFRKLVTDEKVSDNWAIDSS
FT                   AVSDWNVGRPPDPRAVSCLRNHGISTAHKARQITKEDFATFDYILCMDESNLRDLNRKS
FT                   NQVKNCKAKIELLGSYDPQKQLIIEDPYYGNDSDFEVVYQQCLRCCKAFLEKTY"
FT   CDS             complement(join(6533787..6533864,6534027..6534132,
FT                   6535665..6535726,6542852..6542965,6543051..6543124,
FT                   6549489..6549531))
FT                   /codon_start=1
FT                   /locus_tag="mCG_7808"
FT                   /product="mCG7808, isoform CRA_b"
FT                   /note="gene_id=mCG7808.2 transcript_id=mCT185502.0
FT                   protein_id=mCP106760.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q4VAI2"
FT                   /db_xref="InterPro:IPR000106"
FT                   /db_xref="InterPro:IPR002115"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="MGI:MGI:87881"
FT                   /db_xref="UniProtKB/TrEMBL:Q4VAI2"
FT                   /protein_id="EDL36924.1"
FT                   /translation="MAEVGSKSVLFVCLGNICRSPIAEAVFRKLVTDEKVSDNWRIDSA
FT                   ATSTYEVGNPPDYRGQNCMRKHGIHMQHIARQITKEDFATFDYILCMDESNLRDLNRKS
FT                   NQVKNCKAKIELLGSYDPQKQLIIEDPYYGNDSDFEVVYQQCLRCCKAFLEKTY"
FT   CDS             complement(join(6533787..6533864,6534027..6534132,
FT                   6535665..6535684))
FT                   /codon_start=1
FT                   /locus_tag="mCG_7808"
FT                   /product="mCG7808, isoform CRA_a"
FT                   /note="gene_id=mCG7808.2 transcript_id=mCT185501.0
FT                   protein_id=mCP106759.0 isoform=CRA_a"
FT                   /protein_id="EDL36923.1"
FT                   /translation="MDESNLRDLNRKSNQVKNCKAKIELLGSYDPQKQLIIEDPYYGND
FT                   SDFEVVYQQCLRCCKAFLEKTY"
FT   gene            6548533..>6549078
FT                   /locus_tag="mCG_148267"
FT                   /note="gene_id=mCG148267.0"
FT   mRNA            join(6548533..6548615,6548943..>6549078)
FT                   /locus_tag="mCG_148267"
FT                   /product="mCG148267"
FT                   /note="gene_id=mCG148267.0 transcript_id=mCT188530.0
FT                   created on 13-JAN-2004"
FT   CDS             6548987..>6549078
FT                   /codon_start=1
FT                   /locus_tag="mCG_148267"
FT                   /product="mCG148267"
FT                   /note="gene_id=mCG148267.0 transcript_id=mCT188530.0
FT                   protein_id=mCP108097.0"
FT                   /protein_id="EDL36926.1"
FT                   /translation="MMPCLTTSPESTTIQKGPEPLKLSQNKSVLP"
FT   gene            6549684..6598073
FT                   /gene="Sh3yl1"
FT                   /locus_tag="mCG_7813"
FT                   /note="gene_id=mCG7813.2"
FT   mRNA            join(6549684..6550226,6560244..6560354,6562778..6562891,
FT                   6564824..6564888,6577513..6577625,6578230..6578358,
FT                   6579906..6580068,6580729..6580807,6596765..6596821,
FT                   6597721..6598073)
FT                   /gene="Sh3yl1"
FT                   /locus_tag="mCG_7813"
FT                   /product="Sh3 domain YSC-like 1, transcript variant
FT                   mCT6944"
FT                   /note="gene_id=mCG7813.2 transcript_id=mCT6944.1 created on
FT                   03-JUL-2003"
FT   mRNA            join(<6549691..6550226,6560244..6560354,6564824..6564888,
FT                   6577513..6577625,6578230..6578358,6579906..6580068,
FT                   6580729..6580807,6596765..6596821,6597721..6598066)
FT                   /gene="Sh3yl1"
FT                   /locus_tag="mCG_7813"
FT                   /product="Sh3 domain YSC-like 1, transcript variant
FT                   mCT193508"
FT                   /note="gene_id=mCG7813.2 transcript_id=mCT193508.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(<6549728..6550226,6560244..6560354,6562778..6562891,
FT                   6564824..6564888,6577513..6577625,6578230..6578358,
FT                   6579906..6580807,6596765..6596821,6597721..6597934)
FT                   /gene="Sh3yl1"
FT                   /locus_tag="mCG_7813"
FT                   /product="Sh3 domain YSC-like 1, transcript variant
FT                   mCT193507"
FT                   /note="gene_id=mCG7813.2 transcript_id=mCT193507.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<6550193..6550226,6560244..6560354,6564824..6564888,
FT                   6577513..6577625,6578230..6578358,6579906..6580068,
FT                   6580729..6580807,6596765..6596821,6597721..6597911)
FT                   /codon_start=1
FT                   /gene="Sh3yl1"
FT                   /locus_tag="mCG_7813"
FT                   /product="Sh3 domain YSC-like 1, isoform CRA_b"
FT                   /note="gene_id=mCG7813.2 transcript_id=mCT193508.0
FT                   protein_id=mCP114477.0 isoform=CRA_b"
FT                   /protein_id="EDL36921.1"
FT                   /translation="GARVPRGAAGTMNNPIPSNLKSEAKKAAKILREFTEITSRNGPDK
FT                   IIPEWSAPSAIGIAGLGGGFEIGIEVSDLVIILNYDRAVEAFAKGGNLTLGGNFTVAVG
FT                   PLGRNLEGNVSLRSSAAVFTYCKSRGLFAGISLEGSCLIERKETNRKFYCQDIRAYDIL
FT                   FGDVPQPAQAEDLYEILNSFTEKYETEGQRINLKKVAREQRKAKELPPKPSSRPQPAHP
FT                   PVQLNAGSQGNRNEYKLYPELSSYHEKTGNLNQPIEVTALYSFEGQQPGDLNFQAGDRI
FT                   IVISKTDSNFDWWEGKLRGQTGIFPANYVTMN"
FT   CDS             join(<6550193..6550226,6560244..6560354,6562778..6562891,
FT                   6564824..6564888,6577513..6577625,6578230..6578358,
FT                   6579906..6580134)
FT                   /codon_start=1
FT                   /gene="Sh3yl1"
FT                   /locus_tag="mCG_7813"
FT                   /product="Sh3 domain YSC-like 1, isoform CRA_a"
FT                   /note="gene_id=mCG7813.2 transcript_id=mCT193507.0
FT                   protein_id=mCP114476.0 isoform=CRA_a"
FT                   /protein_id="EDL36920.1"
FT                   /translation="GARVPRGAAGTMNNPIPSNLKSEAKKAAKILREFTEITSRNGPDK
FT                   IIPAHVIAKAKGLAVLSVIKAGFLVTARGGSGIVLARLPDGKWSAPSAIGIAGLGGGFE
FT                   IGIEVSDLVIILNYDRAVEAFAKGGNLTLGGNFTVAVGPLGRNLEGNVSLRSSAAVFTY
FT                   CKSRGLFAGISLEGSCLIERKETNRKFYCQDIRAYDILFGDVPQPAQAEDLYEILNSFT
FT                   EKYETEGQRINLKKVAREQRKVLWPGFTSLSVNMRGSVLAQL"
FT   CDS             join(6550226,6560244..6560354,6562778..6562891,
FT                   6564824..6564888,6577513..6577625,6578230..6578358,
FT                   6579906..6580068,6580729..6580807,6596765..6596821,
FT                   6597721..6597911)
FT                   /codon_start=1
FT                   /gene="Sh3yl1"
FT                   /locus_tag="mCG_7813"
FT                   /product="Sh3 domain YSC-like 1, isoform CRA_c"
FT                   /note="gene_id=mCG7813.2 transcript_id=mCT6944.1
FT                   protein_id=mCP10271.1 isoform=CRA_c"
FT                   /protein_id="EDL36922.1"
FT                   /translation="MNNPIPSNLKSEAKKAAKILREFTEITSRNGPDKIIPAHVIAKAK
FT                   GLAVLSVIKAGFLVTARGGSGIVLARLPDGKWSAPSAIGIAGLGGGFEIGIEVSDLVII
FT                   LNYDRAVEAFAKGGNLTLGGNFTVAVGPLGRNLEGNVSLRSSAAVFTYCKSRGLFAGIS
FT                   LEGSCLIERKETNRKFYCQDIRAYDILFGDVPQPAQAEDLYEILNSFTEKYETEGQRIN
FT                   LKKVAREQRKAKELPPKPSSRPQPAHPPVQLNAGSQGNRNEYKLYPELSSYHEKTGNLN
FT                   QPIEVTALYSFEGQQPGDLNFQAGDRIIVISKTDSNFDWWEGKLRGQTGIFPANYVTMN
FT                   "
FT   gene            6655851..6657138
FT                   /pseudo
FT                   /locus_tag="mCG_9933"
FT                   /note="gene_id=mCG9933.1"
FT   mRNA            join(6655851..6656166,6656284..6656457,6656530..6657138)
FT                   /pseudo
FT                   /locus_tag="mCG_9933"
FT                   /note="gene_id=mCG9933.1 transcript_id=mCT9672.1 created on
FT                   10-SEP-2002"
FT   gene            <6708070..>6709194
FT                   /locus_tag="mCG_55594"
FT                   /note="gene_id=mCG55594.1"
FT   mRNA            <6708070..>6709194
FT                   /locus_tag="mCG_55594"
FT                   /product="mCG55594"
FT                   /note="gene_id=mCG55594.1 transcript_id=mCT55777.1 created
FT                   on 03-SEP-2002"
FT   CDS             6708070..6709194
FT                   /codon_start=1
FT                   /locus_tag="mCG_55594"
FT                   /product="mCG55594"
FT                   /note="gene_id=mCG55594.1 transcript_id=mCT55777.1
FT                   protein_id=mCP38879.1"
FT                   /protein_id="EDL36919.1"
FT                   /translation="MRALPTLDSLARMRPPLGDPRAAEDTLTPRPANKSAVERLAADRA
FT                   KYVRSTLGSSRGPVSEHRVPEAPGVQHRNPIPSALAPAPVARRAIARKPLRPDSLVIYR
FT                   QKCEFVRGSDADCSRVGLMKKFFQGSGKDKMAVAPETTRVADEDKTTKETEATWTKSSQ
FT                   AAAARPASMLPPPTPVVAVKSPAEKTRVANEDKTTKETEATWTKSSQAAATRPASMLPP
FT                   PTPVVAVKSPALPFEVAPRVPVGCSGVQLRVSRSKGLQRSQSDLSSRYSIAKAESDTFF
FT                   KYCGLDPDVVEALGRENFSAGSDCVTLKVRSVSMAASDSSFSRHSEDGLQEEELLEQVP
FT                   STTSVVERNARIIKWLFTCKKAKETPSQKLQGPA"
FT   gene            complement(6732781..6733356)
FT                   /pseudo
FT                   /locus_tag="mCG_1041598"
FT                   /note="gene_id=mCG1041598.1"
FT   mRNA            complement(6732781..6733356)
FT                   /pseudo
FT                   /locus_tag="mCG_1041598"
FT                   /note="gene_id=mCG1041598.1 transcript_id=mCT159302.1
FT                   created on 26-SEP-2002"
FT   gene            <6898481..6963073
FT                   /gene="Lamb1-1"
FT                   /locus_tag="mCG_22463"
FT                   /note="gene_id=mCG22463.1"
FT   mRNA            join(<6898481..6898785,6899875..6900050,6902241..6902376,
FT                   6905614..6905687,6911646..6911834,6911920..6911983,
FT                   6915741..6915943,6918810..6918930,6920600..6920788,
FT                   6921063..6921242,6921387..6921499,6922527..6922606,
FT                   6930811..6930946,6931997..6932155,6933109..6933236,
FT                   6933392..6933515,6934191..6934395,6935747..6935890,
FT                   6936090..6936321,6937776..6937939,6938953..6939177,
FT                   6940161..6940375,6941136..6941232,6951450..6951819,
FT                   6953105..6953289,6954084..6954325,6956647..6956850,
FT                   6957361..6957505,6959355..6959562,6959753..6959894,
FT                   6960830..6961006,6962295..6962454,6962542..6963073)
FT                   /gene="Lamb1-1"
FT                   /locus_tag="mCG_22463"
FT                   /product="laminin B1 subunit 1"
FT                   /note="gene_id=mCG22463.1 transcript_id=mCT22317.1 created
FT                   on 10-SEP-2002"
FT   CDS             join(<6898560..6898785,6899875..6900050,6902241..6902376,
FT                   6905614..6905687,6911646..6911834,6911920..6911983,
FT                   6915741..6915943,6918810..6918930,6920600..6920788,
FT                   6921063..6921242,6921387..6921499,6922527..6922606,
FT                   6930811..6930946,6931997..6932155,6933109..6933236,
FT                   6933392..6933515,6934191..6934395,6935747..6935890,
FT                   6936090..6936321,6937776..6937939,6938953..6939177,
FT                   6940161..6940375,6941136..6941232,6951450..6951819,
FT                   6953105..6953289,6954084..6954325,6956647..6956850,
FT                   6957361..6957505,6959355..6959562,6959753..6959894,
FT                   6960830..6961006,6962295..6962454,6962542..6962678)
FT                   /codon_start=1
FT                   /gene="Lamb1-1"
FT                   /locus_tag="mCG_22463"
FT                   /product="laminin B1 subunit 1"
FT                   /note="gene_id=mCG22463.1 transcript_id=mCT22317.1
FT                   protein_id=mCP11346.1"
FT                   /protein_id="EDL36918.1"
FT                   /translation="PPSWAQPPLPWERQEMEGPLSSLPTFAFSPRYLSRKEDPKKRQAA
FT                   CLLRPPSRAASPRLRGLDMGLLQVFAFGVLALWGTRVCAQEPEFSYGCAEGSCYPATGD
FT                   LLIGRAQKLSVTSTCGLHKPEPYCIVSHLQEDKKCFICDSRDPYHETLNPDSHLIENVV
FT                   TTFAPNRLKIWWQSENGVENVTIQLDLEAEFHFTHLIMTFKTFRPAAMLIERSSDFGKT
FT                   WGVYRYFAYDCESSFPGISTGPMKKVDDIICDSRYSDIEPSTEGEVIFRALDPAFKIED
FT                   PYSPRIQNLLKITNLRIKFVKLHTLGDNLLDSRMEIREKYYYAVYDMVVRGNCFCYGHA
FT                   SECAPVDGVNEEVEGMVHGHCMCRHNTKGLNCELCMDFYHDLPWRPAEGRNSNACKKCN
FT                   CNEHSSSCHFDMAVFLATGNVSGGVCDNCQHNTMGRNCEQCKPFYFQHPERDIRDPNLC
FT                   EPCTCDPAGSENGGICDGYTDFSVGLIAGQCRCKLHVEGERCDVCKEGFYDLSAEDPYG
FT                   CKSCACNPLGTIPGGNPCDSETGYCYCKRLVTGQRCDQCLPQHWGLSNDLDGCRPCDCD
FT                   LGGALNNSCSEDSGQCSCLPHMIGRQCNEVESGYYFTTLDHYIYEAEEANLGPGVVVVE
FT                   RQYIQDRIPSWTGPGFVRVPEGAYLEFFIDNIPYSMEYEILIRYEPQLPDHWEKAVITV
FT                   QRPGKIPASSRCGNTVPDDDNQVVSLSPGSRYVVLPRPVCFEKGMNYTVRLELPQYTAS
FT                   GSDVESPYTFIDSLVLMPYCKSLDIFTVGGSGDGEVTNSAWETFQRYRCLENSRSVVKT
FT                   PMTDVCRNIIFSISALIHQTGLACECDPQGSLSSVCDPNGGQCQCRPNVVGRTCNRCAP
FT                   GTFGFGPNGCKPCDCHLQGSASAFCDAITGQCHCFQGIYARQCDRCLPGYWGFPSCQPC
FT                   QCNGHALDCDTVTGECLSCQDYTTGHNCERCLAGYYGDPIIGSGDHCRPCPCPDGPDSG
FT                   RQFARSCYQDPVTLQLACVCDPGYIGSRCDDCASGFFGNPSDFGGSCQPCQCHHNIDTT
FT                   DPEACDKETGRCLKCLYHTEGDHCQLCQYGYYGDALRQDCRKCVCNYLGTVKEHCNGSD
FT                   CHCDKATGQCSCLPNVIGQNCDRCAPNTWQLASGTGCGPCNCNAAHSFGPSCNEFTGQC
FT                   QCMPGFGGRTCSECQELFWGDPDVECRACDCDPRGIETPQCDQSTGQCVCVEGVEGPRC
FT                   DKCTRGYSGVFPDCTPCHQCFALWDAIIGELTNRTHKFLEKAKALKISGVIGPYRETVD
FT                   SVEKKVNEIKDILAQSPAAEPLKNIGILFEEAEKLTKDVTEKMAQVEVKLTDTASQSNS
FT                   TAGELGALQAEAESLDKTVKELAEQLEFIKNSDIQGALDSITKYFQMSLEAEKRVNAST
FT                   TDPNSTVEQSALTRDRVEDLMLERESPFKEQQEEQARLLDELAGKLQSLDLSAVAQMTC
FT                   GTPPGADCSESECGGPNCRTDEGEKKCGGPGCGGLVTVAHSAWQKAMDFDRDVLSALAE
FT                   VEQLSKMVSEAKVRADEAKQNAQDVLLKTNATKEKVDKSNEDLRNLIKQIRNFLTEDSA
FT                   DLDSIEAVANEVLKMEMPSTPQQLQNLTEDIRERVETLSQVEVILQQSAADIARAELLL
FT                   EEAKRASKSATDVKVTADMVKEALEEAEKAQVAAEKAIKQADEDIQGTQNLLTSIESET
FT                   AASEETLTNASQRISKLERNVEELKRKAAQNSGEAEYIEKVVYSVKQNADDVKKTLDGE
FT                   LDEKYKKVESLIAQKTEESADARRKAELLQNEAKTLLAQANSKLQLLEDLERKYEDNQK
FT                   YLEDKAQELVRLEGEVRSLLKDISEKVAVYSTCL"
FT   gene            complement(6964834..>6984636)
FT                   /gene="Dld"
FT                   /locus_tag="mCG_22465"
FT                   /note="gene_id=mCG22465.1"
FT   mRNA            complement(join(6964834..6965425,6965522..6965611,
FT                   6966608..6966745,6967050..6967239,6967796..6967966,
FT                   6968649..6968839,6973463..6973564,6974047..6974190,
FT                   6974561..6974661,6975927..6975996,6976558..6976626,
FT                   6978006..6978085,6982780..6982858,6984484..>6984636))
FT                   /gene="Dld"
FT                   /locus_tag="mCG_22465"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /note="gene_id=mCG22465.1 transcript_id=mCT22318.0 created
FT                   on 03-SEP-2002"
FT   CDS             complement(join(6965360..6965425,6965522..6965611,
FT                   6966608..6966745,6967050..6967239,6967796..6967966,
FT                   6968649..6968839,6973463..6973564,6974047..6974190,
FT                   6974561..6974661,6975927..6975996,6976558..6976626,
FT                   6978006..6978085,6982780..6982858,6984484..>6984636))
FT                   /codon_start=1
FT                   /gene="Dld"
FT                   /locus_tag="mCG_22465"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /note="gene_id=mCG22465.1 transcript_id=mCT22318.0
FT                   protein_id=mCP11307.0"
FT                   /protein_id="EDL36917.1"
FT                   /translation="LGDDVYVAQAQGGETLDKSYQAFSGGENPWLEGRDRGTMQSWSRV
FT                   YRSLAKKGHFNRISHGLQGVSSVPLRTYADQPIEADVTVIGSGPGGYVAAIKSAQLGFK
FT                   TVCIEKNETLGGTCLNVGCIPSKALLNNSHYYHMAHGKDFASRGIEIPEVRLNLEKMME
FT                   QKHSAVKALTGGIAHLFKQNKVVHVNGFGKITGKNQVTATKADGSTQVIDTKNILVATG
FT                   SEVTPFPGITIDEDTIVSSTGALSLKKVPEKLVVIGAGVIGVELGSVWQRLGADVTAVE
FT                   FLGHVGGIGIDMEISKNFQRILQRQGFKFKLNTKVTGATKKSDGKIDVSVEAASGGKAE
FT                   VITCDVLLVCIGRRPFTQNLGLEELGIELDPKGRIPVNNRFQTKIPNIYAIGDVVAGPM
FT                   LAHKAEDEGIICVEGMAGGAVHIDYNCVPSVIYTHPEVAWVGKSEEQLKEEGIEFKIGK
FT                   FPFAANSRAKTNADTDGMVKILGHKSTDRVLGAHILGPGAGEMVNEAALALEYGASCED
FT                   IARVCHAHPTLSEAFREANLAAAFGKPINF"
FT   gene            <7054577..7056097
FT                   /locus_tag="mCG_128434"
FT                   /note="gene_id=mCG128434.0"
FT   mRNA            <7054577..7056097
FT                   /locus_tag="mCG_128434"
FT                   /product="mCG128434"
FT                   /note="gene_id=mCG128434.0 transcript_id=mCT129730.0
FT                   created on 10-SEP-2002"
FT   CDS             <7055026..7055532
FT                   /codon_start=1
FT                   /locus_tag="mCG_128434"
FT                   /product="mCG128434"
FT                   /note="gene_id=mCG128434.0 transcript_id=mCT129730.0
FT                   protein_id=mCP78606.0"
FT                   /protein_id="EDL36916.1"
FT                   /translation="FVGSVLLEARTPSMSSLLLKMPTLEKRMPLSPSFRETWRRGDALS
FT                   HLDTLETNKRKALQLLPKDSDKVKEFFEKLQHTLGQKKNEILSDFETMKLAVMQTCDPE
FT                   INKINTILQEQRMAFNIAEAFKDVSEPIIFLQQMQEFKEKIRVIKETPLPHSNLPTSPF
FT                   NEEEL"
FT   gene            7074301..7108091
FT                   /gene="Slc26a3"
FT                   /locus_tag="mCG_142287"
FT                   /note="gene_id=mCG142287.0"
FT   mRNA            join(7074301..7074342,7084631..7084743,7084980..7085146,
FT                   7086709..7086873,7088391..7088543,7089758..7089840,
FT                   7092891..7093038,7093134..7093247,7093353..7093430,
FT                   7096456..7096551,7098223..7098329,7099432..7099501,
FT                   7099593..7099687,7105246..7105388,7105494..7105559,
FT                   7107844..7108091)
FT                   /gene="Slc26a3"
FT                   /locus_tag="mCG_142287"
FT                   /product="solute carrier family 26, member 3"
FT                   /note="gene_id=mCG142287.0 transcript_id=mCT179802.0
FT                   created on 07-FEB-2003"
FT   CDS             join(7085000..7085146,7086709..7086873,7088391..7088543,
FT                   7089758..7089840,7092891..7093038,7093134..7093247,
FT                   7093353..7093430,7096456..7096551,7098223..7098329,
FT                   7099432..7099501,7099593..7099687,7105246..7105249)
FT                   /codon_start=1
FT                   /gene="Slc26a3"
FT                   /locus_tag="mCG_142287"
FT                   /product="solute carrier family 26, member 3"
FT                   /note="gene_id=mCG142287.0 transcript_id=mCT179802.0
FT                   protein_id=mCP102724.0"
FT                   /protein_id="EDL36915.1"
FT                   /translation="MMVGVVVTRVVSDPNASSELSSSSTENDSFIEEKVMVAASVTVLS
FT                   GIIQLLLGVLQVGFVVIYLSESLISGFTTAAAIHVLVSQLKFMLQLPVPAYSDPFSIFK
FT                   VLESVFTQIQKTNIADLVTSVIILVVVFVFKEINQRYRSKLPVPIPIELIMTVIATGVS
FT                   YGCNFEDRFGVAVVGNMSLGFQPPITPSVEVFQDTIGDSFGIAIVGFAVAFSVASVYSL
FT                   KYDYPIDGNQELIALGVSNIFTGAFKGFAGSTALSRSGVQESTGGKTQVAGLLSAVIVL
FT                   IVIVAIGFLLQPLQKSVLAALALGNLKGMLMQFAEIGRLWKKDKYDCLIWIMTFIFAIV
FT                   LGLGLGLAASVAFQLLTIVFRTQFPKCSTLANVGRSNIYKNKKNYAEVYEPEGVKIFRC
FT                   PSPIYFANIGFFKQKLIDAV"
FT   gene            complement(7119183..>7134440)
FT                   /gene="Cbll1"
FT                   /locus_tag="mCG_22464"
FT                   /note="gene_id=mCG22464.1"
FT   mRNA            complement(join(7119183..7122671,7124828..7124901,
FT                   7126345..7126428,7126912..7127012,7129412..7129579,
FT                   7134346..>7134440))
FT                   /gene="Cbll1"
FT                   /locus_tag="mCG_22464"
FT                   /product="Casitas B-lineage lymphoma-like 1, transcript
FT                   variant mCT22319"
FT                   /note="gene_id=mCG22464.1 transcript_id=mCT22319.1 created
FT                   on 03-SEP-2002"
FT   mRNA            complement(join(7121258..7122671,7124828..7124901,
FT                   7126345..7126428,7126912..7127009,7129412..7129579,
FT                   7134346..>7134363))
FT                   /gene="Cbll1"
FT                   /locus_tag="mCG_22464"
FT                   /product="Casitas B-lineage lymphoma-like 1, transcript
FT                   variant mCT193455"
FT                   /note="gene_id=mCG22464.1 transcript_id=mCT193455.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(7121636..7122671,7124828..7124901,
FT                   7126345..7126428,7126912..7127012,7129412..7129579,
FT                   7134346..>7134391))
FT                   /codon_start=1
FT                   /gene="Cbll1"
FT                   /locus_tag="mCG_22464"
FT                   /product="Casitas B-lineage lymphoma-like 1, isoform CRA_b"
FT                   /note="gene_id=mCG22464.1 transcript_id=mCT22319.1
FT                   protein_id=mCP11320.1 isoform=CRA_b"
FT                   /protein_id="EDL36914.1"
FT                   /translation="LPFPLCPASRIMDHTDNELQGTNSSGSLGGLDVRRRIPIKLISKQ
FT                   ASKVKPAPRTQRTVSRMPAKAPQGDEEGFDYNEEQRYDCKGGELFGNQRRFPGHLFWDF
FT                   KINILGEKDDTPVHFCDKCGLPIKVYGRMIPCKHVFCYDCAILHEKKGDKMCPGCSDPV
FT                   QRIEQCTRGSLFMCSIVQGCKRTYLSQRDLQAHINHRHMRTGKPVTRASLENVHPPIAP
FT                   PPTDIPDRFIMPPDKHHMSHIPPKQHIMMPPPPLQHVPHEHYNQPHEDIRAPPAELSMA
FT                   PPPPRSVSQETFRISTRKHSNLITVPIQDDSSSGAREPPPPAPAPAHHHPEYQGQPVVS
FT                   HPHHIMPPQQHYAPPPPPPPPISHPMPHPPQAAGTPHLVYSQAPPPPMTSAPPPITPPP
FT                   GHIIAQMPPYMNHPPPGPPPPQHGGPPVTAPPPHHYNPNSLPQFTEDQGTLSPPFTQPG
FT                   GMSPGIWPAPRGPPPPPRMQGPPSQTPLPGPHHPDQTRYRPYYQ"
FT   CDS             complement(join(7121636..7122671,7124828..7124901,
FT                   7126345..7126428,7126912..7127009,7129412..7129579,
FT                   7134346..>7134361))
FT                   /codon_start=1
FT                   /gene="Cbll1"
FT                   /locus_tag="mCG_22464"
FT                   /product="Casitas B-lineage lymphoma-like 1, isoform CRA_a"
FT                   /note="gene_id=mCG22464.1 transcript_id=mCT193455.0
FT                   protein_id=mCP114419.0 isoform=CRA_a"
FT                   /protein_id="EDL36913.1"
FT                   /translation="IMDHTDNELQGTNSSGSLGGLDVRRRIPIKLISKQASKVKPAPRT
FT                   QRTVSRMPAKAPQGDEGFDYNEEQRYDCKGGELFGNQRRFPGHLFWDFKINILGEKDDT
FT                   PVHFCDKCGLPIKVYGRMIPCKHVFCYDCAILHEKKGDKMCPGCSDPVQRIEQCTRGSL
FT                   FMCSIVQGCKRTYLSQRDLQAHINHRHMRTGKPVTRASLENVHPPIAPPPTDIPDRFIM
FT                   PPDKHHMSHIPPKQHIMMPPPPLQHVPHEHYNQPHEDIRAPPAELSMAPPPPRSVSQET
FT                   FRISTRKHSNLITVPIQDDSSSGAREPPPPAPAPAHHHPEYQGQPVVSHPHHIMPPQQH
FT                   YAPPPPPPPPISHPMPHPPQAAGTPHLVYSQAPPPPMTSAPPPITPPPGHIIAQMPPYM
FT                   NHPPPGPPPPQHGGPPVTAPPPHHYNPNSLPQFTEDQGTLSPPFTQPGGMSPGIWPAPR
FT                   GPPPPPRMQGPPSQTPLPGPHHPDQTRYRPYYQ"
FT   gene            7135325..7135569
FT                   /locus_tag="mCG_1041687"
FT                   /note="gene_id=mCG1041687.1"
FT   mRNA            7135325..7135569
FT                   /locus_tag="mCG_1041687"
FT                   /product="mCG1041687"
FT                   /note="gene_id=mCG1041687.1 transcript_id=mCT159391.1
FT                   created on 26-SEP-2002"
FT   CDS             7135409..7135432
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041687"
FT                   /product="mCG1041687"
FT                   /note="gene_id=mCG1041687.1 transcript_id=mCT159391.1
FT                   protein_id=mCP78429.1"
FT                   /protein_id="EDL36912.1"
FT                   /translation="MSRKEHN"
FT   gene            complement(7153914..>7194066)
FT                   /gene="Slc26a4"
FT                   /locus_tag="mCG_128433"
FT                   /note="gene_id=mCG128433.0"
FT   mRNA            complement(join(7153914..7154462,7156537..7156620,
FT                   7159546..7159691,7160698..7160752,7162716..7162946,
FT                   7163556..7163651,7167253..7167322,7169357..7169463,
FT                   7169718..7169813,7169943..7170020,7173299..7173412,
FT                   7174620..7174767,7178344..7178426,7178548..7178700,
FT                   7181220..7181384,7181964..7182148,7184031..7184141,
FT                   7191158..7191297,7193256..7193615,7194047..>7194066))
FT                   /gene="Slc26a4"
FT                   /locus_tag="mCG_128433"
FT                   /product="solute carrier family 26, member 4"
FT                   /note="gene_id=mCG128433.0 transcript_id=mCT129729.1
FT                   created on 03-SEP-2002"
FT   CDS             complement(join(7154439..7154462,7156537..7156620,
FT                   7159546..7159691,7160698..7160752,7162716..7162946,
FT                   7163556..7163651,7167253..7167322,7169357..7169463,
FT                   7169718..7169813,7169943..7170020,7173299..7173412,
FT                   7174620..7174767,7178344..7178426,7178548..7178700,
FT                   7181220..7181384,7181964..7182148,7184031..7184141,
FT                   7191158..7191297,7193256..7193615,7194047..>7194066))
FT                   /codon_start=1
FT                   /gene="Slc26a4"
FT                   /locus_tag="mCG_128433"
FT                   /product="solute carrier family 26, member 4"
FT                   /note="gene_id=mCG128433.0 transcript_id=mCT129729.1
FT                   protein_id=mCP78571.1"
FT                   /protein_id="EDL36911.1"
FT                   /translation="ELRSPNRWPAAGTVCCQRRGLRDADRLSEVAATGGTRGCSQVPAA
FT                   GRLLAPRFRTSSLVASPPGRRSSGTQAMAARGGRSEPPQLAEYSCSYTVSRPVYSELAF
FT                   QQQRERRLPERRTLRDSLARSCSCSRKRAFGVVKTLLPILDWLPKYRVKEWLLSDIISG
FT                   VSTGLVGTLQGMAYALLAAVPVQFGLYSAFFPILTYFVFGTSRHISVGPFPVVSLMVGS
FT                   VVLSMAPDDHFLVPSGNGSALNSTTLDTGTRDAARVLLASTLTLLVGIIQLVFGGLQIG
FT                   FIVRYLADPLVGGFTTAAAFQVLVSQLKIVLNVSTKNYNGILSIIYTLIEIFQNIGDTN
FT                   IADFIAGLLTIIVCMAVKELNDRFKHRIPVPIPIEVIVTIIATAISYGANLEKNYNAGI
FT                   VKSIPSGFLPPVLPSVGLFSDMLAASFSIAVVAYAIAVSVGKVYATKHDYVIDGNQEFI
FT                   AFGISNVFSGFFSCFVATTALSRTAVQESTGGKTQVAGLISAVIVMVAIVALGRLLEPL
FT                   QKSVLAAVVIANLKGMFMQVCDVPRLWKQNKTDAVIWVFTCIMSIILGLDLGLLAGLLF
FT                   ALLTVVLRVQFPSWNGLGSVPSTDIYKSITHYKNVGFDAIRVYNKRLKALRRIQKLIKK
FT                   GQLRATKNGIISDIGSSNNAFEPDEDVEEPEELNIPTKEIEIQVDWNSELPVKVNVPKV
FT                   PIHSLVLDCGAVSFLDVVGVRSLRMIVKEFQRIDVNVYFALLQDDVLEKMEQCGFFDDN
FT                   IRKDRFFLTVHDAILHLQNQVKSREGQDSLLETVARIRDCKDPLDLMEAEMNAEELDVQ
FT                   DEAMRRLAS"
FT   gene            complement(7230555..>7269321)
FT                   /gene="Bcap29"
FT                   /locus_tag="mCG_22467"
FT                   /note="gene_id=mCG22467.1"
FT   mRNA            complement(join(7230555..7231463,7235730..7235830,
FT                   7252032..7252137,7259051..7259186,7261663..7261813,
FT                   7265730..7265830,7269204..>7269321))
FT                   /gene="Bcap29"
FT                   /locus_tag="mCG_22467"
FT                   /product="B-cell receptor-associated protein 29"
FT                   /note="gene_id=mCG22467.1 transcript_id=mCT22321.1 created
FT                   on 30-AUG-2002"
FT   CDS             complement(join(7231428..7231463,7235730..7235830,
FT                   7252032..7252137,7259051..7259186,7261663..7261813,
FT                   7265730..7265830,7269204..>7269319))
FT                   /codon_start=1
FT                   /gene="Bcap29"
FT                   /locus_tag="mCG_22467"
FT                   /product="B-cell receptor-associated protein 29"
FT                   /note="gene_id=mCG22467.1 transcript_id=mCT22321.1
FT                   protein_id=mCP11315.0"
FT                   /protein_id="EDL36910.1"
FT                   /translation="VKKKQNKTMTIQWAAVASFLYAEIGLILLFCLPFIPPQRWQKIFS
FT                   FSVWGKIASFWNKAFLTIIILLIILFLDAVREVRKYSSTNVVEKNSAIRPSAFEHTQMK
FT                   LFRSQRNLYISGFSLFFWLVLRRLVTLITQLAKEIANKGVLKIQAENTNKAAKKFMEEN
FT                   EKLKLGLRNDNAEEHLLEAENKKLIESKENLKTELKKASDALLKAQNDVMTMKIQSERL
FT                   SKEYDRLLKEHSELQNRLEKEKKKGL"
FT   gene            complement(7274877..7289643)
FT                   /gene="Dus4l"
FT                   /locus_tag="mCG_22472"
FT                   /note="gene_id=mCG22472.2"
FT   mRNA            complement(join(7274877..7275766,7276324..7276550,
FT                   7277587..7277709,7281446..7281563,7283587..7283708,
FT                   7287108..7287258,7289505..>7289642))
FT                   /gene="Dus4l"
FT                   /locus_tag="mCG_22472"
FT                   /product="dihydrouridine synthase 4-like (S. cerevisiae),
FT                   transcript variant mCT193467"
FT                   /note="gene_id=mCG22472.2 transcript_id=mCT193467.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(7274878..7275766,7276324..7276550,
FT                   7277587..7277709,7281446..7281563,7283587..7283708,
FT                   7287108..7287258,7289501..7289643))
FT                   /gene="Dus4l"
FT                   /locus_tag="mCG_22472"
FT                   /product="dihydrouridine synthase 4-like (S. cerevisiae),
FT                   transcript variant mCT22326"
FT                   /note="gene_id=mCG22472.2 transcript_id=mCT22326.1 created
FT                   on 07-APR-2003"
FT   CDS             complement(join(7275498..7275766,7276324..7276550,
FT                   7277587..7277709,7281446..7281563,7283587..7283708,
FT                   7287108..>7287232))
FT                   /codon_start=1
FT                   /gene="Dus4l"
FT                   /locus_tag="mCG_22472"
FT                   /product="dihydrouridine synthase 4-like (S. cerevisiae),
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG22472.2 transcript_id=mCT193467.0
FT                   protein_id=mCP114421.0 isoform=CRA_a"
FT                   /protein_id="EDL36908.1"
FT                   /translation="PVHMRSDSLPTTICQERKKDPIEMFHSGQLVKVCAPMVRYSKLAF
FT                   RTLVRKYSCDLCYTPMIIAADFVRSIKARDSEFTTNQGDCPLIVQFAANDARLLSDAAL
FT                   LVCPYANGIDINCGCPQRWAMADGYGACLINKPELVHDMVRQVRNRVESPRFSVSIKIR
FT                   IHDDLARTIDLCRKAEATGVSWITVHGRTVEERHQPVHYDAIKMIKENVSIPIVANGDI
FT                   RSLKEAENVWQMTGTDGVMVARGLLTNPAMFAGYEETPLKCIWDWVDISLELGTPFMCF
FT                   HQHLMYMMEKITSRQEKRVFNALSSTSAVLDYLMDHYGDESLSKSL"
FT   CDS             complement(join(7275498..7275766,7276324..7276550,
FT                   7277587..7277709,7281446..7281563,7283587..7283708,
FT                   7287108..7287223))
FT                   /codon_start=1
FT                   /gene="Dus4l"
FT                   /locus_tag="mCG_22472"
FT                   /product="dihydrouridine synthase 4-like (S. cerevisiae),
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG22472.2 transcript_id=mCT22326.1
FT                   protein_id=mCP11327.2 isoform=CRA_b"
FT                   /protein_id="EDL36909.1"
FT                   /translation="MRSDSLPTTICQERKKDPIEMFHSGQLVKVCAPMVRYSKLAFRTL
FT                   VRKYSCDLCYTPMIIAADFVRSIKARDSEFTTNQGDCPLIVQFAANDARLLSDAALLVC
FT                   PYANGIDINCGCPQRWAMADGYGACLINKPELVHDMVRQVRNRVESPRFSVSIKIRIHD
FT                   DLARTIDLCRKAEATGVSWITVHGRTVEERHQPVHYDAIKMIKENVSIPIVANGDIRSL
FT                   KEAENVWQMTGTDGVMVARGLLTNPAMFAGYEETPLKCIWDWVDISLELGTPFMCFHQH
FT                   LMYMMEKITSRQEKRVFNALSSTSAVLDYLMDHYGDESLSKSL"
FT   gene            <7289683..7577089
FT                   /locus_tag="mCG_22471"
FT                   /note="gene_id=mCG22471.2"
FT   mRNA            join(<7289683..7289798,7295531..7295670,7300294..7300351,
FT                   7304603..7304657,7305149..7305218,7320714..7320834,
FT                   7398012..7398142,7429012..7429177,7440169..7440281,
FT                   7440592..7440669,7458327..7458408,7472710..7472914,
FT                   7476717..7476878,7479278..7479377,7508920..7509030,
FT                   7509573..7509635,7525699..7525802,7533448..7533685,
FT                   7540401..7540477,7559121..7559247,7560022..7560101,
FT                   7565106..7565252,7576636..7577089)
FT                   /locus_tag="mCG_22471"
FT                   /product="mCG22471, transcript variant mCT193466"
FT                   /note="gene_id=mCG22471.2 transcript_id=mCT193466.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<7289684..7289798,7295531..7295670,7300294..7300351,
FT                   7304603..7304657,7305149..7305218,7320714..7320834,
FT                   7398012..7398142,7429012..7429177,7440169..7440281,
FT                   7440592..7440669,7458327..7458408,7472710..7472914,
FT                   7476717..7476878,7479278..7479377,7508920..7509030,
FT                   7509573..7509635,7525699..7525802,7533448..7533685,
FT                   7540401..7540477,7559121..7559247,7560022..7560101,
FT                   7565106..7565220)
FT                   /codon_start=1
FT                   /locus_tag="mCG_22471"
FT                   /product="mCG22471, isoform CRA_a"
FT                   /note="gene_id=mCG22471.2 transcript_id=mCT193466.0
FT                   protein_id=mCP114420.0 isoform=CRA_a"
FT                   /protein_id="EDL36903.1"
FT                   /translation="INPALANMEGGDSTISVAGRGASGSAVVAATVQAILQDDCYSEFL
FT                   NEDFDVKTYTSQSIHQAVIAEQLAKLAQGISQLDKELHLQVVARHEDLLAQATGIESLE
FT                   GVLQMMQTRIGALQGAVDRMKSKIVEPYNKIVARTAQLARLQVACDLLRRIIRILYLSK
FT                   RLQGQLQGGSREITKAAQSLNELDYLSQGIDLSGIEVIENDLLFIARARLEVENQAKRL
FT                   LEQGVETQNPTQVGTALQVFHNLGTLKETVTSVVDGYCAALEDSINNALDVKVLTQPSQ
FT                   SAVRGGPGRAAMPTPGSTAGFRASLWTNMEKLMDHICAACGQVQHLQKVLTKKRDPVSH
FT                   ICFIEEIIKDGQPEILYMFWNAVTLALSSHFHSATNSSMFLKQAFEGEYPKLLRLYNDL
FT                   WKRLQQSSQNTQGTFSPSGTPDLCVDLPHMEDDTQDMFRLKRPDYDPEKALKDSLQPYE
FT                   AAYLSKSLSRLFDPINLVFPPGGRNPPSSDELDGITKTITSELNVAAVDANLTLAVSKN
FT                   VAKTIQLYAVKSEQLLSTQGDASQVIGPLTEGQKRNVGVVNSLFKLHQSVTKVVASQSS
FT                   FSATAEQTIMSALKTIHDLMGNAIQPLLTSVADAIEAIIITMHQEDFSGASSSSGKPDV
FT                   PCSLYMKELQGFIARVMNDYFKHFECLDFVFDNTEAIAQRAIELFIRNASLIRPLGEGG
FT                   KLRLAADFAQMELAVGPLCRRVSDLGKSYRMLRSFRPLLFQTSEHVADSPAVGDIIPFS
FT                   IIIQFLFTRAPAELKSPFQRAEWSHARFSQWLDDHPSEKDRLLLLRGALEAYVQSVRSR
FT                   DGKEFAPVYPIMVQLLQKAMSALQ"
FT   mRNA            join(7289698..7289798,7295531..7295670,7300294..7300351,
FT                   7304603..7304657,7305149..7305218,7320714..7320834,
FT                   7398012..7398142,7429012..7429177,7440169..7440281,
FT                   7440592..7440669,7458327..7458408,7472710..7472914,
FT                   7479278..7479377,7508920..7509030,7525699..7525802,
FT                   7533448..7533685,7540401..7540477,7559121..7559247,
FT                   7560022..7560101,7565106..7565252,7576636..7577089)
FT                   /locus_tag="mCG_22471"
FT                   /product="mCG22471, transcript variant mCT22325"
FT                   /note="gene_id=mCG22471.2 transcript_id=mCT22325.1 created
FT                   on 11-SEP-2002"
FT   CDS             join(7289705..7289798,7295531..7295670,7300294..7300351,
FT                   7304603..7304657,7305149..7305218,7320714..7320834,
FT                   7398012..7398142,7429012..7429177,7440169..7440281,
FT                   7440592..7440669,7458327..7458408,7472710..7472914,
FT                   7479278..7479377,7508920..7509030,7525699..7525802,
FT                   7533448..7533685,7540401..7540477,7559121..7559247,
FT                   7560022..7560101,7565106..7565220)
FT                   /codon_start=1
FT                   /locus_tag="mCG_22471"
FT                   /product="mCG22471, isoform CRA_b"
FT                   /note="gene_id=mCG22471.2 transcript_id=mCT22325.1
FT                   protein_id=mCP11332.2 isoform=CRA_b"
FT                   /protein_id="EDL36904.1"
FT                   /translation="MEGGDSTISVAGRGASGSAVVAATVQAILQDDCYSEFLNEDFDVK
FT                   TYTSQSIHQAVIAEQLAKLAQGISQLDKELHLQVVARHEDLLAQATGIESLEGVLQMMQ
FT                   TRIGALQGAVDRMKSKIVEPYNKIVARTAQLARLQVACDLLRRIIRILYLSKRLQGQLQ
FT                   GGSREITKAAQSLNELDYLSQGIDLSGIEVIENDLLFIARARLEVENQAKRLLEQGVET
FT                   QNPTQVGTALQVFHNLGTLKETVTSVVDGYCAALEDSINNALDVKVLTQPSQSAVRGGP
FT                   GRAAMPTPGSTAGFRASLWTNMEKLMDHICAACGQVQHLQKVLTKKRDPVSHICFIEEI
FT                   IKDGQPEILYMFWNAVTLALSSHFHSATNSSMFLKQAFEGEYPKLLRLYNDLWKRLQQS
FT                   SQNTQGTFSPSGTPDLCVDLPHMEDDTQDMFRLKRPDYDELNVAAVDANLTLAVSKNVA
FT                   KTIQLYAVKSEQLLSTQGDASQVIGPLTEGQKRNVGVVNSLFKLHQSVTKTIHDLMGNA
FT                   IQPLLTSVADAIEAIIITMHQEDFSGASSSSGKPDVPCSLYMKELQGFIARVMNDYFKH
FT                   FECLDFVFDNTEAIAQRAIELFIRNASLIRPLGEGGKLRLAADFAQMELAVGPLCRRVS
FT                   DLGKSYRMLRSFRPLLFQTSEHVADSPAVGDIIPFSIIIQFLFTRAPAELKSPFQRAEW
FT                   SHARFSQWLDDHPSEKDRLLLLRGALEAYVQSVRSRDGKEFAPVYPIMVQLLQKAMSAL
FT                   Q"
FT   gene            complement(7341894..7348939)
FT                   /gene="Gpr22"
FT                   /locus_tag="mCG_142736"
FT                   /note="gene_id=mCG142736.0"
FT   mRNA            complement(join(7341894..7345062,7346598..7347588,
FT                   7348527..7348939))
FT                   /gene="Gpr22"
FT                   /locus_tag="mCG_142736"
FT                   /product="G protein-coupled receptor 22"
FT                   /note="gene_id=mCG142736.0 transcript_id=mCT181979.0
FT                   created on 17-APR-2003"
FT   CDS             complement(join(7343739..7345062,7346598..7346683))
FT                   /codon_start=1
FT                   /gene="Gpr22"
FT                   /locus_tag="mCG_142736"
FT                   /product="G protein-coupled receptor 22"
FT                   /note="gene_id=mCG142736.0 transcript_id=mCT181979.0
FT                   protein_id=mCP104901.0"
FT                   /db_xref="GOA:G3X9C3"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:1920260"
FT                   /db_xref="UniProtKB/TrEMBL:G3X9C3"
FT                   /protein_id="EDL36907.1"
FT                   /translation="MSELSMTSCINLWKTTMVSPKAHKATVNRQNTNCSKRMCFSPVLE
FT                   INMQSESNVTVRDDIDDIDTNMYQPLSYPLSFQVSLTGFLMLEIVLGLGSNLTVLVLYC
FT                   MKSNLINSVSNIITMNLHVLDVIICVGCIPLTIVILLLSLESNTALICCFHEACVSFAS
FT                   VSTAINVFAITLDRYDISVKPANRILTMGRAVMLMTSIWIFSFFSFLIPFIEVNFFSLQ
FT                   SGNTWANKTLLCVSTSEYYTELGMYYHLLVQIPIFFFTVIVMLITYTKILQALNIRIGT
FT                   RFSTGQKKKARKKKTISLATHETTDMSQSSGGRNVVFGVRTSVSVIIALRRAVKRHRER
FT                   RERQKRVFKMSLLIISTFLLCWTPISVLNTTILCLGPSDLLVKLRLCFLVMAYGTTIFH
FT                   PLLYAFTRQKFQKVLKSKMKKRVVSIVEADPMPNNAVIHNSWIDPKRNKKVTYEDSEIR
FT                   EKCLVPQVVTD"
FT   gene            complement(<7486044..7489148)
FT                   /locus_tag="mCG_148264"
FT                   /note="gene_id=mCG148264.0"
FT   mRNA            complement(join(<7486044..7488150,7489030..7489148))
FT                   /locus_tag="mCG_148264"
FT                   /product="mCG148264"
FT                   /note="gene_id=mCG148264.0 transcript_id=mCT188527.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(<7486044..7486241)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148264"
FT                   /product="mCG148264"
FT                   /note="gene_id=mCG148264.0 transcript_id=mCT188527.0
FT                   protein_id=mCP108099.0"
FT                   /protein_id="EDL36906.1"
FT                   /translation="MTETTPDPPLGPYDETCSLHGRSDMYFEKSFDVTMPPCSHQTVLH
FT                   QETFPQIVLYLNMLTINCQAS"
FT   gene            complement(7534103..>7534452)
FT                   /locus_tag="mCG_128325"
FT                   /note="gene_id=mCG128325.0"
FT   mRNA            complement(7534103..>7534452)
FT                   /locus_tag="mCG_128325"
FT                   /product="mCG128325"
FT                   /note="gene_id=mCG128325.0 transcript_id=mCT129619.0
FT                   created on 11-SEP-2002"
FT   CDS             complement(7534136..>7534438)
FT                   /codon_start=1
FT                   /locus_tag="mCG_128325"
FT                   /product="mCG128325"
FT                   /note="gene_id=mCG128325.0 transcript_id=mCT129619.0
FT                   protein_id=mCP78960.0"
FT                   /protein_id="EDL36905.1"
FT                   /translation="DLLDILQEMWEAPTPQGDTVQEGQGSLYAQGKRRYDRKQSGYGGQ
FT                   TKPIFRKKAKTTKKIVLRLECVEPNCRSKRMLAVKRCKHFELGSDKKRKGQVIQF"
FT   gene            complement(7565936..>7589662)
FT                   /gene="Hbp1"
FT                   /locus_tag="mCG_22473"
FT                   /note="gene_id=mCG22473.1"
FT   mRNA            complement(join(7565936..7566968,7568045..7568186,
FT                   7570140..7570463,7572815..7572959,7573743..7573899,
FT                   7576431..7576543,7576629..7576740,7577077..7577218,
FT                   7579737..7579965,7583287..7583470,7589623..>7589662))
FT                   /gene="Hbp1"
FT                   /locus_tag="mCG_22473"
FT                   /product="high mobility group box transcription factor 1,
FT                   transcript variant mCT22327"
FT                   /note="gene_id=mCG22473.1 transcript_id=mCT22327.1 created
FT                   on 11-SEP-2002"
FT   CDS             complement(join(7566951..7566968,7568045..7568186,
FT                   7570140..7570463,7572815..7572959,7573743..7573899,
FT                   7576431..7576543,7576629..7576740,7577077..7577218,
FT                   7579737..7579965,7583287..7583470,7589623..>7589661))
FT                   /codon_start=1
FT                   /gene="Hbp1"
FT                   /locus_tag="mCG_22473"
FT                   /product="high mobility group box transcription factor 1,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG22473.1 transcript_id=mCT22327.1
FT                   protein_id=mCP11343.1 isoform=CRA_b"
FT                   /protein_id="EDL36902.1"
FT                   /translation="RRSLKDLVMATGLSEHHNMVWEVKTNQMPNAVQKLLLVMDKRAPG
FT                   MSDSLELLQCNENLPSSPGYNSCDEHMELDDLPELQAVQSDPTQSAIYQLSSDVSHQEY
FT                   PRSSWSQNTSDIPENTHREDEVDWLTELANIATSPQSPLMQCSFYNRSSPVHIIATSKS
FT                   LHSYARPPPVSSSSKSGPAFPHDHWKEETPVRHERANSESESGIFCMSSLSDDDDLGWC
FT                   NSWPSTIWHCFLKGTRLCFHKESNKEWQDVEDFARAASCDNEEEIQMGTHKGYGSDGLK
FT                   LLSHEESVSFGESVLKLTFDPGTVEDGLLTVECKLDHPFYVKNKGWSSFYPSLTVVQHG
FT                   IPCCEIHIGDVCLPPGHPDAINFDDSGVFDTFKSYDFTPMDSSAVYVLSSMARQRRASL
FT                   SCGGGPGTGQEFSGSEFSKSCGSPGSSQLSSSSLYAKAVKSHSSGTVSATSPNKCKRPM
FT                   NAFMLFAKKYRVEYTQMYPGKDNRAISVILGDRWKKMKNEERRMYTLEAKALAEEQKRL
FT                   NPDCWKRKRTNSGSQQH"
FT   mRNA            complement(join(7568841..7570463,7572815..7572959,
FT                   7573743..7573899,7576431..7576543,7576629..7576740,
FT                   7577077..7577218,7579737..7579965,7583287..7583470,
FT                   7589623..>7589650))
FT                   /gene="Hbp1"
FT                   /locus_tag="mCG_22473"
FT                   /product="high mobility group box transcription factor 1,
FT                   transcript variant mCT193470"
FT                   /note="gene_id=mCG22473.1 transcript_id=mCT193470.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(7570136..7570463,7572815..7572959,
FT                   7573743..7573899,7576431..7576543,7576629..7576740,
FT                   7577077..7577218,7579737..7579965,7583287..7583470,
FT                   7589623..>7589649))
FT                   /codon_start=1
FT                   /gene="Hbp1"
FT                   /locus_tag="mCG_22473"
FT                   /product="high mobility group box transcription factor 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG22473.1 transcript_id=mCT193470.0
FT                   protein_id=mCP114422.0 isoform=CRA_a"
FT                   /protein_id="EDL36901.1"
FT                   /translation="KDLVMATGLSEHHNMVWEVKTNQMPNAVQKLLLVMDKRAPGMSDS
FT                   LELLQCNENLPSSPGYNSCDEHMELDDLPELQAVQSDPTQSAIYQLSSDVSHQEYPRSS
FT                   WSQNTSDIPENTHREDEVDWLTELANIATSPQSPLMQCSFYNRSSPVHIIATSKSLHSY
FT                   ARPPPVSSSSKSGPAFPHDHWKEETPVRHERANSESESGIFCMSSLSDDDDLGWCNSWP
FT                   STIWHCFLKGTRLCFHKESNKEWQDVEDFARAASCDNEEEIQMGTHKGYGSDGLKLLSH
FT                   EESVSFGESVLKLTFDPGTVEDGLLTVECKLDHPFYVKNKGWSSFYPSLTVVQHGIPCC
FT                   EIHIGDVCLPPGHPDAINFDDSGVFDTFKSYDFTPMDSSAVYVLSSMARQRRASLSCGG
FT                   GPGTGQEFSGSEFSKSCGSPGSSQLSSSSLYAKAVKSHSSGTVSATSPNKCKRPMNAFM
FT                   LFAKKYRVEYTQMYPGKDNR"
FT   gene            complement(7597879..>7695750)
FT                   /gene="Prkar2b"
FT                   /locus_tag="mCG_22474"
FT                   /note="gene_id=mCG22474.2"
FT   mRNA            complement(join(7597879..7598122,7599783..7599923,
FT                   7602399..7602537,7603288..7603353,7604505..7604579,
FT                   7606603..7606704,7611440..7611593,7615110..7615216,
FT                   7627083..7627166,7632920..7632972,7673152..7673187,
FT                   7695279..>7695737))
FT                   /gene="Prkar2b"
FT                   /locus_tag="mCG_22474"
FT                   /product="protein kinase, cAMP dependent regulatory, type
FT                   II beta, transcript variant mCT22330"
FT                   /note="gene_id=mCG22474.2 transcript_id=mCT22330.2 created
FT                   on 11-SEP-2002"
FT   mRNA            complement(join(7597883..7599923,7602399..7602537,
FT                   7603288..7603353,7604505..7604579,7606603..7606704,
FT                   7611440..7611593,7615110..7615216,7627083..7627166,
FT                   7632920..7632972,7673152..7673187,7694813..>7695087))
FT                   /gene="Prkar2b"
FT                   /locus_tag="mCG_22474"
FT                   /product="protein kinase, cAMP dependent regulatory, type
FT                   II beta, transcript variant mCT193472"
FT                   /note="gene_id=mCG22474.2 transcript_id=mCT193472.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(7599187..7599923,7602399..7602537,
FT                   7603288..7603353,7604505..7604579,7606603..7606704,
FT                   7611440..7611593,7615110..7615216,7627083..7627166,
FT                   7632920..7632972,7673152..7673187,7695279..>7695750))
FT                   /gene="Prkar2b"
FT                   /locus_tag="mCG_22474"
FT                   /product="protein kinase, cAMP dependent regulatory, type
FT                   II beta, transcript variant mCT193473"
FT                   /note="gene_id=mCG22474.2 transcript_id=mCT193473.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(7599790..7599923,7602399..7602537,
FT                   7603288..7603353,7604505..7604579,7606603..7606704,
FT                   7611440..7611593,7615110..7615216,7627083..7627166,
FT                   7632920..7632972,7673152..7673187,7695279..>7695675))
FT                   /codon_start=1
FT                   /gene="Prkar2b"
FT                   /locus_tag="mCG_22474"
FT                   /product="protein kinase, cAMP dependent regulatory, type
FT                   II beta, isoform CRA_b"
FT                   /note="gene_id=mCG22474.2 transcript_id=mCT193473.0
FT                   protein_id=mCP114466.0 isoform=CRA_b"
FT                   /protein_id="EDL36899.1"
FT                   /translation="RPGRSLGSRAARDRTADRGRGRRPGASACTGRMSIEIPAGLTELL
FT                   QGFTVEVLRHQPADLLEFALQHFTRLQQENERKGAARFGHEGRTWGDAGAAAGGGTPSK
FT                   GVNFAEEPMRSDSENGEEEEAAEAGAFNAPVINRFTRRASVCAEAYNPDEEEDDAESRI
FT                   IHPKTDDQRNRLQEACKDILLFKNLDPEQMSQVLDAMFEKLVKEGEHVIDQGDDGDNFY
FT                   VIDRGTFDIYVKCDGVGRCVGNYDNRGSFGELALMYNTPRAATITATSPGALWGLDRVT
FT                   FRRIIVKNNAKKRKMYESFIESLPFLKSLEVSERLKVVDVIGTKVYNDGEQIIAQGDLA
FT                   DSFFIVESGEVKITMKRKGKSEVEENGAVEIARCFRGQYFGELALVTNKPRAASAHAIG
FT                   TVKCLAMDVQAFERLLGPCMEIMKRNIATYEEQLVALFGTNMDIVEPTA"
FT   CDS             complement(join(7599790..7599923,7602399..7602537,
FT                   7603288..7603353,7604505..7604579,7606603..7606704,
FT                   7611440..7611593,7615110..7615216,7627083..7627166,
FT                   7632920..7632972,7673152..7673187,7695279..>7695675))
FT                   /codon_start=1
FT                   /gene="Prkar2b"
FT                   /locus_tag="mCG_22474"
FT                   /product="protein kinase, cAMP dependent regulatory, type
FT                   II beta, isoform CRA_b"
FT                   /note="gene_id=mCG22474.2 transcript_id=mCT22330.2
FT                   protein_id=mCP11335.2 isoform=CRA_b"
FT                   /protein_id="EDL36900.1"
FT                   /translation="RPGRSLGSRAARDRTADRGRGRRPGASACTGRMSIEIPAGLTELL
FT                   QGFTVEVLRHQPADLLEFALQHFTRLQQENERKGAARFGHEGRTWGDAGAAAGGGTPSK
FT                   GVNFAEEPMRSDSENGEEEEAAEAGAFNAPVINRFTRRASVCAEAYNPDEEEDDAESRI
FT                   IHPKTDDQRNRLQEACKDILLFKNLDPEQMSQVLDAMFEKLVKEGEHVIDQGDDGDNFY
FT                   VIDRGTFDIYVKCDGVGRCVGNYDNRGSFGELALMYNTPRAATITATSPGALWGLDRVT
FT                   FRRIIVKNNAKKRKMYESFIESLPFLKSLEVSERLKVVDVIGTKVYNDGEQIIAQGDLA
FT                   DSFFIVESGEVKITMKRKGKSEVEENGAVEIARCFRGQYFGELALVTNKPRAASAHAIG
FT                   TVKCLAMDVQAFERLLGPCMEIMKRNIATYEEQLVALFGTNMDIVEPTA"
FT   CDS             complement(join(7599790..7599923,7602399..7602537,
FT                   7603288..7603353,7604505..7604579,7606603..7606704,
FT                   7611440..7611593,7615110..7615216,7627083..7627166,
FT                   7632920..7632972,7673152..7673187,7694813..>7694813))
FT                   /codon_start=1
FT                   /gene="Prkar2b"
FT                   /locus_tag="mCG_22474"
FT                   /product="protein kinase, cAMP dependent regulatory, type
FT                   II beta, isoform CRA_a"
FT                   /note="gene_id=mCG22474.2 transcript_id=mCT193472.0
FT                   protein_id=mCP114465.0 isoform=CRA_a"
FT                   /protein_id="EDL36898.1"
FT                   /translation="APVINRFTRRASVCAEAYNPDEEEDDAESRIIHPKTDDQRNRLQE
FT                   ACKDILLFKNLDPEQMSQVLDAMFEKLVKEGEHVIDQGDDGDNFYVIDRGTFDIYVKCD
FT                   GVGRCVGNYDNRGSFGELALMYNTPRAATITATSPGALWGLDRVTFRRIIVKNNAKKRK
FT                   MYESFIESLPFLKSLEVSERLKVVDVIGTKVYNDGEQIIAQGDLADSFFIVESGEVKIT
FT                   MKRKGKSEVEENGAVEIARCFRGQYFGELALVTNKPRAASAHAIGTVKCLAMDVQAFER
FT                   LLGPCMEIMKRNIATYEEQLVALFGTNMDIVEPTA"
FT   gene            complement(7748086..7758120)
FT                   /locus_tag="mCG_148260"
FT                   /note="gene_id=mCG148260.0"
FT   mRNA            complement(join(7748086..7750624,7758039..7758120))
FT                   /locus_tag="mCG_148260"
FT                   /product="mCG148260"
FT                   /note="gene_id=mCG148260.0 transcript_id=mCT188523.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(7748609..7748788)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148260"
FT                   /product="mCG148260"
FT                   /note="gene_id=mCG148260.0 transcript_id=mCT188523.0
FT                   protein_id=mCP108095.0"
FT                   /protein_id="EDL36897.1"
FT                   /translation="MEPPKKESGGRMKNKGAQAKKRRRRRRGRGGGGRGGGGRGGGEGG
FT                   RGGGERKIRGGLRA"
FT   gene            complement(7812275..7850730)
FT                   /gene="Pik3cg"
FT                   /locus_tag="mCG_5362"
FT                   /note="gene_id=mCG5362.2"
FT   mRNA            complement(join(7812275..7812771,7814491..7815662,
FT                   7833682..7833839,7835719..7835830,7836814..7836944,
FT                   7837739..7837829,7839305..7839451,7841208..7841311,
FT                   7842620..7842845,7842955..7843020,7846112..7848118,
FT                   7850637..7850730))
FT                   /gene="Pik3cg"
FT                   /locus_tag="mCG_5362"
FT                   /product="phosphoinositide-3-kinase, catalytic, gamma
FT                   polypeptide, transcript variant mCT4753"
FT                   /note="gene_id=mCG5362.2 transcript_id=mCT4753.2 created on
FT                   28-MAY-2003"
FT   mRNA            complement(join(7814441..7815662,7833682..7833839,
FT                   7835719..7835830,7836814..7836944,7837739..7837829,
FT                   7839305..7839451,7841208..7841311,7842620..7842845,
FT                   7842955..7843020,7846112..7848118,7850281..>7850329))
FT                   /gene="Pik3cg"
FT                   /locus_tag="mCG_5362"
FT                   /product="phosphoinositide-3-kinase, catalytic, gamma
FT                   polypeptide, transcript variant mCT193448"
FT                   /note="gene_id=mCG5362.2 transcript_id=mCT193448.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(7814442..7814929,7829686..7829843,
FT                   7831543..7831654,7836814..7836944,7837739..7837829,
FT                   7839305..7839451,7841208..7841311,7842620..7842845,
FT                   7842955..7843020,7846112..7848118,7850281..7850589))
FT                   /gene="Pik3cg"
FT                   /locus_tag="mCG_5362"
FT                   /product="phosphoinositide-3-kinase, catalytic, gamma
FT                   polypeptide, transcript variant mCT182226"
FT                   /note="gene_id=mCG5362.2 transcript_id=mCT182226.0 created
FT                   on 28-MAY-2003"
FT   CDS             complement(join(7814876..7814929,7829686..7829843,
FT                   7831543..7831654,7836814..7836944,7837739..7837829,
FT                   7839305..7839451,7841208..7841311,7842620..7842845,
FT                   7842955..7843020,7846112..7848106))
FT                   /codon_start=1
FT                   /gene="Pik3cg"
FT                   /locus_tag="mCG_5362"
FT                   /product="phosphoinositide-3-kinase, catalytic, gamma
FT                   polypeptide, isoform CRA_c"
FT                   /note="gene_id=mCG5362.2 transcript_id=mCT182226.0
FT                   protein_id=mCP105122.0 isoform=CRA_c"
FT                   /protein_id="EDL36895.1"
FT                   /translation="MELENYEQPVVLREDNLRRRRRMKPRSAAGSLSSMELIPIEFVLP
FT                   TSQRISKTPETALLHVAGHGNVEQMKAQVWLRALETSVAAEFYHRLGPDQFLLLYQKKG
FT                   QWYEIYDRYQVVQTLDCLHYWKLMHKSPGQIHVVQRHVPSEETLAFQKQLTSLIGYDVT
FT                   DISNVHDDELEFTRRRLVTPRMAEVAGRDAKLYAMHPWVTSKPLPDYLSKKIANNCIFI
FT                   VIHRGTTSQTIKVSADDTPGTILQSFFTKMAKKKSLMNIPESQSEQDFVLRVCGRDEYL
FT                   VGETPLKNFQWVRQCLKNGDEIHLVLDTPPDPALDEVRKEEWPLVDDCTGVTGYHEQLT
FT                   IHGKDHESVFTVSLWDCDRKFRVKIRGIDIPVLPRNTDLTVFVEANIQHGQQVLCQRRT
FT                   SPKPFAEEVLWNVWLEFGIKIKDLPKGALLNLQIYCCKTPSLSSKASAETPGSESKGKA
FT                   QLLYYVNLLLIDHRFLLRHGDYVLHMWQISGKAEEQGSFNADKLTSATNPDKENSMSIS
FT                   ILLDNYCHPIALPKHRPTPDPEGDRVRAEMPNQLRKQLEAIIATDPLNPLTAEDKELLW
FT                   HFRYESLKHPKAYPKLFSSVKWGQQEIVAKTYQLLARREIWDQSALDVGLTMQLLDCNF
FT                   SDENVRAIAVQKLESLEDDDVLHYLLQLVQAVKFEPYHDSALARFLLKRGLRNKRIGHF
FT                   LFWFLRSEIAQSRHYQQRFAVILEAYLRGCGTAMLQDFTQQVHVIEMLQKVTIDIKSLS
FT                   AEKYDVSSQVISQLKQKLESLQNSNLPESFRVPYDPGLKAGTLVIEKCKVMASKKKPLW
FT                   LEFKCADPTVLSNETIGIIFKHGDDLRQDMLILQILRIMESIWETESLDLCLLPYGCIS
FT                   TGDKIGMIEIVKDATTIAQIQQSTVGNTGAFKDEVLNHWLKEKCPIEEKFQAAVERFVY
FT                   SCAGYCVATFVLGIGDRHNDNIMISETGNLFHIDFGHILGNYKSFLGINKERVPFVLTP
FT                   DFLFVMGSSGKKTSPHFQKFQKGVSKHPLSAHRARNAS"
FT   CDS             complement(join(7815384..7815662,7833682..7833839,
FT                   7835719..7835830,7836814..7836944,7837739..7837829,
FT                   7839305..7839451,7841208..7841311,7842620..7842845,
FT                   7842955..7843020,7846112..>7848109))
FT                   /codon_start=1
FT                   /gene="Pik3cg"
FT                   /locus_tag="mCG_5362"
FT                   /product="phosphoinositide-3-kinase, catalytic, gamma
FT                   polypeptide, isoform CRA_b"
FT                   /note="gene_id=mCG5362.2 transcript_id=mCT193448.0
FT                   protein_id=mCP114426.0 isoform=CRA_b"
FT                   /protein_id="EDL36894.1"
FT                   /translation="GMELENYEQPVVLREDNLRRRRRMKPRSAAGSLSSMELIPIEFVL
FT                   PTSQRISKTPETALLHVAGHGNVEQMKAQVWLRALETSVAAEFYHRLGPDQFLLLYQKK
FT                   GQWYEIYDRYQVVQTLDCLHYWKLMHKSPGQIHVVQRHVPSEETLAFQKQLTSLIGYDV
FT                   TDISNVHDDELEFTRRRLVTPRMAEVAGRDAKLYAMHPWVTSKPLPDYLSKKIANNCIF
FT                   IVIHRGTTSQTIKVSADDTPGTILQSFFTKMAKKKSLMNIPESQSEQDFVLRVCGRDEY
FT                   LVGETPLKNFQWVRQCLKNGDEIHLVLDTPPDPALDEVRKEEWPLVDDCTGVTGYHEQL
FT                   TIHGKDHESVFTVSLWDCDRKFRVKIRGIDIPVLPRNTDLTVFVEANIQHGQQVLCQRR
FT                   TSPKPFAEEVLWNVWLEFGIKIKDLPKGALLNLQIYCCKTPSLSSKASAETPGSESKGK
FT                   AQLLYYVNLLLIDHRFLLRHGDYVLHMWQISGKAEEQGSFNADKLTSATNPDKENSMSI
FT                   SILLDNYCHPIALPKHRPTPDPEGDRVRAEMPNQLRKQLEAIIATDPLNPLTAEDKELL
FT                   WHFRYESLKHPKAYPKLFSSVKWGQQEIVAKTYQLLARREIWDQSALDVGLTMQLLDCN
FT                   FSDENVRAIAVQKLESLEDDDVLHYLLQLVQAVKFEPYHDSALARFLLKRGLRNKRIGH
FT                   FLFWFLRSEIAQSRHYQQRFAVILEAYLRGCGTAMLQDFTQQVHVIEMLQKVTIDIKSL
FT                   SAEKYDVSSQVISQLKQKLESLQNSNLPESFRVPYDPGLKAGTLVIEKCKVMASKKKPL
FT                   WLEFKCADPTVLSNETIGIIFKHGDDLRQDMLILQILRIMESIWETESLDLCLLPYGCI
FT                   STGDKIGMIEIVKDATTIAQIQQSTVGNTGAFKDEVLNHWLKEKCPIEEKFQAAVERFV
FT                   YSCAGYCVATFVLGIGDRHNDNIMISETGNLFHIDFGHILGNYKSFLGINKERVPFVLT
FT                   PDFLFVMGSSGKKTSPHFQKFQDVCVRAYLALRHHTNLLIILFSMMLMTGMPQLTSKED
FT                   IEYIRDALTVGKSEEDAKKYFLDQIEVCRDKGWTVQFNWFLHLVLGIKQGEKHSA"
FT   mRNA            complement(join(7815384..7815662,7824240..7824270,
FT                   7833682..7833839,7835719..7835830,7836814..7836944,
FT                   7837739..7837829,7839305..7839451,7841208..7841311,
FT                   7842620..7842845,7842955..7843020,7846112..>7848106))
FT                   /gene="Pik3cg"
FT                   /locus_tag="mCG_5362"
FT                   /product="phosphoinositide-3-kinase, catalytic, gamma
FT                   polypeptide, transcript variant mCT182225"
FT                   /note="gene_id=mCG5362.2 transcript_id=mCT182225.0 created
FT                   on 28-MAY-2003"
FT   CDS             complement(join(7815384..7815662,7833682..7833839,
FT                   7835719..7835830,7836814..7836944,7837739..7837829,
FT                   7839305..7839451,7841208..7841311,7842620..7842845,
FT                   7842955..7843020,7846112..7848106))
FT                   /codon_start=1
FT                   /gene="Pik3cg"
FT                   /locus_tag="mCG_5362"
FT                   /product="phosphoinositide-3-kinase, catalytic, gamma
FT                   polypeptide, isoform CRA_d"
FT                   /note="gene_id=mCG5362.2 transcript_id=mCT4753.2
FT                   protein_id=mCP11339.2 isoform=CRA_d"
FT                   /protein_id="EDL36896.1"
FT                   /translation="MELENYEQPVVLREDNLRRRRRMKPRSAAGSLSSMELIPIEFVLP
FT                   TSQRISKTPETALLHVAGHGNVEQMKAQVWLRALETSVAAEFYHRLGPDQFLLLYQKKG
FT                   QWYEIYDRYQVVQTLDCLHYWKLMHKSPGQIHVVQRHVPSEETLAFQKQLTSLIGYDVT
FT                   DISNVHDDELEFTRRRLVTPRMAEVAGRDAKLYAMHPWVTSKPLPDYLSKKIANNCIFI
FT                   VIHRGTTSQTIKVSADDTPGTILQSFFTKMAKKKSLMNIPESQSEQDFVLRVCGRDEYL
FT                   VGETPLKNFQWVRQCLKNGDEIHLVLDTPPDPALDEVRKEEWPLVDDCTGVTGYHEQLT
FT                   IHGKDHESVFTVSLWDCDRKFRVKIRGIDIPVLPRNTDLTVFVEANIQHGQQVLCQRRT
FT                   SPKPFAEEVLWNVWLEFGIKIKDLPKGALLNLQIYCCKTPSLSSKASAETPGSESKGKA
FT                   QLLYYVNLLLIDHRFLLRHGDYVLHMWQISGKAEEQGSFNADKLTSATNPDKENSMSIS
FT                   ILLDNYCHPIALPKHRPTPDPEGDRVRAEMPNQLRKQLEAIIATDPLNPLTAEDKELLW
FT                   HFRYESLKHPKAYPKLFSSVKWGQQEIVAKTYQLLARREIWDQSALDVGLTMQLLDCNF
FT                   SDENVRAIAVQKLESLEDDDVLHYLLQLVQAVKFEPYHDSALARFLLKRGLRNKRIGHF
FT                   LFWFLRSEIAQSRHYQQRFAVILEAYLRGCGTAMLQDFTQQVHVIEMLQKVTIDIKSLS
FT                   AEKYDVSSQVISQLKQKLESLQNSNLPESFRVPYDPGLKAGTLVIEKCKVMASKKKPLW
FT                   LEFKCADPTVLSNETIGIIFKHGDDLRQDMLILQILRIMESIWETESLDLCLLPYGCIS
FT                   TGDKIGMIEIVKDATTIAQIQQSTVGNTGAFKDEVLNHWLKEKCPIEEKFQAAVERFVY
FT                   SCAGYCVATFVLGIGDRHNDNIMISETGNLFHIDFGHILGNYKSFLGINKERVPFVLTP
FT                   DFLFVMGSSGKKTSPHFQKFQDVCVRAYLALRHHTNLLIILFSMMLMTGMPQLTSKEDI
FT                   EYIRDALTVGKSEEDAKKYFLDQIEVCRDKGWTVQFNWFLHLVLGIKQGEKHSA"
FT   CDS             complement(join(7815649..7815662,7824240..7824270,
FT                   7833682..7833839,7835719..7835830,7836814..7836944,
FT                   7837739..7837829,7839305..7839451,7841208..7841311,
FT                   7842620..7842845,7842955..7843020,7846112..7848106))
FT                   /codon_start=1
FT                   /gene="Pik3cg"
FT                   /locus_tag="mCG_5362"
FT                   /product="phosphoinositide-3-kinase, catalytic, gamma
FT                   polypeptide, isoform CRA_a"
FT                   /note="gene_id=mCG5362.2 transcript_id=mCT182225.0
FT                   protein_id=mCP105121.0 isoform=CRA_a"
FT                   /protein_id="EDL36893.1"
FT                   /translation="MELENYEQPVVLREDNLRRRRRMKPRSAAGSLSSMELIPIEFVLP
FT                   TSQRISKTPETALLHVAGHGNVEQMKAQVWLRALETSVAAEFYHRLGPDQFLLLYQKKG
FT                   QWYEIYDRYQVVQTLDCLHYWKLMHKSPGQIHVVQRHVPSEETLAFQKQLTSLIGYDVT
FT                   DISNVHDDELEFTRRRLVTPRMAEVAGRDAKLYAMHPWVTSKPLPDYLSKKIANNCIFI
FT                   VIHRGTTSQTIKVSADDTPGTILQSFFTKMAKKKSLMNIPESQSEQDFVLRVCGRDEYL
FT                   VGETPLKNFQWVRQCLKNGDEIHLVLDTPPDPALDEVRKEEWPLVDDCTGVTGYHEQLT
FT                   IHGKDHESVFTVSLWDCDRKFRVKIRGIDIPVLPRNTDLTVFVEANIQHGQQVLCQRRT
FT                   SPKPFAEEVLWNVWLEFGIKIKDLPKGALLNLQIYCCKTPSLSSKASAETPGSESKGKA
FT                   QLLYYVNLLLIDHRFLLRHGDYVLHMWQISGKAEEQGSFNADKLTSATNPDKENSMSIS
FT                   ILLDNYCHPIALPKHRPTPDPEGDRVRAEMPNQLRKQLEAIIATDPLNPLTAEDKELLW
FT                   HFRYESLKHPKAYPKLFSSVKWGQQEIVAKTYQLLARREIWDQSALDVGLTMQLLDCNF
FT                   SDENVRAIAVQKLESLEDDDVLHYLLQLVQAVKFEPYHDSALARFLLKRGLRNKRIGHF
FT                   LFWFLRSEIAQSRHYQQRFAVILEAYLRGCGTAMLQDFTQQVHVIEMLQKVTIDIKSLS
FT                   AEKYDVSSQVISQLKQKLESLQNSNLPESFRVPYDPGLKAGTLVIEKCKVMASKKKPLW
FT                   LEFKCADPTVLSNETIGIIFKHGDDLRQDMLILQILRIMESIWETESLDLCLLPYGCIS
FT                   TGDKIGMIEIVKDATTIAQIQQSTVGNTGAFKDEVLNHWLKEKCPIEEKFQAAVERFVY
FT                   SCAGYCVATFVLGIGDRHNDNIMISETGNLFHIDFGHILGNYKSFLGINKERVPFVLTP
FT                   DFLFVMGSSGKKTSPHFQKFQDCCVYFTVLWGCLC"
FT   gene            <8022286..8026090
FT                   /locus_tag="mCG_142431"
FT                   /note="gene_id=mCG142431.1"
FT   mRNA            join(<8022286..8022388,8022576..8026090)
FT                   /locus_tag="mCG_142431"
FT                   /product="mCG142431"
FT                   /note="gene_id=mCG142431.1 transcript_id=mCT180469.1
FT                   created on 10-JUN-2003"
FT   CDS             <8022792..8023295
FT                   /codon_start=1
FT                   /locus_tag="mCG_142431"
FT                   /product="mCG142431"
FT                   /note="gene_id=mCG142431.1 transcript_id=mCT180469.1
FT                   protein_id=mCP103391.1"
FT                   /protein_id="EDL36892.1"
FT                   /translation="CALRRLLPAAARGSFRALERTYVNVSRMFTEPAPFGALYARTRPL
FT                   DAVRRRGPGSGQVRPPRPRPDGTAGPATEVPLLPNPDGDVSRTWRDTCVFSLSDSTSPV
FT                   WKTSEDLQIFFSKGILFSCLCNTARILLAPDSPSVFFLTVSPTFWTEDRLCFLVKCWCT
FT                   LRVF"
FT   gene            complement(8070316..8072518)
FT                   /locus_tag="mCG_1041686"
FT                   /note="gene_id=mCG1041686.1"
FT   mRNA            complement(8070316..8072518)
FT                   /locus_tag="mCG_1041686"
FT                   /product="mCG1041686"
FT                   /note="gene_id=mCG1041686.1 transcript_id=mCT159390.1
FT                   created on 26-SEP-2002"
FT   CDS             complement(8070392..8070544)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041686"
FT                   /product="mCG1041686"
FT                   /note="gene_id=mCG1041686.1 transcript_id=mCT159390.1
FT                   protein_id=mCP78422.1"
FT                   /protein_id="EDL36891.1"
FT                   /translation="MSSRWQYDRYQDVSVVELKAHHLLRRSTNVTAPGLAPRCSHLTVK
FT                   VSPST"
FT   gene            8341468..8345131
FT                   /pseudo
FT                   /locus_tag="mCG_127170"
FT                   /note="gene_id=mCG127170.0"
FT   mRNA            join(8341468..8341634,8341685..8342213,8343130..8343312,
FT                   8343336..8345131)
FT                   /pseudo
FT                   /locus_tag="mCG_127170"
FT                   /note="gene_id=mCG127170.0 transcript_id=mCT128451.0
FT                   created on 10-SEP-2002"
FT   gene            complement(8382346..8402043)
FT                   /locus_tag="mCG_148266"
FT                   /note="gene_id=mCG148266.0"
FT   mRNA            complement(join(8382346..8384255,8401804..8402043))
FT                   /locus_tag="mCG_148266"
FT                   /product="mCG148266"
FT                   /note="gene_id=mCG148266.0 transcript_id=mCT188529.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(8382643..8382861)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148266"
FT                   /product="mCG148266"
FT                   /note="gene_id=mCG148266.0 transcript_id=mCT188529.0
FT                   protein_id=mCP108101.0"
FT                   /protein_id="EDL36890.1"
FT                   /translation="MLSNPNGCYICITTPEPKAHNRTENRKIVRGILLRDYISYKRQGS
FT                   FTHDTSTIWLPKEHLTKDVLTWKGEIS"
FT   gene            <8450010..8481285
FT                   /gene="Pbef1"
FT                   /locus_tag="mCG_5364"
FT                   /note="gene_id=mCG5364.1"
FT   mRNA            join(<8450010..8450161,8459702..8459858,8462567..8462670,
FT                   8464436..8464564,8467952..8468110,8468804..8468940,
FT                   8470578..8470803,8472363..8472482,8476384..8476524,
FT                   8478295..8478429,8480101..8481285)
FT                   /gene="Pbef1"
FT                   /locus_tag="mCG_5364"
FT                   /product="pre-B-cell colony-enhancing factor 1"
FT                   /note="gene_id=mCG5364.1 transcript_id=mCT4756.1 created on
FT                   30-AUG-2002"
FT   CDS             join(<8450018..8450161,8459702..8459858,8462567..8462670,
FT                   8464436..8464564,8467952..8468110,8468804..8468940,
FT                   8470578..8470803,8472363..8472482,8476384..8476524,
FT                   8478295..8478429,8480101..8480211)
FT                   /codon_start=1
FT                   /gene="Pbef1"
FT                   /locus_tag="mCG_5364"
FT                   /product="pre-B-cell colony-enhancing factor 1"
FT                   /note="gene_id=mCG5364.1 transcript_id=mCT4756.1
FT                   protein_id=mCP11308.1"
FT                   /protein_id="EDL36889.1"
FT                   /translation="ATERSEAHFSPCSQPRRAARGAASPLRPEMNAAAEAEFNILLATD
FT                   SYKVTHYKQYPPNTSKVYSYFECREKKTENSKVRKVKYEETVFYGLQYILNKYLKGKVV
FT                   TKEKIQEAKEVYREHFQDDVFNERGWNYILEKYDGHLPIEVKAVPEGSVIPRGNVLFTV
FT                   ENTDPECYWLTNWIETILVQSWYPITVATNSREQKKILAKYLLETSGNLDGLEYKLHDF
FT                   GYRGVSSQETAGIGASAHLVNFKGTDTVAGIALIKKYYGTKDPVPGYSVPAAEHSTITA
FT                   WGKDHEKDAFEHIVTQFSSVPVSVVSDSYDIYNACEKIWGEDLRHLIVSRSTEAPLIIR
FT                   PDSGNPLDTVLKVLDILGKKFPVTENSKGYKLLPPYLRVIQGDGVDINTLQEIVEGMKQ
FT                   KKWSIENVSFGSGGALLQKLTRDLLNCSFKCSYVVTNGLGVNVFKDPVADPNKRSKKGR
FT                   LSLHRTPAGNFVTLEEGKGDLEEYGHDLLHTVFKNGKVTKSYSFDEVRKNAQLNIEQDV
FT                   APH"
FT   gene            8451409..8455518
FT                   /pseudo
FT                   /locus_tag="mCG_142302"
FT                   /note="gene_id=mCG142302.0"
FT   mRNA            8451409..8455518
FT                   /pseudo
FT                   /locus_tag="mCG_142302"
FT                   /note="gene_id=mCG142302.0 transcript_id=mCT179818.0
FT                   created on 07-FEB-2003"
FT   gene            <8526591..8536495
FT                   /locus_tag="mCG_145559"
FT                   /note="gene_id=mCG145559.0"
FT   mRNA            join(<8526591..8527006,8527855..8527969,8532703..8536495)
FT                   /locus_tag="mCG_145559"
FT                   /product="mCG145559"
FT                   /note="gene_id=mCG145559.0 transcript_id=mCT184983.0
FT                   created on 05-JUN-2003"
FT   CDS             <8533769..8535196
FT                   /codon_start=1
FT                   /locus_tag="mCG_145559"
FT                   /product="mCG145559"
FT                   /note="gene_id=mCG145559.0 transcript_id=mCT184983.0
FT                   protein_id=mCP105143.0"
FT                   /protein_id="EDL36888.1"
FT                   /translation="TLVASGHYRSDKWMSRIFPPLREINIYMFRRNPLKNGIVVYTDGS
FT                   KTGIGAYVANGKVVSKQYNENSPQVVECLVVLEVLKTFLEPLNIVSDSCYVVNAVNLLE
FT                   VAGVIKPSSRVANIFQQIQLVLLSRRFPVYITHVRAHSGLPGPMALGNDLADKATKVVA
FT                   AALSSPVEAARNFHNNFHVTAETLRSRFSLTRKEARDIVTQCQSCCEFLPVPHVGINPR
FT                   GIRPLQVWQMDVTHVSSFGKLQYLHVSIDTCSGIMFASPLTGEKASHVIQHCLEAWSAW
FT                   GKPKLLKTDNGPAYTSQKFQQFCRQMDVTHLTGLPYNPQGQGIVERAHRTLKAYLIKQK
FT                   RGTFEEILPRAPRVSVSLALFTLNFLNIDAHGHTAAERHCTEPDRPNEMVKWKNVLDNK
FT                   WYGPDPILIRSRGAICVFPQNEDNPFWIPERLTRKIQTDQGNTDVPRLGDVQGVNNKKR
FT                   AALGDNVDISTPNDGDV"
FT   gene            complement(8549319..8584777)
FT                   /locus_tag="mCG_54161"
FT                   /note="gene_id=mCG54161.2"
FT   mRNA            complement(join(8549319..8550115,8550430..8550663,
FT                   8550758..8550838,8555408..8555469,8584188..8584361,
FT                   8584491..8584777))
FT                   /locus_tag="mCG_54161"
FT                   /product="mCG54161, transcript variant mCT54344"
FT                   /note="gene_id=mCG54161.2 transcript_id=mCT54344.3 created
FT                   on 13-JUN-2003"
FT   CDS             complement(join(8550079..8550115,8550430..8550635))
FT                   /codon_start=1
FT                   /locus_tag="mCG_54161"
FT                   /product="mCG54161, isoform CRA_b"
FT                   /note="gene_id=mCG54161.2 transcript_id=mCT54344.3
FT                   protein_id=mCP33129.3 isoform=CRA_b"
FT                   /protein_id="EDL36887.1"
FT                   /translation="MNSGKLVFGRKVALQEEFLSQVKHCFNHTRMKQPSDTPTTTTTSL
FT                   HMSELGTQAGPVWTMLILRSTGSWVSNNVVKSSQS"
FT   mRNA            complement(join(8554891..8555469,8555566..8555689,
FT                   8556810..8556921,8563024..8563090,8573357..8573472,
FT                   8584188..8584361,8584491..8584770))
FT                   /locus_tag="mCG_54161"
FT                   /product="mCG54161, transcript variant mCT173191"
FT                   /note="gene_id=mCG54161.2 transcript_id=mCT173191.1 created
FT                   on 13-JUN-2003"
FT   gene            complement(8570160..8610480)
FT                   /locus_tag="mCG_148256"
FT                   /note="gene_id=mCG148256.0"
FT   mRNA            complement(join(8570160..8570189,8608375..8610480))
FT                   /locus_tag="mCG_148256"
FT                   /product="mCG148256"
FT                   /note="gene_id=mCG148256.0 transcript_id=mCT188519.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(join(8584247..8584361,8584491..8584579))
FT                   /codon_start=1
FT                   /locus_tag="mCG_54161"
FT                   /product="mCG54161, isoform CRA_a"
FT                   /note="gene_id=mCG54161.2 transcript_id=mCT173191.1
FT                   protein_id=mCP96110.0 isoform=CRA_a"
FT                   /protein_id="EDL36886.1"
FT                   /translation="MIHQTFPQTSQSCWSQSRRKTTHLRSWLDREHSLLPPEWDQSRHL
FT                   FSGFLVPGLFWRVGIVACLHAW"
FT   gene            <8584954..8607908
FT                   /gene="Sypl"
FT                   /locus_tag="mCG_5358"
FT                   /note="gene_id=mCG5358.3"
FT   mRNA            join(<8584954..8585004,8585274..8585345,8596362..8596489,
FT                   8598534..8598741,8605131..8605322,8606594..>8606728)
FT                   /gene="Sypl"
FT                   /locus_tag="mCG_5358"
FT                   /product="synaptophysin-like protein, transcript variant
FT                   mCT4754"
FT                   /note="gene_id=mCG5358.3 transcript_id=mCT4754.0 created on
FT                   30-AUG-2002"
FT   CDS             join(8584954..8585004,8585274..8585345,8596362..8596489,
FT                   8598534..8598741,8605131..8605322,8606594..8606728)
FT                   /codon_start=1
FT                   /gene="Sypl"
FT                   /locus_tag="mCG_5358"
FT                   /product="synaptophysin-like protein, isoform CRA_c"
FT                   /note="gene_id=mCG5358.3 transcript_id=mCT4754.0
FT                   protein_id=mCP11314.0 isoform=CRA_c"
FT                   /protein_id="EDL36885.1"
FT                   /translation="MASKANMVRQRFSRLSQRMSAFQINLNPLKEPLGFIKILEWFASI
FT                   FAFATCGGFKGKTEIQVNCPKVGVNKNQTVTATFGYPFRLNQASFHTPPNVNVCDVNWE
FT                   KHVLIGDYSSSAQFYVTFAVFVFLYCIAALLLYVGYTNLYRDSRKLPMIDFIVTLVATF
FT                   LWLVSSSAWAKALTDIKVATGHRIVEELEICNPESGVSCYFVSVTSMGSLNVSVIFGFL
FT                   NMILWGGNAWFVYKETSLHSPSNTSASHSQGGGPPTSGM"
FT   mRNA            join(<8585215..8585345,8596362..8596489,8598534..8598741,
FT                   8605131..8605322,8606594..8607908)
FT                   /gene="Sypl"
FT                   /locus_tag="mCG_5358"
FT                   /product="synaptophysin-like protein, transcript variant
FT                   mCT193431"
FT                   /note="gene_id=mCG5358.3 transcript_id=mCT193431.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<8585217..8585345,8596362..8596489,8598534..8598741,
FT                   8605131..8605322,8606594..8606728)
FT                   /codon_start=1
FT                   /gene="Sypl"
FT                   /locus_tag="mCG_5358"
FT                   /product="synaptophysin-like protein, isoform CRA_b"
FT                   /note="gene_id=mCG5358.3 transcript_id=mCT193431.0
FT                   protein_id=mCP114425.0 isoform=CRA_b"
FT                   /protein_id="EDL36884.1"
FT                   /translation="SRRSPPPPRVLTLFPPFPQRMSAFQINLNPLKEPLGFIKILEWFA
FT                   SIFAFATCGGFKGKTEIQVNCPKVGVNKNQTVTATFGYPFRLNQASFHTPPNVNVCDVN
FT                   WEKHVLIGDYSSSAQFYVTFAVFVFLYCIAALLLYVGYTNLYRDSRKLPMIDFIVTLVA
FT                   TFLWLVSSSAWAKALTDIKVATGHRIVEELEICNPESGVSCYFVSVTSMGSLNVSVIFG
FT                   FLNMILWGGNAWFVYKETSLHSPSNTSASHSQGGGPPTSGM"
FT   mRNA            join(<8585545..8585968,8596362..8596489,8598534..8598741,
FT                   8605131..8605322,8606734..8607509)
FT                   /gene="Sypl"
FT                   /locus_tag="mCG_5358"
FT                   /product="synaptophysin-like protein, transcript variant
FT                   mCT172866"
FT                   /note="gene_id=mCG5358.3 transcript_id=mCT172866.0 created
FT                   on 30-AUG-2002"
FT   CDS             join(<8585960..8585968,8596362..8596489,8598534..8598741,
FT                   8605131..8605322,8606734..8606820)
FT                   /codon_start=1
FT                   /gene="Sypl"
FT                   /locus_tag="mCG_5358"
FT                   /product="synaptophysin-like protein, isoform CRA_a"
FT                   /note="gene_id=mCG5358.3 transcript_id=mCT172866.0
FT                   protein_id=mCP95785.0 isoform=CRA_a"
FT                   /protein_id="EDL36883.1"
FT                   /translation="RVNFASIFAFATCGGFKGKTEIQVNCPKVGVNKNQTVTATFGYPF
FT                   RLNQASFHTPPNVNVCDVNWEKHVLIGDYSSSAQFYVTFAVFVFLYCIAALLLYVGYTN
FT                   LYRDSRKLPMIDFIVTLVATFLWLVSSSAWAKALTDIKVATGHRIVEELEICNPESGVS
FT                   CYFVSVTSMGSLNVSVGRNTLYEMCALACLVANTLKSIIVSNKK"
FT   CDS             complement(8608384..8608539)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148256"
FT                   /product="mCG148256"
FT                   /note="gene_id=mCG148256.0 transcript_id=mCT188519.0
FT                   protein_id=mCP108091.0"
FT                   /protein_id="EDL36882.1"
FT                   /translation="MFSDTNTGFTLLASLGAGQGQVLIPAVSLQDGEVKRKKEEEEGGG
FT                   RKRWYM"
FT   gene            complement(8684767..8716188)
FT                   /gene="1110049B09Rik"
FT                   /locus_tag="mCG_5360"
FT                   /note="gene_id=mCG5360.2"
FT   mRNA            complement(join(8684767..8685063,8686140..8686242,
FT                   8687422..8687593,8694214..8694403,8695502..8695650,
FT                   8701023..8701127,8701865..8701959,8714137..8714234,
FT                   8716023..8716188))
FT                   /gene="1110049B09Rik"
FT                   /locus_tag="mCG_5360"
FT                   /product="RIKEN cDNA 1110049B09"
FT                   /note="gene_id=mCG5360.2 transcript_id=mCT4751.2 created on
FT                   11-SEP-2002"
FT   CDS             complement(join(8684924..8685063,8686140..8686242,
FT                   8687422..8687593,8694214..8694403,8695502..8695650,
FT                   8701023..8701127,8701865..8701926))
FT                   /codon_start=1
FT                   /gene="1110049B09Rik"
FT                   /locus_tag="mCG_5360"
FT                   /product="RIKEN cDNA 1110049B09"
FT                   /note="gene_id=mCG5360.2 transcript_id=mCT4751.2
FT                   protein_id=mCP11330.2"
FT                   /protein_id="EDL36881.1"
FT                   /translation="MSANGTLFSTTELDFEAGHKSFNLLVGVRDSGNLEASTALQVTIV
FT                   NINDETPRFTSPRRVYSVPEEVPLGTMVANITAMDPDDEGFPGRLLYSITTTSSYFMVD
FT                   QLTGTIQVARRLDRDAGELRQNPIISLEVRVRDRPSGGQENRMQITFIVEDINDNPATC
FT                   RKLTFSIMLPERTANGTLLLDLNKFCFDDDSEAPNNKFNFTTPSGAGSSRRFSQHPAGS
FT                   GRIVLTGDLDYENPSNLAVGNVYNVMIQVQDAAPPYYKKSIYISILTRPENEFPLIFER
FT                   PSYVFDVPERRPGREGPSPKSDGFI"
FT   gene            complement(8769538..8782109)
FT                   /locus_tag="mCG_148244"
FT                   /note="gene_id=mCG148244.0"
FT   mRNA            complement(join(8769538..8770255,8775536..8775696,
FT                   8777222..8777319,8781715..8781767,8781863..8782109))
FT                   /locus_tag="mCG_148244"
FT                   /product="mCG148244"
FT                   /note="gene_id=mCG148244.0 transcript_id=mCT188507.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(join(8770078..8770255,8775536..8775555))
FT                   /codon_start=1
FT                   /locus_tag="mCG_148244"
FT                   /product="mCG148244"
FT                   /note="gene_id=mCG148244.0 transcript_id=mCT188507.0
FT                   protein_id=mCP108077.0"
FT                   /protein_id="EDL36880.1"
FT                   /translation="MKGDIAMPCQLEKVFLEEGAVSAKSLWWSPRARTHSSEEGWKPSV
FT                   SGGCFWLFLSCLGANLEVSM"
FT   gene            8782313..>8997308
FT                   /locus_tag="mCG_142289"
FT                   /note="gene_id=mCG142289.0"
FT   mRNA            join(8782313..8782455,8782973..8783041,8852110..8852214,
FT                   8955319..8955541,8971391..8971644,8974339..8974421,
FT                   8975287..8975537,8988107..8988299,8992424..8992545,
FT                   8996423..>8997308)
FT                   /locus_tag="mCG_142289"
FT                   /product="mCG142289, transcript variant mCT179805"
FT                   /note="gene_id=mCG142289.0 transcript_id=mCT179805.0
FT                   created on 15-JUL-2003"
FT   mRNA            join(8782319..8782455,8782973..8783041,8852110..8852214,
FT                   8878904..8879147,8879667..8880562)
FT                   /locus_tag="mCG_142289"
FT                   /product="mCG142289, transcript variant mCT179804"
FT                   /note="gene_id=mCG142289.0 transcript_id=mCT179804.0
FT                   created on 15-JUL-2003"
FT   CDS             join(8782359..8782455,8782973..8783041,8852110..8852214,
FT                   8878904..8878989)
FT                   /codon_start=1
FT                   /locus_tag="mCG_142289"
FT                   /product="mCG142289, isoform CRA_a"
FT                   /note="gene_id=mCG142289.0 transcript_id=mCT179804.0
FT                   protein_id=mCP102726.0 isoform=CRA_a"
FT                   /protein_id="EDL36878.1"
FT                   /translation="MATLHRKVPSPEAFLGKPWSSWIDAAKLHCSDNVDLEEAGKEGGK
FT                   SREVMRLNKEDMHLFGHYPAHDDFYLVVCSACNQVVKPQVFQSHCGRKQDSKRNASISW
FT                   SGAESRQALEQRQV"
FT   gene            <8944848..>9002354
FT                   /locus_tag="mCG_127168"
FT                   /note="gene_id=mCG127168.2"
FT   mRNA            join(<8944848..8944912,8955319..8955541,8971370..8971644,
FT                   8974339..8974421,8975287..8975537,8988107..8988299,
FT                   8992424..8992545,8996423..8997365,9000434..9001808)
FT                   /locus_tag="mCG_127168"
FT                   /product="mCG127168, transcript variant mCT193460"
FT                   /note="gene_id=mCG127168.2 transcript_id=mCT193460.0
FT                   created on 09-MAR-2004"
FT   CDS             join(<8944882..8944912,8955319..8955541,8971370..8971644,
FT                   8974339..8974421,8975287..8975537,8988107..8988299,
FT                   8992424..8992545,8996423..8997365,9000434..9000586)
FT                   /codon_start=1
FT                   /locus_tag="mCG_127168"
FT                   /product="mCG127168, isoform CRA_a"
FT                   /note="gene_id=mCG127168.2 transcript_id=mCT193460.0
FT                   protein_id=mCP114403.0 isoform=CRA_a"
FT                   /protein_id="EDL36876.1"
FT                   /translation="RLLGDHDNLLERRHSSMCRPSPSPASPASNSRTSLAQAKTKACLS
FT                   GHSAVSSTSKPFKTPKDNLLTSSSTQHTVFSAKGPRDKPCVPVPVVSLEKIPNLVKADG
FT                   ANVKMNSTTTTAATSSSSAVSTPPLIKPTLMSKSVPPSPEKILNGKGILSATIDKKHPN
FT                   GTKNSNKPYRRLSEREFDPNKHCGVLDPETKKPCTRSLTCKTHSLSHRRAVPGRKKQFD
FT                   LLLAEHKAKSREKEVKEHLLTSAREILPNPPGPSPDAPQASSGSTVAEPKVASPPKSRP
FT                   LNSVLPRPSSANSISSSTSSNHSGYTPEPPLLPAGGDLASRLSSDEGEMDGADESEKLD
FT                   CQFSTHHPRPLAFCSFGSRLMGRGYYVFDRRWDRFRFALNSMVEKHLNSQMWKKIPPAA
FT                   DSPMPSPAAHITTPVPASVLQPFSNPSAVYLPSAPISSRLTSSYIMTSAMLSDAAFVAS
FT                   PDPRVLMSHTTAFPHVAATLSIMDSTFKAPSAVSPIPAVIPSPSHKPSKTKTSKSSKVK
FT                   DLSARSDESPSNKKRKPQSSTSASSLSLQAPLSSPLSGPHKKNCILNASSALNSYQAAP
FT                   PYNSLSVHNSNNGVSPLSAKLEPSGRTSLPSGPMDIVRQVGAVGGSSGPCPLSVPSLAL
FT                   HAGDLSLASHNAVSSLPLSFDKSEGKKRKNSSPSSKACKITKMPGMNSVHKKNPPSLLA
FT                   PVPDPVNSTSSRQVGKNSSLALSQSSPSSISSPGHSRQVSFQGWRKPRKANIKPVRMCT
FT                   RVRP"
FT   mRNA            join(8944891..8944912,8955319..8955541,8971370..8971644,
FT                   8974339..8974421,8975287..8975537,8988107..8988299,
FT                   8992424..8992545,8996423..8997365,9000434..9000508,
FT                   9002316..>9002354)
FT                   /locus_tag="mCG_127168"
FT                   /product="mCG127168, transcript variant mCT128449"
FT                   /note="gene_id=mCG127168.2 transcript_id=mCT128449.1
FT                   created on 11-SEP-2002"
FT   CDS             join(8955336..8955541,8971370..8971644,8974339..8974421,
FT                   8975287..8975537,8988107..8988299,8992424..8992545,
FT                   8996423..8997365,9000434..9000508,9002316..>9002354)
FT                   /codon_start=1
FT                   /locus_tag="mCG_127168"
FT                   /product="mCG127168, isoform CRA_b"
FT                   /note="gene_id=mCG127168.2 transcript_id=mCT128449.1
FT                   protein_id=mCP78618.1 isoform=CRA_b"
FT                   /protein_id="EDL36877.1"
FT                   /translation="MCRPSPSPASPASNSRTSLAQAKTKACLSGHSAVSSTSKPFKTPK
FT                   DNLLTSSSTQHTVFSAKGPRDKPCVPVPVVSLEKIPNLVKADGANVKMNSTTTTAATSS
FT                   SSAVSTPPLIKPTLMSKSVPPSPEKILNGKGILSATIDKKHPNGTKNSNKPYRRLSERE
FT                   FDPNKHCGVLDPETKKPCTRSLTCKTHSLSHRRAVPGRKKQFDLLLAEHKAKSREKEVK
FT                   EHLLTSAREILPNPPGPSPDAPQASSGSTVAEPKVASPPKSRPLNSVLPRPSSANSISS
FT                   STSSNHSGYTPEPPLLPAGGDLASRLSSDEGEMDGADESEKLDCQFSTHHPRPLAFCSF
FT                   GSRLMGRGYYVFDRRWDRFRFALNSMVEKHLNSQMWKKIPPAADSPMPSPAAHITTPVP
FT                   ASVLQPFSNPSAVYLPSAPISSRLTSSYIMTSAMLSDAAFVASPDPRVLMSHTTAFPHV
FT                   AATLSIMDSTFKAPSAVSPIPAVIPSPSHKPSKTKTSKSSKVKDLSARSDESPSNKKRK
FT                   PQSSTSASSLSLQAPLSSPLSGPHKKNCILNASSALNSYQAAPPYNSLSVHNSNNGVSP
FT                   LSAKLEPSGRTSLPSGPMDIVRQVGAVGGSSGPCPLSVPSLALHAGDLSLASHNAVSSL
FT                   PLSFDKSEGKKRKNSSPSSKACKITKMPGMNSVHKKNPPSLLAPVPDPVNSTSSRQVGK
FT                   NSSLALSQSSPSSISSPGHSRQKNTNRMGRIRTLP"
FT   CDS             join(8955336..8955541,8971391..8971644,8974339..8974421,
FT                   8975287..8975537,8988107..8988299,8992424..8992545,
FT                   8996423..>8997308)
FT                   /codon_start=1
FT                   /locus_tag="mCG_142289"
FT                   /product="mCG142289, isoform CRA_b"
FT                   /note="gene_id=mCG142289.0 transcript_id=mCT179805.0
FT                   protein_id=mCP102727.0 isoform=CRA_b"
FT                   /protein_id="EDL36879.1"
FT                   /translation="MCRPSPSPASPASNSRTSLAQAKTKACLSGHSAVSSTSKPFKTPK
FT                   DNLLTSSSTQHTVFSAKGPRDKPCLEKIPNLVKADGANVKMNSTTTTAATSSSSAVSTP
FT                   PLIKPTLMSKSVPPSPEKILNGKGILSATIDKKHPNGTKNSNKPYRRLSEREFDPNKHC
FT                   GVLDPETKKPCTRSLTCKTHSLSHRRAVPGRKKQFDLLLAEHKAKSREKEVKEHLLTSA
FT                   REILPNPPGPSPDAPQASSGSTVAEPKVASPPKSRPLNSVLPRPSSANSISSSTSSNHS
FT                   GYTPEPPLLPAGGDLASRLSSDEGEMDGADESEKLDCQFSTHHPRPLAFCSFGSRLMGR
FT                   GYYVFDRRWDRFRFALNSMVEKHLNSQMWKKIPPAADSPMPSPAAHITTPVPASVLQPF
FT                   SNPSAVYLPSAPISSRLTSSYIMTSAMLSDAAFVASPDPRVLMSHTTAFPHVAATLSIM
FT                   DSTFKAPSAVSPIPAVIPSPSHKPSKTKTSKSSKVKDLSARSDESPSNKKRKPQSSTSA
FT                   SSLSLQAPLSSPLSGPHKKNCILNASSALNSYQAAPPYNSLSVHNSNNGVSPLSAKLEP
FT                   SGRTSLPSGPMDIVRQVGAVGGSSGPCPLSVPSLALHAGDLSLASHNAVSSLPLSFDKS
FT                   EGKKRKNSSPSSKACKITKMPGMNSVHKKN"
FT   gene            complement(8987694..>9024249)
FT                   /locus_tag="mCG_146095"
FT                   /note="gene_id=mCG146095.0"
FT   mRNA            complement(join(8987694..8989491,8995716..8995774,
FT                   9013257..9013354,9024185..>9024249))
FT                   /locus_tag="mCG_146095"
FT                   /product="mCG146095"
FT                   /note="gene_id=mCG146095.0 transcript_id=mCT186198.0
FT                   created on 14-JUL-2003"
FT   CDS             complement(8988103..>8988459)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146095"
FT                   /product="mCG146095"
FT                   /note="gene_id=mCG146095.0 transcript_id=mCT186198.0
FT                   protein_id=mCP107274.0"
FT                   /protein_id="EDL36875.1"
FT                   /translation="CSRTSLMPFHLWESLLMRLYSRALSSGIQASVAITKGPLKQQGTQ
FT                   HSRDKGDLPQEVWGGVWRTDSLTSRTRRLRPSPLHHWTVGWQGRLQLGAEGALECSRCG
FT                   LKKYCCLCCLQTMV"
FT   gene            9024341..9030863
FT                   /locus_tag="mCG_12459"
FT                   /note="gene_id=mCG12459.1"
FT   mRNA            join(9024341..9024686,9027775..9027939,9028044..9028131,
FT                   9030786..9030863)
FT                   /locus_tag="mCG_12459"
FT                   /product="mCG12459"
FT                   /note="gene_id=mCG12459.1 transcript_id=mCT13176.1 created
FT                   on 11-SEP-2002"
FT   CDS             join(9024578..9024686,9027775..9027939,9028044..9028131,
FT                   9030786..9030822)
FT                   /codon_start=1
FT                   /locus_tag="mCG_12459"
FT                   /product="mCG12459"
FT                   /note="gene_id=mCG12459.1 transcript_id=mCT13176.1
FT                   protein_id=mCP11349.1"
FT                   /protein_id="EDL36874.1"
FT                   /translation="MEPVADRELQAKLYLERHRIMELLNQLTSFLLFARPKKPREYLIS
FT                   LLERLRVAKATHVAFPYFMDNSNTVSMFEMMDMAGRGCISFVQYKEALKNLGLCTADEV
FT                   LNDDGHIITLDTFRDEMNKRMEKMWSMF"
FT   gene            9059011..9070032
FT                   /gene="Twistnb"
FT                   /locus_tag="mCG_12460"
FT                   /note="gene_id=mCG12460.1"
FT   mRNA            join(9059011..9059374,9062977..9063118,9066408..9066616,
FT                   9067165..9070032)
FT                   /gene="Twistnb"
FT                   /locus_tag="mCG_12460"
FT                   /product="TWIST neighbor"
FT                   /note="gene_id=mCG12460.1 transcript_id=mCT13177.1 created
FT                   on 11-SEP-2002"
FT   CDS             join(9059121..9059374,9062977..9063118,9066408..9066616,
FT                   9067165..9067552)
FT                   /codon_start=1
FT                   /gene="Twistnb"
FT                   /locus_tag="mCG_12460"
FT                   /product="TWIST neighbor"
FT                   /note="gene_id=mCG12460.1 transcript_id=mCT13177.1
FT                   protein_id=mCP11348.1"
FT                   /db_xref="GOA:B2RT77"
FT                   /db_xref="InterPro:IPR005576"
FT                   /db_xref="MGI:MGI:106292"
FT                   /db_xref="UniProtKB/TrEMBL:B2RT77"
FT                   /protein_id="EDL36873.1"
FT                   /translation="MAAGSVESQRSQAASERPVAGQAGVLPCLELPSYAAACALVGSRY
FT                   SCLVAAPHRRHIALSPRYLSRKRTGIREQLDAELLRYSESLLGVPIAYDNIRVVGELGD
FT                   IYDDQGHIHLNIEADFVIFCPEPGQTLMGTVNKVSSSHIGCLVHGCFNASIPKPEQMSY
FT                   EEWQTLEIHVGDELEFDVFRLDSDSAGVFCIRGKLSTTSLQLKHSAVSEDVAETVVEEV
FT                   VEKTPKKKKKKKDKDTDTCGTVDSVTEVADVTDVTPQEETDIPCSDNVNDFFEEEPKKK
FT                   KKKKKRHQEDQDPIFQASDSSGYQSDHNKKKKKRKHSEEANFESPKKRQ"
FT   gene            complement(9107786..9108861)
FT                   /pseudo
FT                   /locus_tag="mCG_1041682"
FT                   /note="gene_id=mCG1041682.1"
FT   mRNA            complement(9107786..9108861)
FT                   /pseudo
FT                   /locus_tag="mCG_1041682"
FT                   /note="gene_id=mCG1041682.1 transcript_id=mCT159386.1
FT                   created on 26-SEP-2002"
FT   gene            9460830..9461876
FT                   /pseudo
FT                   /locus_tag="mCG_49714"
FT                   /note="gene_id=mCG49714.2"
FT   mRNA            9460830..9461876
FT                   /pseudo
FT                   /locus_tag="mCG_49714"
FT                   /note="gene_id=mCG49714.2 transcript_id=mCT49897.2 created
FT                   on 09-SEP-2002"
FT   gene            <9547050..>9547556
FT                   /gene="Ferd3l"
FT                   /locus_tag="mCG_54967"
FT                   /note="gene_id=mCG54967.1"
FT   mRNA            <9547050..>9547556
FT                   /gene="Ferd3l"
FT                   /locus_tag="mCG_54967"
FT                   /product="Fer3-like (Drosophila)"
FT                   /note="gene_id=mCG54967.1 transcript_id=mCT55150.1 created
FT                   on 30-AUG-2002"
FT   CDS             9547050..9547556
FT                   /codon_start=1
FT                   /gene="Ferd3l"
FT                   /locus_tag="mCG_54967"
FT                   /product="Fer3-like (Drosophila)"
FT                   /note="gene_id=mCG54967.1 transcript_id=mCT55150.1
FT                   protein_id=mCP33143.1"
FT                   /protein_id="EDL36872.1"
FT                   /translation="MAAYPESCLDATVLNFVADLSLASPRHPLLCEFPPGVPFGDRTLG
FT                   YREGRPGRLSQFDERYQEVEGDEVEYEDPEEEEEEGEGRGRVASLLGRPKRKRVITYAQ
FT                   RQAANIRERKRMFNLNEAFDQLRRKVPTFAYEKRLSRIETLRLAIVYISFMTELLQSKE
FT                   EKEAS"
FT   gene            <9576372..9578386
FT                   /gene="Twist1"
FT                   /locus_tag="mCG_12458"
FT                   /note="gene_id=mCG12458.1"
FT   mRNA            join(<9576372..9577198,9577730..9578386)
FT                   /gene="Twist1"
FT                   /locus_tag="mCG_12458"
FT                   /product="twist gene homolog 1 (Drosophila)"
FT                   /note="gene_id=mCG12458.1 transcript_id=mCT13175.1 created
FT                   on 30-AUG-2002"
FT   CDS             <9576469..9577158
FT                   /codon_start=1
FT                   /gene="Twist1"
FT                   /locus_tag="mCG_12458"
FT                   /product="twist gene homolog 1 (Drosophila)"
FT                   /note="gene_id=mCG12458.1 transcript_id=mCT13175.1
FT                   protein_id=mCP11345.1"
FT                   /protein_id="EDL36871.1"
FT                   /translation="GAPLLCSTLPRPGSARPHVAAREMMQDVSSSPVSPADDSLSNSEE
FT                   EPDRQQPASGKRGARKRRSSRRSAGGSAGPGGATGGGIGGGDEPGSPAQGKRGKKSAGG
FT                   GGGGGAGGGGGGGGGSSSGGGSPQSYEELQTQRVMANVRERQRTQSLNEAFAALRKIIP
FT                   TLPSDKLSKIQTLKLAARYIDFLYQVLQSDELDSKMASCSYVAHERLSYAFSVWRMEGA
FT                   WSMSASH"
FT   gene            complement(9668407..>9862420)
FT                   /locus_tag="mCG_145563"
FT                   /note="gene_id=mCG145563.0"
FT   mRNA            complement(join(9668407..9670082,9689319..9689466,
FT                   9711281..9711365,9722553..9722686,9783794..9783912,
FT                   9828839..9828936,9829249..9829368,9834700..9834787,
FT                   9835032..9835087,9862096..>9862420))
FT                   /locus_tag="mCG_145563"
FT                   /product="mCG145563"
FT                   /note="gene_id=mCG145563.0 transcript_id=mCT184987.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(9670043..9670082,9689319..9689466,
FT                   9711281..9711365,9722553..9722686,9783794..9783912,
FT                   9828839..9828936,9829249..9829368,9834700..9834787,
FT                   9835032..9835087,9862096..>9862398))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145563"
FT                   /product="mCG145563"
FT                   /note="gene_id=mCG145563.0 transcript_id=mCT184987.0
FT                   protein_id=mCP105147.0"
FT                   /protein_id="EDL36870.1"
FT                   /translation="AKPCPEGLFSWPGRKTNVFVHRLLLCQPFLTDLVFLSRPLPHPPS
FT                   HPSLLFSFSLLFGPCCLFAQVDSDTIWNELHSSGAARMAVGCVIELASKVASGELKNGF
FT                   AVVRPPGHHAEESAAMGFCFFNSVAITAKYLRDQLNISKILIVDLDVHHGNGTQQAFYA
FT                   DPSILYISLHRYDEGNFFPGSGAPNEVGVGLGEGYNVNIAWTGGLDPPMGDVEYLEAFR
FT                   TVVMPVAREFDPDMVLVSAGFDALEGHTPPLGGYKVTAKCFGHLTKQLMTLANGRVALA
FT                   LEGGHDLTAICDASEACINALLGNEPGPLEEDALHQSVNTNAAASLQKTIDIQSKYWKS
FT                   IKMVAAARGGALPASQLQEETETVSALASLTVDVEQPFAQEDGRTAGEPMEEEPAL"
FT   gene            complement(9987017..>10143509)
FT                   /gene="Hdac9"
FT                   /locus_tag="mCG_5365"
FT                   /note="gene_id=mCG5365.1"
FT   mRNA            complement(join(9987017..9987367,10002474..10002691,
FT                   10003371..10003581,10006512..10006634,10015981..10016096,
FT                   10020996..10021127,10045180..10045301,10047551..10047671,
FT                   10048763..10048904,10052819..10053060,10143488..>10143509))
FT                   /gene="Hdac9"
FT                   /locus_tag="mCG_5365"
FT                   /product="histone deacetylase 9, transcript variant
FT                   mCT5054"
FT                   /note="gene_id=mCG5365.1 transcript_id=mCT5054.0 created on
FT                   30-AUG-2002"
FT   mRNA            complement(join(<9987056..9987367,10002474..10002691,
FT                   10003371..10003581,10006512..10006634,10015981..10016096,
FT                   10045180..10045301,10047545..10047671,10048763..10048904,
FT                   10052819..10053060,10143488..>10143509))
FT                   /gene="Hdac9"
FT                   /locus_tag="mCG_5365"
FT                   /product="histone deacetylase 9, transcript variant
FT                   mCT193449"
FT                   /note="gene_id=mCG5365.1 transcript_id=mCT193449.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(<9987056..9987367,10002474..10002691,
FT                   10003371..10003581,10006512..10006634,10015981..10016096,
FT                   10020996..10021127,10045180..10045301,10047545..10047671,
FT                   10048763..10048904,10052819..10053060,10143488..>10143509))
FT                   /gene="Hdac9"
FT                   /locus_tag="mCG_5365"
FT                   /product="histone deacetylase 9, transcript variant
FT                   mCT193450"
FT                   /note="gene_id=mCG5365.1 transcript_id=mCT193450.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(9987056..9987367,10002474..10002691,
FT                   10003371..10003581,10006512..10006634,10015981..10016096,
FT                   10020996..10021127,10045180..10045301,10047551..10047671,
FT                   10048763..10048904,10052819..10053060,10143488..10143509))
FT                   /codon_start=1
FT                   /gene="Hdac9"
FT                   /locus_tag="mCG_5365"
FT                   /product="histone deacetylase 9, isoform CRA_c"
FT                   /note="gene_id=mCG5365.1 transcript_id=mCT5054.0
FT                   protein_id=mCP11331.0 isoform=CRA_c"
FT                   /protein_id="EDL36869.1"
FT                   /translation="MHSMISSVDVKSEVPMGLEPISPLDLRTDLRMMMPVVDPVVREKQ
FT                   LQQELLLIQQQQQIQKQLLIAEFQKQHENLTRQHQAQLQEHIKELLAIKQQQELLEKEQ
FT                   KLEQQRQEQEVERHRREQQLPPLRGKDRGRERAVASTEVKQKLQEFLLSKSATKDTPTN
FT                   GKNHSVGRHPKLWAAHHTSLDQSSPPLSGTSPSYKYTLPGAQDSKDDFPLRKTASEPNL
FT                   KVRSRLKQKVAERRSSPLLRRKDGNLVTSFKKRVFEVAESSVSSSSPGSGPSSPNNGPA
FT                   GNVTENEASALPPTPHPEQLVPQQRILIHEDSMNLLSLYTSPSLPNITLGLPAVPSPLN
FT                   ASNSLKDKQKCETQMLRQGVPLPSQYGSSIAASSSHVHVAMEGKPTSSHQALLQHLLLK
FT                   EQMRQQKLLVAGGVPLHPQSPLATKERISPGIRGTHKLPRHRPLNRTQSAPLPQSTLAQ
FT                   LVIQQQHQQFLEKQKQYQQQIHMNKLLSKSIEQLKQPGSHLEEAEEELQGDQSMEDRAA
FT                   SKDNSARSDSSACVEDTLGQVGAVKVKEEPVDSDEDAQIQEMECGEQAAFMQQVIGKDL
FT                   APGFVIKVII"
FT   CDS             complement(join(9987056..9987367,10002474..10002691,
FT                   10003371..10003581,10006512..10006634,10015981..10016096,
FT                   10045180..10045301,10047545..10047671,10048763..10048904,
FT                   10052819..10053060,10143488..10143509))
FT                   /codon_start=1
FT                   /gene="Hdac9"
FT                   /locus_tag="mCG_5365"
FT                   /product="histone deacetylase 9, isoform CRA_a"
FT                   /note="gene_id=mCG5365.1 transcript_id=mCT193449.0
FT                   protein_id=mCP114427.0 isoform=CRA_a"
FT                   /protein_id="EDL36867.1"
FT                   /translation="MHSMISSVDVKSEVPMGLEPISPLDLRTDLRMMMPVVDPVVREKQ
FT                   LQQELLLIQQQQQIQKQLLIAEFQKQHENLTRQHQAQLQEHIKELLAIKQQQELLEKEQ
FT                   KLEQQRQEQEVERHRREQQLPPLRGKDRGRERAVASTEVKQKLQEFLLSKSATKDTPTN
FT                   GKNHSVGRHPKLWYTAAHHTSLDQSSPPLSGTSPSYKYTLPGAQDSKDDFPLRKTESSV
FT                   SSSSPGSGPSSPNNGPAGNVTENEASALPPTPHPEQLVPQQRILIHEDSMNLLSLYTSP
FT                   SLPNITLGLPAVPSPLNASNSLKDKQKCETQMLRQGVPLPSQYGSSIAASSSHVHVAME
FT                   GKPTSSHQALLQHLLLKEQMRQQKLLVAGGVPLHPQSPLATKERISPGIRGTHKLPRHR
FT                   PLNRTQSAPLPQSTLAQLVIQQQHQQFLEKQKQYQQQIHMNKLLSKSIEQLKQPGSHLE
FT                   EAEEELQGDQSMEDRAASKDNSARSDSSACVEDTLGQVGAVKVKEEPVDSDEDAQIQEM
FT                   ECGEQAAFMQQVIGKDLAPGFVIKVII"
FT   CDS             complement(join(9987056..9987367,10002474..10002691,
FT                   10003371..10003581,10006512..10006634,10015981..10016096,
FT                   10020996..10021127,10045180..10045301,10047545..10047671,
FT                   10048763..10048904,10052819..10053060,10143488..10143509))
FT                   /codon_start=1
FT                   /gene="Hdac9"
FT                   /locus_tag="mCG_5365"
FT                   /product="histone deacetylase 9, isoform CRA_b"
FT                   /note="gene_id=mCG5365.1 transcript_id=mCT193450.0
FT                   protein_id=mCP114428.0 isoform=CRA_b"
FT                   /protein_id="EDL36868.1"
FT                   /translation="MHSMISSVDVKSEVPMGLEPISPLDLRTDLRMMMPVVDPVVREKQ
FT                   LQQELLLIQQQQQIQKQLLIAEFQKQHENLTRQHQAQLQEHIKELLAIKQQQELLEKEQ
FT                   KLEQQRQEQEVERHRREQQLPPLRGKDRGRERAVASTEVKQKLQEFLLSKSATKDTPTN
FT                   GKNHSVGRHPKLWYTAAHHTSLDQSSPPLSGTSPSYKYTLPGAQDSKDDFPLRKTASEP
FT                   NLKVRSRLKQKVAERRSSPLLRRKDGNLVTSFKKRVFEVAESSVSSSSPGSGPSSPNNG
FT                   PAGNVTENEASALPPTPHPEQLVPQQRILIHEDSMNLLSLYTSPSLPNITLGLPAVPSP
FT                   LNASNSLKDKQKCETQMLRQGVPLPSQYGSSIAASSSHVHVAMEGKPTSSHQALLQHLL
FT                   LKEQMRQQKLLVAGGVPLHPQSPLATKERISPGIRGTHKLPRHRPLNRTQSAPLPQSTL
FT                   AQLVIQQQHQQFLEKQKQYQQQIHMNKLLSKSIEQLKQPGSHLEEAEEELQGDQSMEDR
FT                   AASKDNSARSDSSACVEDTLGQVGAVKVKEEPVDSDEDAQIQEMECGEQAAFMQQVIGK
FT                   DLAPGFVIKVII"
FT   gene            10595784..10597416
FT                   /gene="1700011K15Rik"
FT                   /locus_tag="mCG_48722"
FT                   /note="gene_id=mCG48722.1"
FT   mRNA            10595784..10597416
FT                   /gene="1700011K15Rik"
FT                   /locus_tag="mCG_48722"
FT                   /product="RIKEN cDNA 1700011K15"
FT                   /note="gene_id=mCG48722.1 transcript_id=mCT48905.2 created
FT                   on 25-SEP-2002"
FT   CDS             10595868..10596824
FT                   /codon_start=1
FT                   /gene="1700011K15Rik"
FT                   /locus_tag="mCG_48722"
FT                   /product="RIKEN cDNA 1700011K15"
FT                   /note="gene_id=mCG48722.1 transcript_id=mCT48905.2
FT                   protein_id=mCP33107.0"
FT                   /db_xref="GOA:Q8C5R8"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="MGI:MGI:1922706"
FT                   /db_xref="UniProtKB/TrEMBL:Q8C5R8"
FT                   /protein_id="EDL36866.1"
FT                   /translation="MPNIKLFSGSSHQDLSQKITERLGLELSKVVTKKFSNQETCVEIG
FT                   ESVRGEDVYIVQSGCGEINDSLMELLIMINACKIASASRVTAVIPCFPYARQDKKDKSR
FT                   APISAKLVANMLSIAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIKENISDWR
FT                   NCTIVSPDAGGAKRVTSIADHLNVDFALIHKERKKANEVDRMVLVGDVKDRVAILVDDM
FT                   ADTCGTICYAADKLLSEGATRVYAILTHGIFSGPAIARINGACFEAVVVTNTIPQEDKM
FT                   KQCSKIQVIDIAMILAEAIRRTHNGESVSYLFSHVPL"
FT   gene            <10655772..10755648
FT                   /gene="Snx13"
FT                   /locus_tag="mCG_13956"
FT                   /note="gene_id=mCG13956.2"
FT   mRNA            join(<10655772..10655981,10688253..10688365,
FT                   10692090..10692192,10695171..10695260,10696096..10696217,
FT                   10700649..10700770,10700855..10700956,10702111..10702199,
FT                   10707504..10707587,10709725..10709863,10714294..10714487,
FT                   10715900..10716004,10716607..10716744,10721641..10721710,
FT                   10728977..10729116,10732137..10732244,10733650..10733760,
FT                   10742173..10742334,10743442..10743513,10748165..10748310,
FT                   10748541..10748609,10750306..10750418,10754363..10754830)
FT                   /gene="Snx13"
FT                   /locus_tag="mCG_13956"
FT                   /product="sorting nexin 13, transcript variant mCT18508"
FT                   /note="gene_id=mCG13956.2 transcript_id=mCT18508.1 created
FT                   on 09-SEP-2002"
FT   CDS             join(<10655772..10655981,10688253..10688365,
FT                   10692090..10692192,10695171..10695260,10696096..10696217,
FT                   10700649..10700770,10700855..10700956,10702111..10702199,
FT                   10707504..10707587,10709725..10709863,10714294..10714487,
FT                   10715900..10716004,10716607..10716744,10721641..10721710,
FT                   10728977..10729116,10732137..10732244,10733650..10733760,
FT                   10742173..10742334,10743442..10743513,10748165..10748310,
FT                   10748541..10748609,10750306..10750418,10754363..10754610)
FT                   /codon_start=1
FT                   /gene="Snx13"
FT                   /locus_tag="mCG_13956"
FT                   /product="sorting nexin 13, isoform CRA_a"
FT                   /note="gene_id=mCG13956.2 transcript_id=mCT18508.1
FT                   protein_id=mCP11325.1 isoform=CRA_a"
FT                   /protein_id="EDL36864.1"
FT                   /translation="LFQDGGASVASSRAGGKPAKPSKAAARDRTEAAVAAVGGGPGSFR
FT                   CCYGCCHAARLGRTSLPRGVMMLTEASLSIWGWGSLGIVLFLITFGPFVIFYLAFYILC
FT                   FVGGGLVVTLLYGKTNSEKYLEQCEHSFLPPTSSGVPKCLEEMKREARTIKIDRRLTGA
FT                   NIIDEPLQQVIQFSLRDYVQYWYYTLSDDESFLLEIRQTLQNALIQFATRSKEIDWQPY
FT                   FTTRIVDDFGTHLRVFRKAQQRVTEKDDQVKGTAEDLVETFFEVEVEMEKDVCRDLVCT
FT                   SPKDEEGFLRDLCEVLLYLLLPPGDFQSKIMRYFVREILARGILLPLINQLSDPDYINQ
FT                   YVIWMIRDSNCNYEAFMNIIKLSDNIGELEAVRDKAAEELQYLRSLDTAGDDYMQQTGG
FT                   QAHLFFWMTVEGYRVTAQQQLEVLSGRQRDGKQQTNQTKGLLRAAAVGIYEQYLSEKAS
FT                   PRVTVDDYLVAKLADTLNHEDPTPEIFDDIQRKVYELMLRDERFYPSFRQNALYVRMLA
FT                   ELDMLKDPSFRGSDDGDGGKSLDDLSSVTSDDSVQLHAYISDTGVCNDHGKTYALYAIT
FT                   VHRRNLNTEEMWKTYRRYSDFHDFHMRITEQFENLSSILKLPGKKTFNNMDRDFLEKRK
FT                   KDLNAYLQLLLTPEMMKASPALAHCVYDFLENKAYSKGKGDFARKMDTFVNPLRNSMRN
FT                   VSNAVKSLPDSLAEGVTKMSDNVGRMSERLGQDIKQSFFKVPPLITKTDSDPEHCRVSA
FT                   QLDDNVDDNIPLRVMLLLMDEVFDLKERNQWLRRNIKNLLQQLIRATYGDTINRKIVDH
FT                   VDWMTSPEQVADSVKRFRDAFWPNGILAETVPCRDKAIRMRTRIAGKTKLFAIMPDELK
FT                   HIIGAETTRKGILRVFEMFQHNQLNRRMVYVFLEGFLETLFPQYKFRELFNKLHSRSKQ
FT                   MQKYKQKLQSTQAPSLQKR"
FT   mRNA            join(<10655787..10655981,10688253..10688365,
FT                   10692090..10692192,10695171..10695260,10696096..10696217,
FT                   10700649..10700770,10700855..10700956,10702111..10702199,
FT                   10707504..10707587,10709725..10709863,10710207..10710295,
FT                   10712227..10712326,10714294..10714487,10715900..10716004,
FT                   10716607..10716739,10719830..10719867,10721641..10721710,
FT                   10728977..10729116,10732137..10732244,10733650..10733760,
FT                   10742173..10742334,10743442..10743513,10748165..10748310,
FT                   10748541..10748609,10750306..10750418,10754363..10755648)
FT                   /gene="Snx13"
FT                   /locus_tag="mCG_13956"
FT                   /product="sorting nexin 13, transcript variant mCT193424"
FT                   /note="gene_id=mCG13956.2 transcript_id=mCT193424.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<10655787..10655981,10688253..10688365,
FT                   10692090..10692192,10695171..10695260,10696096..10696217,
FT                   10700649..10700770,10700855..10700956,10702111..10702199,
FT                   10707504..10707587,10709725..10709863,10710207..10710295,
FT                   10712227..10712326,10714294..10714487,10715900..10716004,
FT                   10716607..10716739,10719830..10719867,10721641..10721710,
FT                   10728977..10729116,10732137..10732244,10733650..10733760,
FT                   10742173..10742334,10743442..10743513,10748165..10748310,
FT                   10748541..10748609,10750306..10750418,10754363..10754610)
FT                   /codon_start=1
FT                   /gene="Snx13"
FT                   /locus_tag="mCG_13956"
FT                   /product="sorting nexin 13, isoform CRA_b"
FT                   /note="gene_id=mCG13956.2 transcript_id=mCT193424.0
FT                   protein_id=mCP114404.0 isoform=CRA_b"
FT                   /protein_id="EDL36865.1"
FT                   /translation="GASVASSRAGGKPAKPSKAAARDRTEAAVAAVGGGPGSFRCCYGC
FT                   CHAARLGRTSLPRGVMMLTEASLSIWGWGSLGIVLFLITFGPFVIFYLAFYILCFVGGG
FT                   LVVTLLYGKTNSEKYLEQCEHSFLPPTSSGVPKCLEEMKREARTIKIDRRLTGANIIDE
FT                   PLQQVIQFSLRDYVQYWYYTLSDDESFLLEIRQTLQNALIQFATRSKEIDWQPYFTTRI
FT                   VDDFGTHLRVFRKAQQRVTEKDDQVKGTAEDLVETFFEVEVEMEKDVCRDLVCTSPKDE
FT                   EGFLRDLCEVLLYLLLPPGDFQSKIMRYFVREILARGILLPLINQLSDPDYINQYVIWM
FT                   IRDSNCNYEAFMNIIKLSDNIGELEAVRDKAAEELQYLRSLDTAGDDINTIKNQINSLL
FT                   FVKKVCDSRIQRLQSGKEINTVKLAANFGKLCTVPLDSILVDNVALQFFMDYMQQTGGQ
FT                   AHLFFWMTVEGYRVTAQQQLEVLSGRQRDGKQQTNQTKGLLRAAAVGIYEQYLSEKASP
FT                   RVTVDDYLVAKLADTLNHEDPTPEIFDDIQRKVYELMLRDERFYPSFRQNALYVRMLAE
FT                   LDMLKDPSFRGSDDGDGESFNGSPTGSINLSLDDLSSVTSDDSVQLHAYISDTGVCNDH
FT                   GKTYALYAITVHRRNLNTEEMWKTYRRYSDFHDFHMRITEQFENLSSILKLPGKKTFNN
FT                   MDRDFLEKRKKDLNAYLQLLLTPEMMKASPALAHCVYDFLENKAYSKGKGDFARKMDTF
FT                   VNPLRNSMRNVSNAVKSLPDSLAEGVTKMSDNVGRMSERLGQDIKQSFFKVPPLITKTD
FT                   SDPEHCRVSAQLDDNVDDNIPLRVMLLLMDEVFDLKERNQWLRRNIKNLLQQLIRATYG
FT                   DTINRKIVDHVDWMTSPEQVADSVKRFRDAFWPNGILAETVPCRDKAIRMRTRIAGKTK
FT                   LFAIMPDELKHIIGAETTRKGILRVFEMFQHNQLNRRMVYVFLEGFLETLFPQYKFREL
FT                   FNKLHSRSKQMQKYKQKLQSTQAPSLQKR"
FT   gene            complement(11133719..>11169264)
FT                   /gene="Ahr"
FT                   /locus_tag="mCG_13952"
FT                   /note="gene_id=mCG13952.1"
FT   mRNA            complement(join(11133719..11136406,11139415..11140678,
FT                   11141948..11142089,11143105..11143214,11143815..11144017,
FT                   11145670..11145800,11146762..11146873,11148566..11148655,
FT                   11150731..11150834,11160970..11161157,11168922..>11169264))
FT                   /gene="Ahr"
FT                   /locus_tag="mCG_13952"
FT                   /product="aryl-hydrocarbon receptor"
FT                   /note="gene_id=mCG13952.1 transcript_id=mCT18503.1 created
FT                   on 30-AUG-2002"
FT   CDS             complement(join(11136266..11136406,11139415..11140678,
FT                   11141948..11142089,11143105..11143214,11143815..11144017,
FT                   11145670..11145800,11146762..11146873,11148566..11148655,
FT                   11150731..11150834,11160970..11161157,11168922..>11169190))
FT                   /codon_start=1
FT                   /gene="Ahr"
FT                   /locus_tag="mCG_13952"
FT                   /product="aryl-hydrocarbon receptor"
FT                   /note="gene_id=mCG13952.1 transcript_id=mCT18503.1
FT                   protein_id=mCP11341.1"
FT                   /protein_id="EDL36863.1"
FT                   /translation="STAAPPDPRDRARLACGFLLRGQLGQPESPLSPAPARRGRPALGG
FT                   GSPGRSAGRAPPPGRRWSGQGAGTMSSGANITYASRKRRKPVQKTVKPIPAEGIKSNPS
FT                   KRHRDRLNTELDRLASLLPFPQDVINKLDKLSVLRLSVSYLRAKSFFDVALKSTPADRN
FT                   GGQDQCRAQIRDWQDLQEGEFLLQALNGFVLVVTADALVFYASSTIQDYLGFQQSDVIH
FT                   QSVYELIHTEDRAEFQRQLHWALNPDSAQGVDEAHGPPQAAVYYTPDQLPPENASFMER
FT                   CFRCRLRCLLDNSSGFLAMNFQGRLKYLHGQNKKGKDGALLPPQLALFAIATPLQPPSI
FT                   LEIRTKNFIFRTKHKLDFTPIGCDAKGQLILGYTEVELCTRGSGYQFIHAADILHCAES
FT                   HIRMIKTGESGMTVFRLLAKHSRWRWVQSNARLIYRNGRPDYIIATQRPLTDEEGREHL
FT                   QKRSTSLPFMFATGEAVLYEISSPFSPIMDPLPIRTKSNTSRKDWAPQSTPSKDSFHPS
FT                   SLMSALIQQDESIYLCPPSSPAPLDSHFLMGSVSKCGSWQDSFAAAGSEAALKHEQIGH
FT                   AQDVNLALSGGPSELFPDNKNNDLYNIMRNLGIDFEDIRSMQNEEFFRTDSTAAGEVDF
FT                   KDIDITDEILTYVQDSLNNSTLMNSACQQQPVTQHLSCMLQERLQLEQQQQLQQPPPQA
FT                   LEPQQQLCQMVCPQQDLGPKHTQINGTFASWNPTPPVSFNCPQQELKHYQLFSSLQGTA
FT                   QEFPYKPEVDSVPYTQNFAPCNQPLLPEHSKSVQLDFPGRDFEPSLHPTTSNLDFVSCL
FT                   QVPENQSHGINSQSAMVSPQAYYAGAMSMYQCQPGPQRTPVDQTQYSSEIPGSQAFLSK
FT                   VQSRGIFNETYSSDLSSIGHAAQTTGHLHHLAEARPLPDITPGGFL"
FT   gene            complement(11312668..11335384)
FT                   /locus_tag="mCG_148270"
FT                   /note="gene_id=mCG148270.0"
FT   mRNA            complement(join(11312668..11312827,11314399..11314567,
FT                   11332214..11332375,11334735..11334912,11335220..11335384))
FT                   /locus_tag="mCG_148270"
FT                   /product="mCG148270"
FT                   /note="gene_id=mCG148270.0 transcript_id=mCT188533.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(join(11312752..11312827,11314399..11314472))
FT                   /codon_start=1
FT                   /locus_tag="mCG_148270"
FT                   /product="mCG148270"
FT                   /note="gene_id=mCG148270.0 transcript_id=mCT188533.0
FT                   protein_id=mCP108104.0"
FT                   /protein_id="EDL36861.1"
FT                   /translation="MSTAAGSHPAFTAFLCQFTAFYESRFLVCLSFCHNFPLPWTVIWK
FT                   YKKK"
FT   gene            11322726..11334949
FT                   /locus_tag="mCG_148257"
FT                   /note="gene_id=mCG148257.0"
FT   mRNA            join(11322726..11322931,11334594..11334949)
FT                   /locus_tag="mCG_148257"
FT                   /product="mCG148257"
FT                   /note="gene_id=mCG148257.0 transcript_id=mCT188520.0
FT                   created on 13-JAN-2004"
FT   CDS             join(11322786..11322931,11334594..11334603)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148257"
FT                   /product="mCG148257"
FT                   /note="gene_id=mCG148257.0 transcript_id=mCT188520.0
FT                   protein_id=mCP108088.0"
FT                   /protein_id="EDL36862.1"
FT                   /translation="MQRPQPNSKWSSESLLEECWDGILEPDVSRTPPHEELQSKLTWPH
FT                   RGTRPQ"
FT   gene            <11416108..>11417675
FT                   /locus_tag="mCG_13955"
FT                   /note="gene_id=mCG13955.0"
FT   mRNA            join(<11416108..11416566,11416819..11416991,
FT                   11417060..>11417675)
FT                   /locus_tag="mCG_13955"
FT                   /product="mCG13955"
FT                   /note="gene_id=mCG13955.0 transcript_id=mCT18507.0 created
FT                   on 09-SEP-2002"
FT   CDS             join(<11416108..11416566,11416819..11416991,
FT                   11417060..11417675)
FT                   /codon_start=1
FT                   /locus_tag="mCG_13955"
FT                   /product="mCG13955"
FT                   /note="gene_id=mCG13955.0 transcript_id=mCT18507.0
FT                   protein_id=mCP11321.0"
FT                   /protein_id="EDL36860.1"
FT                   /translation="ELISNTSDTLDKIQYESLTDPSKLDRGKELKIDIIPNPQEHTLTL
FT                   VDIGIGMTKADLINNLGTIAKSGTKAFMEALQAGADTSMIGQFGVRFFLAYLVAEKVVV
FT                   ITKHNDDEQYAWESSAGGSFNAHADHGESIVWGTKVILHLKEDLAEYLEEELNKMKPIW
FT                   TRNPDELTQEEYGKFYKSLTNNWEDLLAVKDFSVDGQLKFRALLFITHMDSFDEMIPEY
FT                   LNFICSAVDSKDLSLNISREMFHQSKILKVICKNIVKKCPELFSELAEDEENYKKFCEA
FT                   FSKNLKLGIHMDSTNYFHLSESHCFHTSQSGDEMTSLLEYVSHMKETQKSIYYTTGENK
FT                   EQVANSAFVESEWKQGFEVVYITEPIDECSVQQLKEFDGKSLVSVTKEGLEPPEDEEKK
FT                   KKMEESKAKFEDHCRL"
FT   gene            <11564060..11588500
FT                   /gene="E030025L21Rik"
FT                   /locus_tag="mCG_13957"
FT                   /note="gene_id=mCG13957.2"
FT   mRNA            join(<11564060..11564167,11566677..11566812,
FT                   11572893..11572956,11585417..11585469,11586034..11586110,
FT                   11586309..11586372,11586786..11586869,11588018..11588500)
FT                   /gene="E030025L21Rik"
FT                   /locus_tag="mCG_13957"
FT                   /product="RIKEN cDNA E030025L21"
FT                   /note="gene_id=mCG13957.2 transcript_id=mCT18505.2 created
FT                   on 09-SEP-2002"
FT   CDS             join(<11564147..11564167,11566677..11566812,
FT                   11572893..11572956,11585417..11585469,11586034..11586110,
FT                   11586309..11586372,11586786..11586869,11588018..11588067)
FT                   /codon_start=1
FT                   /gene="E030025L21Rik"
FT                   /locus_tag="mCG_13957"
FT                   /product="RIKEN cDNA E030025L21"
FT                   /note="gene_id=mCG13957.2 transcript_id=mCT18505.2
FT                   protein_id=mCP11344.1"
FT                   /protein_id="EDL36859.1"
FT                   /translation="QERWAAQLPLSDSIEDKMLHSALALCLLLITVSSNLAIAIKKEKR
FT                   PPQTLSRGWGDDITWVQTYEEGLFHARKSNKPLMVIHHLEDCQYCQALKKEFAKNEEIQ
FT                   EMAQNDFIMLNLMHETTDKNLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLYTYEPQD
FT                   LPMLVDNMKKALRLIQSEL"
FT   gene            complement(11616264..11617621)
FT                   /locus_tag="mCG_148255"
FT                   /note="gene_id=mCG148255.0"
FT   mRNA            complement(join(11616264..11617305,11617337..11617621))
FT                   /locus_tag="mCG_148255"
FT                   /product="mCG148255"
FT                   /note="gene_id=mCG148255.0 transcript_id=mCT188518.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(11616365..11616622)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148255"
FT                   /product="mCG148255"
FT                   /note="gene_id=mCG148255.0 transcript_id=mCT188518.0
FT                   protein_id=mCP108090.0"
FT                   /protein_id="EDL36858.1"
FT                   /translation="MSFTHLRALLEIQDVSSLIYLLPRSPVILMLLQKDLAQLDSMFTV
FT                   LPVFFMPGIAALGCKLDRFCFIQQIKQKKTLLALCLPNDT"
FT   gene            <11631446..11642549
FT                   /gene="Agr2"
FT                   /locus_tag="mCG_13953"
FT                   /note="gene_id=mCG13953.1"
FT   mRNA            join(<11631446..11631490,11634028..11634173,
FT                   11634413..11634476,11634593..11634645,11635941..11636014,
FT                   11637101..11637164,11640159..11640242,11642321..11642549)
FT                   /gene="Agr2"
FT                   /locus_tag="mCG_13953"
FT                   /product="anterior gradient 2 (Xenopus laevis)"
FT                   /note="gene_id=mCG13953.1 transcript_id=mCT18504.1 created
FT                   on 30-AUG-2002"
FT   CDS             join(<11631447..11631490,11634028..11634173,
FT                   11634413..11634476,11634593..11634645,11635941..11636014,
FT                   11637101..11637164,11640159..11640242,11642321..11642370)
FT                   /codon_start=1
FT                   /gene="Agr2"
FT                   /locus_tag="mCG_13953"
FT                   /product="anterior gradient 2 (Xenopus laevis)"
FT                   /note="gene_id=mCG13953.1 transcript_id=mCT18504.1
FT                   protein_id=mCP11310.0"
FT                   /protein_id="EDL36857.1"
FT                   /translation="ATLAAHTKQEGGKPRFAMEKFSVSAILLLVAISGTLAKDTTVKSG
FT                   AKKDPKDSRPKLPQTLSRGWGDQLIWTQTYEEALYRSKTSNRPLMVIHHLDECPHSQAL
FT                   KKVFAEHKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIVFVDPSLTVRADITGRYS
FT                   NRLYAYEPSDTALLYDNMKKALKLLKTEL"
FT   gene            complement(11653639..>11681486)
FT                   /gene="Tspan13"
FT                   /locus_tag="mCG_127095"
FT                   /note="gene_id=mCG127095.0"
FT   mRNA            complement(join(11653639..11654855,11659583..11659696,
FT                   11660874..11660987,11661826..11661906,11662983..11663150,
FT                   11681320..>11681486))
FT                   /gene="Tspan13"
FT                   /locus_tag="mCG_127095"
FT                   /product="tetraspanin 13, transcript variant mCT128376"
FT                   /note="gene_id=mCG127095.0 transcript_id=mCT128376.0
FT                   created on 30-AUG-2002"
FT   mRNA            complement(join(11653959..11654855,11659583..11659696,
FT                   11660874..11660987,11661826..11661906,11662983..11663150,
FT                   11678547..>11678997))
FT                   /gene="Tspan13"
FT                   /locus_tag="mCG_127095"
FT                   /product="tetraspanin 13, transcript variant mCT172853"
FT                   /note="gene_id=mCG127095.0 transcript_id=mCT172853.0
FT                   created on 30-AUG-2002"
FT   CDS             complement(join(11654781..11654855,11659583..11659696,
FT                   11660874..11660987,11661826..11661906,11662983..11663150,
FT                   11681320..>11681481))
FT                   /codon_start=1
FT                   /gene="Tspan13"
FT                   /locus_tag="mCG_127095"
FT                   /product="tetraspanin 13, isoform CRA_b"
FT                   /note="gene_id=mCG127095.0 transcript_id=mCT128376.0
FT                   protein_id=mCP78889.0 isoform=CRA_b"
FT                   /protein_id="EDL36856.1"
FT                   /translation="PGPQAQEARIQKLLAQPGGRRLDPQAPASPRATMVCGGFSCSKNC
FT                   LCALNLLYTLVSLLLIGIAAWGIGFGLISSLRVVGVVIAVGIFLFLIALVGLIGAVKHH
FT                   QVLLFFYMIILLLVFIVQFSVSCACLALNREQQGQLLEVGWNNTASARNDIQRNLNCCG
FT                   FRSYNPNDTCPASCAKSTQKCSSCAPIIGEYAGEVLRFVGGIGLFFSFTEILGVWLTYR
FT                   YRNQKDPRANPSAFL"
FT   CDS             complement(join(11654781..11654855,11659583..11659696,
FT                   11660874..11660987,11661826..11661906,11662983..11663150,
FT                   11678547..>11678609))
FT                   /codon_start=1
FT                   /gene="Tspan13"
FT                   /locus_tag="mCG_127095"
FT                   /product="tetraspanin 13, isoform CRA_a"
FT                   /note="gene_id=mCG127095.0 transcript_id=mCT172853.0
FT                   protein_id=mCP95772.0 isoform=CRA_a"
FT                   /protein_id="EDL36855.1"
FT                   /translation="LVCDDMSLNLEMQEQTKLDSKLVSLLLIGIAAWGIGFGLISSLRV
FT                   VGVVIAVGIFLFLIALVGLIGAVKHHQVLLFFYMIILLLVFIVQFSVSCACLALNREQQ
FT                   GQLLEVGWNNTASARNDIQRNLNCCGFRSYNPNDTCPASCAKSTQKCSSCAPIIGEYAG
FT                   EVLRFVGGIGLFFSFTEILGVWLTYRYRNQKDPRANPSAFL"
FT   gene            <11720774..11730530
FT                   /locus_tag="mCG_50154"
FT                   /note="gene_id=mCG50154.2"
FT   mRNA            join(<11720774..11720823,11729545..11730530)
FT                   /locus_tag="mCG_50154"
FT                   /product="mCG50154"
FT                   /note="gene_id=mCG50154.2 transcript_id=mCT50337.2 created
FT                   on 25-SEP-2002"
FT   CDS             join(11720774..11720823,11729545..11730115)
FT                   /codon_start=1
FT                   /locus_tag="mCG_50154"
FT                   /product="mCG50154"
FT                   /note="gene_id=mCG50154.2 transcript_id=mCT50337.2
FT                   protein_id=mCP33106.1"
FT                   /protein_id="EDL36854.1"
FT                   /translation="MLADEFITASSYFCSSRKVAVMLTLASKLKWDEDLKGSQTSVSTS
FT                   DSTRRFSMRDKLLVTEVAELEANLPWTCKVHFPDPNKLHCFQLTVSPDEGYYQGGNFQF
FT                   EIEVPDAYNMVPPKVKCLTKIWHPNITETGEICLSLLREHSADGTGWAPTRTLKDVVWG
FT                   LNSLFTDLLNFYDPLNIEAAEHHLQDKEDFRDKVDEYIRRYAR"
FT   gene            complement(11731338..>11796139)
FT                   /gene="Bzw2"
FT                   /locus_tag="mCG_15552"
FT                   /note="gene_id=mCG15552.1"
FT   mRNA            complement(join(11731338..11731385,11732366..11732488,
FT                   11741298..11741436,11746949..11747095,11749157..11749327,
FT                   11753420..11753529,11758437..11758572,11760139..11760204,
FT                   11763358..11763461,11769415..11769591,11774314..11774378,
FT                   11796025..>11796139))
FT                   /gene="Bzw2"
FT                   /locus_tag="mCG_15552"
FT                   /product="basic leucine zipper and W2 domains 2"
FT                   /note="gene_id=mCG15552.1 transcript_id=mCT18563.0 created
FT                   on 30-AUG-2002"
FT   CDS             complement(join(11731357..11731385,11732366..11732488,
FT                   11741298..11741436,11746949..11747095,11749157..11749327,
FT                   11753420..11753529,11758437..11758572,11760139..11760204,
FT                   11763358..11763461,11769415..11769591,11774314..11774378,
FT                   11796025..>11796137))
FT                   /codon_start=1
FT                   /gene="Bzw2"
FT                   /locus_tag="mCG_15552"
FT                   /product="basic leucine zipper and W2 domains 2"
FT                   /note="gene_id=mCG15552.1 transcript_id=mCT18563.0
FT                   protein_id=mCP11318.0"
FT                   /protein_id="EDL36853.1"
FT                   /translation="CVCPSLLHCLPQPLPPPLLLQDPPQPPVSRVVAPSLDSNFMNKHQ
FT                   KPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRLDYRRY
FT                   ADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLIRRYK
FT                   YLEKAFEDEMKKLLLFLKAFSEAEQTKLAMLSGILLGNGTLPATILTSLFTDSLVKEGI
FT                   AASFAVKLFKAWMAEKDANSVTSSLRKANLDKRLLELFPVNRQSVDHFAKYFTDAGLKE
FT                   LSDFLRVQQSLGTRKELQKELQERLSQECPIKEVVLYVKEEMKRNDLPETAVIGLLWTC
FT                   IMNAVEWNKKEELVAEQALKHLKQYAPLLAVFSSQGQSELVLLQKVQEYCYDNIHFMKA
FT                   FQKIVVLFYKADVLSEEAILKWYKEAHAAKGKSVFLDQMKKFVEWLQNAEEESESEGEE
FT                   S"
FT   gene            <11796524..11839142
FT                   /gene="Ankmy2"
FT                   /locus_tag="mCG_15556"
FT                   /note="gene_id=mCG15556.2"
FT   mRNA            join(<11796524..11796780,11805350..11805414,
FT                   11809928..11810066,11816097..11816195,11821989..11822149,
FT                   11826367..11826581,11827291..11827426,11833311..11833439,
FT                   11836834..11836963,11838070..11838458)
FT                   /gene="Ankmy2"
FT                   /locus_tag="mCG_15556"
FT                   /product="ankyrin repeat and MYND domain containing 2,
FT                   transcript variant mCT193515"
FT                   /note="gene_id=mCG15556.2 transcript_id=mCT193515.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(<11796526..11796780,11805350..11805414,
FT                   11809928..11810066,11816097..11816195,11821989..11822149,
FT                   11826367..11826581,11827291..11827426,11833311..11833439,
FT                   11833834..11833962,11836834..11836963,11838070..11839142)
FT                   /gene="Ankmy2"
FT                   /locus_tag="mCG_15556"
FT                   /product="ankyrin repeat and MYND domain containing 2,
FT                   transcript variant mCT18567"
FT                   /note="gene_id=mCG15556.2 transcript_id=mCT18567.1 created
FT                   on 09-SEP-2002"
FT   CDS             join(<11796567..11796780,11805350..11805414,
FT                   11809928..11810066,11816097..11816195,11821989..11822149,
FT                   11826367..11826581,11827291..11827426,11833311..11833439,
FT                   11833834..11833962,11836834..11836963,11838070..11838251)
FT                   /codon_start=1
FT                   /gene="Ankmy2"
FT                   /locus_tag="mCG_15556"
FT                   /product="ankyrin repeat and MYND domain containing 2,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG15556.2 transcript_id=mCT18567.1
FT                   protein_id=mCP11336.1 isoform=CRA_b"
FT                   /protein_id="EDL36852.1"
FT                   /translation="DPSDSATSLGCCSGLELPCCGGLPRRIHVSCFFKKPFQRNRISVK
FT                   LAGTMGHIKKGELTQEEKELLEVIGKGTVQEAGRLLSSKNVHVNCLDENGMTPLMHAAY
FT                   KGKLEMCKLLLRHGADASCHQHEHGYTALMFAALSGNKDITWVMLEAGAETDVVNSVGR
FT                   TAAQMAAFVGQHDCVAIINNFFPRERLDYYTKPQGLDKEPKLPPKLAGPLHKIITTTNL
FT                   HPVKIVMLVSENPLLADAAALGKCYRVMDLICEKCMKQRDMNEVLAMKMHYISCIFQKC
FT                   ITFLKEGENKLDTLIRSLLKGRASDGFPVYQEKIIRESIRKFPYCEATLLQQLVRSIAP
FT                   VEIGSDPTAFSVLTQAITGQVGFVDVEFCTTCGEKGASKRCSVCKMGSDPTAFSVLTQA
FT                   ITGQVGFVDVEFCTTCGEKGASKRCSVCKMVIYCDQTCQKTHWFAHKKMCKSLKDVYEK
FT                   QQIEAAKHKRQEEKNGNPNVSSNHVNEDQPEAEEGITQENSIPSDSVEGEKEAANDTGL
FT                   ASAQDAPTGPQLSEE"
FT   CDS             join(<11796567..11796780,11805350..11805414,
FT                   11809928..11810066,11816097..11816195,11821989..11822149,
FT                   11826367..11826581,11827291..11827426,11833311..11833439,
FT                   11836834..11836963,11838070..11838251)
FT                   /codon_start=1
FT                   /gene="Ankmy2"
FT                   /locus_tag="mCG_15556"
FT                   /product="ankyrin repeat and MYND domain containing 2,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG15556.2 transcript_id=mCT193515.0
FT                   protein_id=mCP114457.0 isoform=CRA_a"
FT                   /protein_id="EDL36851.1"
FT                   /translation="DPSDSATSLGCCSGLELPCCGGLPRRIHVSCFFKKPFQRNRISVK
FT                   LAGTMGHIKKGELTQEEKELLEVIGKGTVQEAGRLLSSKNVHVNCLDENGMTPLMHAAY
FT                   KGKLEMCKLLLRHGADASCHQHEHGYTALMFAALSGNKDITWVMLEAGAETDVVNSVGR
FT                   TAAQMAAFVGQHDCVAIINNFFPRERLDYYTKPQGLDKEPKLPPKLAGPLHKIITTTNL
FT                   HPVKIVMLVSENPLLADAAALGKCYRVMDLICEKCMKQRDMNEVLAMKMHYISCIFQKC
FT                   ITFLKEGENKLDTLIRSLLKGRASDGFPVYQEKIIRESIRKFPYCEATLLQQLVRSIAP
FT                   VEIGSDPTAFSVLTQAITGQVGFVDVEFCTTCGEKGASKRCSVCKMVIYCDQTCQKTHW
FT                   FAHKKMCKSLKDVYEKQQIEAAKHKRQEEKNGNPNVSSNHVNEDQPEAEEGITQENSIP
FT                   SDSVEGEKEAANDTGLASAQDAPTGPQLSEE"
FT   gene            complement(11843781..11888876)
FT                   /gene="1700108M19Rik"
FT                   /locus_tag="mCG_15553"
FT                   /note="gene_id=mCG15553.1"
FT   mRNA            complement(join(11843781..11844136,11845216..11845243,
FT                   11848089..11848241,11856964..11857083,11858232..11858313,
FT                   11878757..11878826,11883079..11883171,11888696..11888876))
FT                   /gene="1700108M19Rik"
FT                   /locus_tag="mCG_15553"
FT                   /product="RIKEN cDNA 1700108M19, transcript variant
FT                   mCT18564"
FT                   /note="gene_id=mCG15553.1 transcript_id=mCT18564.2 created
FT                   on 09-SEP-2002"
FT   CDS             complement(join(11843971..11844136,11845216..11845243,
FT                   11848089..11848215))
FT                   /codon_start=1
FT                   /gene="1700108M19Rik"
FT                   /locus_tag="mCG_15553"
FT                   /product="RIKEN cDNA 1700108M19, isoform CRA_a"
FT                   /note="gene_id=mCG15553.1 transcript_id=mCT18564.2
FT                   protein_id=mCP11329.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q9D9C3"
FT                   /db_xref="MGI:MGI:1920830"
FT                   /db_xref="UniProtKB/TrEMBL:Q9D9C3"
FT                   /protein_id="EDL36849.1"
FT                   /translation="MITIFDHKKAHVIQSVAFGKRVDASWNPKLPIKQKRVKKPPSDFA
FT                   FGDNVDKTLFDDPEDAVFVRSTKRSLMTFTSMNWNTVLTRSEKYDQKKKSSAAEMLMIS
FT                   LR"
FT   mRNA            complement(join(11845088..11845243,11848089..11848241,
FT                   11849801..11849890,11856973..11857083,11858232..11858313,
FT                   11878757..11878826,11883079..11883171,11888696..>11888875))
FT                   /gene="1700108M19Rik"
FT                   /locus_tag="mCG_15553"
FT                   /product="RIKEN cDNA 1700108M19, transcript variant
FT                   mCT193510"
FT                   /note="gene_id=mCG15553.1 transcript_id=mCT193510.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(11845212..11845243,11848089..11848241,
FT                   11849801..11849890,11856973..11857083,11858232..11858313,
FT                   11878757..11878826,11883079..11883171,11888696..>11888697))
FT                   /codon_start=1
FT                   /gene="1700108M19Rik"
FT                   /locus_tag="mCG_15553"
FT                   /product="RIKEN cDNA 1700108M19, isoform CRA_b"
FT                   /note="gene_id=mCG15553.1 transcript_id=mCT193510.0
FT                   protein_id=mCP114456.0 isoform=CRA_b"
FT                   /protein_id="EDL36850.1"
FT                   /translation="RLIICYQAVEDQLKICGHKRDIDVLELFLSKKELTEVIDLSRFKK
FT                   LRYLWLHHNKLHGISFLTRNYCLTELYLNNNAIFEIEGLHNLPSLNILLLHHNELTNID
FT                   ATMKELKGMQNLRSLSLYQNPLSQYNLYRLYIIFHLPGLELLDRKQITEKERRYMITIF
FT                   DHKKAHVIQSVAFGKRVDASWNPKLPIKQKRVKKPPSDFAFGDNVDK"
FT   gene            <11948202..11952339
FT                   /gene="Sostdc1"
FT                   /locus_tag="mCG_127093"
FT                   /note="gene_id=mCG127093.0"
FT   mRNA            join(<11948202..11948475,11951009..11952339)
FT                   /gene="Sostdc1"
FT                   /locus_tag="mCG_127093"
FT                   /product="sclerostin domain containing 1"
FT                   /note="gene_id=mCG127093.0 transcript_id=mCT128374.0
FT                   created on 30-AUG-2002"
FT   CDS             join(<11948238..11948475,11951009..11951430)
FT                   /codon_start=1
FT                   /gene="Sostdc1"
FT                   /locus_tag="mCG_127093"
FT                   /product="sclerostin domain containing 1"
FT                   /note="gene_id=mCG127093.0 transcript_id=mCT128374.0
FT                   protein_id=mCP78884.0 partial"
FT                   /protein_id="EDL36848.1"
FT                   /translation="RLLSPANPPLIMLPPAIHLSLIPLLCILMRNCLAFKNDATEILYS
FT                   HVVKPVPAHPSSNSTLNQARNGGRHFSSTGLDRNSRVQVGCRELRSTKYISDGQCTSIS
FT                   PLKELVCAGECLPLPVLPNWIGGGYGTKYWSRRSSQEWRCVNDKTRTQRIQLQCQDGST
FT                   RTYKITVVTACKCKRYTRQHNESXXXXXXXXXXXXXXXXXIAWKTLSRACHCSFLT"
FT   gene            <12010256..12205491
FT                   /gene="4930579E17Rik"
FT                   /locus_tag="mCG_15551"
FT                   /note="gene_id=mCG15551.2"
FT   mRNA            join(<12010256..12010831,12019158..12019434,
FT                   12055561..12055710,12102291..12102395,12105726..12105771,
FT                   12124025..12124119,12143498..12143587,12144024..12144116,
FT                   12169891..12170022,12205131..12205491)
FT                   /gene="4930579E17Rik"
FT                   /locus_tag="mCG_15551"
FT                   /product="RIKEN cDNA 4930579E17, transcript variant
FT                   mCT193509"
FT                   /note="gene_id=mCG15551.2 transcript_id=mCT193509.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<12010506..12010831,12019158..12019434,
FT                   12055561..12055710,12102291..12102395,12105726..12105771,
FT                   12124025..12124119,12143498..12143587,12144024..12144116,
FT                   12169891..12170022,12205131..12205151)
FT                   /codon_start=1
FT                   /gene="4930579E17Rik"
FT                   /locus_tag="mCG_15551"
FT                   /product="RIKEN cDNA 4930579E17, isoform CRA_b"
FT                   /note="gene_id=mCG15551.2 transcript_id=mCT193509.0
FT                   protein_id=mCP114455.0 isoform=CRA_b"
FT                   /protein_id="EDL36847.1"
FT                   /translation="SRPRAGAGVSLSVSICTSSFCALPAMEPGPCSRPAEPGHCVSGPA
FT                   GAGSAFPESPLSVAGAEPGNRPGTVAAVLPAGGCGERMGVRTPKQFCRVLERPLISYTL
FT                   QAMERVCWIKDIVVTVTGENMEAMRSIIQRYGHKRISLAEAGATRHRSIFNGLKALAED
FT                   QPDCKLTKPEVVIIHDAVRPFVEEDILLRVVLAAKEHGAAGAIRPLVSTVISPSADGHL
FT                   DHSLDRAKHRASEMPQAFLFDVIYEAYQQCSDFDLEFGTECLQLALKYCHRKAKLVEGP
FT                   PALWKVTYKQDLCAAEAMIKEKISQEICVVMNTKDEESVGHLLEEALRKELNCMKITST
FT                   VMDHIGGDIRNFIEQCYSFICVNVVSLDSQETRKLLHILKESSLPLLYPVVVVLVHCFD
FT                   FTSVPLAQKMESLVWIRGLAKEVKERNILLSGLLLNYSQNFYYGG"
FT   mRNA            join(<12010986..12011110,12019158..12019434,
FT                   12055561..12055710,12102291..12102395,12105726..12105771,
FT                   12124025..12124119,12169891..12170022,12205131..12205488)
FT                   /gene="4930579E17Rik"
FT                   /locus_tag="mCG_15551"
FT                   /product="RIKEN cDNA 4930579E17, transcript variant
FT                   mCT18562"
FT                   /note="gene_id=mCG15551.2 transcript_id=mCT18562.1 created
FT                   on 09-SEP-2002"
FT   CDS             join(<12011103..12011110,12019158..12019434,
FT                   12055561..12055710,12102291..12102395,12105726..12105771,
FT                   12124025..12124119,12169891..12170022,12205131..12205151)
FT                   /codon_start=1
FT                   /gene="4930579E17Rik"
FT                   /locus_tag="mCG_15551"
FT                   /product="RIKEN cDNA 4930579E17, isoform CRA_a"
FT                   /note="gene_id=mCG15551.2 transcript_id=mCT18562.1
FT                   protein_id=mCP11342.1 isoform=CRA_a"
FT                   /protein_id="EDL36846.1"
FT                   /translation="ITRVCWIKDIVVTVTGENMEAMRSIIQRYGHKRISLAEAGATRHR
FT                   SIFNGLKALAEDQPDCKLTKPEVVIIHDAVRPFVEEDILLRVVLAAKEHGAAGAIRPLV
FT                   STVISPSADGHLDHSLDRAKHRASEMPQAFLFDVIYEAYQQCSDFDLEFGTECLQLALK
FT                   YCHRKAKLVEGPPALWKVTYKQDLCAAEAMIKEKISQEICVVMNTKDEESVGHLLEEAL
FT                   RKELNVHCFDFTSVPLAQKMESLVWIRGLAKEVKERNILLSGLLLNYSQNFYYGG"
FT   gene            12299752..12311738
FT                   /locus_tag="mCG_148263"
FT                   /note="gene_id=mCG148263.0"
FT   mRNA            join(12299752..12300049,12311419..12311738)
FT                   /locus_tag="mCG_148263"
FT                   /product="mCG148263"
FT                   /note="gene_id=mCG148263.0 transcript_id=mCT188526.0
FT                   created on 13-JAN-2004"
FT   CDS             join(12299870..12300049,12311419..12311523)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148263"
FT                   /product="mCG148263"
FT                   /note="gene_id=mCG148263.0 transcript_id=mCT188526.0
FT                   protein_id=mCP108096.0"
FT                   /protein_id="EDL36845.1"
FT                   /translation="MPLRWLIHTCASRMGSTVYPSQAMGLSLPIIAAYEGLGQLSHSHT
FT                   LEAGFTIRFLHHVAQDEQKLQESLGQSAAIIAALVKERNSALVGQLLVA"
FT   gene            <12733448..12793467
FT                   /gene="Meox2"
FT                   /locus_tag="mCG_49365"
FT                   /note="gene_id=mCG49365.1"
FT   mRNA            join(<12733448..12734237,12781244..12781416,
FT                   12792091..12793467)
FT                   /gene="Meox2"
FT                   /locus_tag="mCG_49365"
FT                   /product="mesenchyme homeobox 2"
FT                   /note="gene_id=mCG49365.1 transcript_id=mCT49548.1 created
FT                   on 09-SEP-2002"
FT   CDS             join(<12733691..12734237,12781244..12781416,
FT                   12792091..12792315)
FT                   /codon_start=1
FT                   /gene="Meox2"
FT                   /locus_tag="mCG_49365"
FT                   /product="mesenchyme homeobox 2"
FT                   /note="gene_id=mCG49365.1 transcript_id=mCT49548.1
FT                   protein_id=mCP42611.1"
FT                   /protein_id="EDL36844.1"
FT                   /translation="SLLLGSRNLHAMEHPLFGCLRSPHATAQGLHPFSQSSLALHGRSD
FT                   HMSYPELSTSSSSCIIAGYPNEEGMFASQHHRGHHHHHHHHHHHHQQQQHQALQSNWHL
FT                   PQMSSPPSAARHSLCLQPDSGGPPELGSSPPVLCSNSSSLGSSTPTGAACAPGDYGRQA
FT                   LSPADVEKRSGSKRKSDSSDSQEGNYKSEVNSKPRKERTAFTKEQIRELEAEFAHHNYL
FT                   TRLRRYEIAVNLDLTERQVKVWFQNRRMKWKRVKGGQQGAAAREKELVNVKKGTLLPSE
FT                   LSGIGAATLQQTGDSLANEDSRDSDHSSEHAHL"
FT   gene            12864584..13206338
FT                   /gene="A530016O06Rik"
FT                   /locus_tag="mCG_8101"
FT                   /note="gene_id=mCG8101.2"
FT   mRNA            join(12864584..12865000,12866539..12866669,
FT                   12877999..12878150,12972849..12972952,12983196..12983291,
FT                   13023351..13023417,13026592..13026657,13026749..13026828,
FT                   13029981..13030115,13030590..13030706,13038668..13038750,
FT                   13039555..13039660,13206194..13206338)
FT                   /gene="A530016O06Rik"
FT                   /locus_tag="mCG_8101"
FT                   /product="RIKEN cDNA A530016O06, transcript variant
FT                   mCT7150"
FT                   /note="gene_id=mCG8101.2 transcript_id=mCT7150.2 created on
FT                   09-APR-2003"
FT   CDS             join(12864875..12865000,12866539..12866669,
FT                   12877999..12878150,12972849..12972952,12983196..12983291,
FT                   13023351..13023417,13026592..13026657,13026749..13026828,
FT                   13029981..13030115,13030590..13030706,13038668..13038750,
FT                   13039555..13039660,13206194..13206274)
FT                   /codon_start=1
FT                   /gene="A530016O06Rik"
FT                   /locus_tag="mCG_8101"
FT                   /product="RIKEN cDNA A530016O06, isoform CRA_b"
FT                   /note="gene_id=mCG8101.2 transcript_id=mCT7150.2
FT                   protein_id=mCP22790.2 isoform=CRA_b"
FT                   /protein_id="EDL36843.1"
FT                   /translation="MRSPGAQDNVSVSQGMRAMFYMMEPSETAFQTVEEVPDYVKKATP
FT                   FFIFLILLELVISWILKGKPSGRLDDALTSISAGVVSRLPSLFFRSLEVTSYIYIWENY
FT                   RLLELPWDSTWTWYFTFLGVDFGYYWFHRMAHEINIFWAAHQAHHSSEDYNLSTALRQS
FT                   VLQQYSSWVFYCPLALFIPPSVFAVHIQFNLLYQFWIHTEIIRTLGPLEVILNTPSHHR
FT                   VHHGRNRYCIDKNYAGTLIIWDRIFGTFEAENEQVIYGLTHPIGTFEPFNVQFHHLLYI
FT                   WTTFWTTPGFCHKFSVLFKGPGWGPGKPRLGLSEEIPEVTGQEVPFSSSASQLLKIYTV
FT                   LQFAVMLAFYEETFANTAVLSQVTLLLRIFFFILTLTSIGFLLDQRSKAATMETFRCLL
FT                   FLTLHRFGHLKPLIPSLSFAFEIFFSVCIAFWGVRSITQLTSGSWKKP"
FT   mRNA            join(<12864901..12865000,12866539..12866669,
FT                   12877999..12878150,12972849..12972952,12983196..12983291,
FT                   13023351..13023417,13026592..13026657,13026749..13026828,
FT                   13029981..13030115,13030590..13030706,13038668..13038750,
FT                   13039555..13039660,13189016..13189946)
FT                   /gene="A530016O06Rik"
FT                   /locus_tag="mCG_8101"
FT                   /product="RIKEN cDNA A530016O06, transcript variant
FT                   mCT193491"
FT                   /note="gene_id=mCG8101.2 transcript_id=mCT193491.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<12864902..12865000,12866539..12866669,
FT                   12877999..12878150,12972849..12972952,12983196..12983291,
FT                   13023351..13023417,13026592..13026657,13026749..13026828,
FT                   13029981..13030115,13030590..13030706,13038668..13038750,
FT                   13039555..13039660,13189016..13189060)
FT                   /codon_start=1
FT                   /gene="A530016O06Rik"
FT                   /locus_tag="mCG_8101"
FT                   /product="RIKEN cDNA A530016O06, isoform CRA_a"
FT                   /note="gene_id=mCG8101.2 transcript_id=mCT193491.0
FT                   protein_id=mCP114484.0 isoform=CRA_a"
FT                   /protein_id="EDL36842.1"
FT                   /translation="VSVSQGMRAMFYMMEPSETAFQTVEEVPDYVKKATPFFIFLILLE
FT                   LVISWILKGKPSGRLDDALTSISAGVVSRLPSLFFRSLEVTSYIYIWENYRLLELPWDS
FT                   TWTWYFTFLGVDFGYYWFHRMAHEINIFWAAHQAHHSSEDYNLSTALRQSVLQQYSSWV
FT                   FYCPLALFIPPSVFAVHIQFNLLYQFWIHTEIIRTLGPLEVILNTPSHHRVHHGRNRYC
FT                   IDKNYAGTLIIWDRIFGTFEAENEQVIYGLTHPIGTFEPFNVQFHHLLYIWTTFWTTPG
FT                   FCHKFSVLFKGPGWGPGKPRLGLSEEIPEVTGQEVPFSSSASQLLKIYTVLQFAVMLAF
FT                   YEETFANTAVLSQVTLLLRIFFFILTLTSIGFLLDQRSKAATMETFRCLLFLTLHRFGH
FT                   LKPLIPSLSFAFEGWCTEVWSSALPPS"
FT   gene            13501791..14243856
FT                   /gene="Dgkb"
FT                   /locus_tag="mCG_145718"
FT                   /note="gene_id=mCG145718.0"
FT   mRNA            join(13501791..13502200,13602916..13603171,
FT                   13691042..13691118,13707240..13707393,13724413..13724553,
FT                   13730487..13730536,13734058..13734132,13737154..13737273,
FT                   13746430..13746547,13749294..13749382,13749459..13749575,
FT                   13757429..13757527,13776605..13776637,13783591..13783707,
FT                   13794723..13794796,13821007..13821092,13822735..13822824,
FT                   13836718..13836878,13939683..13939747,14037377..14037467,
FT                   14048503..14048698,14212656..14212776,14214043..14214103,
FT                   14240190..14243856)
FT                   /gene="Dgkb"
FT                   /locus_tag="mCG_145718"
FT                   /product="diacylglycerol kinase, beta, transcript variant
FT                   mCT185314"
FT                   /note="gene_id=mCG145718.0 transcript_id=mCT185314.0
FT                   created on 11-JUN-2003"
FT   mRNA            join(13501961..13502200,13602916..13603171,
FT                   13691042..13691118,13694448..13694468,13707240..13707393,
FT                   13724413..13724553,13730487..13730536,13734058..13734132,
FT                   13737154..13737273,13746430..13746547,13749294..13749382,
FT                   13749459..13749575,13757429..13757527,13776605..13776637,
FT                   13783591..13783707,13794723..13794796,13821007..13821092,
FT                   13822735..13822824,13836718..13836878,13939683..13939747,
FT                   14037377..14037467,14048503..14048698,14212656..14212776,
FT                   14214043..14214103,14240190..14243856)
FT                   /gene="Dgkb"
FT                   /locus_tag="mCG_145718"
FT                   /product="diacylglycerol kinase, beta, transcript variant
FT                   mCT185315"
FT                   /note="gene_id=mCG145718.0 transcript_id=mCT185315.0
FT                   created on 11-JUN-2003"
FT   CDS             join(13603102..13603171,13691042..13691118,
FT                   13694448..13694468,13707240..13707393,13724413..13724553,
FT                   13730487..13730536,13734058..13734132,13737154..13737273,
FT                   13746430..13746547,13749294..13749382,13749459..13749575,
FT                   13757429..13757527,13776605..13776637,13783591..13783707,
FT                   13794723..13794796,13821007..13821092,13822735..13822824,
FT                   13836718..13836878,13939683..13939747,14037377..14037467,
FT                   14048503..14048698,14212656..14212776,14214043..14214103,
FT                   14240190..14240297)
FT                   /codon_start=1
FT                   /gene="Dgkb"
FT                   /locus_tag="mCG_145718"
FT                   /product="diacylglycerol kinase, beta, isoform CRA_b"
FT                   /note="gene_id=mCG145718.0 transcript_id=mCT185315.0
FT                   protein_id=mCP106573.0 isoform=CRA_b"
FT                   /protein_id="EDL36840.1"
FT                   /translation="MTNQEKWAHLSPSEFSQLQKYAEYSTKKLKDVLEEFHGNGVLAKY
FT                   NPEGKQDILNQTIDFEGFKLFMKTFLEAELPDDFTAHLFMSFSNKFPHSSPNVKSKPAL
FT                   LSGGLRMNKGAITPPRSSPANTCSPEVIHLKDIVCYLSLLERGRPEDKLEFMFRLYDTD
FT                   GNGFLDSSELENIIGQMMHVAEYLEWDVTELNPILHEMMEEIDYDRDGTVSLEEWIQGG
FT                   MTTIPLLVLLGLENNVKDDGQHVWRLKHFNKPAYCNLCLNMLIGVGKQGLCCSFCKYTV
FT                   HERCVARAPPSCIKTYVKSKKNTDVMHHYWVEGNCPTKCDKCHKTVKCYQGLTGLHCVW
FT                   CQTTLHNKCASHLKPECDCGPLKDHILPPTTICPVVLTMPSAGASVPEERQSTAKKEKS
FT                   SSQQPNKATDKNKMQRANSVTMDGQGLQITPVPGTHPLLVFVNPKSGGKQGERLHFFRD
FT                   VPDFRVLACGGDGTVGWILDCIEKANVVKHPPVAILPLGTGNDLARCLRWGGGYEGENL
FT                   MKILKDIESSTEIMLDRWKFEVTPNDKDEKGDPVPYSIINNYFSIGVDASIAHRFHIMR
FT                   EKHPEKFNSRMKNKFWYFEFGTSETFSATCKKLHESVEIECDGVQIDLINISLEGIAIL
FT                   NIPSMHGGSNLWGESKKKRSHRRIEKKGSDKRPTLTDAKELKFASQDLSDQLLEVVGLE
FT                   GAMEMGQIYTGLKSAGRRLAQCSSVVIRTSKSLPMQIDGEPWMQTPCTIKITHKNQAPM
FT                   LMGPPPKTGLFCSLIKRTRNRSKE"
FT   CDS             join(13603102..13603171,13691042..13691118,
FT                   13707240..13707393,13724413..13724553,13730487..13730536,
FT                   13734058..13734132,13737154..13737273,13746430..13746547,
FT                   13749294..13749382,13749459..13749575,13757429..13757527,
FT                   13776605..13776637,13783591..13783707,13794723..13794796,
FT                   13821007..13821092,13822735..13822824,13836718..13836878,
FT                   13939683..13939747,14037377..14037467,14048503..14048698,
FT                   14212656..14212776,14214043..14214103,14240190..14240297)
FT                   /codon_start=1
FT                   /gene="Dgkb"
FT                   /locus_tag="mCG_145718"
FT                   /product="diacylglycerol kinase, beta, isoform CRA_a"
FT                   /note="gene_id=mCG145718.0 transcript_id=mCT185314.0
FT                   protein_id=mCP106572.0 isoform=CRA_a"
FT                   /protein_id="EDL36839.1"
FT                   /translation="MTNQEKWAHLSPSEFSQLQKYAEYSTKKLKDVLEEFHGNGVLAKY
FT                   NPEGTIDFEGFKLFMKTFLEAELPDDFTAHLFMSFSNKFPHSSPNVKSKPALLSGGLRM
FT                   NKGAITPPRSSPANTCSPEVIHLKDIVCYLSLLERGRPEDKLEFMFRLYDTDGNGFLDS
FT                   SELENIIGQMMHVAEYLEWDVTELNPILHEMMEEIDYDRDGTVSLEEWIQGGMTTIPLL
FT                   VLLGLENNVKDDGQHVWRLKHFNKPAYCNLCLNMLIGVGKQGLCCSFCKYTVHERCVAR
FT                   APPSCIKTYVKSKKNTDVMHHYWVEGNCPTKCDKCHKTVKCYQGLTGLHCVWCQTTLHN
FT                   KCASHLKPECDCGPLKDHILPPTTICPVVLTMPSAGASVPEERQSTAKKEKSSSQQPNK
FT                   ATDKNKMQRANSVTMDGQGLQITPVPGTHPLLVFVNPKSGGKQGERLHFFRDVPDFRVL
FT                   ACGGDGTVGWILDCIEKANVVKHPPVAILPLGTGNDLARCLRWGGGYEGENLMKILKDI
FT                   ESSTEIMLDRWKFEVTPNDKDEKGDPVPYSIINNYFSIGVDASIAHRFHIMREKHPEKF
FT                   NSRMKNKFWYFEFGTSETFSATCKKLHESVEIECDGVQIDLINISLEGIAILNIPSMHG
FT                   GSNLWGESKKKRSHRRIEKKGSDKRPTLTDAKELKFASQDLSDQLLEVVGLEGAMEMGQ
FT                   IYTGLKSAGRRLAQCSSVVIRTSKSLPMQIDGEPWMQTPCTIKITHKNQAPMLMGPPPK
FT                   TGLFCSLIKRTRNRSKE"
FT   gene            complement(13978334..13978893)
FT                   /pseudo
FT                   /locus_tag="mCG_53631"
FT                   /note="gene_id=mCG53631.0"
FT   mRNA            complement(join(13978334..13978496,13978751..13978893))
FT                   /pseudo
FT                   /locus_tag="mCG_53631"
FT                   /note="gene_id=mCG53631.0 transcript_id=mCT53814.0 created
FT                   on 09-SEP-2002"
FT   gene            complement(14162430..>14225393)
FT                   /locus_tag="mCG_1041909"
FT                   /note="gene_id=mCG1041909.0"
FT   mRNA            complement(join(14162430..14162480,14165616..14165703,
FT                   14170237..14170312,14170563..14170695,14172135..14172166,
FT                   14195063..14195245,14200096..14200198,14200622..14200689,
FT                   14224276..>14225393))
FT                   /locus_tag="mCG_1041909"
FT                   /product="mCG1041909"
FT                   /note="gene_id=mCG1041909.0 transcript_id=mCT159613.0
FT                   created on 25-SEP-2002"
FT   CDS             complement(14225211..14225393)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041909"
FT                   /product="mCG1041909"
FT                   /note="gene_id=mCG1041909.0 transcript_id=mCT159613.0
FT                   protein_id=mCP78873.1"
FT                   /protein_id="EDL36841.1"
FT                   /translation="MACAKNNLLKKPDIADSWEAMPEPGKYRGRCLQPITGLSSGSPMG
FT                   DLEKEQKELKEFANP"
FT   gene            14317558..14318273
FT                   /pseudo
FT                   /locus_tag="mCG_1041677"
FT                   /note="gene_id=mCG1041677.0"
FT   mRNA            join(14317558..14317574,14317594..14317728,
FT                   14317775..14317889,14318152..14318273)
FT                   /pseudo
FT                   /locus_tag="mCG_1041677"
FT                   /note="gene_id=mCG1041677.0 transcript_id=mCT159381.0
FT                   created on 25-SEP-2002"
FT   gene            complement(<14351281..>14351772)
FT                   /locus_tag="mCG_64478"
FT                   /note="gene_id=mCG64478.0"
FT   mRNA            complement(<14351281..>14351772)
FT                   /locus_tag="mCG_64478"
FT                   /product="mCG64478"
FT                   /note="gene_id=mCG64478.0 transcript_id=mCT64661.0 created
FT                   on 25-SEP-2002"
FT   CDS             complement(14351281..14351772)
FT                   /codon_start=1
FT                   /locus_tag="mCG_64478"
FT                   /product="mCG64478"
FT                   /note="gene_id=mCG64478.0 transcript_id=mCT64661.0
FT                   protein_id=mCP42607.0"
FT                   /protein_id="EDL36838.1"
FT                   /translation="MALIQRNYSLVLTVPDAPSRKDSKFRKWHHFLVVNMKDNGINSGA
FT                   VLSDSVGSGPSSGLHRYIWLVYEQDKPLNCGEPMCSNRSGDHCGKFKVTASARSITSDP
FT                   RCQARVSRHRAMSCPNCRSSCLGSRGAAEASSPGDPHSIIKLFKACCFSSSYLLPERES
FT                   "
FT   gene            14386592..14475136
FT                   /gene="Etv1"
FT                   /locus_tag="mCG_19074"
FT                   /note="gene_id=mCG19074.3"
FT   mRNA            join(14386592..14386704,14387132..14387263,
FT                   14388083..14388170,14389522..14389569,14399455..14399508,
FT                   14434613..14434742,14437928..14438116,14441916..14442163,
FT                   14459068..14459135,14461006..14461074,14463787..14463956,
FT                   14468217..14468318,14472481..14475136)
FT                   /gene="Etv1"
FT                   /locus_tag="mCG_19074"
FT                   /product="ets variant gene 1, transcript variant mCT16917"
FT                   /note="gene_id=mCG19074.3 transcript_id=mCT16917.3 created
FT                   on 24-NOV-2004"
FT   CDS             join(14387219..14387263,14388083..14388170,
FT                   14389522..14389569,14399455..14399508,14434613..14434742,
FT                   14437928..14438116,14441916..14442163,14459068..14459135,
FT                   14461006..14461074,14463787..14463873)
FT                   /codon_start=1
FT                   /gene="Etv1"
FT                   /locus_tag="mCG_19074"
FT                   /product="ets variant gene 1, isoform CRA_c"
FT                   /note="gene_id=mCG19074.3 transcript_id=mCT16917.3
FT                   protein_id=mCP22794.3 isoform=CRA_c"
FT                   /protein_id="EDL36836.1"
FT                   /translation="MDGFYDQQVPYVVTNSQRGRNCTEKPTNVRKRKFINRDLAHDSEE
FT                   LFQDLSQLQETWLAEAQVPDNDEQFVPDYQAESLAFHGLPLKIKKEPHSPCSELGSACS
FT                   QEQPFKFSYGEKCLYNVSAYDQKPQVGMRPSNPPTPSSTPVSPLHHASPNTAHTPKPDR
FT                   AFPAHLPPSQSIPDSTYPMDHRFRRQLSEPCNSFPPLPTMPREGRPMYQRQMSEPNIPF
FT                   PPQGFKQEYHDPVYEHTTMVGGAASQSFPPPLMIKQEPRDFAYDSEVPSCHSIYMRQEG
FT                   FLAHPSRTEAACLRRVPGSSMMTPVWSRRSSMGTLSKSLECTGKDPRTRGEDPSSSGSF
FT                   W"
FT   mRNA            join(14387413..14387586,14388083..14388170,
FT                   14389522..14389569,14399455..14399508,14434613..14434742,
FT                   14437928..14438116,14441916..14442163,14459068..14459135,
FT                   14461006..14461074,14463787..14463956,14468217..14468318,
FT                   14472481..14475136)
FT                   /gene="Etv1"
FT                   /locus_tag="mCG_19074"
FT                   /product="ets variant gene 1, transcript variant mCT193489"
FT                   /note="gene_id=mCG19074.3 transcript_id=mCT193489.1 created
FT                   on 24-NOV-2004"
FT   CDS             join(14387494..14387586,14388083..14388170,
FT                   14389522..14389569,14399455..14399508,14434613..14434742,
FT                   14437928..14438116,14441916..14442163,14459068..14459135,
FT                   14461006..14461074,14463787..14463873)
FT                   /codon_start=1
FT                   /gene="Etv1"
FT                   /locus_tag="mCG_19074"
FT                   /product="ets variant gene 1, isoform CRA_b"
FT                   /note="gene_id=mCG19074.3 transcript_id=mCT193489.1
FT                   protein_id=mCP114462.1 isoform=CRA_b"
FT                   /protein_id="EDL36835.1"
FT                   /translation="MSTMSARGDGGQQQLHSKFVAGFICHIEKNESQRGRNCTEKPTNV
FT                   RKRKFINRDLAHDSEELFQDLSQLQETWLAEAQVPDNDEQFVPDYQAESLAFHGLPLKI
FT                   KKEPHSPCSELGSACSQEQPFKFSYGEKCLYNVSAYDQKPQVGMRPSNPPTPSSTPVSP
FT                   LHHASPNTAHTPKPDRAFPAHLPPSQSIPDSTYPMDHRFRRQLSEPCNSFPPLPTMPRE
FT                   GRPMYQRQMSEPNIPFPPQGFKQEYHDPVYEHTTMVGGAASQSFPPPLMIKQEPRDFAY
FT                   DSEVPSCHSIYMRQEGFLAHPSRTEAACLRRVPGSSMMTPVWSRRSSMGTLSKSLECTG
FT                   KDPRTRGEDPSSSGSFW"
FT   mRNA            join(14387848..14387994,14388083..14388170,
FT                   14389522..14389569,14399455..14399508,14434613..14434742,
FT                   14437928..14438116,14441916..14442163,14459068..14459135,
FT                   14461006..14461074,14463787..14463956,14468217..14468318,
FT                   14472481..14475136)
FT                   /gene="Etv1"
FT                   /locus_tag="mCG_19074"
FT                   /product="ets variant gene 1, transcript variant mCT193488"
FT                   /note="gene_id=mCG19074.3 transcript_id=mCT193488.1 created
FT                   on 24-NOV-2004"
FT   CDS             join(14387863..14387994,14388083..14388170,
FT                   14389522..14389569,14399455..14399508,14434613..14434742,
FT                   14437928..14438116,14441916..14442163,14459068..14459135,
FT                   14461006..14461074,14463787..14463873)
FT                   /codon_start=1
FT                   /gene="Etv1"
FT                   /locus_tag="mCG_19074"
FT                   /product="ets variant gene 1, isoform CRA_a"
FT                   /note="gene_id=mCG19074.3 transcript_id=mCT193488.1
FT                   protein_id=mCP114461.1 isoform=CRA_a"
FT                   /protein_id="EDL36834.1"
FT                   /translation="MLWEATLPPHCLPNSQPEPPLSKSDNMCWSSPVNFFFSTQREDPS
FT                   QRGRNCTEKPTNVRKRKFINRDLAHDSEELFQDLSQLQETWLAEAQVPDNDEQFVPDYQ
FT                   AESLAFHGLPLKIKKEPHSPCSELGSACSQEQPFKFSYGEKCLYNVSAYDQKPQVGMRP
FT                   SNPPTPSSTPVSPLHHASPNTAHTPKPDRAFPAHLPPSQSIPDSTYPMDHRFRRQLSEP
FT                   CNSFPPLPTMPREGRPMYQRQMSEPNIPFPPQGFKQEYHDPVYEHTTMVGGAASQSFPP
FT                   PLMIKQEPRDFAYDSEVPSCHSIYMRQEGFLAHPSRTEAACLRRVPGSSMMTPVWSRRS
FT                   SMGTLSKSLECTGKDPRTRGEDPSSSGSFW"
FT   mRNA            join(14389994..14390086,14399455..14399508,
FT                   14434613..14434742,14437928..14438116,14441916..14442163,
FT                   14459068..14459135,14461006..14461074,14463787..14463956,
FT                   14468217..14468318,14472481..14475136)
FT                   /gene="Etv1"
FT                   /locus_tag="mCG_19074"
FT                   /product="ets variant gene 1, transcript variant mCT194590"
FT                   /note="gene_id=mCG19074.3 transcript_id=mCT194590.0 created
FT                   on 24-NOV-2004"
FT   CDS             join(14390026..14390086,14399455..14399508,
FT                   14434613..14434742,14437928..14438116,14441916..14442163,
FT                   14459068..14459135,14461006..14461074,14463787..14463873)
FT                   /codon_start=1
FT                   /gene="Etv1"
FT                   /locus_tag="mCG_19074"
FT                   /product="ets variant gene 1, isoform CRA_d"
FT                   /note="gene_id=mCG19074.3 transcript_id=mCT194590.0
FT                   protein_id=mCP115619.0 isoform=CRA_d"
FT                   /protein_id="EDL36837.1"
FT                   /translation="MLQDLSAGVFFPPCSQHRTLAQVPDNDEQFVPDYQAESLAFHGLP
FT                   LKIKKEPHSPCSELGSACSQEQPFKFSYGEKCLYNVSAYDQKPQVGMRPSNPPTPSSTP
FT                   VSPLHHASPNTAHTPKPDRAFPAHLPPSQSIPDSTYPMDHRFRRQLSEPCNSFPPLPTM
FT                   PREGRPMYQRQMSEPNIPFPPQGFKQEYHDPVYEHTTMVGGAASQSFPPPLMIKQEPRD
FT                   FAYDSEVPSCHSIYMRQEGFLAHPSRTEAACLRRVPGSSMMTPVWSRRSSMGTLSKSLE
FT                   CTGKDPRTRGEDPSSSGSFW"
FT   gene            <15488287..15489714
FT                   /locus_tag="mCG_5065"
FT                   /note="gene_id=mCG5065.1"
FT   mRNA            join(<15488287..15488459,15489039..15489714)
FT                   /locus_tag="mCG_5065"
FT                   /product="mCG5065"
FT                   /note="gene_id=mCG5065.1 transcript_id=mCT4253.1 created on
FT                   09-SEP-2002"
FT   CDS             join(15488287..15488459,15489039..15489273)
FT                   /codon_start=1
FT                   /locus_tag="mCG_5065"
FT                   /product="mCG5065"
FT                   /note="gene_id=mCG5065.1 transcript_id=mCT4253.1
FT                   protein_id=mCP22802.1"
FT                   /protein_id="EDL36833.1"
FT                   /translation="MALLPSGETQSQDKANYLPQNSLQHLTAHHLPAPGYSHFQNLAIT
FT                   KEDFQPWKLAAARKSVAKGMRFGPFQGKGVNASKVKTHRDNSQMWEIFEDGHLSHFIDG
FT                   KGSGTWMSSVNCARFHKEQNLAAEQHERQIF"
FT   gene            complement(15620128..15651331)
FT                   /locus_tag="mCG_5062"
FT                   /note="gene_id=mCG5062.1"
FT   mRNA            complement(join(15620128..15620193,15621521..15621554,
FT                   15623102..15623220,15624692..15624860,15649968..15650234,
FT                   15650664..15650819))
FT                   /locus_tag="mCG_5062"
FT                   /product="mCG5062, transcript variant mCT172865"
FT                   /note="gene_id=mCG5062.1 transcript_id=mCT172865.0 created
FT                   on 13-JUN-2003"
FT   CDS             complement(join(15624846..15624860,15649968..15650147))
FT                   /codon_start=1
FT                   /locus_tag="mCG_5062"
FT                   /product="mCG5062, isoform CRA_a"
FT                   /note="gene_id=mCG5062.1 transcript_id=mCT172865.0
FT                   protein_id=mCP95784.0 isoform=CRA_a"
FT                   /db_xref="GOA:G3UVX1"
FT                   /db_xref="InterPro:IPR006689"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:99437"
FT                   /db_xref="UniProtKB/TrEMBL:G3UVX1"
FT                   /protein_id="EDL36829.1"
FT                   /translation="MGNGLSDQTSILSSLPSFQSFHIVILGLDCAGKTTVLYRLQFNEF
FT                   VNTVPTKGFNTEKIKTHST"
FT   mRNA            complement(join(15646693..15648286,15648576..15650234,
FT                   15650664..15650819))
FT                   /locus_tag="mCG_5062"
FT                   /product="mCG5062, transcript variant mCT185587"
FT                   /note="gene_id=mCG5062.1 transcript_id=mCT185587.0 created
FT                   on 13-JUN-2003"
FT   mRNA            complement(join(15647443..15650234,15651239..15651331))
FT                   /locus_tag="mCG_5062"
FT                   /product="mCG5062, transcript variant mCT185588"
FT                   /note="gene_id=mCG5062.1 transcript_id=mCT185588.0 created
FT                   on 13-JUN-2003"
FT   mRNA            complement(join(15647443..15650234,15650664..15650819))
FT                   /locus_tag="mCG_5062"
FT                   /product="mCG5062, transcript variant mCT4255"
FT                   /note="gene_id=mCG5062.1 transcript_id=mCT4255.1 created on
FT                   13-JUN-2003"
FT   CDS             complement(15649545..15650147)
FT                   /codon_start=1
FT                   /locus_tag="mCG_5062"
FT                   /product="mCG5062, isoform CRA_b"
FT                   /note="gene_id=mCG5062.1 transcript_id=mCT185587.0
FT                   protein_id=mCP106845.0 isoform=CRA_b"
FT                   /protein_id="EDL36830.1"
FT                   /translation="MGNGLSDQTSILSSLPSFQSFHIVILGLDCAGKTTVLYRLQFNEF
FT                   VNTVPTKGFNTEKIKVTLGNSKTVTFHFWDVGGQEKLRPLWKSYTRCTDGIVFVVDSVD
FT                   VERMEEAKTELHKITRISENQGVPVLIVANKQDLRNSLSLSEIEKLLAMGELSSSTPWH
FT                   LQPTCAIIGDGLKEGLEKLHDMIIKRRKMLRQQKKKR"
FT   CDS             complement(15649545..15650147)
FT                   /codon_start=1
FT                   /locus_tag="mCG_5062"
FT                   /product="mCG5062, isoform CRA_b"
FT                   /note="gene_id=mCG5062.1 transcript_id=mCT185588.0
FT                   protein_id=mCP106846.0 isoform=CRA_b"
FT                   /protein_id="EDL36831.1"
FT                   /translation="MGNGLSDQTSILSSLPSFQSFHIVILGLDCAGKTTVLYRLQFNEF
FT                   VNTVPTKGFNTEKIKVTLGNSKTVTFHFWDVGGQEKLRPLWKSYTRCTDGIVFVVDSVD
FT                   VERMEEAKTELHKITRISENQGVPVLIVANKQDLRNSLSLSEIEKLLAMGELSSSTPWH
FT                   LQPTCAIIGDGLKEGLEKLHDMIIKRRKMLRQQKKKR"
FT   CDS             complement(15649545..15650147)
FT                   /codon_start=1
FT                   /locus_tag="mCG_5062"
FT                   /product="mCG5062, isoform CRA_b"
FT                   /note="gene_id=mCG5062.1 transcript_id=mCT4255.1
FT                   protein_id=mCP22797.1 isoform=CRA_b"
FT                   /protein_id="EDL36832.1"
FT                   /translation="MGNGLSDQTSILSSLPSFQSFHIVILGLDCAGKTTVLYRLQFNEF
FT                   VNTVPTKGFNTEKIKVTLGNSKTVTFHFWDVGGQEKLRPLWKSYTRCTDGIVFVVDSVD
FT                   VERMEEAKTELHKITRISENQGVPVLIVANKQDLRNSLSLSEIEKLLAMGELSSSTPWH
FT                   LQPTCAIIGDGLKEGLEKLHDMIIKRRKMLRQQKKKR"
FT   gene            15651728..15653426
FT                   /locus_tag="mCG_148258"
FT                   /note="gene_id=mCG148258.0"
FT   mRNA            join(15651728..15651906,15653088..15653426)
FT                   /locus_tag="mCG_148258"
FT                   /product="mCG148258"
FT                   /note="gene_id=mCG148258.0 transcript_id=mCT188521.0
FT                   created on 13-JAN-2004"
FT   CDS             join(15651819..15651906,15653088..15653236)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148258"
FT                   /product="mCG148258"
FT                   /note="gene_id=mCG148258.0 transcript_id=mCT188521.0
FT                   protein_id=mCP108092.0"
FT                   /protein_id="EDL36828.1"
FT                   /translation="MPLLRRKKRTLETLNISSSPRRTGDEAAAVIDTKQVRSDNSETPS
FT                   SLAENILLSCTSVCYSELLTRTATSSLQPVSSI"
FT   gene            complement(15673174..>15747828)
FT                   /gene="Scin"
FT                   /locus_tag="mCG_5064"
FT                   /note="gene_id=mCG5064.1"
FT   mRNA            complement(join(15673174..15674028,15674558..15674618,
FT                   15676613..15676690,15686703..15686873,15690338..15690428,
FT                   15690872..15690993,15692997..15693212,15694333..15694421,
FT                   15695043..15695175,15698137..15698229,15718674..15718823,
FT                   15738212..15738373,15741526..15741680,15747555..>15747828))
FT                   /gene="Scin"
FT                   /locus_tag="mCG_5064"
FT                   /product="scinderin"
FT                   /note="gene_id=mCG5064.1 transcript_id=mCT4252.1 created on
FT                   30-AUG-2002"
FT   CDS             complement(join(15673901..15674028,15674558..15674618,
FT                   15676613..15676690,15686703..15686873,15690338..15690428,
FT                   15690872..15690993,15692997..15693212,15694333..15694421,
FT                   15695043..15695175,15698137..15698229,15718674..15718823,
FT                   15738212..15738373,15741526..15741680,15747555..>15747828))
FT                   /codon_start=1
FT                   /gene="Scin"
FT                   /locus_tag="mCG_5064"
FT                   /product="scinderin"
FT                   /note="gene_id=mCG5064.1 transcript_id=mCT4252.1
FT                   protein_id=mCP22798.0"
FT                   /protein_id="EDL36827.1"
FT                   /translation="TGHRALPWAQGTDQVLGSLGQHRGTMAQELQHPEFARAGQQAGLQ
FT                   VWRVEKLELVPVPQGAYGDFYVGDAYLVLHTTKSSRGFSYRLHFWLGKECSQDESTAAA
FT                   IFTVQMDDYLGGKPVQSRELQGYESTDFVGYFKGGLKYKAGGVASGLNHVLTNDLTAKR
FT                   LLHVKGRRVVRATEVPLSWESFNKGDCFIIDLGTEIYQWCGSSCNKYERLKASQVAIGI
FT                   RDNERKGRSQLIVVEEGSEPSELMKVLGRKPELPDGDNDDDVVADISNRKMAKLYMVSD
FT                   ASGSMKVTLVAEENPFSMGMLLSEECFILDHGAAKQIFVWKGKNANPQERKTAMKTAEE
FT                   FLQKMKYSTNTQIQVLPEGGETPIFKQFFKDWKDKDQSDGFGKVYITEKVAQIKQIPFD
FT                   ASKLHSSPQMAAQHNMVDDGSGGVEIWRVENSGRVQIDPSSYGEFYGGDCYIILYTYPR
FT                   GQIIYTWQGANATRDELTMSAFLTVQLDRSLGGQAVQVRVSQGKEPAHLLSLFKDKPLI
FT                   IYKNGTSKKEGQAPAPPTRLFQVRRNLASITRIVEIEEVPGEFTQDDLAEDDVMLLDAW
FT                   EQIFIWIGKDANEVEKKESVKSAKMYLETDPSGRDKRTPIVIIKQGHEPPTFTGWFLGW
FT                   DSSRW"
FT   gene            complement(15790405..15812536)
FT                   /locus_tag="mCG_65656"
FT                   /note="gene_id=mCG65656.2"
FT   mRNA            complement(join(15790405..15790897,15794315..15794443,
FT                   15798884..15799015,15812430..15812536))
FT                   /locus_tag="mCG_65656"
FT                   /product="mCG65656"
FT                   /note="gene_id=mCG65656.2 transcript_id=mCT65839.2 created
FT                   on 09-SEP-2002"
FT   CDS             complement(join(15790767..15790897,15794315..15794443,
FT                   15798884..15799010))
FT                   /codon_start=1
FT                   /locus_tag="mCG_65656"
FT                   /product="mCG65656"
FT                   /note="gene_id=mCG65656.2 transcript_id=mCT65839.2
FT                   protein_id=mCP42608.2"
FT                   /db_xref="GOA:B2RVW5"
FT                   /db_xref="InterPro:IPR028099"
FT                   /db_xref="MGI:MGI:2685735"
FT                   /db_xref="UniProtKB/TrEMBL:B2RVW5"
FT                   /protein_id="EDL36826.1"
FT                   /translation="MTHSSQDAGSHGIQEEGRLYVVDSINDLNKLSLCPMESQHLFSLE
FT                   DKIPNAGTAPGNGRRGLFFVGLLLVLTVSLALVFFAIFLIIQTGNQMEDVSRRLTAEGK
FT                   DIDDLKKINNMIVKRLNQLDSEQN"
FT   gene            complement(15816353..15836387)
FT                   /gene="Ifrd1"
FT                   /locus_tag="mCG_5061"
FT                   /note="gene_id=mCG5061.1"
FT   mRNA            complement(join(15816353..15816674,15817142..15817237,
FT                   15817520..15817648,15820212..15820346,15825533..15825641,
FT                   15826162..15826340,15826432..15826482,15827201..15827358,
FT                   15829413..15829537,15830381..15830465,15830601..15830705,
FT                   15836092..15836387))
FT                   /gene="Ifrd1"
FT                   /locus_tag="mCG_5061"
FT                   /product="interferon-related developmental regulator 1"
FT                   /note="gene_id=mCG5061.1 transcript_id=mCT4262.1 created on
FT                   25-SEP-2002"
FT   CDS             complement(join(15816585..15816674,15817142..15817237,
FT                   15817520..15817648,15820212..15820346,15825533..15825641,
FT                   15826162..15826340,15826432..15826482,15827201..15827358,
FT                   15829413..15829537,15830381..15830465,15830601..15830705,
FT                   15836092..15836179))
FT                   /codon_start=1
FT                   /gene="Ifrd1"
FT                   /locus_tag="mCG_5061"
FT                   /product="interferon-related developmental regulator 1"
FT                   /note="gene_id=mCG5061.1 transcript_id=mCT4262.1
FT                   protein_id=mCP22799.1"
FT                   /db_xref="GOA:P19182"
FT                   /db_xref="InterPro:IPR006921"
FT                   /db_xref="InterPro:IPR007701"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="MGI:MGI:1316717"
FT                   /db_xref="UniProtKB/Swiss-Prot:P19182"
FT                   /protein_id="EDL36825.1"
FT                   /translation="MPKNKKRNAPHRGGGGGGGSGAATSAATAGGPHRTVQPFSDEDAS
FT                   IETMSHCSGYSDPSSFAEDGPEVLDEEGTQEDLEYKLKGLIDLTLDKSAKTRQAALEGL
FT                   KNALSSKVLYEFVLERRMTLTDSIERCLKKGKSDEQRAAAAVASVLCIQLGPGFESEEI
FT                   LKTLGPILKKIICDGAASIQARQTCATCFGVCCFIATDDITELYSTLECFENIFTKSYL
FT                   KEKDTNVTCSTPNTVLHISSLLAWTLLLTICPINEVKKKLELHFHKLPSLLSCDDVNMR
FT                   IAAGESLALLFELARGMESDFFYEDMDSLTQMLRALATDGNKHRAKVDKRKQRSVFRDV
FT                   LRAVEERDFPTETVKFGPERMYIDSWVKKHTYDTFKEVLGSGMQYHLQTNEFLRNVFEL
FT                   GPPVMLDAATLKTMKISRFERHLYNSAAFKARTKARSKCRDKRADVGEFL"
FT   gene            <15836267..15842411
FT                   /locus_tag="mCG_5063"
FT                   /note="gene_id=mCG5063.1"
FT   mRNA            join(<15836267..15836776,15837892..15838099,
FT                   15842250..15842411)
FT                   /locus_tag="mCG_5063"
FT                   /product="mCG5063"
FT                   /note="gene_id=mCG5063.1 transcript_id=mCT4251.1 created on
FT                   09-SEP-2002"
FT   CDS             <15836323..15836763
FT                   /codon_start=1
FT                   /locus_tag="mCG_5063"
FT                   /product="mCG5063"
FT                   /note="gene_id=mCG5063.1 transcript_id=mCT4251.1
FT                   protein_id=mCP22803.1"
FT                   /protein_id="EDL36824.1"
FT                   /translation="EAAAAAAEIPVKSCERKRYMFLSSAGAKAGWPDHDALSSQTAACR
FT                   HHAWAGLHRSLANRCRSPHRGVHWGGACIRTPIPRASVCPRCLGCYALGPRGALGDVVS
FT                   ERARPSPGSSQSDCVVTSSQRGVRPGIHPGSHRDEPCGSYAA"
FT   gene            complement(15928247..>16057311)
FT                   /locus_tag="mCG_61794"
FT                   /note="gene_id=mCG61794.2"
FT   mRNA            complement(join(15928247..15929104,15930292..15930466,
FT                   15931736..15931778,15933826..15933922,15935754..15935821,
FT                   15941899..15942031,15942709..15942819,15948508..15948599,
FT                   15976365..15976447,15977313..15977401,15989691..15989892,
FT                   16022113..16022490,16057195..>16057304))
FT                   /locus_tag="mCG_61794"
FT                   /product="mCG61794, transcript variant mCT193439"
FT                   /note="gene_id=mCG61794.2 transcript_id=mCT193439.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(15928249..15928613,15928982..15929104,
FT                   15935754..15935821,15941899..15942024,15948548..15948599,
FT                   15989691..15989892,16057195..16057307))
FT                   /locus_tag="mCG_61794"
FT                   /product="mCG61794, transcript variant mCT61977"
FT                   /note="gene_id=mCG61794.2 transcript_id=mCT61977.1 created
FT                   on 25-SEP-2002"
FT   CDS             complement(join(15928544..15928613,15928982..15929104,
FT                   15935754..15935821,15941899..15942024,15948548..15948599,
FT                   15989691..15989892,16057195..16057288))
FT                   /codon_start=1
FT                   /locus_tag="mCG_61794"
FT                   /product="mCG61794, isoform CRA_d"
FT                   /note="gene_id=mCG61794.2 transcript_id=mCT61977.1
FT                   protein_id=mCP42603.2 isoform=CRA_d"
FT                   /protein_id="EDL36823.1"
FT                   /translation="MAASEVQGLPVDPREAGVRGVRGGIGHTDHEDSKDCILEPLSLPE
FT                   SPGGTTALEGSPSVPCIFCEEHFPMAEQDKLLKHMIIEHKIVIADVKLVADFRRKKFWI
FT                   SNSESEMIQAFMCLYCEKTFRDKNTLKDHMRKKQHRRINPKNREYDRFYVINYLELGKS
FT                   WEEVQSEDDRELLDLQEEYYFPTYENDTLLCTLSDSESDLTAQEQTENVPVISEDTSRL
FT                   PVIYQVTEFSVISVLNWELVND"
FT   mRNA            complement(join(15928761..15929104,15930292..15930466,
FT                   15931736..15931778,15933826..15933922,15935754..15935821,
FT                   15941899..15942031,15942709..15942819,15948508..15948599,
FT                   15976365..15976447,15977313..15977401,15989691..15989892,
FT                   16057195..>16057311))
FT                   /locus_tag="mCG_61794"
FT                   /product="mCG61794, transcript variant mCT193438"
FT                   /note="gene_id=mCG61794.2 transcript_id=mCT193438.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(15928918..15929104,15930292..15930466,
FT                   15931736..15931778,15933826..15933922,15935754..15935821,
FT                   15941899..15942031,15942709..15942819,15948508..15948599,
FT                   15976365..15976447,15977313..15977401,15989691..15989892,
FT                   16057195..>16057309))
FT                   /codon_start=1
FT                   /locus_tag="mCG_61794"
FT                   /product="mCG61794, isoform CRA_b"
FT                   /note="gene_id=mCG61794.2 transcript_id=mCT193438.0
FT                   protein_id=mCP114438.0 isoform=CRA_b"
FT                   /protein_id="EDL36821.1"
FT                   /translation="PFLLCQVMAASEVQGLPVDPREAGVRGVRGGIGHTDHEDSKDCIL
FT                   EPLSLPESPGGTTALEGSPSVPCIFCEEHFPMAEQDKLLKHMIIEHKIVIADVKLVADF
FT                   RRYILYWRKRFTEQPITDFCSVIRINSTAPFEEQDNYYLLCDALPEDRILREELQKHKL
FT                   KEVLDQQQRERNDTSFHGVCMFCSEEFRGNRSVLLNHMAREHAFNIGLPDNIVNCAEFL
FT                   CTLQKKLDNLQCLYCEKTFRDKNTLKDHMRKKQHRRINPKNREYDRFYVINYLELGKSW
FT                   EEVQSEDDRELLDLQEDDWSDWQEYPVSAVCLFCEKQEETIDKLYVHMKDTHEFDLLRI
FT                   KSELGLNFYQQVKLVNFIRRQVHQCKCYSCHVKFKSKADLRTHMEDTKHTSLLPDRKTW
FT                   DQLEYYFPTYENDTLLCTLSDSESDLTAQEQTENVPVISEDTSRLCALKQSSVLNQLLL
FT                   QGCLEN"
FT   CDS             complement(join(15928918..15929104,15930292..15930466,
FT                   15931736..15931778,15933826..15933922,15935754..15935821,
FT                   15941899..15942031,15942709..15942819,15948508..15948599,
FT                   15976365..15976447,15977313..15977401,15989691..15989892,
FT                   16022113..16022490,16057195..>16057303))
FT                   /codon_start=1
FT                   /locus_tag="mCG_61794"
FT                   /product="mCG61794, isoform CRA_c"
FT                   /note="gene_id=mCG61794.2 transcript_id=mCT193439.0
FT                   protein_id=mCP114439.0 isoform=CRA_c"
FT                   /protein_id="EDL36822.1"
FT                   /translation="LLCQVMAASEVQGLPVDPREAGVRGVRGGIGHTDHEGHLGSFQLL
FT                   ATINKAAMNIVEHVSFLPVGTSSGYIAASSGITMSNFLRNRQTDFQSGCTSLQSHQQWR
FT                   SVPLSPHPHQHLLSPEFLILAILTGVRWNLRIALICISLMIKDAEHFFRCFSAIWYSSD
FT                   SKDCILEPLSLPESPGGTTALEGSPSVPCIFCEEHFPMAEQDKLLKHMIIEHKIVIADV
FT                   KLVADFRRYILYWRKRFTEQPITDFCSVIRINSTAPFEEQDNYYLLCDALPEDRILREE
FT                   LQKHKLKEVLDQQQRERNDTSFHGVCMFCSEEFRGNRSVLLNHMAREHAFNIGLPDNIV
FT                   NCAEFLCTLQKKLDNLQCLYCEKTFRDKNTLKDHMRKKQHRRINPKNREYDRFYVINYL
FT                   ELGKSWEEVQSEDDRELLDLQEDDWSDWQEYPVSAVCLFCEKQEETIDKLYVHMKDTHE
FT                   FDLLRIKSELGLNFYQQVKLVNFIRRQVHQCKCYSCHVKFKSKADLRTHMEDTKHTSLL
FT                   PDRKTWDQLEYYFPTYENDTLLCTLSDSESDLTAQEQTENVPVISEDTSRLCALKQSSV
FT                   LNQLLLQGCLEN"
FT   mRNA            complement(join(<15933834..15933922,15935754..15935821,
FT                   15941899..15942031,15942709..15942819,15948508..15948599,
FT                   15976365..15976447,15977313..15977401,16057195..>16057286))
FT                   /locus_tag="mCG_61794"
FT                   /product="mCG61794, transcript variant mCT193437"
FT                   /note="gene_id=mCG61794.2 transcript_id=mCT193437.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(<15933834..15933922,15935754..15935821,
FT                   15941899..15942031,15942709..15942819,15948508..15948599,
FT                   15976365..15976447,15977313..15977401,16057195..>16057196))
FT                   /codon_start=1
FT                   /locus_tag="mCG_61794"
FT                   /product="mCG61794, isoform CRA_a"
FT                   /note="gene_id=mCG61794.2 transcript_id=mCT193437.0
FT                   protein_id=mCP114437.0 isoform=CRA_a"
FT                   /protein_id="EDL36820.1"
FT                   /translation="RYILYWRKRFTEQPITDFCSVIRINSTAPFEEQDNYYLLCDALPE
FT                   DRILREELQKHKLKEVLDQQQRERNDTSFHGVCMFCSEEFRGNRSVLLNHMAREHAFNI
FT                   GLPDNIVNCAEFLCTLQKKLDNLQCLYCEKTFRDKNTLKDHMRKKQHRRINPKNREYDR
FT                   FYVINYLELGKSWEEVQSEDDRELLDLQEDDWSDWQEYPVSAVCLFCEKQEETIDKLYV
FT                   "
FT   gene            16248910..>16457797
FT                   /gene="Dock4"
FT                   /locus_tag="mCG_125566"
FT                   /note="gene_id=mCG125566.0"
FT   mRNA            join(16248910..16249058,16253189..16253273,
FT                   16262007..16262158,16281075..16281156,16281677..16281737,
FT                   16285412..16285544,16289373..16289461,16305636..16305761,
FT                   16315583..16315707,16317053..16317215,16323516..16323622,
FT                   16338368..16338529,16342765..16342848,16343009..16343109,
FT                   16344546..16344627,16345897..16346067,16350086..16350278,
FT                   16358376..16358503,16360697..16360831,16378717..16378811,
FT                   16389650..16389725,16391583..16391683,16392106..16392164,
FT                   16400688..16400836,16402536..16402621,16407228..16407323,
FT                   16408097..16408157,16412121..16412235,16420025..16420173,
FT                   16423620..16423706,16425395..16425499,16430770..16430928,
FT                   16433765..16433851,16441932..16442108,16442764..16442847,
FT                   16445366..16445485,16446322..16446387,16449782..16449854,
FT                   16457393..>16457797)
FT                   /gene="Dock4"
FT                   /locus_tag="mCG_125566"
FT                   /product="dedicator of cytokinesis 4"
FT                   /note="gene_id=mCG125566.0 transcript_id=mCT126827.0
FT                   created on 09-SEP-2002"
FT   CDS             join(16248949..16249058,16253189..16253273,
FT                   16262007..16262158,16281075..16281156,16281677..16281737,
FT                   16285412..16285544,16289373..16289461,16305636..16305761,
FT                   16315583..16315707,16317053..16317215,16323516..16323622,
FT                   16338368..16338529,16342765..16342848,16343009..16343109,
FT                   16344546..16344627,16345897..16346067,16350086..16350278,
FT                   16358376..16358503,16360697..16360831,16378717..16378811,
FT                   16389650..16389725,16391583..16391683,16392106..16392164,
FT                   16400688..16400836,16402536..16402621,16407228..16407323,
FT                   16408097..16408157,16412121..16412235,16420025..16420173,
FT                   16423620..16423706,16425395..16425499,16430770..16430928,
FT                   16433765..16433851,16441932..16442108,16442764..16442847,
FT                   16445366..16445485,16446322..16446387,16449782..16449854,
FT                   16457393..>16457797)
FT                   /codon_start=1
FT                   /gene="Dock4"
FT                   /locus_tag="mCG_125566"
FT                   /product="dedicator of cytokinesis 4"
FT                   /note="gene_id=mCG125566.0 transcript_id=mCT126827.0
FT                   protein_id=mCP78444.1"
FT                   /protein_id="EDL36819.1"
FT                   /translation="MNEILDLRRQVLVGHLTHDRMKDVKRHITARLDWGNEQLGLDLVP
FT                   RKEYAMVDPEDISITELYRLMEHRHRKKDTPVQASSHHLFVQMKSLMCSNLGEELEVIF
FT                   SLFDSKENRPISERFFLRLNRNGLPKAPDKPERHCSLFVDLGSSELRKDIYITVHIIRI
FT                   GRMGAGEKKNACSVQYRRPFGCAVLSIADLLTGETKDDLVLKVYMCNTESEWYQIHENI
FT                   IKKLNARYNLTGSNAGLAVSLQLLHGDIEQIRREYSSVFSHGVSITRKLGFSDIIMPGE
FT                   MRNDLYITVERGEFEKGGKSVARNVEVTMFIVDSNGQPLKDFISFGSGEPPASEYHSFV
FT                   LYHNNSPRWSELLKLPIPVDKFRGSHIRFEFRHCSTKEKGEKKLFGFSFVPLMQEDGRT
FT                   LPDGTHELIVHKCEENTNLQDTTRYLKLPFSKVIFLGNNNQTMKATKESFWITSFLCST
FT                   KLTQNGNFLQDTLDTLFGILDENSQKYGSKVFDSLVHIINLLQDSKFHHFKPVMDTYIE
FT                   SHFAGALAYRDLIKVLKWYVDRITEAERQEHIQEVLKAQEYIFKYIVQSRRLFSLATGG
FT                   QNEEEFRCCIQELLMSVRFFLSQESKGTGALSQSQAVFLSSFPAVYSELLKLFDVREVA
FT                   NLVQDTLGSLPTIMHVDDSLQAIKLQCIGKTVESQLYTNPDSRYILLPVVLHHLHIHLQ
FT                   EQKDLIMCARILSNVFCLIKKNSSEKSVLEEIDVIVASLLDILLRTILEITSRPQASSS
FT                   AMRLQFQDVTDFLLQIFTVFRILIRPEMFPKDWTVMRLVANNVIITTVLYLSDALRKNF
FT                   LNENFDYKIWDSYFYLAVIFINQLCLQLEMFTPSKKKKVLEKYGDMRVTMGCEIFSMWQ
FT                   NLGEHKLHFIPALIGPFLEVTLIPQPDLRNVMIPIFHDMMDWEQRRSGNFKQVEAKLID
FT                   KLDSLMSEGKGDETYRELFNSILLKKIERETWRESGVSLIATVTRLMERLLDYRDCMKI
FT                   GEVDGKKIGCTVSLLNFYKTELNKEEMYIRYIHKLYDLHLKAQNFTGQSAGDSEAAYTL
FT                   LLYDELLEWSDRPLREFLTYPMQTEWQRKEHLHLTIIQNFDRGKCWENGIILCRKIAEQ
FT                   YESYYDYRNLSKMRMMEASLYDKIMDQQRLEPEFFRVGFYGKKFPFFLRIYAVTPIPES
FT                   QEVLQREGVPDNIKSFYKVNHIWKFRYDRPFHKGAKDKENEFKSLWVERTSLYLVQSLP
FT                   GISRWFEVEKREVVEMSPLENAIEVLENKNQQLKTLISQCQTRQMQNINPLTMCLNGVI
FT                   DAAVNGGVSRYQEAFFVKDYILSHPEDGEKIARLRELMLEQAQILEFGLAVHEKFVPQD
FT                   MRPLHKKLVDQFFVMKSSFGIQASAEVSNITGQSESSDEVFNMQRMLFNHIGDGALPRS
FT                   DPNLSAPEKVEYNSPGLSSNSPVLSGSYSSGISSLSRCSTSETSGFENQANEQSVPVPV
FT                   PVPVPVPVPSFSGSEEPVRKESKTPPPYSVYERTLRRPVPLPHSLSIPVTSEPPALPPK
FT                   PLAARSSHLENGTRRTEPGPRPRPLP"
FT   gene            complement(16494939..>16496047)
FT                   /locus_tag="mCG_14809"
FT                   /note="gene_id=mCG14809.1"
FT   mRNA            complement(16494939..>16496047)
FT                   /locus_tag="mCG_14809"
FT                   /product="mCG14809"
FT                   /note="gene_id=mCG14809.1 transcript_id=mCT20323.1 created
FT                   on 06-SEP-2002"
FT   CDS             complement(16495139..>16495810)
FT                   /codon_start=1
FT                   /locus_tag="mCG_14809"
FT                   /product="mCG14809"
FT                   /note="gene_id=mCG14809.1 transcript_id=mCT20323.1
FT                   protein_id=mCP22792.1"
FT                   /protein_id="EDL36818.1"
FT                   /translation="GNFESITNSANHFFKKRSELISKIPNFWVTTFVKHPQVSALLGEE
FT                   DEEALHYLTRVEVTEFEDIKSGNRIDFYFDENPYFENKVLSKKFHLNESGDPSSKSTEI
FT                   KWKSGKDLTKRSSQMQNKASRKRQHEEPESFFTWFTDRPDAGADELGEVIKDDIWPNPL
FT                   QYYLVPDMDDEEGEAEDDDDDDEEEEELEDIDEEGDEDEGEEDEDEDEGEEGEEDEGED
FT                   D"
FT   gene            16635992..17550181
FT                   /gene="Immp2l"
FT                   /locus_tag="mCG_142422"
FT                   /note="gene_id=mCG142422.0"
FT   mRNA            join(16635992..16636052,16680122..16680258,
FT                   16722658..16722761,17228606..17228671,17303367..17303469,
FT                   17549920..17550181)
FT                   /gene="Immp2l"
FT                   /locus_tag="mCG_142422"
FT                   /product="IMP2 inner mitochondrial membrane peptidase-like
FT                   (S. cerevisiae)"
FT                   /note="gene_id=mCG142422.0 transcript_id=mCT180460.0
FT                   created on 13-FEB-2003"
FT   CDS             join(16680124..16680258,16722658..16722761,
FT                   17228606..17228671,17303367..17303469,17549920..17550039)
FT                   /codon_start=1
FT                   /gene="Immp2l"
FT                   /locus_tag="mCG_142422"
FT                   /product="IMP2 inner mitochondrial membrane peptidase-like
FT                   (S. cerevisiae)"
FT                   /note="gene_id=mCG142422.0 transcript_id=mCT180460.0
FT                   protein_id=mCP103382.0"
FT                   /protein_id="EDL36816.1"
FT                   /translation="MAQSQSWARRCFKAFCKGFFVAVPVAVTFLDRVACVARVEGSSMQ
FT                   PSLNPGGSQSSDVVLLNHWKVRNFEVQRGDIVSLVSPKNPEQKIIKRVIALEGDIVRTI
FT                   GHKNRLVKVPRGHMWVEGDHHGHSFDSNSFGPVSLGLLHAHATHILWPPERWQRLESVL
FT                   PPERCPLQTGEK"
FT   gene            complement(17058067..17092401)
FT                   /gene="Lrrn3"
FT                   /locus_tag="mCG_148259"
FT                   /note="gene_id=mCG148259.1"
FT   mRNA            complement(join(17058067..17061069,17092004..17092401))
FT                   /gene="Lrrn3"
FT                   /locus_tag="mCG_148259"
FT                   /product="leucine rich repeat protein 3, neuronal"
FT                   /note="gene_id=mCG148259.1 transcript_id=mCT188522.1
FT                   created on 28-SEP-2004"
FT   CDS             complement(17058591..17060714)
FT                   /codon_start=1
FT                   /gene="Lrrn3"
FT                   /locus_tag="mCG_148259"
FT                   /product="leucine rich repeat protein 3, neuronal"
FT                   /note="gene_id=mCG148259.1 transcript_id=mCT188522.1
FT                   protein_id=mCP108094.1"
FT                   /protein_id="EDL36817.1"
FT                   /translation="MKDTPLQVHVLLGLAITTLVQAIDKKVDCPQLCTCEIRPWFTPRS
FT                   IYMEASTVDCNDLGLLNFPARLPADTQILLLQTNNIARIEHSTDFPVNLTGLDLSQNNL
FT                   SSVTNINVQKMSQLLSVYLEENKLTELPEKCLYGLSNLQELYVNHNLLSTISPGAFIGL
FT                   HNLLRLHLNSNRLQMINSQWFDALPNLEILMLGDNPIIRIKDMNFQPLVKLRSLVIAGI
FT                   NLTEIPDDALAGLENLESISFYDNRLSKVPQVALQKAVNLKFLDLNKNPINRIRRGDFS
FT                   NMLHLKELGINNMPELVSIDSLAVDNLPDLRKIEATNNPRLSYIHPNAFFRLPKLESLM
FT                   LNTNALSALYHGTIESLPNLKEISIHSNPIRCDCVIRWINMNKTNIRFMEPDSLFCVDP
FT                   PEFQGQNVRQVHFRDMMEICLPLIAPESFPSDLDVEADSYVSLHCRATAEPQPEIYWIT
FT                   PSGKKLLPNTMREKFYVHSEGTLEIRGITPKEGGLYTCIATNLVGADLKSIMIKVGGSV
FT                   PQDNNGSLNIKIRDIRANSVLVSWKASSKILKSSVKWTAFVKTEDSHAAQSARIPSDVK
FT                   VYNLTHLKPSTEYKICIDIPTVYQKSRKQCVNVTTKSLEHDGKEYGKNHTVFVACVGGL
FT                   LGIVGVMCLFSCVSQEGSSEGEHSYAVNHCHKPALAFSELYPPLINLWESSKEKRATLE
FT                   VKATAIGVPTNMS"
FT   gene            complement(19368258..19401931)
FT                   /locus_tag="mCG_1051103"
FT                   /note="gene_id=mCG1051103.0"
FT   mRNA            complement(join(19368258..19370387,19398701..19398801,
FT                   19401783..19401931))
FT                   /locus_tag="mCG_1051103"
FT                   /product="mCG1051103"
FT                   /note="gene_id=mCG1051103.0 transcript_id=mCT194892.0
FT                   created on 27-JAN-2005"
FT   CDS             complement(19369397..19369666)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1051103"
FT                   /product="mCG1051103"
FT                   /note="gene_id=mCG1051103.0 transcript_id=mCT194892.0
FT                   protein_id=mCP115921.0"
FT                   /protein_id="EDL36815.1"
FT                   /translation="MHRMTSWHFDDCREETPSSMVVIFAHLPTYLWFPQFSILFVFVLF
FT                   SFILHSYFGNLRVCILTILKPLHTPFRSNPFHYPSNSVFFPFYF"
FT   gene            complement(<19757601..>19758029)
FT                   /locus_tag="mCG_7334"
FT                   /note="gene_id=mCG7334.1"
FT   mRNA            complement(<19757601..>19758029)
FT                   /locus_tag="mCG_7334"
FT                   /product="mCG7334"
FT                   /note="gene_id=mCG7334.1 transcript_id=mCT6281.1 created on
FT                   25-SEP-2002"
FT   CDS             complement(19757601..19758029)
FT                   /codon_start=1
FT                   /locus_tag="mCG_7334"
FT                   /product="mCG7334"
FT                   /note="gene_id=mCG7334.1 transcript_id=mCT6281.1
FT                   protein_id=mCP22012.1"
FT                   /protein_id="EDL36814.1"
FT                   /translation="MPVQKQSRAGQRTRFKAFVAIGDYNGHVGLGVKCSKEVATDIRGS
FT                   IILAKLSTVPVRRGGYWGNKIGKSHTVPCKVTGRCGSVLVRLIPAPRGTGIVSAPVPKK
FT                   LLMMAGTLQPEAALLPWATLPKPPLMPPLMPPPRPTAI"
FT   gene            complement(19761096..>19765526)
FT                   /gene="Dnajb9"
FT                   /locus_tag="mCG_7339"
FT                   /note="gene_id=mCG7339.2"
FT   mRNA            complement(join(19761096..19762605,19763287..19763513,
FT                   19765140..>19765526))
FT                   /gene="Dnajb9"
FT                   /locus_tag="mCG_7339"
FT                   /product="DnaJ (Hsp40) homolog, subfamily B, member 9"
FT                   /note="gene_id=mCG7339.2 transcript_id=mCT6278.2 created on
FT                   30-AUG-2002"
FT   CDS             complement(join(19762154..19762605,19763287..19763513,
FT                   19765140..>19765240))
FT                   /codon_start=1
FT                   /gene="Dnajb9"
FT                   /locus_tag="mCG_7339"
FT                   /product="DnaJ (Hsp40) homolog, subfamily B, member 9"
FT                   /note="gene_id=mCG7339.2 transcript_id=mCT6278.2
FT                   protein_id=mCP22009.1"
FT                   /protein_id="EDL36813.1"
FT                   /translation="ATRRSEARSEPVRPGSGNRSRAAALWRSCVGAHRLLEMATPQSVF
FT                   VFAICILMITELILASKSYYDILGVPKSASERQIKKAFHKLAMKYHPDKNKSPDAEAKF
FT                   REIAEAYETLSDANSRKEYDTIGHSAFTNGKGQRGNGSPFEQSFNFNFDDLFKDFNFFG
FT                   QNQNTRSKKHFENHFHTRQDGSSRQRHHFQEFSFGGGLFDDMFEDMEKMFSFSGFDTTN
FT                   RHTVQTENRFHGSSKHCRTVTQRRGNMVTTYTDCSGQ"
FT   gene            <19812032..19851922
FT                   /gene="Pnpla8"
FT                   /locus_tag="mCG_7336"
FT                   /note="gene_id=mCG7336.1"
FT   mRNA            join(<19812032..19812147,19825229..19826359,
FT                   19826444..19826593,19830813..19830964,19833201..19833295,
FT                   19835500..19835671,19838836..19838893,19844546..19844740,
FT                   19847554..19847749,19850960..19851922)
FT                   /gene="Pnpla8"
FT                   /locus_tag="mCG_7336"
FT                   /product="patatin-like phospholipase domain containing 8,
FT                   transcript variant mCT6283"
FT                   /note="gene_id=mCG7336.1 transcript_id=mCT6283.1 created on
FT                   30-AUG-2002"
FT   mRNA            join(<19812032..19812147,19825229..19826355,
FT                   19826444..19826593,19830813..19830964,19833201..19833295,
FT                   19835500..19835671,19838836..19838893,19844546..19844740,
FT                   19847554..19847749,19850960..19851922)
FT                   /gene="Pnpla8"
FT                   /locus_tag="mCG_7336"
FT                   /product="patatin-like phospholipase domain containing 8,
FT                   transcript variant mCT193464"
FT                   /note="gene_id=mCG7336.1 transcript_id=mCT193464.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<19825315..19826355,19826444..19826593,
FT                   19830813..19830964,19833201..19833295,19835500..19835671,
FT                   19838836..19838893,19844546..19844740,19847554..19847749,
FT                   19850960..19851234)
FT                   /codon_start=1
FT                   /gene="Pnpla8"
FT                   /locus_tag="mCG_7336"
FT                   /product="patatin-like phospholipase domain containing 8,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG7336.1 transcript_id=mCT193464.0
FT                   protein_id=mCP114440.0 isoform=CRA_a"
FT                   /protein_id="EDL36811.1"
FT                   /translation="VMSINLTLDIYIYFLNNARSLCGKQRSKQLHFVCSKQYWRMNHVN
FT                   VHREFHTSKKSCKWNRSEAHCSKHWHSPSNHGLHFGIVRLSTSAPKGLTKVSIHMSRIK
FT                   STLNSVSKAIFGSQNEMVTRLAQFKPSSRILRKVSDKGWLKQKNVKQAVESLKNYSDKS
FT                   AGKNSLAEQKSYFADKEEDSGKHSLFHYTYGITTRFGESFSVLANHINSYFKSKGKMSQ
FT                   TKEDKQLQDKPDLEERKSSSPGPDTVADRPDSESPLEVKDKLSSPTQMPEAHPVSAKQS
FT                   IANFLSRPTEGVQALVGGYIGGLVPKLKSDPKSPPEEQEVSAKTEQAVNKDKKAEEKKR
FT                   VLLQQEKIIARVSIDNRTRALVQALRRTADPKLCITRVEELTFHLLEFPEGKGVAIKEK
FT                   IIPYLLRLRQVKDETLQAAVREILALIGYVDPVKGRGIRILTIDGGGTRGVVALQTLRK
FT                   LVELTQKPIHQLFDYICGVSTGAILAFMLGLFHMPLDECEELYRKLGSDVFTQNVIVGT
FT                   VKMSWSHAFYDSNTWEKILKDRIGSALMIETARNPACPKVAAISTIVNRGQTPKAFVFR
FT                   NYGHFPGTNSHYLGGCQYKMWQAIRASSAAPGYFAEYALGSDLHQDGGLLLNNPSALAL
FT                   HECKCIWPDTPLECIVSLGTGRYESDVRNTSTYTSLKTKLSNVISSATDTEEVHIMLDG
FT                   LLPSDTYFRFNPVICENIPLDESRDEKLDQLQLEGMKYIERNDQKMKKVAKILSQEKTT
FT                   LQKINDWIKLKSDMYEGLPFFSKL"
FT   CDS             join(<19826240..19826359,19826444..19826593,
FT                   19830813..19830964,19833201..19833295,19835500..19835671,
FT                   19838836..19838893,19844546..19844740,19847554..19847749,
FT                   19850960..19851234)
FT                   /codon_start=1
FT                   /gene="Pnpla8"
FT                   /locus_tag="mCG_7336"
FT                   /product="patatin-like phospholipase domain containing 8,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG7336.1 transcript_id=mCT6283.1
FT                   protein_id=mCP22014.1 isoform=CRA_b"
FT                   /protein_id="EDL36812.1"
FT                   /translation="SLIPRVRPKNRKCLLKQSRLLTKTRRQRRKSVCYFSKKRQIIARV
FT                   SIDNRTRALVQALRRTADPKLCITRVEELTFHLLEFPEGKGVAIKEKIIPYLLRLRQVK
FT                   DETLQAAVREILALIGYVDPVKGRGIRILTIDGGGTRGVVALQTLRKLVELTQKPIHQL
FT                   FDYICGVSTGAILAFMLGLFHMPLDECEELYRKLGSDVFTQNVIVGTVKMSWSHAFYDS
FT                   NTWEKILKDRIGSALMIETARNPACPKVAAISTIVNRGQTPKAFVFRNYGHFPGTNSHY
FT                   LGGCQYKMWQAIRASSAAPGYFAEYALGSDLHQDGGLLLNNPSALALHECKCIWPDTPL
FT                   ECIVSLGTGRYESDVRNTSTYTSLKTKLSNVISSATDTEEVHIMLDGLLPSDTYFRFNP
FT                   VICENIPLDESRDEKLDQLQLEGMKYIERNDQKMKKVAKILSQEKTTLQKINDWIKLKS
FT                   DMYEGLPFFSKL"
FT   gene            19868632..19932949
FT                   /locus_tag="mCG_148253"
FT                   /note="gene_id=mCG148253.0"
FT   mRNA            join(19868632..19868843,19930552..19932949)
FT                   /locus_tag="mCG_148253"
FT                   /product="mCG148253"
FT                   /note="gene_id=mCG148253.0 transcript_id=mCT188516.0
FT                   created on 13-JAN-2004"
FT   CDS             19931224..19931487
FT                   /codon_start=1
FT                   /locus_tag="mCG_148253"
FT                   /product="mCG148253"
FT                   /note="gene_id=mCG148253.0 transcript_id=mCT188516.0
FT                   protein_id=mCP108089.0"
FT                   /protein_id="EDL36810.1"
FT                   /translation="MPAVPGLPSSHGLVYVKAYYKLKYLYIIRKSFSIISKYSFPPNIL
FT                   SNLSILFFQSLSINLAMVSINNDSVHSTNISQMLNIDICSKY"
FT   gene            19988860..20149725
FT                   /locus_tag="mCG_125252"
FT                   /note="gene_id=mCG125252.1"
FT   mRNA            join(19988860..19988916,20006421..20006498,
FT                   20073195..20073396,20077989..20078094,20080168..20080364,
FT                   20094288..20094458,20094942..20094998,20096795..20096906,
FT                   20099437..20099621,20100868..20100999,20109221..20109364,
FT                   20111986..20112097,20113523..20113689,20113786..20113933,
FT                   20115850..20115974,20118106..20118234,20119772..20119969,
FT                   20120068..20120138,20121077..20121302,20121764..20121879,
FT                   20123382..20123586,20125438..20125560,20126166..20126342,
FT                   20133229..20133354,20134397..20134549,20139670..20139801,
FT                   20140498..20140621,20147912..20149725)
FT                   /locus_tag="mCG_125252"
FT                   /product="mCG125252"
FT                   /note="gene_id=mCG125252.1 transcript_id=mCT126512.1
FT                   created on 06-SEP-2002"
FT   CDS             join(20073306..20073396,20077989..20078094,
FT                   20080168..20080364,20094288..20094458,20094942..20094998,
FT                   20096795..20096906,20099437..20099621,20100868..20100999,
FT                   20109221..20109364,20111986..20112097,20113523..20113689,
FT                   20113786..20113933,20115850..20115974,20118106..20118234,
FT                   20119772..20119969,20120068..20120138,20121077..20121302,
FT                   20121764..20121879,20123382..20123586,20125438..20125560,
FT                   20126166..20126342,20133229..20133354,20134397..20134549,
FT                   20139670..20139801,20140498..20140621,20147912..20148149)
FT                   /codon_start=1
FT                   /locus_tag="mCG_125252"
FT                   /product="mCG125252"
FT                   /note="gene_id=mCG125252.1 transcript_id=mCT126512.1
FT                   protein_id=mCP78521.0"
FT                   /protein_id="EDL36809.1"
FT                   /translation="MPKKKHLSAGGVPLILFLCQMISALDVPLDLVQPPTITQQSPKDY
FT                   IIDPRENIVIQCEAKGKPPPSFSWTRNGTHFDIDKDPLVTMKPGSGTLVINIMSEGKAE
FT                   TYEGVYQCTARNERGAAVSNNIVVRPSTFQRLPQSERVSQGLNGDLYFSNVLPEDTRED
FT                   YICYARFNHTQTIQQKQPISLKVISVDELNDTIAANLSDTEFYGAKSSKERPPTFLTPE
FT                   GNESHKEELRGNVLSLECIAEGLPTPIIYWIKEDGMLPANRTFYRNFKKTLQITHVSEA
FT                   DSGNYQCIAKNALGAVHHTISVTVKAAPYWIVAPQNLVLSPGENGTLICRANGNPKPRI
FT                   SWLTNGVPIEIALDDPSRKIDGDTIIFSNVQESSSAVYQCNASNKYGYLLANAFVNVLA
FT                   EPPRILTSANTLYQVIANRPALLDCAFFGSPMPTIEWFKGTKGSALHEDIYVLHDNGTL
FT                   EIPVAQKDSTGTYTCVARNKLGMAKNEVHLEIKDPTRIIKQPEYAVVQRGSKVSFECRV
FT                   KHDHTLIPTIMWLKDNGELPNDERFSTDKDHLVVSDVKDDDGGTYTCTANTTLDSASAS
FT                   AVLRVVDVPNPPFDLELTNQLDKSVQLTWTPGDDNNSPITSMWWFGFVAEFIIEYEDAM
FT                   HDAGLWRHQAEVSGTQTTAQLKLSPYVNYSFRVMAENSIGRSMPSEASEQYLTKAAEPD
FT                   QNPMAVEGLGTEPDNLVITWKPLNGFQSNGPGLQYKVSWRQKDGDDEWTSVVVANVSKY
FT                   IVSGTPTFVPYLIKVQALNDVGFAPEPAAVMGHSGEDLPMVAPGNVRVSVVNSTLAEVH
FT                   WDPVPPKSVRGHLQGYRIYYWKTQSSSKRNRRHIEKKILTFQGTKTHGMLPGLQPYSHY
FT                   ALNVRVVNGKGEGPASTDRGFHTPEGVPSAPSSLKIVNPTLDSLTLEWDPPSHPNGILT
FT                   EYILQYQPINSTHELGPLVDLKIPANKTRWTLKNLNFSTRYKFYFYAQTSVGPGSQITE
FT                   EAITTVDEVRAVNPRISNLTATAAETYANITWEYEGPGHVTFYVEYGVAGSKEEWRKEI
FT                   VNGSRSFFGLKGLMPGTAYKVRVGAEGDSGFVSSEDVFETGPAMASRQVDIATQGWFIG
FT                   LMCAVALLILILLIVCFIRRNKGGKYPGSSGLMDNTTTSNLSVKEKEDAHADPEIQPMK
FT                   EDDGTFGEYSDAEDHKPLKKGSRTPSDRTVKKEDSDDSLVDYGEGVNGQFNEDGSFIGQ
FT                   YSGKKEKEPAEGNESSEAPSPVNAMNSFV"
FT   gene            complement(20169164..>20173916)
FT                   /locus_tag="mCG_125251"
FT                   /note="gene_id=mCG125251.0"
FT   mRNA            complement(join(20169164..20171807,20171920..20172200,
FT                   20172267..20173341,20173788..>20173916))
FT                   /locus_tag="mCG_125251"
FT                   /product="mCG125251"
FT                   /note="gene_id=mCG125251.0 transcript_id=mCT126511.0
FT                   created on 06-SEP-2002"
FT   CDS             complement(join(20170440..20171807,20171920..20172200,
FT                   20172267..20173341,20173788..20173916))
FT                   /codon_start=1
FT                   /locus_tag="mCG_125251"
FT                   /product="mCG125251"
FT                   /note="gene_id=mCG125251.0 transcript_id=mCT126511.0
FT                   protein_id=mCP78510.0"
FT                   /protein_id="EDL36808.1"
FT                   /translation="MEDKQETCPKGDSDFVSDKVNFKTEEEDDDQTPNTVWNKWTLKPA
FT                   DVGDLSTVLSPVRLVQKMAPKIPSPDQIMEESVTVVSSEELSSDVSVTEKYSREEALAG
FT                   SSPNLSMLHYDDASETMADRNLSLPKSTSGSRRRSAVWKHFYLSPLDSSNAVCVHCMNE
FT                   FSRGKNGKDLGTSCLIRHMWRAHRSIVLQENGGNTGIPPLYPMPPTLLPALLPPEGDLN
FT                   SASLSPGKQVKESPSASSSPERLPEDLSSHTNPGDVSREDVSMLSSSDDLGEASVVSSP
FT                   EKQPADTVNPRFESGTVFQQNKKVMRRLKSEVWHHFSLAPMDSLKAVCRYCSCVISRGK
FT                   KGDVGTSCLMRHLYRRHPQVVENQKDFLGASLANSPYATLASAESSSKLTDLPAVVRKN
FT                   HQDSTKVVCLHCGRTISRGKKPTNLGTSCLLRHLQRFHGHVLKNDVSEATLPRSPGIRR
FT                   PLGIELSGPSSFRDSTEKFYDSHLVAKKITSLIAEMIIIMSHLKEAESGVVHFTSGIWM
FT                   SSQTREYLTLTAHWVTFASDVRPHCEDHHCWALLDVSQIDCDYSGNSIQKQLECWWEAW
FT                   VTSIGLQIDITVTDNPSIAKMLSEGEHSSVQCFSHTVNLIVSEAIKSQRMVQNLLSIAR
FT                   KLCERVHRSPRAREKVAELQKEYELPQHQLIQDVLSKWSTSFHMLERLIEQKRAVNEVS
FT                   IECNFRELISCDQWEVMQSVCHVLRPIDAASREMSAHMSTLSQVIPMIHILSRKVEMLF
FT                   GETMGIDTMLKSLKEAMASRLSATLHDPRYIFATLLDPRYKASLFTEEEAEQYRQDLIR
FT                   ELEILNSTSEDTATSNGCDSGSPLKDTGTEESLWSLAPIKRDQREKLPEDMVLAYLEEE
FT                   VLEHSCDPLTYWNLKRSSWPGLSTLAVRFLGCPPSTVPSEKLFSTPMDAGSFGQPRLMM
FT                   EHFEKLIFLKVNLPLICFQY"
FT   gene            complement(20368317..20417497)
FT                   /locus_tag="mCG_4824"
FT                   /note="gene_id=mCG4824.1"
FT   mRNA            complement(join(20368317..20371670,20377986..20378143,
FT                   20416380..20416545,20417366..20417497))
FT                   /locus_tag="mCG_4824"
FT                   /product="mCG4824"
FT                   /note="gene_id=mCG4824.1 transcript_id=mCT4392.1 created on
FT                   06-SEP-2002"
FT   CDS             complement(join(20371647..20371670,20377986..20378143,
FT                   20416380..20416545,20417366..20417410))
FT                   /codon_start=1
FT                   /locus_tag="mCG_4824"
FT                   /product="mCG4824"
FT                   /note="gene_id=mCG4824.1 transcript_id=mCT4392.1
FT                   protein_id=mCP22015.2"
FT                   /protein_id="EDL36807.1"
FT                   /translation="MLEQLRQVNGIDPNRDSAEFDLLFENAFDQWVASTASEKCTFFQI
FT                   LHHTCQRYLTDRKPEFINCQSKIMGGNSILHSAADSVTSAVQKASQALNERGERLGRAE
FT                   EKTEDMKNSAQQFAETAHKLAMKHKC"
FT   gene            complement(20476290..>20479288)
FT                   /locus_tag="mCG_144958"
FT                   /note="gene_id=mCG144958.0"
FT   mRNA            complement(join(20476290..20478450,20478455..20478565,
FT                   20478567..>20479288))
FT                   /locus_tag="mCG_144958"
FT                   /product="mCG144958"
FT                   /note="gene_id=mCG144958.0 transcript_id=mCT184382.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(20478373..20478450,20478455..20478565,
FT                   20478567..>20478620))
FT                   /codon_start=1
FT                   /locus_tag="mCG_144958"
FT                   /product="mCG144958"
FT                   /note="gene_id=mCG144958.0 transcript_id=mCT184382.0
FT                   protein_id=mCP105138.0"
FT                   /protein_id="EDL36806.1"
FT                   /translation="IFFLLLVSLSCASHRTGTFSSLLFSSLLFSSLLFSSLLFSSLLFS
FT                   SLLSLSLSLFFVCLFVCLFETGFLCVPLAVLELTL"
FT   gene            complement(20526845..20589488)
FT                   /locus_tag="mCG_7109"
FT                   /note="gene_id=mCG7109.1"
FT   mRNA            complement(join(20526845..20527432,20528113..20528213,
FT                   20529877..20529945,20533917..20534105,20588973..20589488))
FT                   /locus_tag="mCG_7109"
FT                   /product="mCG7109"
FT                   /note="gene_id=mCG7109.1 transcript_id=mCT6403.1 created on
FT                   06-SEP-2002"
FT   CDS             complement(join(20534024..20534105,20588973..20589286))
FT                   /codon_start=1
FT                   /locus_tag="mCG_7109"
FT                   /product="mCG7109"
FT                   /note="gene_id=mCG7109.1 transcript_id=mCT6403.1
FT                   protein_id=mCP5071.2"
FT                   /protein_id="EDL36805.1"
FT                   /translation="MLTGSGGGRLVLLARTRRQRAGARLQLELWRPELELPGVSPTPPS
FT                   SRTAAGARAGAASRDQPEAEPAQLSLQPRSPRGAAAGEPCLRLGRVPRTRHRPSTSQAA
FT                   RKFPACPPGWLYNECQVCHQQGNFCTS"
FT   gene            20957943..20962461
FT                   /locus_tag="mCG_148277"
FT                   /note="gene_id=mCG148277.0"
FT   mRNA            join(20957943..20958057,20958177..20962461)
FT                   /locus_tag="mCG_148277"
FT                   /product="mCG148277"
FT                   /note="gene_id=mCG148277.0 transcript_id=mCT188540.0
FT                   created on 13-JAN-2004"
FT   CDS             20961188..20961550
FT                   /codon_start=1
FT                   /locus_tag="mCG_148277"
FT                   /product="mCG148277"
FT                   /note="gene_id=mCG148277.0 transcript_id=mCT188540.0
FT                   protein_id=mCP108111.0"
FT                   /protein_id="EDL36804.1"
FT                   /translation="MSAVSGQLFILPSTGAAMGWRAVFRLGAVGSVLLVNGEKEWVELF
FT                   LFHQHLKLLTSCLLFLLHFYPQYCSLLLSFISSFFLSIFRVYLLTFVDCLTIFIVYLIS
FT                   SSLLVLLPVILNSHNT"
FT   gene            <20981143..21061588
FT                   /locus_tag="mCG_145556"
FT                   /note="gene_id=mCG145556.0"
FT   mRNA            join(<20981143..20981374,21003538..21003699,
FT                   21005055..21005177,21007105..21007271,21058871..21061588)
FT                   /locus_tag="mCG_145556"
FT                   /product="mCG145556"
FT                   /note="gene_id=mCG145556.0 transcript_id=mCT184980.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<20981342..20981374,21003538..21003699,
FT                   21005055..21005111)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145556"
FT                   /product="mCG145556"
FT                   /note="gene_id=mCG145556.0 transcript_id=mCT184980.0
FT                   protein_id=mCP105142.0"
FT                   /protein_id="EDL36803.1"
FT                   /translation="GKRLLKTNPGEATEEKGLGFHLGPYRILFHTFMAMPITLFIPRVF
FT                   TVSSTWWAPKQNVVTSLLCMHRSEGYKALQAFTSGFYF"
FT   gene            complement(21990471..21991087)
FT                   /pseudo
FT                   /locus_tag="mCG_20029"
FT                   /note="gene_id=mCG20029.1"
FT   mRNA            complement(join(21990471..21990614,21990653..21991087))
FT                   /pseudo
FT                   /locus_tag="mCG_20029"
FT                   /note="gene_id=mCG20029.1 transcript_id=mCT18235.1 created
FT                   on 06-SEP-2002"
FT   gene            <22179823..22205430
FT                   /locus_tag="mCG_145555"
FT                   /note="gene_id=mCG145555.0"
FT   mRNA            join(<22179823..22179897,22200203..22200382,
FT                   22201788..22205430)
FT                   /locus_tag="mCG_145555"
FT                   /product="mCG145555"
FT                   /note="gene_id=mCG145555.0 transcript_id=mCT184979.0
FT                   created on 05-JUN-2003"
FT   CDS             <22203927..22204220
FT                   /codon_start=1
FT                   /locus_tag="mCG_145555"
FT                   /product="mCG145555"
FT                   /note="gene_id=mCG145555.0 transcript_id=mCT184979.0
FT                   protein_id=mCP105141.0"
FT                   /protein_id="EDL36802.1"
FT                   /translation="VIPPDSTYTKNPALPNAPGLLVHFDLHDSCNFENFWLYQPFGKQN
FT                   HLSCTKVAYCLRNITMLFFITLVCEPKIFILSGEEDFQFINFIFMPSDSATV"
FT   gene            complement(22206233..22331930)
FT                   /locus_tag="mCG_140771"
FT                   /note="gene_id=mCG140771.0"
FT   mRNA            complement(join(22206233..22213422,22225509..22225580,
FT                   22232687..22232853,22330040..22330183,22331770..22331930))
FT                   /locus_tag="mCG_140771"
FT                   /product="mCG140771, transcript variant mCT171375"
FT                   /note="gene_id=mCG140771.0 transcript_id=mCT171375.0
FT                   created on 29-JUL-2002"
FT   CDS             complement(join(22212418..22213422,22225509..22225580,
FT                   22232687..22232853,22330040..22330183,22331770..22331905))
FT                   /codon_start=1
FT                   /locus_tag="mCG_140771"
FT                   /product="mCG140771, isoform CRA_b"
FT                   /note="gene_id=mCG140771.0 transcript_id=mCT171375.0
FT                   protein_id=mCP94294.0 isoform=CRA_b"
FT                   /protein_id="EDL36801.1"
FT                   /translation="MMAAAPIQQNGTHTGVPIDLDPPDSRKRPLEAPPEAGSTKRTNTG
FT                   EDGQYFLKVLIPSYAAGSIIGKGGQTIVQLQKETGATIKLSKSKDFYPGTTERVCLIQG
FT                   TIEALNAVHGFIAEKIREMPQNVAKTEPVSILQPQTTVNPDRIKQTLPSSPTTTKSSPS
FT                   DPMTTSRANQVKIIVPNSTAGLIIGKGGATVKAIMEQSGAWVQLSQKPDGINLQERVVT
FT                   VSGEPEQNRKAVELIIQKIQEDPQSGSCLNISYANVTGPVANSNPTGSPYANTAEVLPT
FT                   AAAAAGLLGHANLAGVAAFPAVLSGFTGNDLVAITSALNTLASYGYNLNTLGLGLSQAA
FT                   ATGALAAAAASANPAAAAANLLATYASEASASGSTAGGTAGTFALGSLAAATAATNGYF
FT                   GAASPLAASAILGTEKSTDGSKDVVEIAVPENLVGAILGKGGKTLVEYQELTGARIQIS
FT                   KKGEFVPGTRNRKVTITGTPAATQAAQYLITQRITYEQGVRAANPQKVG"
FT   mRNA            complement(join(22223714..22223929,22225509..22225580,
FT                   22232687..22232853,22330040..22330183,22331770..22331929))
FT                   /locus_tag="mCG_140771"
FT                   /product="mCG140771, transcript variant mCT171374"
FT                   /note="gene_id=mCG140771.0 transcript_id=mCT171374.0
FT                   created on 29-JUL-2002"
FT   CDS             complement(join(22223906..22223929,22225509..22225580,
FT                   22232687..22232853,22330040..22330183,22331770..22331905))
FT                   /codon_start=1
FT                   /locus_tag="mCG_140771"
FT                   /product="mCG140771, isoform CRA_a"
FT                   /note="gene_id=mCG140771.0 transcript_id=mCT171374.0
FT                   protein_id=mCP94293.0 isoform=CRA_a"
FT                   /protein_id="EDL36800.1"
FT                   /translation="MMAAAPIQQNGTHTGVPIDLDPPDSRKRPLEAPPEAGSTKRTNTG
FT                   EDGQYFLKVLIPSYAAGSIIGKGGQTIVQLQKETGATIKLSKSKDFYPGTTERVCLIQG
FT                   TIEALNAVHGFIAEKIREMPQNVAKTEPVSILQPQTTVNPDRIKQTLPSSPTTTKSSPS
FT                   DPMTTSRANQKHSSWIT"
FT   gene            <23309487..23309912
FT                   /locus_tag="mCG_12232"
FT                   /note="gene_id=mCG12232.0"
FT   mRNA            <23309487..23309912
FT                   /locus_tag="mCG_12232"
FT                   /product="mCG12232"
FT                   /note="gene_id=mCG12232.0 transcript_id=mCT17051.0 created
FT                   on 06-SEP-2002"
FT   CDS             <23309489..23309758
FT                   /codon_start=1
FT                   /locus_tag="mCG_12232"
FT                   /product="mCG12232"
FT                   /note="gene_id=mCG12232.0 transcript_id=mCT17051.0
FT                   protein_id=mCP12228.0"
FT                   /protein_id="EDL36799.1"
FT                   /translation="KMTKNRRNNGRAKKGRGHVQPIRCTNCARCVPKDKAIKKFVIRNI
FT                   VEAAAVRDISEASVFDAYVLPKLYVKLHYYVSCAIHSKVVRNRS"
FT   gene            complement(24059195..>24064988)
FT                   /locus_tag="mCG_124508"
FT                   /note="gene_id=mCG124508.0"
FT   mRNA            complement(join(24059195..24061360,24064753..>24064988))
FT                   /locus_tag="mCG_124508"
FT                   /product="mCG124508"
FT                   /note="gene_id=mCG124508.0 transcript_id=mCT125752.0
FT                   created on 06-SEP-2002"
FT   CDS             complement(join(24060319..24061360,24064753..>24064907))
FT                   /codon_start=1
FT                   /locus_tag="mCG_124508"
FT                   /product="mCG124508"
FT                   /note="gene_id=mCG124508.0 transcript_id=mCT125752.0
FT                   protein_id=mCP79006.0"
FT                   /protein_id="EDL36798.1"
FT                   /translation="RRMRGPAMRLPPRLALSALARGPSCILGSGAATQKDWQTRNRRGF
FT                   SDFNIEPLPDSDLEESSPWTSRNRSEPKRHIACKKAARNLVRDLLEHQNPSRQIILECN
FT                   PGPGILTGALLKAGARVVAFESEKTFIPHLEPLQRNMDGELQVVHCDFFKMDPRYQEVV
FT                   RPDVSSQAIFQNLGIKAVPWSAGVPIKVFGILPYKHERRILWKILFDLYSCESIYRYGR
FT                   VELNMFVSEKEFRKLIATPKRPDLYQVMAVLWQVACDVKFLHMEPWSSFSVHTENGHLE
FT                   KSKHGESVNLLKQNLYLVRMTPRRTLFTENLSPLNYDIFFHLVKHCFGKRNAPIIRHLR
FT                   SLSTVDPINILRQIRKNPGDTAARMYPHDFKKLFETIEQSEDSVFKWIYDYCPEDMEF"
FT   gene            <24643475..>24644220
FT                   /locus_tag="mCG_17415"
FT                   /note="gene_id=mCG17415.0"
FT   mRNA            join(<24643475..24643876,24643966..>24644220)
FT                   /locus_tag="mCG_17415"
FT                   /product="mCG17415"
FT                   /note="gene_id=mCG17415.0 transcript_id=mCT13082.0 created
FT                   on 06-SEP-2002"
FT   CDS             join(24643475..24643876,24643966..24644220)
FT                   /codon_start=1
FT                   /locus_tag="mCG_17415"
FT                   /product="mCG17415"
FT                   /note="gene_id=mCG17415.0 transcript_id=mCT13082.0
FT                   protein_id=mCP12227.0"
FT                   /protein_id="EDL36797.1"
FT                   /translation="MVKVGVNGFGRIGRLVTRAAICSPHGKVEIVAINDPFIDLNFMVY
FT                   MFQYDSTHGKFNGTIKAENGKLVINGKPITILQERDSTNIKWGNASAEYVVESTGVFTT
FT                   MEEAEAHLKGGAKRVIISSPSAYAPMFVMGVIHDKFGIVEGLMTTVHAITATQDTVDGP
FT                   SGKLWHDGRGAAQNIIPASTGAAKVVGKVIPELNGKPTGIAFHVPTPNVSIVDLI"
FT   gene            <24888202..24891860
FT                   /locus_tag="mCG_5477"
FT                   /note="gene_id=mCG5477.1"
FT   mRNA            join(<24888202..24888581,24889558..24891860)
FT                   /locus_tag="mCG_5477"
FT                   /product="mCG5477"
FT                   /note="gene_id=mCG5477.1 transcript_id=mCT4573.2 created on
FT                   29-NOV-2004"
FT   CDS             <24889559..24890935
FT                   /codon_start=1
FT                   /locus_tag="mCG_5477"
FT                   /product="mCG5477"
FT                   /note="gene_id=mCG5477.1 transcript_id=mCT4573.2
FT                   protein_id=mCP1778.2"
FT                   /protein_id="EDL36796.1"
FT                   /translation="GPRAVQNDNHHASHGHHNSHHPQHHHHHHHHHHPPPPAPQPPPPP
FT                   PQQQQQQPPPAPQPPQARGAPAADDDKGPQPLLLPPSTALDGAKADALGAKGEPGGGPA
FT                   ELAPVGPDEKEKGAGAGGEEKKGAGEGGKDGEGGKEGDKKNGKYEKPPFSYNALIMMAI
FT                   RQSPEKRLTLNGIYEFIMKNFPYYRENKQGWQNSIRHNLSLNKCFVKVPRHYDDPGKGN
FT                   YWMLDPSSDDVFIGGTTGKLRRRSTTSRAKLAFKRGARLTSTGLTFMDRAGSLYWPMSP
FT                   FLSLHHPRASSTLSYNGTTSAYPSHPMPYSSVLTQNSLGNNHSFSTANGLSVDRLVNGE
FT                   IPYATHHLTAAALAASVPCGLSVPCSGTYSLNPCSVNLLAGQTSYFFPHVPHPSMTSQT
FT                   STSMSARAASSSTSPQAPSTLPCESLRPSLPSFTTGLSGGLSDYFTHQNQGSSSNPLIH
FT                   "
FT   gene            <24894891..24912358
FT                   /locus_tag="mCG_5478"
FT                   /note="gene_id=mCG5478.1"
FT   mRNA            join(<24894891..24894943,24895407..24895474,
FT                   24911859..24912358)
FT                   /locus_tag="mCG_5478"
FT                   /product="mCG5478"
FT                   /note="gene_id=mCG5478.1 transcript_id=mCT4574.0 created on
FT                   06-SEP-2002"
FT   CDS             join(<24894892..24894943,24895407..24895474,
FT                   24911859..24912026)
FT                   /codon_start=1
FT                   /locus_tag="mCG_5478"
FT                   /product="mCG5478"
FT                   /note="gene_id=mCG5478.1 transcript_id=mCT4574.0
FT                   protein_id=mCP1779.0"
FT                   /protein_id="EDL36794.1"
FT                   /translation="DRRKSPEENLHSPSKKQGSARCYRKAAEDLRTVNTLTRRSSFTPP
FT                   WYKESWHDHPLHIRQCADTKQKIPSKEQTPCSHMSLEKIASSFFRKEKKK"
FT   gene            24906285..24909174
FT                   /locus_tag="mCG_148242"
FT                   /note="gene_id=mCG148242.0"
FT   mRNA            24906285..24909174
FT                   /locus_tag="mCG_148242"
FT                   /product="mCG148242"
FT                   /note="gene_id=mCG148242.0 transcript_id=mCT188505.0
FT                   created on 13-JAN-2004"
FT   CDS             24908290..24908475
FT                   /codon_start=1
FT                   /locus_tag="mCG_148242"
FT                   /product="mCG148242"
FT                   /note="gene_id=mCG148242.0 transcript_id=mCT188505.0
FT                   protein_id=mCP108076.0"
FT                   /protein_id="EDL36795.1"
FT                   /translation="MKVHMEARGIQISLKMELQAAVSYIQHGAENQTGFSGRAAFALNF
FT                   WAISSTLSYLLLNDSI"
FT   gene            complement(24981787..>24985662)
FT                   /locus_tag="mCG_146096"
FT                   /note="gene_id=mCG146096.0"
FT   mRNA            complement(join(24981787..24982015,24982806..24982953,
FT                   24985326..>24985662))
FT                   /locus_tag="mCG_146096"
FT                   /product="mCG146096"
FT                   /note="gene_id=mCG146096.0 transcript_id=mCT186199.0
FT                   created on 14-JUL-2003"
FT   CDS             complement(join(24982830..24982953,24985326..>24985459))
FT                   /codon_start=1
FT                   /locus_tag="mCG_146096"
FT                   /product="mCG146096"
FT                   /note="gene_id=mCG146096.0 transcript_id=mCT186199.0
FT                   protein_id=mCP107275.0"
FT                   /protein_id="EDL36793.1"
FT                   /translation="QGLICFFSTGKSLTQSLVNLIICFIACRRFSFLLYLKVTAVNYYW
FT                   EIISIGIKSQKVLSPYHFKMLRYFCKRSLILKEWEKCWKF"
FT   gene            complement(25274842..25275606)
FT                   /pseudo
FT                   /locus_tag="mCG_5480"
FT                   /note="gene_id=mCG5480.1"
FT   mRNA            complement(join(25274842..25275437,25275460..25275606))
FT                   /pseudo
FT                   /locus_tag="mCG_5480"
FT                   /note="gene_id=mCG5480.1 transcript_id=mCT4571.1 created on
FT                   06-SEP-2002"
FT   gene            complement(25338290..25339389)
FT                   /pseudo
FT                   /locus_tag="mCG_5479"
FT                   /note="gene_id=mCG5479.1"
FT   mRNA            complement(join(25338290..25338776,25338847..25339280,
FT                   25339310..25339389))
FT                   /pseudo
FT                   /locus_tag="mCG_5479"
FT                   /note="gene_id=mCG5479.1 transcript_id=mCT4575.1 created on
FT                   06-SEP-2002"
FT   gene            complement(25839799..>25988990)
FT                   /gene="Prkcm"
FT                   /locus_tag="mCG_124725"
FT                   /note="gene_id=mCG124725.0"
FT   mRNA            complement(join(25839799..25840298,25841132..25841217,
FT                   25862553..25862837,25863651..25863753,25864343..25864504,
FT                   25881319..25881425,25883062..25883134,25885138..25885190,
FT                   25886175..25886454,25889223..25889300,25890912..25891035,
FT                   25892421..25892625,25894185..25894262,25894416..25894626,
FT                   25918749..25918772,25924335..25924495,25926999..25927130,
FT                   25988852..>25988990))
FT                   /gene="Prkcm"
FT                   /locus_tag="mCG_124725"
FT                   /product="protein kinase C, mu"
FT                   /note="gene_id=mCG124725.0 transcript_id=mCT125973.1
FT                   created on 30-AUG-2002"
FT   CDS             complement(join(25840080..25840298,25841132..25841217,
FT                   25862553..25862837,25863651..25863753,25864343..25864504,
FT                   25881319..25881425,25883062..25883134,25885138..25885190,
FT                   25886175..25886454,25889223..25889300,25890912..25891035,
FT                   25892421..25892625,25894185..25894262,25894416..25894626,
FT                   25918749..25918772,25924335..25924495,25926999..25927130,
FT                   25988852..>25988990))
FT                   /codon_start=1
FT                   /gene="Prkcm"
FT                   /locus_tag="mCG_124725"
FT                   /product="protein kinase C, mu"
FT                   /note="gene_id=mCG124725.0 transcript_id=mCT125973.1
FT                   protein_id=mCP78634.1"
FT                   /protein_id="EDL36792.1"
FT                   /translation="FPECGFYGLYDKILLFRHDPASDNILQLVKIASDIQEGDLIEVVL
FT                   SASATFEDFQIRPHALFVHSYRAPAFCDHCGEMLWGLVRQGLKCEGCGLNYHKRCAFKI
FT                   PNNCSGVRRRRLSNVSLTGLGTVRTASAEFSTSVPDEPLLSPVSPGFEQKSPSESFIGR
FT                   EKRSNSQSYIGRPIQLDKLLMSKVKVPHTFVIHSYTRPTVCQFCKKLLKGLFRQGLQCK
FT                   DCRFNCHKRCAPKVPNNCLGEVTINGELLSPGAESDVVMEEGSDDNDSERNSGLMDDMD
FT                   EAMVQDTEMALAEGQSGGAEMQDPDADQEDSNRTISPSTSNNIPLMRVVQSVKHTKRRS
FT                   STVMKEGWMVHYTSKDTLRKRHYWRLDSKCITLFQNDTGSRYYKEIPLSEILCLEPAKP
FT                   SALTPVGATPHCFEITTANVVYYVGENVVNPSSSPPNNSVLPSGIGPDVARMWEVAIQH
FT                   ALMPVIPKGSSVGSGSNSHKDISVSISVSNCQIQENVDISTVYQIFPDEVLGSGQFGIV
FT                   YGGKHRKTGRDVAIKIIDKLRFPTKQESQLRNEVAILQNLHHPGVVNLECMFETPERVF
FT                   VVMEKLHGDMLEMILSSEKGRLPEHITKFLITQILVALRHLHFKNIVHCDLKPENVLLA
FT                   SADPFPQAKSYCQQVKLCDFGFARIIGEKSFRRSVVGTPAYLAPEVLRNKGYNRSLDMW
FT                   SVGVIIYVSLSGTFPFNEDEDIHDQIQNAAFMYPPNPWKEISHEAIDLINNLLQVKMRK
FT                   RYSVDKTLSHPWLQDYQTWLDLRELECRIGERYITHESDDSRWEQYAGEQGLQYPAHLI
FT                   SLSASHSDSPEAEEREMKALSERVSIL"
FT   gene            complement(<26463639..>26477504)
FT                   /locus_tag="mCG_66755"
FT                   /note="gene_id=mCG66755.1"
FT   mRNA            complement(join(<26463639..26463806,26466106..26466270,
FT                   26466387..26466449,26470601..26470869,26472206..26472411,
FT                   26477440..>26477504))
FT                   /locus_tag="mCG_66755"
FT                   /product="mCG66755"
FT                   /note="gene_id=mCG66755.1 transcript_id=mCT66938.1 created
FT                   on 25-SEP-2002"
FT   CDS             complement(join(26463639..26463806,26466106..26466270,
FT                   26466387..26466449,26470601..26470869,26472206..26472411,
FT                   26477440..26477504))
FT                   /codon_start=1
FT                   /locus_tag="mCG_66755"
FT                   /product="mCG66755"
FT                   /note="gene_id=mCG66755.1 transcript_id=mCT66938.1
FT                   protein_id=mCP24712.1"
FT                   /protein_id="EDL36791.1"
FT                   /translation="MKLYEQSLICVTENYDYQFRSRRKQKDDFRKVVEEDQKLCLFIDA
FT                   FIRLLSVSRLLSVGHNHVMSQRYRHQYHVFILEMVEERNKSSRTCYIRRTNPTKQLTVG
FT                   LAYKRMLFSDFSIWKHGESKDNFMEITNKSEVEGVGIHLFSYPQLQMGKQTSPPRALQI
FT                   QEIATESFAEEQAGTSKLGIWRTHLLSAEKELAEDTGEGTRRDLPAEHNPQATLGNVHT
FT                   LDVFACVVHKQAGSYTGFYSNGFYSATLLDTARHAAWMEVHFHLKGSQGMGRKREYSEN
FT                   GILWGEAMLKGLTHNEEVDYFLITPKFGLQ"
FT   gene            <26488030..26544190
FT                   /locus_tag="mCG_145558"
FT                   /note="gene_id=mCG145558.0"
FT   mRNA            join(<26488030..26488165,26498883..26499010,
FT                   26526255..26526341,26534175..26534381,26543948..26544190)
FT                   /locus_tag="mCG_145558"
FT                   /product="mCG145558"
FT                   /note="gene_id=mCG145558.0 transcript_id=mCT184982.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<26526310..26526341,26534175..26534379)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145558"
FT                   /product="mCG145558"
FT                   /note="gene_id=mCG145558.0 transcript_id=mCT184982.0
FT                   protein_id=mCP105140.0"
FT                   /protein_id="EDL36790.1"
FT                   /translation="WRRTWSTLNTRQEHTQDNRNLLQQSFYCLPIRREDPEPGKWHCLY
FT                   SPQHDISAPDVALQLLIRCSPITPLLHREMGSD"
FT   gene            complement(26621089..>26622645)
FT                   /locus_tag="mCG_125663"
FT                   /note="gene_id=mCG125663.0"
FT   mRNA            complement(26621089..>26622645)
FT                   /locus_tag="mCG_125663"
FT                   /product="mCG125663"
FT                   /note="gene_id=mCG125663.0 transcript_id=mCT126926.0
FT                   created on 06-SEP-2002"
FT   CDS             complement(26621276..>26622457)
FT                   /codon_start=1
FT                   /locus_tag="mCG_125663"
FT                   /product="mCG125663"
FT                   /note="gene_id=mCG125663.0 transcript_id=mCT126926.0
FT                   protein_id=mCP79055.0"
FT                   /protein_id="EDL36789.1"
FT                   /translation="DRSWQACALVFVDLESTVIDEVRTYRQLFHPEQLITGKEDAANNY
FT                   VRGHYTTGKEIIDLVLDRIHKLADQCMGLQGFLVFHSFGGGTGSGFTSLLMEQLSVDYG
FT                   KKSKLEFSIDPAPQVSTAVVEPYNSILITHTTLEHSDCAFMVDNEAIYDICRRNLDSER
FT                   LTYTNLNRLIGQIVSSITSSLRFDGALNVDLTEFQTNLVPYPRINFPLASYAPVISAEK
FT                   AYHEQLSVAEITNVCFEPANQMVKCDPCHGKYMSCCLLYRGDVVPKDVNAAIATIKTKR
FT                   TIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCLLSNTTAIAEAWARLDHKFDLM
FT                   YAKRVFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDSVEGEGEEEGEEY"
FT   gene            <26775698..26776226
FT                   /locus_tag="mCG_49907"
FT                   /note="gene_id=mCG49907.2"
FT   mRNA            <26775698..26776226
FT                   /locus_tag="mCG_49907"
FT                   /product="mCG49907"
FT                   /note="gene_id=mCG49907.2 transcript_id=mCT50090.2 created
FT                   on 25-SEP-2002"
FT   CDS             26775698..26776174
FT                   /codon_start=1
FT                   /locus_tag="mCG_49907"
FT                   /product="mCG49907"
FT                   /note="gene_id=mCG49907.2 transcript_id=mCT50090.2
FT                   protein_id=mCP24719.1"
FT                   /protein_id="EDL36788.1"
FT                   /translation="MVDIQTEHAYQKQPTIFQNKKRVLLGETGKEKLPPYYKNIALGFK
FT                   MPKEAIKGTYIDKKCPFTGNVSIRGWILSGVVTKMKMQRTIVICQDYLCYIRKYNRFEK
FT                   CHKNMSVHLSPCFRDVQIGDIVTVGECRPLSKTVRFNVLKVTKAAGTKKQFQKF"
FT   gene            <26825798..26853145
FT                   /gene="6030408C04Rik"
FT                   /locus_tag="mCG_8289"
FT                   /note="gene_id=mCG8289.2"
FT   mRNA            join(<26825798..26825954,26828915..26828955,
FT                   26831116..26831213,26831312..26831413,26833393..26833517,
FT                   26834539..26834704,26837257..26837363,26838446..26838562,
FT                   26840701..26840825,26840932..26841061,26841467..26841535,
FT                   26842770..26843074,26845290..26845471,26846561..26846733,
FT                   26849078..26849268,26849948..26850787)
FT                   /gene="6030408C04Rik"
FT                   /locus_tag="mCG_8289"
FT                   /product="RIKEN cDNA 6030408C04, transcript variant
FT                   mCT193480"
FT                   /note="gene_id=mCG8289.2 transcript_id=mCT193480.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(<26825872..26825954,26828915..26828955,
FT                   26831116..26831213,26831312..26831413,26833393..26833517,
FT                   26834539..26834704,26837257..26837363,26838446..26838562,
FT                   26840701..26840825,26840932..26841061,26842770..26843074,
FT                   26845290..26845471,26846561..26846733,26849078..26849268,
FT                   26849948..26853145)
FT                   /gene="6030408C04Rik"
FT                   /locus_tag="mCG_8289"
FT                   /product="RIKEN cDNA 6030408C04, transcript variant
FT                   mCT7511"
FT                   /note="gene_id=mCG8289.2 transcript_id=mCT7511.2 created on
FT                   06-SEP-2002"
FT   mRNA            join(<26825879..26825954,26828915..26828955,
FT                   26831116..26831213,26831312..26831413,26833393..26833517,
FT                   26834539..26834704,26837257..26837363,26838446..26838562,
FT                   26840701..26840825,26840932..26841061,26845267..26845471,
FT                   26846561..26846733,26849078..26849268,26849948..26850888)
FT                   /gene="6030408C04Rik"
FT                   /locus_tag="mCG_8289"
FT                   /product="RIKEN cDNA 6030408C04, transcript variant
FT                   mCT193481"
FT                   /note="gene_id=mCG8289.2 transcript_id=mCT193481.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<26825914..26825954,26828915..26828955,
FT                   26831116..26831213,26831312..26831413,26833393..26833517,
FT                   26834539..26834704,26837257..26837363,26838446..26838562,
FT                   26840701..26840825,26840932..26841061,26841467..26841535,
FT                   26842770..26843074,26845290..26845471,26846561..26846733,
FT                   26849078..26849268,26849948..26850240)
FT                   /codon_start=1
FT                   /gene="6030408C04Rik"
FT                   /locus_tag="mCG_8289"
FT                   /product="RIKEN cDNA 6030408C04, isoform CRA_a"
FT                   /note="gene_id=mCG8289.2 transcript_id=mCT193480.0
FT                   protein_id=mCP114487.0 isoform=CRA_a"
FT                   /protein_id="EDL36785.1"
FT                   /translation="RRARGQTEVSRAAGKMNENKPDNSQSLACVFCRKNDDCPNKYGEK
FT                   KTYEKWNFSVHYYCLLMSSGIWQRGKEEEGVYGFLIEDIRKEVQRASKLKCTVCKKNGA
FT                   SIGCVVPTCKRSYHLPCGLQKECIFQFTDNFASFCWKHRPVQAITSNKYSSSLPCTICL
FT                   EFVEPIPTYNILQSPCCKNAWFHRDCLQVQAINAGVFFFRCTLCNNTDIFQKEMLRMGI
FT                   HIPEKDASWELEENAYQELLQSHDRCDIRRCHCKKGRDYNEPNSKWEVKRCQSCGSSGT
FT                   HLACSSLQSWEQNWECLDCRRITYTSDFQKAPKHPLANSTNVTVTDCLLEESSSKLPRQ
FT                   STVAQHKELLRLKQEIQLSTTACIFRRQSCLTQRQGSKFRRDISTILIELGFQIKKKTK
FT                   TLYINKANVWRSALEQFQSQKFNPSCSIDVVYVNGNEVGSQHLGSKQEFLSHLMHHLEN
FT                   SSVFEGSLAKNLSLNSQAVKENLYYEVGKMLAISLVHGGPSPGFFSETLFNCLAYGPEN
FT                   TLPTLDDVSDIDVAQIIIKIDSATDLNILNSVISQHYNYLEVSGCLRLTTSLSDKFMLV
FT                   KDILFYHVINRVKAPFESFKQGLKTLGVLEKIQTYPEAFYKILCHKPENLSAKNLSDLF
FT                   TIHSVADVQTLRFWNSYLKAIEDGKSATTMEDILIFATGCSSVPPTGFKPSLSVECLHV
FT                   DFPVADKYRNHLVLPATNTYEEFQENMDFTIRDTLRLEKEERSHILPRTLNVSSNEEML
FT                   I"
FT   CDS             join(<26825914..26825954,26828915..26828955,
FT                   26831116..26831213,26831312..26831413,26833393..26833517,
FT                   26834539..26834704,26837257..26837363,26838446..26838562,
FT                   26840701..26840825,26840932..26841061,26842770..26843074,
FT                   26845290..26845471,26846561..26846733,26849078..26849268,
FT                   26849948..26850240)
FT                   /codon_start=1
FT                   /gene="6030408C04Rik"
FT                   /locus_tag="mCG_8289"
FT                   /product="RIKEN cDNA 6030408C04, isoform CRA_c"
FT                   /note="gene_id=mCG8289.2 transcript_id=mCT7511.2
FT                   protein_id=mCP1782.2 isoform=CRA_c"
FT                   /protein_id="EDL36787.1"
FT                   /translation="RRARGQTEVSRAAGKMNENKPDNSQSLACVFCRKNDDCPNKYGEK
FT                   KTYEKWNFSVHYYCLLMSSGIWQRGKEEEGVYGFLIEDIRKEVQRASKLKCTVCKKNGA
FT                   SIGCVVPTCKRSYHLPCGLQKECIFQFTDNFASFCWKHRPVQAITSNKYSSSLPCTICL
FT                   EFVEPIPTYNILQSPCCKNAWFHRDCLQVQAINAGVFFFRCTLCNNTDIFQKEMLRMGI
FT                   HIPEKDASWELEENAYQELLQSHDRCDIRRCHCKKGRDYNEPNSKWEVKRCQSCGSSGT
FT                   HLACSSLQSWEQNWECLDCRRITYTSDFQKAPKHPLANSTNVTVTDCLLEESSSKLPRQ
FT                   STVAQHKELLRQGSKFRRDISTILIELGFQIKKKTKTLYINKANVWRSALEQFQSQKFN
FT                   PSCSIDVVYVNGNEVGSQHLGSKQEFLSHLMHHLENSSVFEGSLAKNLSLNSQAVKENL
FT                   YYEVGKMLAISLVHGGPSPGFFSETLFNCLAYGPENTLPTLDDVSDIDVAQIIIKIDSA
FT                   TDLNILNSVISQHYNYLEVSGCLRLTTSLSDKFMLVKDILFYHVINRVKAPFESFKQGL
FT                   KTLGVLEKIQTYPEAFYKILCHKPENLSAKNLSDLFTIHSVADVQTLRFWNSYLKAIED
FT                   GKSATTMEDILIFATGCSSVPPTGFKPSLSVECLHVDFPVADKYRNHLVLPATNTYEEF
FT                   QENMDFTIRDTLRLEKEERSHILPRTLNVSSNEEMLI"
FT   CDS             join(<26825914..26825954,26828915..26828955,
FT                   26831116..26831213,26831312..26831413,26833393..26833517,
FT                   26834539..26834704,26837257..26837363,26838446..26838562,
FT                   26840701..26840825,26840932..26841061,26845267..26845471,
FT                   26846561..26846733,26849078..26849268,26849948..26850240)
FT                   /codon_start=1
FT                   /gene="6030408C04Rik"
FT                   /locus_tag="mCG_8289"
FT                   /product="RIKEN cDNA 6030408C04, isoform CRA_b"
FT                   /note="gene_id=mCG8289.2 transcript_id=mCT193481.0
FT                   protein_id=mCP114488.0 isoform=CRA_b"
FT                   /protein_id="EDL36786.1"
FT                   /translation="RRARGQTEVSRAAGKMNENKPDNSQSLACVFCRKNDDCPNKYGEK
FT                   KTYEKWNFSVHYYCLLMSSGIWQRGKEEEGVYGFLIEDIRKEVQRASKLKCTVCKKNGA
FT                   SIGCVVPTCKRSYHLPCGLQKECIFQFTDNFASFCWKHRPVQAITSNKYSSSLPCTICL
FT                   EFVEPIPTYNILQSPCCKNAWFHRDCLQVQAINAGVFFFRCTLCNNTDIFQKEMLRMGI
FT                   HIPEKDASWELEENAYQELLQSHDRCDIRRCHCKKGRDYNEPNSKWEVKRCQSCGSSGT
FT                   HLACSSLQSWEQNWECLDCRRITYTSDFQKAPKHPLANSTNVTVTDCLLEESSSKLPRQ
FT                   STVAQHKELLSLFLSVFTAVKENLYYEVGKMLAISLVHGGPSPGFFSETLFNCLAYGPE
FT                   NTLPTLDDVSDIDVAQIIIKIDSATDLNILNSVISQHYNYLEVSGCLRLTTSLSDKFML
FT                   VKDILFYHVINRVKAPFESFKQGLKTLGVLEKIQTYPEAFYKILCHKPENLSAKNLSDL
FT                   FTIHSVADVQTLRFWNSYLKAIEDGKSATTMEDILIFATGCSSVPPTGFKPSLSVECLH
FT                   VDFPVADKYRNHLVLPATNTYEEFQENMDFTIRDTLRLEKEERSHILPRTLNVSSNEEM
FT                   LI"
FT   gene            <26855098..26931246
FT                   /gene="Scfd1"
FT                   /locus_tag="mCG_50215"
FT                   /note="gene_id=mCG50215.1"
FT   mRNA            join(<26855098..26855155,26861629..26861699,
FT                   26864566..26864654,26866798..26866888,26867822..26867944,
FT                   26875209..26875294,26877515..26877614,26890041..26890180,
FT                   26891632..26891722,26892387..26892460,26903633..26903703,
FT                   26909551..26909644,26912632..26912694,26914375..26914450,
FT                   26920427..26920480,26926816..26926881,26928711..26928779,
FT                   26931046..26931246)
FT                   /gene="Scfd1"
FT                   /locus_tag="mCG_50215"
FT                   /product="sec1 family domain containing 1"
FT                   /note="gene_id=mCG50215.1 transcript_id=mCT50398.1 created
FT                   on 06-SEP-2002"
FT   CDS             join(<26855098..26855155,26861629..26861699,
FT                   26864566..26864654,26866798..26866888,26867822..26867944,
FT                   26875209..26875294,26877515..26877614,26890041..26890180,
FT                   26891632..26891722,26892387..26892460,26903633..26903703,
FT                   26909551..26909644,26912632..26912694,26914375..26914450,
FT                   26920427..26920480,26926816..26926881,26928711..26928779,
FT                   26931046..26931069)
FT                   /codon_start=1
FT                   /gene="Scfd1"
FT                   /locus_tag="mCG_50215"
FT                   /product="sec1 family domain containing 1"
FT                   /note="gene_id=mCG50215.1 transcript_id=mCT50398.1
FT                   protein_id=mCP24708.1"
FT                   /protein_id="EDL36783.1"
FT                   /translation="QWMVGSKMAATASIRERQTVALKRMLNFNVPHVKNSTGEPVWKVL
FT                   IYDRFGQDIISPLLSVKELRDMGITLHLLLHSDRDPIPDVPAVYFVMPTEENIDRLCQD
FT                   LRNQLYESYYLNFISAISRSKLEDIANAALAASAVTQVAKKLDKKLRENLRDARNSLFT
FT                   GDPLGTGQFSFQRPLLVLVDRNIDLATPLHHTWTYQALVHDVLDFHLNRVNLEESTGVE
FT                   NSPAGARPKRKNKKSYDLTPVDKFWQKHKGSPFPEVAESVQQELESYRAQEDEVKRLKS
FT                   IMGLEGEDEGAISMLSDNTAKLTSAVSRDSGRQNEAVSYLLHKRTASTVRAGTPEDKMR
FT                   LFLIYYISAQQAPSEVWKLTPEGAFAKMASTPASYGNTTTKPMGLLSRVMNTGSQFVME
FT                   GVKNLVLKQQNLPVTRILDNLMEMKSNPAIVFVVGGGNYIEYQNLVDYIKAKQGKHILY
FT                   GCSEIFNATQFIKQLSQLGQK"
FT   gene            <26886309..26888523
FT                   /locus_tag="mCG_125662"
FT                   /note="gene_id=mCG125662.0"
FT   mRNA            <26886309..26888523
FT                   /locus_tag="mCG_125662"
FT                   /product="mCG125662"
FT                   /note="gene_id=mCG125662.0 transcript_id=mCT126925.0
FT                   created on 06-SEP-2002"
FT   CDS             <26886309..26886773
FT                   /codon_start=1
FT                   /locus_tag="mCG_125662"
FT                   /product="mCG125662"
FT                   /note="gene_id=mCG125662.0 transcript_id=mCT126925.0
FT                   protein_id=mCP79049.0"
FT                   /protein_id="EDL36784.1"
FT                   /translation="QRQGKRKPDGHWATLCLAEENQLNMGKGDPKKPRGKMSSNAFFVQ
FT                   TCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGRFEDMAKADKARYEREMKTYIP
FT                   PPPKGRPKRSSRTPMHPRGLLRPSSCSVLSTTPKSKASILASPLVILQRN"
FT   gene            <26958783..26959398
FT                   /locus_tag="mCG_125660"
FT                   /note="gene_id=mCG125660.0"
FT   mRNA            <26958783..26959398
FT                   /locus_tag="mCG_125660"
FT                   /product="mCG125660"
FT                   /note="gene_id=mCG125660.0 transcript_id=mCT126923.0
FT                   created on 06-SEP-2002"
FT   CDS             <26958783..26959223
FT                   /codon_start=1
FT                   /locus_tag="mCG_125660"
FT                   /product="mCG125660"
FT                   /note="gene_id=mCG125660.0 transcript_id=mCT126923.0
FT                   protein_id=mCP79033.0"
FT                   /protein_id="EDL36782.1"
FT                   /translation="AAAAAMSSKVSRDTLYEAVREVLHGNQRKRRKFLETVELQISLKN
FT                   YDPQKDKRFSGTVRLKSTPRPKFSVCVLGDQQHCDEAKAVDIPHMDIEALKKLNKNKKL
FT                   VKKLAKKYDAFLASESLIKQIPRILGPGLNKAGKFPYPADTQ"
FT   gene            <27081689..27094104
FT                   /gene="Coch"
FT                   /locus_tag="mCG_8286"
FT                   /note="gene_id=mCG8286.2"
FT   mRNA            join(<27081689..27081737,27081937..27081989,
FT                   27082071..27082124,27083668..27083824,27084777..27084910,
FT                   27085348..27085410,27086360..27086404,27086484..27086631,
FT                   27090147..27090250,27090978..27091204,27091527..27092043,
FT                   27093188..27094092)
FT                   /gene="Coch"
FT                   /locus_tag="mCG_8286"
FT                   /product="coagulation factor C homolog (Limulus
FT                   polyphemus), transcript variant mCT7512"
FT                   /note="gene_id=mCG8286.2 transcript_id=mCT7512.0 created on
FT                   30-AUG-2002"
FT   CDS             join(<27081691..27081737,27081937..27081989,
FT                   27082071..27082124,27083668..27083824,27084777..27084910,
FT                   27085348..27085410,27086360..27086404,27086484..27086631,
FT                   27090147..27090250,27090978..27091204,27091527..27092043,
FT                   27093188..27093363)
FT                   /codon_start=1
FT                   /gene="Coch"
FT                   /locus_tag="mCG_8286"
FT                   /product="coagulation factor C homolog (Limulus
FT                   polyphemus), isoform CRA_b"
FT                   /note="gene_id=mCG8286.2 transcript_id=mCT7512.0
FT                   protein_id=mCP1783.0 isoform=CRA_b"
FT                   /protein_id="EDL36781.1"
FT                   /translation="EPRLPHSGVAGRIPRRSTEILAMPSSRIPALCLGAWLLLLLLPRF
FT                   ARAEGAVPIPVTCFTRGLDIRKEKADVLCPGGCSLEEFSVFGNIVYASVSSICGAAVHR
FT                   GVIGTSGGPVRVYSLPGRENYSSVDANGIQSQMLSRWSASFAVTKGKSSTQEATGRAVS
FT                   TAHPPSGKRLKKTPEKKTGNKDCKADIAFLIDGSFNIGQRRFNLQKNFVGKVALMLGIG
FT                   TEGPHVGLVQASEHPKIEFYLKNFTSAKDVLFAIKEVGFRGGNSNTGKALKHTAQKFFT
FT                   ADTGVRKGIPKVVVVFIDGWPSDDIEEAGIVAREFGVNVFIVSVAKPIPEELGMVQDVA
FT                   FVDKAVCRNNGFFSYHMPNWFGTTKYVKPLVQKLCTHEQMMCSKTCYNSVNIAFLIDGS
FT                   SSVGDSNFRLMLEFVSNIAKTFEISDIGAKIAAVQFTYDQRTEFSFTDYNTKENVLAVL
FT                   ANIRYMSGGTATGDAIAFTVRNVFGPIRDSPNKNFLVIVTDGQSYDDVRGPAAAAHDAG
FT                   ITIFSVGVAWAPLDDLRDMASKPKESHAFFTREFTGLEPIVSDVIRGICRDFLESQQ"
FT   mRNA            join(<27081786..27081989,27082071..27082124,
FT                   27083668..27083824,27084777..27084910,27085348..27085410,
FT                   27086360..27086404,27086484..27086631,27090147..27090250,
FT                   27090978..27091204,27091527..27092043,27093188..27094104)
FT                   /gene="Coch"
FT                   /locus_tag="mCG_8286"
FT                   /product="coagulation factor C homolog (Limulus
FT                   polyphemus), transcript variant mCT193479"
FT                   /note="gene_id=mCG8286.2 transcript_id=mCT193479.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<27081788..27081989,27082071..27082124,
FT                   27083668..27083824,27084777..27084910,27085348..27085410,
FT                   27086360..27086404,27086484..27086631,27090147..27090250,
FT                   27090978..27091204,27091527..27092043,27093188..27093363)
FT                   /codon_start=1
FT                   /gene="Coch"
FT                   /locus_tag="mCG_8286"
FT                   /product="coagulation factor C homolog (Limulus
FT                   polyphemus), isoform CRA_a"
FT                   /note="gene_id=mCG8286.2 transcript_id=mCT193479.0
FT                   protein_id=mCP114486.0 isoform=CRA_a"
FT                   /protein_id="EDL36780.1"
FT                   /translation="WRTPRWSEVAQRVWSCSNCSGRVLPPSPASEERRAVRSPANLVHA
FT                   SLSRRSTEILAMPSSRIPALCLGAWLLLLLLPRFARAEGAVPIPVTCFTRGLDIRKEKA
FT                   DVLCPGGCSLEEFSVFGNIVYASVSSICGAAVHRGVIGTSGGPVRVYSLPGRENYSSVD
FT                   ANGIQSQMLSRWSASFAVTKGKSSTQEATGRAVSTAHPPSGKRLKKTPEKKTGNKDCKA
FT                   DIAFLIDGSFNIGQRRFNLQKNFVGKVALMLGIGTEGPHVGLVQASEHPKIEFYLKNFT
FT                   SAKDVLFAIKEVGFRGGNSNTGKALKHTAQKFFTADTGVRKGIPKVVVVFIDGWPSDDI
FT                   EEAGIVAREFGVNVFIVSVAKPIPEELGMVQDVAFVDKAVCRNNGFFSYHMPNWFGTTK
FT                   YVKPLVQKLCTHEQMMCSKTCYNSVNIAFLIDGSSSVGDSNFRLMLEFVSNIAKTFEIS
FT                   DIGAKIAAVQFTYDQRTEFSFTDYNTKENVLAVLANIRYMSGGTATGDAIAFTVRNVFG
FT                   PIRDSPNKNFLVIVTDGQSYDDVRGPAAAAHDAGITIFSVGVAWAPLDDLRDMASKPKE
FT                   SHAFFTREFTGLEPIVSDVIRGICRDFLESQQ"
FT   gene            complement(27097976..>27180387)
FT                   /gene="Strn3"
FT                   /locus_tag="mCG_8277"
FT                   /note="gene_id=mCG8277.1"
FT   mRNA            complement(join(27097976..27098603,27098690..27098776,
FT                   27108115..27108222,27110081..27110221,27111495..27111662,
FT                   27115426..27115547,27115829..27115876,27116017..27116196,
FT                   27117690..27117823,27121846..27121986,27131256..27131366,
FT                   27136146..27136287,27138256..27138382,27140824..27140997,
FT                   27143811..27143892,27149561..27149634,27150020..27150123,
FT                   27179850..27179925,27180268..>27180387))
FT                   /gene="Strn3"
FT                   /locus_tag="mCG_8277"
FT                   /product="striatin, calmodulin binding protein 3"
FT                   /note="gene_id=mCG8277.1 transcript_id=mCT7520.2 created on
FT                   30-AUG-2002"
FT   CDS             complement(join(27115838..27115876,27116017..27116196,
FT                   27117690..27117823,27121846..27121986,27131256..27131366,
FT                   27136146..27136287,27138256..27138382,27140824..27140997,
FT                   27143811..27143892,27149561..27149634,27150020..27150123,
FT                   27179850..27179925,27180268..>27180377))
FT                   /codon_start=1
FT                   /gene="Strn3"
FT                   /locus_tag="mCG_8277"
FT                   /product="striatin, calmodulin binding protein 3"
FT                   /note="gene_id=mCG8277.1 transcript_id=mCT7520.2
FT                   protein_id=mCP1790.2"
FT                   /protein_id="EDL36779.1"
FT                   /translation="WRRPAAPCSDPRQAHGNDPLPGRLPGRPPALRSARGQHYIQHEWA
FT                   RFEMERAHWEVERAELQARIAFLQGERKGQENLKKDLVRRIKMLEYALKQERAKYHKLK
FT                   YGTELNQGDLKMPTFESEETKDVEAPPAPQNSQLTWKQGRQLLRQYLQEVGYTDTILDV
FT                   RSQRVRSLLGLSNSEPNGSVEAKNLEQILNGGESPKQKGQEIKRPPGDVLETFNFLENA
FT                   DDSDEEENDMIEGIPEGKDKLRIHKHKIGNEGLAADLTDDPDTEEALKEFDFLVTAEDG
FT                   EGAGEARSSGDGTEWDKDDLSPTAEVWDVDQGLISKLKEQYKKERKGKKGVKRVNRTNL
FT                   CDMITDLGDDELPHIPSGIINQSRSASTRMADHEGARAEEAEPITFPSGGGKSFIMGSD
FT                   DVLLSVLGLGDLADLTVTNDADYSYDLPANKDAFRKTWNPKYTLRSHFDGVRALAFHPV
FT                   EPVLVTASEDHTLKLWNLQKTVPAKKQECLFRCRTYLHI"
FT   gene            <27179394..27228310
FT                   /gene="Ap4s1"
FT                   /locus_tag="mCG_8283"
FT                   /note="gene_id=mCG8283.2"
FT   mRNA            join(<27179394..27179742,27206312..27206520,
FT                   27210006..27210092,27212350..27212418,27220256..>27220341)
FT                   /gene="Ap4s1"
FT                   /locus_tag="mCG_8283"
FT                   /product="adaptor-related protein complex AP-4, sigma 1,
FT                   transcript variant mCT193475"
FT                   /note="gene_id=mCG8283.2 transcript_id=mCT193475.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(<27179416..27179742,27206312..27206520,
FT                   27210006..27210092,27212350..27212418,27227921..27228310)
FT                   /gene="Ap4s1"
FT                   /locus_tag="mCG_8283"
FT                   /product="adaptor-related protein complex AP-4, sigma 1,
FT                   transcript variant mCT7515"
FT                   /note="gene_id=mCG8283.2 transcript_id=mCT7515.1 created on
FT                   30-AUG-2002"
FT   CDS             join(<27206341..27206520,27210006..27210092,
FT                   27212350..27212418,27227921..27228049)
FT                   /codon_start=1
FT                   /gene="Ap4s1"
FT                   /locus_tag="mCG_8283"
FT                   /product="adaptor-related protein complex AP-4, sigma 1,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG8283.2 transcript_id=mCT7515.1
FT                   protein_id=mCP1774.1 isoform=CRA_b"
FT                   /protein_id="EDL36778.1"
FT                   /translation="LLKDIAKKLGKGEKMIKFFLMVNKQGQTRLSKYYEHVDINKRALL
FT                   ETEVSKSCLSRSSEQCSFIEYKDFKLIYRQYAALFVVVGVNDTENEMAIYEFIHNFVEV
FT                   LDGYFSRVIMFNLDKVHIILDEMVLNGCIVETNRARILAPLLILDKLSES"
FT   CDS             join(<27206341..27206520,27210006..27210092,
FT                   27212350..27212418,27220256..>27220341)
FT                   /codon_start=1
FT                   /gene="Ap4s1"
FT                   /locus_tag="mCG_8283"
FT                   /product="adaptor-related protein complex AP-4, sigma 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG8283.2 transcript_id=mCT193475.0
FT                   protein_id=mCP114485.0 isoform=CRA_a"
FT                   /protein_id="EDL36777.1"
FT                   /translation="LLKDIAKKLGKGEKMIKFFLMVNKQGQTRLSKYYEHVDINKRALL
FT                   ETEVSKSCLSRSSEQCSFIEYKDFKLIYRQYAALFVVVGVNDTENEMAIYEFIHNFVEV
FT                   LDGYFSRVSELDVSFFCTFFHGMWQKAHSGCDHQVSA"
FT   gene            27319293..27320711
FT                   /locus_tag="mCG_1041833"
FT                   /note="gene_id=mCG1041833.1"
FT   mRNA            join(27319293..27320177,27320576..27320711)
FT                   /locus_tag="mCG_1041833"
FT                   /product="mCG1041833"
FT                   /note="gene_id=mCG1041833.1 transcript_id=mCT159537.1
FT                   created on 25-SEP-2002"
FT   CDS             join(27320020..27320177,27320576..27320657)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041833"
FT                   /product="mCG1041833"
FT                   /note="gene_id=mCG1041833.1 transcript_id=mCT159537.1
FT                   protein_id=mCP78931.1"
FT                   /protein_id="EDL36776.1"
FT                   /translation="MQRPRLVVFNPGGTLETPGKVFIRRVLDPQQIEQKVQRISYGYPV
FT                   LYHVFLARCLESTFTDYERLMQKFPKFPNRKNTF"
FT   gene            <27330080..>27358566
FT                   /locus_tag="mCG_1041582"
FT                   /note="gene_id=mCG1041582.0"
FT   mRNA            join(<27330080..27330195,27334456..27334711,
FT                   27347207..27347313,27348756..27348862,27353124..27353204,
FT                   27358481..>27358566)
FT                   /locus_tag="mCG_1041582"
FT                   /product="mCG1041582"
FT                   /note="gene_id=mCG1041582.0 transcript_id=mCT159286.0
FT                   created on 25-SEP-2002"
FT   CDS             join(27330080..27330195,27334456..27334711,
FT                   27347207..27347313,27348756..27348862,27353124..27353204,
FT                   27358481..27358566)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041582"
FT                   /product="mCG1041582"
FT                   /note="gene_id=mCG1041582.0 transcript_id=mCT159286.0
FT                   protein_id=mCP78837.0"
FT                   /protein_id="EDL36775.1"
FT                   /translation="MANSFPDPPHRGCDGPRTTDHGVVNLRILWPNMSLLEVLLAQRSE
FT                   GRTLGKSRLSKGVGAVYRLRLLAPKVTGVKCKPGVYLSQSNMLCNREQWALCERLFRQQ
FT                   PQVQDYSALHPELCGTKILEFRAAKGLPSAAGNTHGTPQSRSGATSTFQLMAEKQQSPQ
FT                   VQSLVAENQNAKPNHLMLQLSSVGISEPKRAPYEELKLKREGAEGSPILAMMRTLAACI
FT                   GPLIKVRSIAQQVKELAAEPDNRSLRRA"
FT   gene            complement(27365942..>27461105)
FT                   /gene="D930036F22Rik"
FT                   /locus_tag="mCG_8281"
FT                   /note="gene_id=mCG8281.1"
FT   mRNA            complement(join(27365942..27367741,27369373..27369586,
FT                   27371232..27371383,27374377..27374577,27377953..27378225,
FT                   27378809..27378956,27379542..27379669,27381182..27381427,
FT                   27383594..27383816,27384207..27384386,27386507..27386575,
FT                   27387691..27387872,27388999..27389235,27395495..27395674,
FT                   27400112..27400247,27405127..27405296,27406220..27406409,
FT                   27411491..27411596,27415152..27415327,27415408..27415571,
FT                   27429685..27429837,27435324..27435435,27437656..27437906,
FT                   27439830..27439985,27440827..27440989,27442385..27442542,
FT                   27445307..27445481,27446048..27446197,27447016..27447124,
FT                   27448823..27449034,27460989..>27461105))
FT                   /gene="D930036F22Rik"
FT                   /locus_tag="mCG_8281"
FT                   /product="RIKEN cDNA D930036F22, transcript variant
FT                   mCT7519"
FT                   /note="gene_id=mCG8281.1 transcript_id=mCT7519.1 created on
FT                   06-SEP-2002"
FT   mRNA            complement(join(27365998..27367741,27369373..27369586,
FT                   27371232..27371383,27374377..27374601,27377953..27378225,
FT                   27378809..27378956,27379542..27379669,27381182..27381427,
FT                   27383594..27383816,27384207..27384386,27386507..27386575,
FT                   27387691..27387872,27388999..27389235,27395495..27395674,
FT                   27400112..27400247,27405127..27405296,27406220..27406409,
FT                   27408737..27408893,27410543..27410730,27411491..27411596,
FT                   27415152..27415327,27415408..27415571,27420330..27420439,
FT                   27428184..27428283,27429685..27429837,27435324..27435435,
FT                   27437656..27437906,27439830..27439985,27440827..27441082,
FT                   27442385..27442542,27445307..27445481,27446048..27446197,
FT                   27447016..27447124,27448823..27449034,27451403..27451614,
FT                   27460964..>27461082))
FT                   /gene="D930036F22Rik"
FT                   /locus_tag="mCG_8281"
FT                   /product="RIKEN cDNA D930036F22, transcript variant
FT                   mCT193468"
FT                   /note="gene_id=mCG8281.1 transcript_id=mCT193468.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(27367437..27367741,27369373..27369586,
FT                   27371232..27371383,27374377..27374577,27377953..27378225,
FT                   27378809..27378956,27379542..27379669,27381182..27381427,
FT                   27383594..27383816,27384207..27384386,27386507..27386575,
FT                   27387691..27387872,27388999..27389235,27395495..27395674,
FT                   27400112..27400247,27405127..27405296,27406220..27406409,
FT                   27411491..27411596,27415152..27415327,27415408..27415571,
FT                   27429685..27429837,27435324..27435435,27437656..27437906,
FT                   27439830..27439985,27440827..27440989,27442385..27442542,
FT                   27445307..27445481,27446048..27446197,27447016..27447124,
FT                   27448823..27449034,27460989..27461105))
FT                   /codon_start=1
FT                   /gene="D930036F22Rik"
FT                   /locus_tag="mCG_8281"
FT                   /product="RIKEN cDNA D930036F22, isoform CRA_b"
FT                   /note="gene_id=mCG8281.1 transcript_id=mCT7519.1
FT                   protein_id=mCP1795.1 isoform=CRA_b"
FT                   /protein_id="EDL36774.1"
FT                   /translation="MAAPAALSAPPALPAPHSPAGSRVPLCCRGAGNVAQPGREDVREK
FT                   QKTLVGQLLSLLNSSPGPPTRKLLAQDLAILYSVGDTVSVYETIDKCNDLIRSKDDSPS
FT                   YLPTKLAAVVCLGSLYKKLGRILANGFTDTVVNILKAMKSAESQGRYEIMLSLQSILTG
FT                   LGAAAAPCHRDVYKAARSCLTDRSMAVRCAAAKCLLELQNEAIFMWSTDLDSVATLCFK
FT                   SFEGSNYDVRISVSKLLGTVLAKAVTAKHPGAGSKQSARRVSLEEVLELLGAGFLRGSS
FT                   GFLRASGDMLKGNSSVSRDVRVGVTQSNPKATQTQIDAVCCRRCVSFILRATLGGLLGE
FT                   KAQIAAAKEICQAVWRLKKVMDAALSDGNVETRLSSTDVAASQHVLVCALQELGNLIHN
FT                   LGTTAAPLLQDSSTGLLDSVISVVLHPSISVRLAAAWCLHCIAVALPSYLTPLLDRCLE
FT                   RLAILKSSPEAVTGFSSAVAALLGSVTHCPLGIPHGKGKIIMTIAEDLLCSAAQNSRLS
FT                   LQRTQAGWLLVAALMTLGPAVVSHHLTRVLLLWKCVFPASPRDLETEKSRGDSFTWQVT
FT                   LEGRAGALCGNLCVILKELAAELTAPDTQAAASTCLLPALCHPDDLLILSPLLQETDHR
FT                   FIEEQLLLGNGVACGSLEYDPYSIYEKDVEGDSVPKPLPPALSVISSASKLFGVVCATV
FT                   DEAQRVLILEQLLNSIKHTKGARQQTVQLHVVSAISNLLKTWALHSLSLTIDSAGALYH
FT                   VHVESTLSLIVMLLLNVPPTHAQVHQSLGRCLNALITTLGPELQGSNTSVSALRTSCLL
FT                   GCAVMQDHPGCLVQAQAISCLQQLHMFAPRHVNLSSLVSCLCVNLCSPYLLLRRAVLAC
FT                   LRQLVQREAAEVSEHAIMLARDGRDAAADANLREVGLEGALLALLDRETDESLCQDIRE
FT                   TLHHMLTSMAVGKLTLWLKLCKDVLAASADFTAVTCVDTMQEEEGDRGDDASVLTRGDD
FT                   KPHPFSNPRWATRVFAADCVCRIINQCENANRAHFDIALAQEMKKRDSRNDFLVLHLAD
FT                   LIRMAFMAATDHSDQLRLSGLDTLLVVIRRFADIAEPEFPGHVILEQYQANVGAALRPA
FT                   FTSETPPDITAKACQVCSAWIASGVVSDLSDLRRVHQLLVSSLTKIQAGKEALSQLYNE
FT                   SASTMEILAVLRAWAEVYIIAVQRHKNHKQALKTTVNSEDSMRNGSSSAAGLLDLVCTD
FT                   LATLSKLWLAALQDFALLTLPAEFASQLPTEGGAFYTAETSKSAKLHYHDSWALILHAA
FT                   ALWLTSTGFADPDEGGANLSRPVTPTSMCQGSSSSGAAVKSPEDVYTDRFHLILGISVE
FT                   FLCSLRSDASLESIMACLRALQALLDVPWPRWRIGSDQDLGIELLNVLHRVILTRESPA
FT                   IQLASLEVVRQIICAAQEHVKEKRRSAEVDDGASEKETLPEFGEGKDTGGLVPGKSLVF
FT                   ATLELCVCILVRQLPELNPKLAGSPGGKASKPKTLLEEGSRLVAAALAILAELPAVCSP
FT                   EVLYLTIGVLRETAVKLPGGQLSCTVTASLQTLKGILTSPMARAEKSHEAWTSLLQSAL
FT                   ATVLDCWSPVDGAQEPDEVSLLTAVTVFILSTSPEVTTVPCLQNRCIEKFKAALESKDS
FT                   VVQMKTCQLLHSIFQYPKPAVSYPYIYSLASSIVEKLQDIARRKPEDATELQLCQEGIK
FT                   LLEALVAIAEEEHRAQLVACLLPILISFLLDENALGSATSVTRSLHDFALHSLMQIGPR
FT                   YSSVFKRVMASSPALKARLEAAVKGNQESVRVDPPSKHAKNLARNSSIQLKTNFL"
FT   CDS             complement(join(27367437..27367741,27369373..27369586,
FT                   27371232..27371383,27374377..27374601,27377953..27378225,
FT                   27378809..27378956,27379542..27379669,27381182..27381427,
FT                   27383594..27383816,27384207..27384386,27386507..27386575,
FT                   27387691..27387872,27388999..27389235,27395495..27395674,
FT                   27400112..27400247,27405127..27405296,27406220..27406409,
FT                   27408737..27408893,27410543..27410730,27411491..27411596,
FT                   27415152..27415327,27415408..27415571,27420330..27420439,
FT                   27428184..27428283,27429685..27429837,27435324..27435435,
FT                   27437656..27437906,27439830..27439985,27440827..27441082,
FT                   27442385..27442542,27445307..27445481,27446048..27446197,
FT                   27447016..27447124,27448823..27449034,27451403..>27451546))
FT                   /codon_start=1
FT                   /gene="D930036F22Rik"
FT                   /locus_tag="mCG_8281"
FT                   /product="RIKEN cDNA D930036F22, isoform CRA_a"
FT                   /note="gene_id=mCG8281.1 transcript_id=mCT193468.0
FT                   protein_id=mCP114443.0 isoform=CRA_a"
FT                   /protein_id="EDL36773.1"
FT                   /translation="ESLLQGMELAHSLLLNEEASNQLGAVQKAEFIFEWLRYLEKLLLA
FT                   TNREDVREKQKTLVGQLLSLLNSSPGPPTRKLLAQDLAILYSVGDTVSVYETIDKCNDL
FT                   IRSKDDSPSYLPTKLAAVVCLGSLYKKLGRILANGFTDTVVNILKAMKSAESQGRYEIM
FT                   LSLQSILTGLGAAAAPCHRDVYKAARSCLTDRSMAVRCAAAKCLLELQNEAIFMWSTDL
FT                   DSVATLCFKSFEGSNYDVRISVSKLLGTVLAKAVTAKHPGAGSKQSARRVSLEEVLELL
FT                   GAGFLRGSSGFLRASGDMLKGNSSVSRDVRVGVTQAYVVFVSTLGGAWLEKNLAAFLSH
FT                   ILSLVSQSNPKATQTQIDAVCCRRCVSFILRATLGGLLGEKAQIAAAKEICQAVWRLKK
FT                   VMDAALSDGNVETRLSSTDVAASQHVLVCALQELGNLIHNLGTTAAPLLQDSSTGLLDS
FT                   VISVVLHPSISVRLAAAWCLHCIAVALPSYLTPLLDRCLERLAILKSSPEAVTGFSSAV
FT                   AALLGSVTHCPLGIPHGKGKIIMTIAEDLLCSAAQNSRLSLQRTQAGWLLVAALMTLGP
FT                   AVVSHHLTRVLLLWKCVFPASPRDLETEKSRGDSFTWQVTLEGRAGALCAVKSFISHCG
FT                   DLLTEEVIQRLLPPLPCAVDLLTQLSSILKTYGSSLKTPSIVYRQRLYELLILLPPETY
FT                   KGNLCVILKELAAELTAPDTQAAASTCLLPALCHPDDLLILSPLLQETDHRFIEEQLLL
FT                   GNGVACGSLEYDPYSIYEKDVEGDSVPKPLPPALSVISSASKLFGVVCATVDEAQRVLI
FT                   LEQLLNSIKHTKGARQQTVQLHVVSAISNLLKYVAGSKQSLGPEVRRLVLTLVLGALES
FT                   PTPLLRCAASEAWARLAQVADDGAFTAGLAQLSFDKLKSARDVVTRTGHSLALGSLHRY
FT                   LGGIGPQHLSSCIGVLYTLSQDSTSPDVQTWALHSLSLTIDSAGALYHVHVESTLSLIV
FT                   MLLLNVPPTHAQVHQSLGRCLNALITTLGPELQGSNTSVSALRTSCLLGCAVMQDHPGC
FT                   LVQAQAISCLQQLHMFAPRHVNLSSLVSCLCVNLCSPYLLLRRAVLACLRQLVQREAAE
FT                   VSEHAIMLARDGRDAAADANLREVGLEGALLALLDRETDESLCQDIRETLHHMLTSMAV
FT                   GKLTLWLKLCKDVLAASADFTAVTCVDTMQEEEGDRGDDASVLTRGDDKPHPFSNPRWA
FT                   TRVFAADCVCRIINQCENANRAHFDIALAQEMKKRDSRNDFLVLHLADLIRMAFMAATD
FT                   HSDQLRLSGLDTLLVVIRRFADIAEPEFPGHVILEQYQANVGAALRPAFTSETPPDITA
FT                   KACQVCSAWIASGVVSDLSDLRRVHQLLVSSLTKIQAGKEALSQLYNESASTMEILAVL
FT                   RAWAEVYIIAVQRHKNHKQALKTTVNSEDSMRNGSSSAAGLLDLVCTDLATLSKLWLAA
FT                   LQDFALLTLPAEFASQLPTEGGAFYTAETSKSAKLHYHDSWALILHAAALWLTSTGFAD
FT                   PDEGGANLSRPVTPTSMCQGSSSSGAAVKSPEDVYTDRFHLILGISVEFLCSLRSDASL
FT                   ESIMACLRALQALLDVPWPRWRIGSDQDLGIELLNVLHRVILTRESPAIQLASLEVVRQ
FT                   IICAAQEHVKEKRRSAEVDDGASEKETLPEFGEGKDTGGLVPGKSLVFATLELCVCILV
FT                   RQLPELNPKLAGSPGGKASKPKTLLEEGSRLVAAALAILAELPAVCSPEGSISILPTVL
FT                   YLTIGVLRETAVKLPGGQLSCTVTASLQTLKGILTSPMARAEKSHEAWTSLLQSALATV
FT                   LDCWSPVDGAQEPDEVSLLTAVTVFILSTSPEVTTVPCLQNRCIEKFKAALESKDSVVQ
FT                   MKTCQLLHSIFQYPKPAVSYPYIYSLASSIVEKLQDIARRKPEDATELQLCQEGIKLLE
FT                   ALVAIAEEEHRAQLVACLLPILISFLLDENALGSATSVTRSLHDFALHSLMQIGPRYSS
FT                   VFKRVMASSPALKARLEAAVKGNQESVRVDPPSKHAKNLARNSSIQLKTNFL"
FT   gene            complement(27479894..>27498298)
FT                   /gene="6530401N04Rik"
FT                   /locus_tag="mCG_124772"
FT                   /note="gene_id=mCG124772.0"
FT   mRNA            complement(join(27479894..27480433,27490919..27491195,
FT                   27496673..27496742,27498169..>27498298))
FT                   /gene="6530401N04Rik"
FT                   /locus_tag="mCG_124772"
FT                   /product="RIKEN cDNA 6530401N04, transcript variant
FT                   mCT126022"
FT                   /note="gene_id=mCG124772.0 transcript_id=mCT126022.0
FT                   created on 06-SEP-2002"
FT   mRNA            complement(join(27479894..27480439,27490925..27491195,
FT                   27496673..27496742,27498169..>27498297))
FT                   /gene="6530401N04Rik"
FT                   /locus_tag="mCG_124772"
FT                   /product="RIKEN cDNA 6530401N04, transcript variant
FT                   mCT193492"
FT                   /note="gene_id=mCG124772.0 transcript_id=mCT193492.0
FT                   created on 09-MAR-2004"
FT   CDS             complement(join(27480391..27480439,27490925..27491195,
FT                   27496673..27496742,27498169..>27498297))
FT                   /codon_start=1
FT                   /gene="6530401N04Rik"
FT                   /locus_tag="mCG_124772"
FT                   /product="RIKEN cDNA 6530401N04, isoform CRA_b"
FT                   /note="gene_id=mCG124772.0 transcript_id=mCT193492.0
FT                   protein_id=mCP114449.0 isoform=CRA_b"
FT                   /protein_id="EDL36771.1"
FT                   /translation="AVRTRAMADGGRVAQARALLQQCLHARLQVRPADGDAAAQWVEIR
FT                   RGLVIYVCFFKGADTDLLPKMVNTLLNVKLSETETGKHVSILDLPGDVLIIPQATLGGR
FT                   VKGRSMQYHSNSGKEEGSELYSQFVSLCEKAVANNTKSVEAGVAVAHGTYGNRWSHTQK
FT                   ELQTLLTAF"
FT   CDS             complement(join(27480391..27480433,27490919..27491195,
FT                   27496673..27496742,27498169..>27498297))
FT                   /codon_start=1
FT                   /gene="6530401N04Rik"
FT                   /locus_tag="mCG_124772"
FT                   /product="RIKEN cDNA 6530401N04, isoform CRA_a"
FT                   /note="gene_id=mCG124772.0 transcript_id=mCT126022.0
FT                   protein_id=mCP78445.0 isoform=CRA_a"
FT                   /protein_id="EDL36770.1"
FT                   /translation="AVRTRAMADGGRVAQARALLQQCLHARLQVRPADGDAAAQWVEIR
FT                   RGLVIYVCFFKGADTDLLPKMVNTLLNVKLSETETGKHVSILDLPGDVLIIPQATLGGR
FT                   VKGRSMQYHSNSGKEEGSELYSQFVSLCEKAVANNTKSVEAGVAVAHGTYGNRQVHTQK
FT                   ELQTLLTAF"
FT   gene            27486873..27487705
FT                   /locus_tag="mCG_51950"
FT                   /note="gene_id=mCG51950.1"
FT   mRNA            27486873..27487705
FT                   /locus_tag="mCG_51950"
FT                   /product="mCG51950"
FT                   /note="gene_id=mCG51950.1 transcript_id=mCT52133.1 created
FT                   on 25-SEP-2002"
FT   CDS             27487099..27487524
FT                   /codon_start=1
FT                   /locus_tag="mCG_51950"
FT                   /product="mCG51950"
FT                   /note="gene_id=mCG51950.1 transcript_id=mCT52133.1
FT                   protein_id=mCP24695.0"
FT                   /protein_id="EDL36772.1"
FT                   /translation="MRFAKKHYRKGLKKMQANNAKAASARMRRGHQGPGEASVHQAQDA
FT                   KGPQPQTQPPGFHRSPQAWEADSKLHGQGSEALPTKARGSNQGRGHTAPAKAQASAPAQ
FT                   APKGAQAPVKAPWERLLSASVKTDGLLGHTYPHTICR"
FT   gene            complement(27514604..27523196)
FT                   /gene="Gpr33"
FT                   /locus_tag="mCG_52399"
FT                   /note="gene_id=mCG52399.3"
FT   mRNA            complement(join(27514604..27515858,27521580..>27521713))
FT                   /gene="Gpr33"
FT                   /locus_tag="mCG_52399"
FT                   /product="G protein-coupled receptor 33, transcript variant
FT                   mCT193430"
FT                   /note="gene_id=mCG52399.3 transcript_id=mCT193430.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(<27514833..27515858,27523067..27523196))
FT                   /gene="Gpr33"
FT                   /locus_tag="mCG_52399"
FT                   /product="G protein-coupled receptor 33, transcript variant
FT                   mCT52582"
FT                   /note="gene_id=mCG52399.3 transcript_id=mCT52582.1 created
FT                   on 24-SEP-2002"
FT   CDS             complement(27514833..>27515858)
FT                   /codon_start=1
FT                   /gene="Gpr33"
FT                   /locus_tag="mCG_52399"
FT                   /product="G protein-coupled receptor 33, isoform CRA_a"
FT                   /note="gene_id=mCG52399.3 transcript_id=mCT193430.0
FT                   protein_id=mCP114424.0 isoform=CRA_a"
FT                   /protein_id="EDL36768.1"
FT                   /translation="VIMDLINSSTHVINVSTSLTNSTGVPTPAPKTIIAASLFMAFIIG
FT                   VISNGLYLWMLQFKMQRTVNTLLFFHLILSYFISTLILPFMATSFLQDNHWAFGSVLCK
FT                   AFNSTLSVSMFASVFFLSAISVARYYLILHPVWSQQHRTPHWASRIALQIWISATILSI
FT                   PYLVFRTTHDDHKGRIKCQNNYIVSTDWESKEHQTLGQWIHAACFVGRFLLGFLLPFLV
FT                   IIFCYKRVATKMKEKGLFKSSKPFKVMVTAVISFFVCWMPYHVHSGLVLTKSQPLPLHL
FT                   TLGLAVVTISFNTVVSPVLYLFTGENFKVFKKSILALFNSTFSDISSTERTQTLNSETE
FT                   I"
FT   CDS             complement(27514833..27515852)
FT                   /codon_start=1
FT                   /gene="Gpr33"
FT                   /locus_tag="mCG_52399"
FT                   /product="G protein-coupled receptor 33, isoform CRA_b"
FT                   /note="gene_id=mCG52399.3 transcript_id=mCT52582.1
FT                   protein_id=mCP24720.1 isoform=CRA_b"
FT                   /protein_id="EDL36769.1"
FT                   /translation="MDLINSSTHVINVSTSLTNSTGVPTPAPKTIIAASLFMAFIIGVI
FT                   SNGLYLWMLQFKMQRTVNTLLFFHLILSYFISTLILPFMATSFLQDNHWAFGSVLCKAF
FT                   NSTLSVSMFASVFFLSAISVARYYLILHPVWSQQHRTPHWASRIALQIWISATILSIPY
FT                   LVFRTTHDDHKGRIKCQNNYIVSTDWESKEHQTLGQWIHAACFVGRFLLGFLLPFLVII
FT                   FCYKRVATKMKEKGLFKSSKPFKVMVTAVISFFVCWMPYHVHSGLVLTKSQPLPLHLTL
FT                   GLAVVTISFNTVVSPVLYLFTGENFKVFKKSILALFNSTFSDISSTERTQTLNSETEI"
FT   gene            <27577859..27578473
FT                   /locus_tag="mCG_8285"
FT                   /note="gene_id=mCG8285.0"
FT   mRNA            <27577859..27578473
FT                   /locus_tag="mCG_8285"
FT                   /product="mCG8285"
FT                   /note="gene_id=mCG8285.0 transcript_id=mCT7517.1 created on
FT                   06-SEP-2002"
FT   CDS             <27577861..27578160
FT                   /codon_start=1
FT                   /locus_tag="mCG_8285"
FT                   /product="mCG8285"
FT                   /note="gene_id=mCG8285.0 transcript_id=mCT7517.1
FT                   protein_id=mCP1775.0"
FT                   /protein_id="EDL36767.1"
FT                   /translation="PVPRPFLDMGEGTKNRIITAEGIILLFCAMVPGTLLLFRKRWQNE
FT                   KFGVDMPDDYEDENLYEGLNLDDCSNYEDISRGLQGTYQDVGNLHIGDAQLEKP"
FT   gene            <27589172..27792689
FT                   /locus_tag="mCG_124774"
FT                   /note="gene_id=mCG124774.0"
FT   mRNA            join(<27589172..27589326,27589788..27589935,
FT                   27591902..27591936,27628719..27628809,27768070..27768155,
FT                   27784411..27784609,27787528..27787610,27792432..27792689)
FT                   /locus_tag="mCG_124774"
FT                   /product="mCG124774"
FT                   /note="gene_id=mCG124774.0 transcript_id=mCT126024.0
FT                   created on 06-SEP-2002"
FT   CDS             join(<27589174..27589326,27589788..27589935,
FT                   27591902..27591936,27628719..27628809,27768070..27768155,
FT                   27784411..27784609,27787528..27787610,27792432..27792494)
FT                   /codon_start=1
FT                   /locus_tag="mCG_124774"
FT                   /product="mCG124774"
FT                   /note="gene_id=mCG124774.0 transcript_id=mCT126024.0
FT                   protein_id=mCP78485.0"
FT                   /protein_id="EDL36766.1"
FT                   /translation="GRQVLPSRPEQEPRAMGTWRRLLLFGGVSLRGGGAATVPPRGCRA
FT                   LGCGRQLLGAESEALKQRRTQIMSRGLPKQKPIEGVREVIVVASGKGGVGKSTTAVNLA
FT                   LALAANDSSKAVGLLDVDVYGPSIPKMMNLRGNPELSPSAVIVSTPQDIALMDAHKGAE
FT                   MFRKVNVPVLGLVQNMSVFQCPKCKHKTHIFGADGARKLAQTLDLDVLGKTLESSFTGQ
FT                   ITGGEMTVNPGNGGNRDVPLHLSIREASDMGQPVVFSQPGSDEAKAYLHIASEVVRRLK
FT                   SSPE"
FT   gene            <28001283..28056970
FT                   /gene="Arhgap5"
FT                   /locus_tag="mCG_14971"
FT                   /note="gene_id=mCG14971.2"
FT   mRNA            join(<28001283..28005002,28027551..28027698,
FT                   28046095..28046172,28048573..28048704,28050893..28050998,
FT                   28055574..28056970)
FT                   /gene="Arhgap5"
FT                   /locus_tag="mCG_14971"
FT                   /product="Rho GTPase activating protein 5"
FT                   /note="gene_id=mCG14971.2 transcript_id=mCT21445.2 created
FT                   on 30-AUG-2002"
FT   CDS             join(28001283..28005002,28027551..28027698,
FT                   28046095..28046172,28048573..28048704,28050893..28050998,
FT                   28055574..28055901)
FT                   /codon_start=1
FT                   /gene="Arhgap5"
FT                   /locus_tag="mCG_14971"
FT                   /product="Rho GTPase activating protein 5"
FT                   /note="gene_id=mCG14971.2 transcript_id=mCT21445.2
FT                   protein_id=mCP1767.2"
FT                   /db_xref="GOA:B9EKC3"
FT                   /db_xref="InterPro:IPR000198"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR002713"
FT                   /db_xref="InterPro:IPR008936"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1332637"
FT                   /db_xref="UniProtKB/TrEMBL:B9EKC3"
FT                   /protein_id="EDL36765.1"
FT                   /translation="MMAKNKEPRPPSYTVSVVGLSGTEKDKGNCGVGKSCLCNRFVRSK
FT                   ADEYYPEHTSVLSTIDFGGRVVNNDHFLYWGDITQNGEDGVECKIHVIEQTEFIDDQTF
FT                   LPHRSTNLQPYIKRAAASKLQSAEKLMYICTDQLGLEQDFEQKQMPEGKLNVDGFLLCI
FT                   DVSQGCNRKFDDQLKFVNNLFVQLSKSKKPVIIAATKCDECVDHYLREVQAFASNKKNL
FT                   LVVETSARFNVNIETCFTALVQMLDKTRGKPKIIPYLDAYKTQRQLVVTATDKFEKLVQ
FT                   TVRDYHATWKTVSNKLKNHPDYEEYINLEGTRKARNTFSKHIEQLKQEHIRKRREEYIS
FT                   TLPRAFNTLLPDLEEIEHLNWLEALKLMEKRADFQLCFVVLEKTPWDETDHIDKINDRR
FT                   IPFDLLSTLEAEKVYQNHVQHLISEKRRIEMKEKFKKTLEKIQFISPGQPWEEVMCFVM
FT                   EDEAFKYITEADSKEVYGRHQREIVEKAKEEFQEMLFEHSELFYDLDLNATPSSDKMSE
FT                   IHTVLSEEPRYKALQKLAPDRESLLLKHIGFVYHPTKETCLSGQYCTDIKVENLLATSL
FT                   LEMDHNRVRLYHDSTNIDKVNLFILGKDGLAQELANEIRTQSTDDEYALDGKIYELDLR
FT                   PVDAKSPYILSQLWTAAFKPHGCFCVFNSIESLSFIGEFIGKIRTEASQIRKDKYMTNL
FT                   PFTLILANQRDSISKNLPILRHQGQQLANKLQCPFVDVPTGTYPRKFNESQIKQALRGV
FT                   LESVKHNLDVVSPVPINKDVSEADLRIVMCAMCGDPFSVDLILSPFLDSHSCSAAQAGQ
FT                   NNSLMLDKIIGEKRRRIQITILSYHSSIGVRKDELVHGYILVYSAKRKASMGMLRAFLS
FT                   EVQDTIPVQLVAVTDSQADFFENEAIKELMTEGEHIATEITAKFTALYSLSQYHRQTEV
FT                   FTLFFSDVLEKKNMIENSYLSDNTRESTHQSEDVFLPSPRDCFPYNNYPDSDDDTEAPP
FT                   PYSPIGDDVQLLPTPSDRSRYRLDLEGNEYPVHSTPNCHDHERNHKVPPPIKPKPVVPK
FT                   TNVKKLDPNLLKTIEAGIGKNPRKQTSRVPLAHPEDMDSSDNYAEPLDTIFKQKGYSDE
FT                   IYVVPDDSQNRIIKIRNSFVNNTQGDEENGFSDRTSKGHGERRPSKYKYKSKTLFSKAK
FT                   SYYRRTHSDASDDEAFTTSKTKRKGRHRGSEEDPLLSPVETWKGGIDNPAITSDQEVDD
FT                   KKIKKKTHKVKEDKKQKKKTKTFNPPTRRNWESNYFGMPLQDLVTAEKPIPLFVEKCVE
FT                   FIEDTGLCTEGLYRVSGNKTDQDNIQKQFDQDHNINLASMEVTVNAVAGALKAFFADLP
FT                   DPLIPYSLHPELLEAAKIPDKTERFHALKEIVKKFHPVNYDVFRYVITHLNRVSQQNKI
FT                   NLMTADNLSICFWPTLMRPDFENREFLSTTKIHQSVVETFIQQCQFFFYNGEIVETANT
FT                   VAPPPTSNPGQLVESMVPLQLPPPLQPQLIQPQLQTDPLGII"
FT   gene            28057211..28060059
FT                   /locus_tag="mCG_148250"
FT                   /note="gene_id=mCG148250.0"
FT   mRNA            join(28057211..28058648,28059121..28060059)
FT                   /locus_tag="mCG_148250"
FT                   /product="mCG148250"
FT                   /note="gene_id=mCG148250.0 transcript_id=mCT188513.0
FT                   created on 13-JAN-2004"
FT   CDS             28058102..28058260
FT                   /codon_start=1
FT                   /locus_tag="mCG_148250"
FT                   /product="mCG148250"
FT                   /note="gene_id=mCG148250.0 transcript_id=mCT188513.0
FT                   protein_id=mCP108084.0"
FT                   /protein_id="EDL36764.1"
FT                   /translation="MHSIIDLTHYIVNHLNILHLVHFTTRLQILKIKVWFKAQSVTLTC
FT                   VCFWPRV"
FT   gene            complement(28088833..28091170)
FT                   /locus_tag="mCG_1051101"
FT                   /note="gene_id=mCG1051101.0"
FT   mRNA            complement(join(28088833..28088927,28090837..28090902,
FT                   28091027..28091170))
FT                   /locus_tag="mCG_1051101"
FT                   /product="mCG1051101"
FT                   /note="gene_id=mCG1051101.0 transcript_id=mCT194890.0
FT                   created on 27-JAN-2005"
FT   CDS             complement(28091072..28091158)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1051101"
FT                   /product="mCG1051101"
FT                   /note="gene_id=mCG1051101.0 transcript_id=mCT194890.0
FT                   protein_id=mCP115919.0"
FT                   /protein_id="EDL36763.1"
FT                   /translation="MKTSPPSHPTHLVFLGYRLYPSPQRGHF"
FT   gene            28096516..28117727
FT                   /locus_tag="mCG_1041828"
FT                   /note="gene_id=mCG1041828.0"
FT   mRNA            join(28096516..28096584,28110291..28110527,
FT                   28116279..28116389,28117678..28117727)
FT                   /locus_tag="mCG_1041828"
FT                   /product="mCG1041828"
FT                   /note="gene_id=mCG1041828.0 transcript_id=mCT159532.0
FT                   created on 24-SEP-2002"
FT   CDS             join(28110439..28110527,28116279..28116324)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041828"
FT                   /product="mCG1041828"
FT                   /note="gene_id=mCG1041828.0 transcript_id=mCT159532.0
FT                   protein_id=mCP78568.1"
FT                   /protein_id="EDL36762.1"
FT                   /translation="MLTSSFWQVGKDHRADTPHLLAYKQDLHSRRSQEADDETACLRF"
FT   gene            complement(28245189..28250618)
FT                   /locus_tag="mCG_148262"
FT                   /note="gene_id=mCG148262.0"
FT   mRNA            complement(join(28245189..28248251,28250552..28250618))
FT                   /locus_tag="mCG_148262"
FT                   /product="mCG148262"
FT                   /note="gene_id=mCG148262.0 transcript_id=mCT188525.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(28247958..28248242)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148262"
FT                   /product="mCG148262"
FT                   /note="gene_id=mCG148262.0 transcript_id=mCT188525.0
FT                   protein_id=mCP108098.0"
FT                   /protein_id="EDL36761.1"
FT                   /translation="MLFLTNDSSLPLTGCLCASCYCTIDRLNHLLFGCVDLAGMTGKPM
FT                   SLISSVSNTSCPVPLRAPPPGCLATAQLSVFSPSTTPNMNTSHICLPLS"
FT   gene            <28289728..28628574
FT                   /locus_tag="mCG_14970"
FT                   /note="gene_id=mCG14970.1"
FT   mRNA            join(<28289728..28290015,28375142..28375393,
FT                   28380813..28381610,28382070..28382567,28401318..28401440,
FT                   28421153..28421249,28422358..28422524,28496262..28496410,
FT                   28511523..28511643,28554951..28555097,28590330..28590545,
FT                   28625186..28628574)
FT                   /locus_tag="mCG_14970"
FT                   /product="mCG14970"
FT                   /note="gene_id=mCG14970.1 transcript_id=mCT21444.1 created
FT                   on 06-SEP-2002"
FT   CDS             join(<28289728..28290015,28375142..28375393,
FT                   28380813..28381610,28382070..28382567,28401318..28401440,
FT                   28421153..28421249,28422358..28422524,28496262..28496410,
FT                   28511523..28511643,28554951..28555097,28590330..28590545,
FT                   28625186..28628533)
FT                   /codon_start=1
FT                   /locus_tag="mCG_14970"
FT                   /product="mCG14970"
FT                   /note="gene_id=mCG14970.1 transcript_id=mCT21444.1
FT                   protein_id=mCP1784.1"
FT                   /protein_id="EDL36760.1"
FT                   /translation="DPDPMATDASPMAINMTPTVEQEEGEGEEAVKDVGAEQQYGKPPP
FT                   LHTAADWKIVLHLPEIETWLRMTSERVRDLTYSVQQDADSKHVDVHLVQLKDICEDISD
FT                   HVEQIHALLETEFSLKLLSYSVNVIVDIHAVQLLWHQLRVSVLVLRERILQGLQDANGN
FT                   YTRQTDILQAFSEETTEGRLDSLTEVDDSGQLTIKCSQNYLSLDCGITAFELSDYSPSE
FT                   DLLGGLGDMTTSQAKTKSFDSWSYSEMEKEFPELIRSVGLLTVATEPVPSSCGAANEDS
FT                   SQVILSEDHRGGHEEDGALEPGEQLGSTLETSSLGDTLTNAAEHPPETANQDSTSSPQL
FT                   GAKKSQPGPCEMMTPKRSIRDCFNYNEDSPTQPTLPKRGLFLKETLKNERRGSDGKGRV
FT                   VDLKPELSRSTPSLVEPPDRSKLCLVLQSSYPSSPSAASQSYECLHKNGQVVEAWYGSD
FT                   EYLALPSHLKQTEVLALKLENLTKLLPQKPRGETIQDIDDWELSEMNSDSEIYPTYHIK
FT                   KKHTRLGTVSPSSSSDIASSLGESIESGPLSDILSDEDLCMPLSGMKKFTDEKSERPSS
FT                   SEKNESHSATKSALIQKLMKDIQHQDNYEAIWERIEGFVNKLDEFIQWLNEAMETTENW
FT                   TPPKAETDSLRLYLETHLSFKLNVDSHCALKEAVEEEGHQLLELIASHKAEGLKDMLKM
FT                   IASQWKELQRQIKRQHSWILRALDTIKAEILATDVSVEDEEGTGSPKAEAQLCYLEAQR
FT                   DAVEQMSLKLYSEQYTSGSKRKEEFADMSKAHSVGSNGLLDFDSEYQELWDWLIDMESL
FT                   VMDSHDLMMSEEQQQHLYKRYSVEMSIRHLKKTELLSKVEALKKGGLSLPNDILEKVDS
FT                   INEKWELLGSLCHEIKQRRRGVASILRLCQHLLDDRDTCNLNADHQPMQLIIVNLERRW
FT                   EAIVMQAVQWQTRLRKKMGKESETLNVIDPGLMDLNGMSEDALEWDETDISNKLISVHE
FT                   ESNDLDQDLEPMVPTVKLEETHHKDSGYEEEAGDCGGSQYTSNITAPSSPHIYQVYSLH
FT                   NVEFHEDSHTQFLKSSPKFTGTVQPTVLTKSLSKDSSFSSTKSLPDLLGGSSLVRPYSC
FT                   QSGDLSQNSGSESGIVSEGDNEMPTNSDMSLFSMVDGSPSNPETQHLDPQMGDAANVLE
FT                   QKFKDEGECIKLSSVSQASVSPVGCVNGKAGDLNSITKHTTDCLGDELQGKHEVFTFYD
FT                   YSYLQGSKLKFPMIMKQPQSEKAHLEDPLLRGFYFDKKSCKPKHQTSESQPDAPLHEKI
FT                   LASAPHEMGRSSYKSSDIEKALTGIQNARQLSLLSRSSSVESLSPGGDLFGLGIFKNGS
FT                   DSLQRSTSLESWLTSYKSNEDLFSCHSSGDISVSSGSVGELSKRTLDLLNRLENIQSPS
FT                   EQKIKRSVSDITLQSSSQKMSFSGQMSLDVASSINEDSPASLTELSSSDELSLCSEDIV
FT                   LHKNKVPESNASFRKRLNRSVADESDVNVSMIVNVSCTSACTDDEDDSDLLSSSTLTLT
FT                   EEELCLKDEDDDSSIATDDEIYEESNLMSGLDYIKNELQTWIRPKLSLSREKKRPSVTD
FT                   EIKVNKDGGSTERANPSDTLDIEALLNCSIKRLSENNGNGKNPPRTHDLGTKGENKKNT
FT                   YDVTKDPHVADMENGNVESTPEREKEKPEIPEASANLASNVKKISESKHDEYEALMDGS
FT                   DDSSVTGKEFGPPNDRHPPQIGADPQHPERGDCTSVQNSCSGLLLETGGGSRQDSDGLK
FT                   SLSNDAPSVARNAAGCCLLEQNETEESASISSSTSCCNCKPDVFHQKDDEDCSVHDFVK
FT                   EIIDMASTALKSKSQPESEVAAPTSLTQIKEKVLEHSHRPIHLRKGDFYSYLSLSSHDS
FT                   DCGEVTNYIDEKSNTPLPPDTVDSGLDDKEDVDCFFEACVEDEPADEEARLSSALPNES
FT                   EVQDEAAKPEQMTASSSVFRDETDTVPLSGLSPQKGADDAKEGDGASHTSQGCVESAEP
FT                   TTPPGKAKREGSSRKQSVSGTPEENAASAKPKIQAFSLNAKQPKGKAALYPSPQTLTCK
FT                   EKLVSFHEDRHSNMHR"
FT   gene            complement(28789438..28795982)
FT                   /locus_tag="mCG_148274"
FT                   /note="gene_id=mCG148274.0"
FT   mRNA            complement(join(28789438..28789858,28795697..28795982))
FT                   /locus_tag="mCG_148274"
FT                   /product="mCG148274"
FT                   /note="gene_id=mCG148274.0 transcript_id=mCT188537.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(28789476..28789610)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148274"
FT                   /product="mCG148274"
FT                   /note="gene_id=mCG148274.0 transcript_id=mCT188537.0
FT                   protein_id=mCP108106.0"
FT                   /protein_id="EDL36759.1"
FT                   /translation="MHKHPPVSALVYVHVHVCVHVHVRLEVNAKCIPLLHSTLLCEMG"
FT   gene            complement(<28937595..>28959185)
FT                   /locus_tag="mCG_1041824"
FT                   /note="gene_id=mCG1041824.0"
FT   mRNA            complement(join(<28937595..28937670,28946249..28946503,
FT                   28959052..>28959185))
FT                   /locus_tag="mCG_1041824"
FT                   /product="mCG1041824"
FT                   /note="gene_id=mCG1041824.0 transcript_id=mCT159528.0
FT                   created on 24-SEP-2002"
FT   CDS             complement(join(28937595..28937670,28946249..28946503,
FT                   28959052..28959185))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041824"
FT                   /product="mCG1041824"
FT                   /note="gene_id=mCG1041824.0 transcript_id=mCT159528.0
FT                   protein_id=mCP78532.0"
FT                   /protein_id="EDL36758.1"
FT                   /translation="MGKMLEKQISSHTGPCSLPQKIPKQKEGPKNREIGSPSSKPNGNR
FT                   RSGLKTNHGTNRNHQSITALVPTSSTLRRKTKEDAERNKTKVKGESWGKSCCRLNLLIH
FT                   SQRPSLKRSLKNERTNKQTQQNRERRGQRHNSTLEESRNEGDVSIKETLH"
FT   gene            complement(28960728..28961333)
FT                   /locus_tag="mCG_64162"
FT                   /note="gene_id=mCG64162.2"
FT   mRNA            complement(28960728..28961333)
FT                   /locus_tag="mCG_64162"
FT                   /product="mCG64162"
FT                   /note="gene_id=mCG64162.2 transcript_id=mCT64345.2 created
FT                   on 24-SEP-2002"
FT   CDS             complement(28960855..28961016)
FT                   /codon_start=1
FT                   /locus_tag="mCG_64162"
FT                   /product="mCG64162"
FT                   /note="gene_id=mCG64162.2 transcript_id=mCT64345.2
FT                   protein_id=mCP24705.2"
FT                   /protein_id="EDL36757.1"
FT                   /translation="MVYKHISENKVGNLNTFVLKPSTFCQKCCFLWTLGTVGGPWNVLC
FT                   IWLPKTQI"
FT   gene            29441128..>29558482
FT                   /gene="Npas3"
FT                   /locus_tag="mCG_124421"
FT                   /note="gene_id=mCG124421.0"
FT   mRNA            join(29441128..29441310,29497379..29497497,
FT                   29533973..29534166,29538207..29538313,29551429..29551576,
FT                   29555229..29555353,29557182..>29558482)
FT                   /gene="Npas3"
FT                   /locus_tag="mCG_124421"
FT                   /product="neuronal PAS domain protein 3"
FT                   /note="gene_id=mCG124421.0 transcript_id=mCT125663.0
FT                   created on 02-APR-2003"
FT   CDS             join(29441193..29441310,29497379..29497497,
FT                   29533973..29534166,29538207..29538313,29551429..29551576,
FT                   29555229..29555353,29557182..29558482)
FT                   /codon_start=1
FT                   /gene="Npas3"
FT                   /locus_tag="mCG_124421"
FT                   /product="neuronal PAS domain protein 3"
FT                   /note="gene_id=mCG124421.0 transcript_id=mCT125663.0
FT                   protein_id=mCP78616.1 partial"
FT                   /protein_id="EDL36756.1"
FT                   /translation="MAEQLGMKLPPGRGLLSQGTTEDAASSASSSSQSETPEPVETTSP
FT                   SLLTTDNTLERSFFIRMKSTLTKRGVHIKSSGYKVIHITGRLRLRVSLSHGRTVPSQIM
FT                   GLVVVAHALPPPTINEVRIDCHMFVTRVNMDLNIIYCENRISDYMDLTPVDIVGKRCYH
FT                   FIHAEDVEGIRHSHLDLLNKGQCVTKYYRWMQKNGGYIWIQSSATIAINAKNANEKNII
FT                   WVNYLLSNPEYKDTPMDIAQLPHLPEKASESSETSDSESDSKDTSGITEDNENSKSDEK
FT                   GNQSENSEDPEPDRKKSGSACDNDMNCNDDGHSSSNPDSRDSDDSFEHSDFEHPKAAED
FT                   GFGALGPMQIKVERYVESEADLRLQPCESLTSDSAKDSDSANEAGAQASSKHQKRKRRR
FT                   KRQKGGSASRRRLSSASSPGLDAGLVEPPRLLSSPHSASVLKIKTEIAEPINFDNDSSI
FT                   WNYPPNREISXXXXXXXXQGQGGSSGGGGALHVAIPDSVLTPPGADGTAGRKTQFSGTA
FT                   PVPSDPLSPPLSASPRDKHPGGGAGSGGGGPGASNSLLYTGDLEALQRLQAGNVVLPLV
FT                   HRVTGTLAATSTAAQRVYTTGTIRYAPAEVTLAMQGNLLPNAHAVNFVDVNSPGFGLDP
FT                   KTPMEMLYHHVHRLNMSGPFGGAVSAASLTQMPGGNVFTTAEGLFSTLPFPVYSNGIHA
FT                   AQTLERKED"
FT   gene            complement(29667746..29672740)
FT                   /locus_tag="mCG_1041818"
FT                   /note="gene_id=mCG1041818.0"
FT   mRNA            complement(join(29667746..29668418,29672535..29672740))
FT                   /locus_tag="mCG_1041818"
FT                   /product="mCG1041818"
FT                   /note="gene_id=mCG1041818.0 transcript_id=mCT159522.0
FT                   created on 24-SEP-2002"
FT   CDS             complement(29668059..29668382)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041818"
FT                   /product="mCG1041818"
FT                   /note="gene_id=mCG1041818.0 transcript_id=mCT159522.0
FT                   protein_id=mCP78487.1"
FT                   /protein_id="EDL36755.1"
FT                   /translation="MDAVLWCACEVPVYDFIAFQTIFQRACRPSWLCLCEVRFLSTVTN
FT                   GWCCPANVVIPPEVQCYPERFDLDFPNSDCCGTAFYLLCCHLRIIFQEMSTLNLFPVQT
FT                   VFP"
FT   gene            complement(29676461..29701196)
FT                   /gene="Egln3"
FT                   /locus_tag="mCG_12077"
FT                   /note="gene_id=mCG12077.1"
FT   mRNA            complement(join(29676461..29678125,29679101..29679174,
FT                   29681350..29681486,29683011..29683130,29700553..29701196))
FT                   /gene="Egln3"
FT                   /locus_tag="mCG_12077"
FT                   /product="EGL nine homolog 3 (C. elegans)"
FT                   /note="gene_id=mCG12077.1 transcript_id=mCT15676.1 created
FT                   on 04-APR-2003"
FT   CDS             complement(join(29678094..29678125,29679101..29679174,
FT                   29681350..29681486,29683011..29683130,29700553..29700909))
FT                   /codon_start=1
FT                   /gene="Egln3"
FT                   /locus_tag="mCG_12077"
FT                   /product="EGL nine homolog 3 (C. elegans)"
FT                   /note="gene_id=mCG12077.1 transcript_id=mCT15676.1
FT                   protein_id=mCP16833.2 partial"
FT                   /protein_id="EDL36754.1"
FT                   /translation="MPLGHIMRLDLEKIALEYIVPCLHEVGFCYLDNFLGEVVGDCVLE
FT                   RVKQLHYNGALRDGQLAGPCAGVSKRHLRGDQITWIGGNEEGCEAINFLLSLIDRLVLY
FT                   CGSRLGKYYVKERSKAMVACYPGNGTGYVRHVDNPNGDGRCITCIYYLNKNWDAKLHGG
FT                   VLRIFPEGKSFVADVEPIFDRLLFFWSDRRNPHEVQPSYATRYAMTVWYFDAEERAEAK
FT                   KKFRNLTRKTESALAKD"
FT   gene            29730944..29739703
FT                   /locus_tag="mCG_148276"
FT                   /note="gene_id=mCG148276.0"
FT   mRNA            join(29730944..29731084,29739018..29739132,
FT                   29739359..29739703)
FT                   /locus_tag="mCG_148276"
FT                   /product="mCG148276"
FT                   /note="gene_id=mCG148276.0 transcript_id=mCT188539.0
FT                   created on 13-JAN-2004"
FT   CDS             join(29731059..29731084,29739018..29739132,
FT                   29739359..29739385)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148276"
FT                   /product="mCG148276"
FT                   /note="gene_id=mCG148276.0 transcript_id=mCT188539.0
FT                   protein_id=mCP108110.0"
FT                   /protein_id="EDL36753.1"
FT                   /translation="MPSIRLPCRYFCCERTWETLHSATFCCENTLSRQHWLENNLAIKP
FT                   CPVLKMVASL"
FT   gene            complement(29888619..29892176)
FT                   /locus_tag="mCG_1041816"
FT                   /note="gene_id=mCG1041816.0"
FT   mRNA            complement(join(29888619..29889065,29892061..29892176))
FT                   /locus_tag="mCG_1041816"
FT                   /product="mCG1041816"
FT                   /note="gene_id=mCG1041816.0 transcript_id=mCT159520.0
FT                   created on 24-SEP-2002"
FT   CDS             complement(join(29888790..29889065,29892061..29892072))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041816"
FT                   /product="mCG1041816"
FT                   /note="gene_id=mCG1041816.0 transcript_id=mCT159520.0
FT                   protein_id=mCP78470.1"
FT                   /protein_id="EDL36752.1"
FT                   /translation="MRFEDFRRRIREVGSACDSRRRIKEKKKDGDSEEETLCQITPQAA
FT                   STDEAVAQRTVVPGLISMNHLSRLCCESPEGGSSCLWKVQSLKVEDWLML"
FT   gene            <29929855..29930422
FT                   /locus_tag="mCG_12076"
FT                   /note="gene_id=mCG12076.1"
FT   mRNA            <29929855..29930422
FT                   /locus_tag="mCG_12076"
FT                   /product="mCG12076"
FT                   /note="gene_id=mCG12076.1 transcript_id=mCT15675.1 created
FT                   on 06-SEP-2002"
FT   CDS             <29929986..29930372
FT                   /codon_start=1
FT                   /locus_tag="mCG_12076"
FT                   /product="mCG12076"
FT                   /note="gene_id=mCG12076.1 transcript_id=mCT15675.1
FT                   protein_id=mCP16836.0"
FT                   /protein_id="EDL36751.1"
FT                   /translation="IYKKGDIVDIKGMGTVQKGMPHKCYRGKTGRVYNVTQHAVGIIVN
FT                   KQVKGKVLAKRINVRIEHIKHSKSRDSFLKWVKENDQKKKEAKEKGTWVQLKCQPAPPG
FT                   EAHFVRTNGKEPELLEPIPYKFMA"
FT   gene            <30124769..30125435
FT                   /locus_tag="mCG_12075"
FT                   /note="gene_id=mCG12075.1"
FT   mRNA            <30124769..30125435
FT                   /locus_tag="mCG_12075"
FT                   /product="mCG12075"
FT                   /note="gene_id=mCG12075.1 transcript_id=mCT15674.1 created
FT                   on 06-SEP-2002"
FT   CDS             <30124820..30125422
FT                   /codon_start=1
FT                   /locus_tag="mCG_12075"
FT                   /product="mCG12075"
FT                   /note="gene_id=mCG12075.1 transcript_id=mCT15674.1
FT                   protein_id=mCP16835.1"
FT                   /protein_id="EDL36750.1"
FT                   /translation="SPTSTRIGSSEWTRSSTSQRARSAGTSAWQAKVHIAPRPASGPIR
FT                   PIVRCPTVRYHTKVRTGRGFSLEELRVAGIHKKMARTIGISVDPRRRNKSTESLQANVQ
FT                   RLKEYRSKLILFPRKPSAPKKGDSSAEELKLATQLTGPVMPIRNVYKKEKARVITEEEK
FT                   NFKAFASLGMARANAQLFGIRAKRAKEAAEQDVEKKK"
FT   gene            complement(30147074..30158205)
FT                   /gene="1110002B05Rik"
FT                   /locus_tag="mCG_54886"
FT                   /note="gene_id=mCG54886.2"
FT   mRNA            complement(join(30147074..30148204,30158048..30158205))
FT                   /gene="1110002B05Rik"
FT                   /locus_tag="mCG_54886"
FT                   /product="RIKEN cDNA 1110002B05"
FT                   /note="gene_id=mCG54886.2 transcript_id=mCT55069.1 created
FT                   on 23-DEC-2002"
FT   CDS             complement(join(30148101..30148204,30158048..30158159))
FT                   /codon_start=1
FT                   /gene="1110002B05Rik"
FT                   /locus_tag="mCG_54886"
FT                   /product="RIKEN cDNA 1110002B05"
FT                   /note="gene_id=mCG54886.2 transcript_id=mCT55069.1
FT                   protein_id=mCP37677.1"
FT                   /protein_id="EDL36749.1"
FT                   /translation="MAGMALARAWKQMSWFYYQYLLVTALYMLEPWERTVFNSMLVSVV
FT                   GMALYTGYVFMPQHIMAILHYFEIVQ"
FT   gene            <30172878..30180743
FT                   /locus_tag="mCG_145562"
FT                   /note="gene_id=mCG145562.0"
FT   mRNA            join(<30172878..30173446,30179595..30179651,
FT                   30180248..30180743)
FT                   /locus_tag="mCG_145562"
FT                   /product="mCG145562"
FT                   /note="gene_id=mCG145562.0 transcript_id=mCT184986.0
FT                   created on 05-JUN-2003"
FT   CDS             <30172912..30173163
FT                   /codon_start=1
FT                   /locus_tag="mCG_145562"
FT                   /product="mCG145562"
FT                   /note="gene_id=mCG145562.0 transcript_id=mCT184986.0
FT                   protein_id=mCP105145.0"
FT                   /protein_id="EDL36747.1"
FT                   /translation="VYKTGLIHYGIFIRTALNFAPSHCPTCLLAPKLSVNIPSPTFQGL
FT                   CECVFQQTQGKQCAHDKACHSLFSPPPHMPPPLGLFPM"
FT   gene            30173605..30174338
FT                   /locus_tag="mCG_1041812"
FT                   /note="gene_id=mCG1041812.1"
FT   mRNA            30173605..30174338
FT                   /locus_tag="mCG_1041812"
FT                   /product="mCG1041812"
FT                   /note="gene_id=mCG1041812.1 transcript_id=mCT159516.1
FT                   created on 24-SEP-2002"
FT   CDS             30174189..30174308
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041812"
FT                   /product="mCG1041812"
FT                   /note="gene_id=mCG1041812.1 transcript_id=mCT159516.1
FT                   protein_id=mCP78918.1"
FT                   /protein_id="EDL36748.1"
FT                   /translation="MSSTHSITAPPHPQKTKGTIHFLLSQLHSNSHWPSSPDL"
FT   gene            complement(30174829..>30195581)
FT                   /gene="1810011O16Rik"
FT                   /locus_tag="mCG_12404"
FT                   /note="gene_id=mCG12404.1"
FT   mRNA            complement(join(30174829..30175211,30179892..30180005,
FT                   30185592..30185703,30191756..30191851,30192537..30192718,
FT                   30195472..>30195581))
FT                   /gene="1810011O16Rik"
FT                   /locus_tag="mCG_12404"
FT                   /product="RIKEN cDNA 1810011O16"
FT                   /note="gene_id=mCG12404.1 transcript_id=mCT15673.1 created
FT                   on 29-AUG-2002"
FT   CDS             complement(join(30174944..30175211,30179892..30180005,
FT                   30185592..30185703,30191756..30191851,30192537..30192718,
FT                   30195472..>30195581))
FT                   /codon_start=1
FT                   /gene="1810011O16Rik"
FT                   /locus_tag="mCG_12404"
FT                   /product="RIKEN cDNA 1810011O16"
FT                   /note="gene_id=mCG12404.1 transcript_id=mCT15673.1
FT                   protein_id=mCP16834.0"
FT                   /protein_id="EDL36746.1"
FT                   /translation="QTPGRCRRPQVAMNRLQDDYDPYAVEEPSDEEPVLSSSEDELDVL
FT                   LHGTPDQKRKLIRECLTGESESSSEDEFEKEMEAELNSTMKTMEDQLSSLGTGSSSGVA
FT                   KVGGVTEKFYDEIYFDSDSEDEDKTVTKKKKKKQHRIPTNDELLYDPEKDNRDQAWVDA
FT                   KRRGYHAFGLQRPRQKQQPVPNSDAVLNCPACMTTLCLDCQRHESYKTQYRAMFVMNCS
FT                   INREEVLRYKNPENRRKRRSAKKMRSNPEDPAEREAEEIYHPVMCTECSTEVAVYDKDE
FT                   VFHFFNVLASHS"
FT   gene            complement(30201003..30201430)
FT                   /locus_tag="mCG_49033"
FT                   /note="gene_id=mCG49033.2"
FT   mRNA            complement(30201003..30201430)
FT                   /locus_tag="mCG_49033"
FT                   /product="mCG49033"
FT                   /note="gene_id=mCG49033.2 transcript_id=mCT49216.2 created
FT                   on 24-SEP-2002"
FT   CDS             complement(30201036..30201413)
FT                   /codon_start=1
FT                   /locus_tag="mCG_49033"
FT                   /product="mCG49033"
FT                   /note="gene_id=mCG49033.2 transcript_id=mCT49216.2
FT                   protein_id=mCP37679.1"
FT                   /protein_id="EDL36745.1"
FT                   /translation="MAPTKKGGEKKKGCSAINEVVTREYTINIHKRIHGVGFKKRAPRA
FT                   LKEIREFAMKEMGTPDVRIDTRLNKAIWAKGIRNVPYRIRVRLSRKRNEDEDSPNKHYT
FT                   LVTYVPVTTFKNLQTVNVDEN"
FT   gene            complement(<30241063..30278851)
FT                   /gene="Snx6"
FT                   /locus_tag="mCG_21236"
FT                   /note="gene_id=mCG21236.1"
FT   mRNA            complement(join(<30241063..30241112,30241186..30241345,
FT                   30243930..30244016,30245822..30245908,30249326..30249365,
FT                   30252577..30252652,30255802..30255907,30257766..30257861,
FT                   30260212..30260335,30262917..30263038,30266607..30266717,
FT                   30267219..30267323,30278604..30278651,30278798..30278851))
FT                   /gene="Snx6"
FT                   /locus_tag="mCG_21236"
FT                   /product="sorting nexin 6, transcript variant mCT20734"
FT                   /note="gene_id=mCG21236.1 transcript_id=mCT20734.2 created
FT                   on 05-SEP-2002"
FT   CDS             complement(join(<30241063..30241112,30241186..30241345,
FT                   30243930..30244016,30245822..30245908,30249326..30249365,
FT                   30252577..30252652,30255802..30255907,30257766..30257861,
FT                   30260212..30260335,30262917..30263038,30266607..30266717,
FT                   30267219..30267323,30278604..30278651,30278798..30278803))
FT                   /codon_start=1
FT                   /gene="Snx6"
FT                   /locus_tag="mCG_21236"
FT                   /product="sorting nexin 6, isoform CRA_b"
FT                   /note="gene_id=mCG21236.1 transcript_id=mCT20734.2
FT                   protein_id=mCP1802.2 isoform=CRA_b"
FT                   /protein_id="EDL36744.1"
FT                   /translation="MMEGLDDGPDFLSEEDRGLKAINVDLQSDAALQVDISDALSERDR
FT                   VKFTVHTKSSLPNFKQNEFSVVRQHEEFIWLHDSFVENEDYAGYIIPPAPPRPDFDASR
FT                   EKLQKLGEGEGSMTKEEFTKMKQELEAEYLAIFKKTVAMHEVFLCRVAAHPILRKDLNF
FT                   HVFLEYNQDLSVRGKNKKEKLEDFFKNMVKSADGVIVSGVKDVDDFFEHERTFLLEYHN
FT                   RVKDASAKSDRMTRSHKSAADDYNRIGSSLYALGTQDSTDICKFFLKVSELFDKTRKIE
FT                   ARVSADEDLKLSDLLKYYLRESQAAKKIEARVSADEDLKLSDLLKYYLRESQAAKDLLY
FT                   RRSRSLVDYENANKALDKARAKNKDVLQAETSQQLCCQKFEKISESAKQELIDFKTSKS
FT                   CCIQKKI"
FT   mRNA            complement(join(30248376..30248605,30252577..30252652,
FT                   30255802..30255907,30257766..30257861,30260212..30260335,
FT                   30262917..30263038,30266607..30266717,30267219..30267323,
FT                   30278604..>30278653))
FT                   /gene="Snx6"
FT                   /locus_tag="mCG_21236"
FT                   /product="sorting nexin 6, transcript variant mCT193461"
FT                   /note="gene_id=mCG21236.1 transcript_id=mCT193461.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(30248533..30248605,30252577..30252652,
FT                   30255802..30255907,30257766..30257861,30260212..30260335,
FT                   30262917..30263038,30266607..30266717,30267219..30267323,
FT                   30278604..>30278651))
FT                   /codon_start=1
FT                   /gene="Snx6"
FT                   /locus_tag="mCG_21236"
FT                   /product="sorting nexin 6, isoform CRA_a"
FT                   /note="gene_id=mCG21236.1 transcript_id=mCT193461.0
FT                   protein_id=mCP114416.0 isoform=CRA_a"
FT                   /protein_id="EDL36743.1"
FT                   /translation="EGLDDGPDFLSEEDRGLKAINVDLQSDAALQVDISDALSERDRVK
FT                   FTVHTKSSLPNFKQNEFSVVRQHEEFIWLHDSFVENEDYAGYIIPPAPPRPDFDASREK
FT                   LQKLGEGEGSMTKEEFTKMKQELEAEYLAIFKKTVAMHEVFLCRVAAHPILRKDLNFHV
FT                   FLEYNQDLSVRGKNKKEKLEDFFKNMVKSADGVIVSGVKDVDDFFEHERTFLLEYHNRV
FT                   KDASAKSDRMTRSHKSAADDYNRIGSSLYALGTQDSTDICKFFLKVSELFDKTRVSSKL
FT                   VRAAA"
FT   gene            complement(30342009..>30345935)
FT                   /gene="Cfl2"
FT                   /locus_tag="mCG_21240"
FT                   /note="gene_id=mCG21240.1"
FT   mRNA            complement(join(30342009..30344408,30344508..30344584,
FT                   30344951..30345004,30345915..>30345935))
FT                   /gene="Cfl2"
FT                   /locus_tag="mCG_21240"
FT                   /product="cofilin 2, muscle, transcript variant mCT172860"
FT                   /note="gene_id=mCG21240.1 transcript_id=mCT172860.0 created
FT                   on 29-AUG-2002"
FT   mRNA            complement(join(30342009..30344408,30344508..30344584,
FT                   30344840..30345004,30345915..>30345935))
FT                   /gene="Cfl2"
FT                   /locus_tag="mCG_21240"
FT                   /product="cofilin 2, muscle, transcript variant mCT172861"
FT                   /note="gene_id=mCG21240.1 transcript_id=mCT172861.0 created
FT                   on 29-AUG-2002"
FT   mRNA            complement(join(30342009..30344408,30344508..30344584,
FT                   30344697..30345004,30345915..>30345935))
FT                   /gene="Cfl2"
FT                   /locus_tag="mCG_21240"
FT                   /product="cofilin 2, muscle, transcript variant mCT20738"
FT                   /note="gene_id=mCG21240.1 transcript_id=mCT20738.1 created
FT                   on 29-AUG-2002"
FT   CDS             complement(30343584..>30343835)
FT                   /codon_start=1
FT                   /gene="Cfl2"
FT                   /locus_tag="mCG_21240"
FT                   /product="cofilin 2, muscle, isoform CRA_a"
FT                   /note="gene_id=mCG21240.1 transcript_id=mCT172860.0
FT                   protein_id=mCP95780.0 isoform=CRA_a"
FT                   /protein_id="EDL36740.1"
FT                   /translation="PGSTDLTLFVKSTFFLMRLIPYKECQLSFITCHQFILVSQCSFFL
FT                   PSYFFQRNSCANVFGFPMSVHYCIIYVYHMSLETLQIF"
FT   CDS             complement(30343584..>30343835)
FT                   /codon_start=1
FT                   /gene="Cfl2"
FT                   /locus_tag="mCG_21240"
FT                   /product="cofilin 2, muscle, isoform CRA_a"
FT                   /note="gene_id=mCG21240.1 transcript_id=mCT172861.0
FT                   protein_id=mCP95779.0 isoform=CRA_a"
FT                   /protein_id="EDL36741.1"
FT                   /translation="PGSTDLTLFVKSTFFLMRLIPYKECQLSFITCHQFILVSQCSFFL
FT                   PSYFFQRNSCANVFGFPMSVHYCIIYVYHMSLETLQIF"
FT   CDS             complement(join(30344296..30344408,30344508..30344584,
FT                   30344697..30345004,30345915..>30345935))
FT                   /codon_start=1
FT                   /gene="Cfl2"
FT                   /locus_tag="mCG_21240"
FT                   /product="cofilin 2, muscle, isoform CRA_b"
FT                   /note="gene_id=mCG21240.1 transcript_id=mCT20738.1
FT                   protein_id=mCP1799.1 isoform=CRA_b"
FT                   /protein_id="EDL36742.1"
FT                   /translation="TSAAGTMASGVTVNDEVIKVFNDMKVRKSSTQEEIKKRKKAVLFC
FT                   LSDDKRQIIVEEAKQILVGDIGDTVEDPYTSFVKLLPLNDCRYALYDATYETKESKKED
FT                   LVFIFWAPESAPLKSKMIYASSKDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKLGGSV
FT                   VVSLEGKPL"
FT   gene            30346202..30346877
FT                   /locus_tag="mCG_148275"
FT                   /note="gene_id=mCG148275.0"
FT   mRNA            join(30346202..30346322,30346490..30346877)
FT                   /locus_tag="mCG_148275"
FT                   /product="mCG148275"
FT                   /note="gene_id=mCG148275.0 transcript_id=mCT188538.0
FT                   created on 13-JAN-2004"
FT   CDS             30346690..30346863
FT                   /codon_start=1
FT                   /locus_tag="mCG_148275"
FT                   /product="mCG148275"
FT                   /note="gene_id=mCG148275.0 transcript_id=mCT188538.0
FT                   protein_id=mCP108109.0"
FT                   /protein_id="EDL36739.1"
FT                   /translation="MRSRNVGLYLEFCKKRVRSQKVSGDTLDRIIIQVKPETAQVTFLF
FT                   PCKWDVLRLLEK"
FT   gene            complement(<30373986..30465569)
FT                   /locus_tag="mCG_126024"
FT                   /note="gene_id=mCG126024.0"
FT   mRNA            complement(join(<30373986..30374078,30375048..30375190,
FT                   30377516..30377820,30379018..30379090,30379133..30379244,
FT                   30379329..30379576,30388045..30388193,30390359..30390510,
FT                   30391624..30391787,30395547..30396146,30397517..30397641,
FT                   30400104..30400211,30401513..30401678,30402110..30402259,
FT                   30402455..30402550,30406634..30406780,30414596..30414695,
FT                   30420623..30420674,30423171..30423258,30425990..30426091,
FT                   30433895..30434038,30454304..30454582,30465261..30465569))
FT                   /locus_tag="mCG_126024"
FT                   /product="mCG126024"
FT                   /note="gene_id=mCG126024.0 transcript_id=mCT127290.1
FT                   created on 03-APR-2003"
FT   CDS             complement(join(<30373986..30374078,30375048..30375190,
FT                   30377516..30377820,30379018..30379090,30379133..30379244,
FT                   30379329..30379576,30388045..30388193,30390359..30390510,
FT                   30391624..30391787,30395547..30396146,30397517..30397641,
FT                   30400104..30400211,30401513..30401678,30402110..30402259,
FT                   30402455..30402550,30406634..30406780,30414596..30414695,
FT                   30420623..30420674,30423171..30423190))
FT                   /codon_start=1
FT                   /locus_tag="mCG_126024"
FT                   /product="mCG126024"
FT                   /note="gene_id=mCG126024.0 transcript_id=mCT127290.1
FT                   protein_id=mCP79124.1"
FT                   /protein_id="EDL36738.1"
FT                   /translation="MESLKLSPANRRRGRPPKRISFGQEDSIASKQTAARYRNKAIKER
FT                   DKLLKQEEMRALEVLEEALVGNDSEGPLCELLFFFLTAIFQAMAEEEEEVAKEQITDAD
FT                   TKDLTEALDEDADPTKSALSAVAALAAAWPQLHQGADVTSANAKYRYQKRGGFDATDDA
FT                   CMELRLSNPSLVKKLSSTSVYDLTPGEKMKILHALCGKLLTLVSTRDFIEDYVDVLRQA
FT                   KQEFRELKAEQHRKEREATAARIRRRKEEKLKEQEQKMKEKQEKLKEDEQRNSAAVPGE
FT                   EEREDFDTSTENKNIEQKDLDPDVVTEDEDDPGSHKRSRRGKVGQTAVKQCIKQEEMNY
FT                   CIKQEPLSADAEEALRQEQQQKEKELLDKIQSAIACTNIFPLGRDRLYRRYWIFPSIPG
FT                   LFIEEDYSGLTEDMLLPRPSSFHNNAQPRDPQVSIKTEESFLSESTSSLDQGPFDDSVL
FT                   LPKPVHKPNRWCFYSSCAQLDQLIDALNSRGHRESALKETLLQEKSRICAQLAHFSEEK
FT                   FHFSDKPQADSKPVSSRGRSSGACDISQMSAERQLELRLRDFLLDIEDRIYQGTLGAIK
FT                   VTDRQVWRSALENGRYELLSEESKENGVIKTVNEDVEEMEMEQARVIVRDRLLGIKTET
FT                   PSTISTSASTPQSVSNVVHYLALALFQIEQGIERRFLKAPLDGNDSGRSYKTVLDRWRE
FT                   SLLSSASLSQVFLHLSTLDRSVMWSKSILNARCKICRKKGDAENMVLCDGCDRGHHTYC
FT                   VRPKLKAVPDGDWFCPECRPKQRSRRLSSRQRPSLESDEEMEEEGQSEEEEYEVEQDEE
FT                   DSDDDEALSPPKRGRPQVRLPIKTKGRFGPSFPSRSQRQDPGRYPSRSQQSTPKNTAKS
FT                   ASKNLRKTRSAPPTETRSLRVGSRSTRHSPSALQDVFVELLSPHSKRRGRKESSPVPLN
FT                   RRSSGRQGGVHELSAFEQLVVELVRHDDSWPFLKLVSKIQVPDYYDIIKKPIALNIIRE
FT                   KVNKCEYKLACE"
FT   gene            complement(30520867..30555848)
FT                   /gene="2700097O09Rik"
FT                   /locus_tag="mCG_21241"
FT                   /note="gene_id=mCG21241.2"
FT   mRNA            complement(join(30520867..30521149,30524397..30524487,
FT                   30528770..30528876,30532707..30532817,30534923..30535044,
FT                   30536521..30536659,30538458..30538579,30555718..30555848))
FT                   /gene="2700097O09Rik"
FT                   /locus_tag="mCG_21241"
FT                   /product="RIKEN cDNA 2700097O09"
FT                   /note="gene_id=mCG21241.2 transcript_id=mCT20739.2 created
FT                   on 17-JUN-2003"
FT   CDS             complement(join(30521033..30521149,30524397..30524487,
FT                   30528770..30528876,30532707..30532817,30534923..30535044,
FT                   30536521..30536659,30538458..30538579,30555718..30555814))
FT                   /codon_start=1
FT                   /gene="2700097O09Rik"
FT                   /locus_tag="mCG_21241"
FT                   /product="RIKEN cDNA 2700097O09"
FT                   /note="gene_id=mCG21241.2 transcript_id=mCT20739.2
FT                   protein_id=mCP1801.2"
FT                   /db_xref="GOA:Q6PGK3"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="MGI:MGI:1919908"
FT                   /db_xref="UniProtKB/TrEMBL:Q6PGK3"
FT                   /protein_id="EDL36737.1"
FT                   /translation="MDFQSARRAVLQLLGTTAPADVPALLHWMRTTRDFDEFTHDNNDI
FT                   MLKNIADDLRKCLPVEAVLCSEHLALQKIRQQPEPTVHVDAFLYDEDFIDTLCEEGKMS
FT                   RNYCTVCGSHRTAPLGFISHSFSLTELKFIYHHVLPDLSGKVLVDVGSRLGTVLYGGYL
FT                   YSSAVQLCGVELNGQFCQLQEMIIKKYQFGDRIKVLHADICTQSSLLQTADVIVMNNVF
FT                   EYFLTEAQQASAWNYIIHNVRKQGSLLVTVPSLQESLMGLQINVQLSSWVEEIPLSLDV
FT                   YSQRDIDQEALQQIHLYKVL"
FT   gene            <30556265..30592227
FT                   /gene="Srp54"
FT                   /locus_tag="mCG_126023"
FT                   /note="gene_id=mCG126023.1"
FT   mRNA            join(<30556265..30556463,30578331..30578481,
FT                   30579971..30580119,30580454..30580554,30581099..30581185,
FT                   30583465..30583635,30589610..30589705,30591334..30592227)
FT                   /gene="Srp54"
FT                   /locus_tag="mCG_126023"
FT                   /product="signal recognition particle 54, transcript
FT                   variant mCT127289"
FT                   /note="gene_id=mCG126023.1 transcript_id=mCT127289.1
FT                   created on 17-JUN-2003"
FT   mRNA            join(<30556268..30556473,30578331..30578481,
FT                   30579971..30580119,30580454..30580554,30581099..30581185,
FT                   30583465..30583635,30589610..30589705,30591334..30592227)
FT                   /gene="Srp54"
FT                   /locus_tag="mCG_126023"
FT                   /product="signal recognition particle 54, transcript
FT                   variant mCT185783"
FT                   /note="gene_id=mCG126023.1 transcript_id=mCT185783.0
FT                   created on 17-JUN-2003"
FT   CDS             join(<30556333..30556463,30578331..30578481,
FT                   30579971..30580119,30580454..30580554,30581099..30581185,
FT                   30583465..30583635,30589610..30589705,30591334..30591425)
FT                   /codon_start=1
FT                   /gene="Srp54"
FT                   /locus_tag="mCG_126023"
FT                   /product="signal recognition particle 54, isoform CRA_a"
FT                   /note="gene_id=mCG126023.1 transcript_id=mCT127289.1
FT                   protein_id=mCP79115.2 isoform=CRA_a"
FT                   /protein_id="EDL36735.1"
FT                   /translation="FLELGSWAAGSVPVLQLPAFLGFLRRRGASLRTRRPCGATALVAY
FT                   TEMDPVIIASEGVEKFKNENFEIIIVDTSGRHKQEDSLFEEMLQVSNAIQPDNIVYVMD
FT                   ASIGQACEAQAKAFKDKVDVASVIVTKLDGHAKGGGALSAVAATKSPIIFIGTGEHIDD
FT                   FEPFKTQPFISKLLGMGDIEGLIDKVNELKLDDNKALIEKWKHELDSTDGAKVFSKQPG
FT                   RIQRVARGSGVSTRDVQELLTQYTKFAQMVKKMGGIKGLFKGGDMSKNVSQSQMAKLNQ
FT                   QMAKMMDPRVLHHMGGMAGLQSMMRQFQQGAAGNMKGMMGFNNM"
FT   CDS             join(<30556460..30556473,30578331..30578481,
FT                   30579971..30580119,30580454..30580554,30581099..30581185,
FT                   30583465..30583635,30589610..30589705,30591334..30591425)
FT                   /codon_start=1
FT                   /gene="Srp54"
FT                   /locus_tag="mCG_126023"
FT                   /product="signal recognition particle 54, isoform CRA_b"
FT                   /note="gene_id=mCG126023.1 transcript_id=mCT185783.0
FT                   protein_id=mCP107041.0 isoform=CRA_b"
FT                   /protein_id="EDL36736.1"
FT                   /translation="WRLLRYTEMDPVIIASEGVEKFKNENFEIIIVDTSGRHKQEDSLF
FT                   EEMLQVSNAIQPDNIVYVMDASIGQACEAQAKAFKDKVDVASVIVTKLDGHAKGGGALS
FT                   AVAATKSPIIFIGTGEHIDDFEPFKTQPFISKLLGMGDIEGLIDKVNELKLDDNKALIE
FT                   KWKHELDSTDGAKVFSKQPGRIQRVARGSGVSTRDVQELLTQYTKFAQMVKKMGGIKGL
FT                   FKGGDMSKNVSQSQMAKLNQQMAKMMDPRVLHHMGGMAGLQSMMRQFQQGAAGNMKGMM
FT                   GFNNM"
FT   gene            30604617..30610881
FT                   /locus_tag="mCG_145759"
FT                   /note="gene_id=mCG145759.0"
FT   mRNA            join(30604617..30604691,30606088..30606185,
FT                   30607754..30610881)
FT                   /locus_tag="mCG_145759"
FT                   /product="mCG145759"
FT                   /note="gene_id=mCG145759.0 transcript_id=mCT185764.0
FT                   created on 17-JUN-2003"
FT   CDS             join(30604661..30604691,30606088..30606185,
FT                   30607754..30607957)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145759"
FT                   /product="mCG145759"
FT                   /note="gene_id=mCG145759.0 transcript_id=mCT185764.0
FT                   protein_id=mCP107022.0"
FT                   /protein_id="EDL36734.1"
FT                   /translation="MLRAATSTLSVCDFLGEKIASVLGISTPKYQYAIDEYYRMKKEEE
FT                   EEEEENRMSEEAERQYQQNKLQTDSIVQTDQPETVSSSFVNINFEMEEDCEAIKENKQR
FT                   PVSVPP"
FT   gene            complement(30609956..30632060)
FT                   /gene="4930511A21Rik"
FT                   /locus_tag="mCG_126018"
FT                   /note="gene_id=mCG126018.1"
FT   mRNA            complement(join(30609956..30611046,30612137..30612196,
FT                   30613995..30614132,30617139..30617275,30617657..30617732,
FT                   30618718..30618850,30621575..30621645,30622853..30622950,
FT                   30626849..30626961,30627482..30627586,30627965..30628092,
FT                   30631665..30631866,30631986..30632060))
FT                   /gene="4930511A21Rik"
FT                   /locus_tag="mCG_126018"
FT                   /product="RIKEN cDNA 4930511A21"
FT                   /note="gene_id=mCG126018.1 transcript_id=mCT127284.1
FT                   created on 17-JUN-2003"
FT   CDS             complement(join(30617722..30617732,30618718..30618850,
FT                   30621575..30621645,30622853..30622950,30626849..30626961,
FT                   30627482..30627586,30627965..30628092,30631665..30631722))
FT                   /codon_start=1
FT                   /gene="4930511A21Rik"
FT                   /locus_tag="mCG_126018"
FT                   /product="RIKEN cDNA 4930511A21"
FT                   /note="gene_id=mCG126018.1 transcript_id=mCT127284.1
FT                   protein_id=mCP79080.1"
FT                   /protein_id="EDL36733.1"
FT                   /translation="MDWKDVLRRRLASPNTDPKRKKSEQELKDEEMDLFTKYYSEWKGG
FT                   RKNTNEFYKTIPRFYYRLPAEDEVLLQKLREESRAVFLQRKSRELLDNEELQNLWFLLD
FT                   KHQIPPMIGEEAMINYENFLKVGEKAGPKCKQFFTAKVFAKLLHTDSYGRISIMQFFNY
FT                   VMRKVWLHQTRIGLSLYDVAGQGYLRESDLENYILELIPTLPQLDGLEKSFYSFYVCTA
FT                   VRKFFFFLDPLRTAKR"
FT   gene            30628648..30716835
FT                   /locus_tag="mCG_22352"
FT                   /note="gene_id=mCG22352.3"
FT   mRNA            join(30628648..30628737,30635408..30635455,
FT                   30637798..30637930,30672485..30672592,30711426..30711574,
FT                   30713594..30713789,30716569..30716748,30716776..30716835)
FT                   /locus_tag="mCG_22352"
FT                   /product="mCG22352, transcript variant mCT172863"
FT                   /note="gene_id=mCG22352.3 transcript_id=mCT172863.1 created
FT                   on 17-JUN-2003"
FT   CDS             join(30628700..30628737,30635408..30635455,
FT                   30637798..30637930,30672485..30672592,30711426..30711574,
FT                   30713594..30713789,30716569..30716712)
FT                   /codon_start=1
FT                   /locus_tag="mCG_22352"
FT                   /product="mCG22352, isoform CRA_a"
FT                   /note="gene_id=mCG22352.3 transcript_id=mCT172863.1
FT                   protein_id=mCP95782.0 isoform=CRA_a"
FT                   /db_xref="GOA:V9GXF2"
FT                   /db_xref="MGI:MGI:1913382"
FT                   /db_xref="UniProtKB/TrEMBL:V9GXF2"
FT                   /protein_id="EDL36730.1"
FT                   /translation="MVLYHHPLPAADSIPGRQWKGQFTTIQKSGQCSGCGRTIEPIHLS
FT                   PEEYEFLKEKIMRDVIDGGDQYKKTTPQELKRFESFVNSCPPFDIVIDGLNVAKMFPKG
FT                   RESQNLLGVVSQLAQQNLQLLVLGRKHMLRPSSQWRKEEMEQVRKQAHCFFADNISEDD
FT                   PFLLYATLNSGNHCKFITKDLLRDHKACLPDARTQRLFFKWQQGHQLAIMKGFQKSKLT
FT                   FQHILSYDTVVQRTGDSWHIPYDEDLVQRSSCEVPTKWLCLQRKTPDPC"
FT   mRNA            join(30631820..30633955,30635408..30635455,
FT                   30637798..30637930,30672485..30672592,30711426..30711574,
FT                   30713594..30713789,30716569..30716748,30716776..30716835)
FT                   /locus_tag="mCG_22352"
FT                   /product="mCG22352, transcript variant mCT21719"
FT                   /note="gene_id=mCG22352.3 transcript_id=mCT21719.3 created
FT                   on 17-JUN-2003"
FT   mRNA            join(30631820..30633955,30635408..30636656)
FT                   /locus_tag="mCG_22352"
FT                   /product="mCG22352, transcript variant mCT185787"
FT                   /note="gene_id=mCG22352.3 transcript_id=mCT185787.0 created
FT                   on 17-JUN-2003"
FT   CDS             join(30632979..30633955,30635408..30635455,
FT                   30637798..30637930,30672485..30672592,30711426..30711574,
FT                   30713594..30713789,30716569..30716712)
FT                   /codon_start=1
FT                   /locus_tag="mCG_22352"
FT                   /product="mCG22352, isoform CRA_c"
FT                   /note="gene_id=mCG22352.3 transcript_id=mCT21719.3
FT                   protein_id=mCP3415.2 isoform=CRA_c"
FT                   /db_xref="GOA:Q8JZY4"
FT                   /db_xref="MGI:MGI:1913382"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8JZY4"
FT                   /protein_id="EDL36732.1"
FT                   /translation="MTFYLSGFRSIPKLWKSNPYFELGPATSSTPFFLCAIGNQQRWFS
FT                   VKPTTPPNSKALNLLDTKARTHRKGNDNNGQVSSDPHYFAAGAAKKRSHIGANPQNQGH
FT                   ALPVRSSVQLPTKPLNSAEWDKLKEDFKGKASFEDFIISQMARNCCSVDVAKSLLAWVA
FT                   AKNNGIVGYNLLVKYLYLCVFHKQTSEVIDVYEIMKAKYKSLESGGYTLLIRGLIHSDR
FT                   WRESLLLLEDIKKVMVPSKKNYGDCIQGALLHQDVNTAWNLYQELIGHNLIPPLETLKA
FT                   FFDYGKDINDDHYSDKLLDILLYLRNNQLYPGESFAHSIKTWFESIPGRQWKGQFTTIQ
FT                   KSGQCSGCGRTIEPIHLSPEEYEFLKEKIMRDVIDGGDQYKKTTPQELKRFESFVNSCP
FT                   PFDIVIDGLNVAKMFPKGRESQNLLGVVSQLAQQNLQLLVLGRKHMLRPSSQWRKEEME
FT                   QVRKQAHCFFADNISEDDPFLLYATLNSGNHCKFITKDLLRDHKACLPDARTQRLFFKW
FT                   QQGHQLAIMKGFQKSKLTFQHILSYDTVVQRTGDSWHIPYDEDLVQRSSCEVPTKWLCL
FT                   QRKTPDPC"
FT   CDS             join(30632979..30633955,30635408..30635459)
FT                   /codon_start=1
FT                   /locus_tag="mCG_22352"
FT                   /product="mCG22352, isoform CRA_b"
FT                   /note="gene_id=mCG22352.3 transcript_id=mCT185787.0
FT                   protein_id=mCP107045.0 isoform=CRA_b"
FT                   /protein_id="EDL36731.1"
FT                   /translation="MTFYLSGFRSIPKLWKSNPYFELGPATSSTPFFLCAIGNQQRWFS
FT                   VKPTTPPNSKALNLLDTKARTHRKGNDNNGQVSSDPHYFAAGAAKKRSHIGANPQNQGH
FT                   ALPVRSSVQLPTKPLNSAEWDKLKEDFKGKASFEDFIISQMARNCCSVDVAKSLLAWVA
FT                   AKNNGIVGYNLLVKYLYLCVFHKQTSEVIDVYEIMKAKYKSLESGGYTLLIRGLIHSDR
FT                   WRESLLLLEDIKKVMVPSKKNYGDCIQGALLHQDVNTAWNLYQELIGHNLIPPLETLKA
FT                   FFDYGKDINDDHYSDKLLDILLYLRNNQLYPGESFAHSIKTWFESIPGRQWKGQFTTIQ
FT                   KR"
FT   gene            complement(30729995..30730597)
FT                   /locus_tag="mCG_49804"
FT                   /note="gene_id=mCG49804.1"
FT   mRNA            complement(30729995..30730597)
FT                   /locus_tag="mCG_49804"
FT                   /product="mCG49804"
FT                   /note="gene_id=mCG49804.1 transcript_id=mCT49987.1 created
FT                   on 24-SEP-2002"
FT   CDS             complement(30730151..30730561)
FT                   /codon_start=1
FT                   /locus_tag="mCG_49804"
FT                   /product="mCG49804"
FT                   /note="gene_id=mCG49804.1 transcript_id=mCT49987.1
FT                   protein_id=mCP26448.0"
FT                   /protein_id="EDL36729.1"
FT                   /translation="MKASGTLREYKVVGRCLPTPKCHTPPLYRMRIFAPNHVVAKSRFL
FT                   YFVSQLKKMKKSSGEIVYCGQVFEKSPLRVKNFGIWLRYDSRSGTHNMYREYRDLTTAG
FT                   AVTQCYRDMGARHRARAHSIQIMKVEEIAAGK"
FT   gene            <30733178..>30779248
FT                   /gene="Psma6"
FT                   /locus_tag="mCG_22345"
FT                   /note="gene_id=mCG22345.2"
FT   mRNA            join(<30733178..30733323,30741801..30741895,
FT                   30742334..30742415,30744459..30744608,30779234..>30779248)
FT                   /gene="Psma6"
FT                   /locus_tag="mCG_22345"
FT                   /product="proteasome (prosome, macropain) subunit, alpha
FT                   type 6, transcript variant mCT172862"
FT                   /note="gene_id=mCG22345.2 transcript_id=mCT172862.0 created
FT                   on 29-AUG-2002"
FT   mRNA            join(<30733229..30733323,30741801..30741895,
FT                   30742334..30742415,30744459..30744614,30746519..30746697,
FT                   30748736..30748830,30752569..30752783)
FT                   /gene="Psma6"
FT                   /locus_tag="mCG_22345"
FT                   /product="proteasome (prosome, macropain) subunit, alpha
FT                   type 6, transcript variant mCT21712"
FT                   /note="gene_id=mCG22345.2 transcript_id=mCT21712.1 created
FT                   on 29-AUG-2002"
FT   CDS             join(<30733233..30733323,30741801..30741895,
FT                   30742334..30742415,30744459..30744608,30779234..>30779248)
FT                   /codon_start=1
FT                   /gene="Psma6"
FT                   /locus_tag="mCG_22345"
FT                   /product="proteasome (prosome, macropain) subunit, alpha
FT                   type 6, isoform CRA_a"
FT                   /note="gene_id=mCG22345.2 transcript_id=mCT172862.0
FT                   protein_id=mCP95781.0 isoform=CRA_a"
FT                   /protein_id="EDL36727.1"
FT                   /translation="NSRNAMSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSV
FT                   AVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITESIGCVMTGMTADSRSQVQRARYEAA
FT                   NWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLVVYEF"
FT   CDS             join(<30733233..30733323,30741801..30741895,
FT                   30742334..30742415,30744459..30744614,30746519..30746697,
FT                   30748736..30748830,30752569..30752626)
FT                   /codon_start=1
FT                   /gene="Psma6"
FT                   /locus_tag="mCG_22345"
FT                   /product="proteasome (prosome, macropain) subunit, alpha
FT                   type 6, isoform CRA_b"
FT                   /note="gene_id=mCG22345.2 transcript_id=mCT21712.1
FT                   protein_id=mCP3431.1 isoform=CRA_b"
FT                   /protein_id="EDL36728.1"
FT                   /translation="NSRNAMSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSV
FT                   AVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITESIGCVMTGMTADSRSQVQRARYEAA
FT                   NWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAG
FT                   YYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEV
FT                   GVVTVENPKFRILTEAEIDAHLVALAERD"
FT   gene            complement(30824098..>30827772)
FT                   /gene="Nfkbia"
FT                   /locus_tag="mCG_22347"
FT                   /note="gene_id=mCG22347.2"
FT   mRNA            complement(join(30824098..30824656,30825093..30825353,
FT                   30825458..30825546,30825807..30826017,30826357..30826465,
FT                   30826868..>30827772))
FT                   /gene="Nfkbia"
FT                   /locus_tag="mCG_22347"
FT                   /product="nuclear factor of kappa light chain gene enhancer
FT                   in B-cells inhibitor, alpha"
FT                   /note="gene_id=mCG22347.2 transcript_id=mCT21714.2 created
FT                   on 29-AUG-2002"
FT   CDS             complement(join(30824609..30824656,30825093..30825353,
FT                   30825458..30825546,30825807..30826017,30826357..30826465,
FT                   30826868..>30827157))
FT                   /codon_start=1
FT                   /gene="Nfkbia"
FT                   /locus_tag="mCG_22347"
FT                   /product="nuclear factor of kappa light chain gene enhancer
FT                   in B-cells inhibitor, alpha"
FT                   /note="gene_id=mCG22347.2 transcript_id=mCT21714.2
FT                   protein_id=mCP3400.1"
FT                   /protein_id="EDL36726.1"
FT                   /translation="VRPRQPAASSLQPAPAQPRTAMFQPAGHGQDWAMEGPRDGLKKER
FT                   LVDDRHDSGLDSMKDEEYEQMVKELREIRLQPQEAPLAAEPWKQQLTEDGDSFLHLAII
FT                   HEEKPLTMEVIGQVKGDLAFLNFQNNLQQTPLHLAVITNQPGIAEALLKAGCDPELRDF
FT                   RGNTPLHLACEQGCLASVAVLTQTCTPQHLHSVLQATNYNGHTCLHLASIHGYLAIVEH
FT                   LVTLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCGADVNRVTYQGYSPYQLTWGR
FT                   PSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEDELPYDDCVFGGQRLTL"
FT   gene            <30900009..30901667
FT                   /locus_tag="mCG_22349"
FT                   /note="gene_id=mCG22349.0"
FT   mRNA            <30900009..30901667
FT                   /locus_tag="mCG_22349"
FT                   /product="mCG22349"
FT                   /note="gene_id=mCG22349.0 transcript_id=mCT21716.0 created
FT                   on 29-AUG-2002"
FT   CDS             <30900009..30901157
FT                   /codon_start=1
FT                   /locus_tag="mCG_22349"
FT                   /product="mCG22349"
FT                   /note="gene_id=mCG22349.0 transcript_id=mCT21716.0
FT                   protein_id=mCP3405.0"
FT                   /protein_id="EDL36725.1"
FT                   /translation="QPIHHLLCQDGATTTTGTMSYPYPALTPEQKKELSDIARRIVAPG
FT                   KGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILFHETLYQ
FT                   KADDGRPFPQIIKSKGGVVGIKVDKGVVPLAGTNGETTTQGLDDLSGRCAQYKQDGADF
FT                   AKWRCVLKIGKHTPSALAIMENANVLAHYASICQQNGIVPIVEPEILPDGDHDLKHCQY
FT                   VTEKVLAAVYKALSDHHVYLEGTLLKPNMVTAGHACTQVFSSEEIAMATVTALRRTVPP
FT                   AVPGVTFLSGGQSEEEASINLNAINKCPLLKPWALTFSYGRALQASALKAWGGKKENTK
FT                   DAQEEYIKRAQANSLACQGKYTPSNESGAAASESLFISNHAY"
FT   gene            <30934194..>30935675
FT                   /gene="Insm2"
FT                   /locus_tag="mCG_22350"
FT                   /note="gene_id=mCG22350.1"
FT   mRNA            <30934194..>30935675
FT                   /gene="Insm2"
FT                   /locus_tag="mCG_22350"
FT                   /product="insulinoma-associated 2"
FT                   /note="gene_id=mCG22350.1 transcript_id=mCT21717.1 created
FT                   on 29-AUG-2002"
FT   CDS             30934194..30935675
FT                   /codon_start=1
FT                   /gene="Insm2"
FT                   /locus_tag="mCG_22350"
FT                   /product="insulinoma-associated 2"
FT                   /note="gene_id=mCG22350.1 transcript_id=mCT21717.1
FT                   protein_id=mCP3406.1"
FT                   /protein_id="EDL36724.1"
FT                   /translation="MPRGFLVKRTKRSGSSYRARPVEPLFPPPGPLAAQSSPEEPGRGL
FT                   LGSPCLAPPQDDAEWGAGGGDGPGPSPAKPAGPELRRAFLERCLRSPVSAESFPSATAF
FT                   CSAAPAAVTSGEELVPPQVPVSVPIPVPGPAPHGLQRRGKGAPICASAPAAVRKPKAVR
FT                   RLSFADEVTTSPVLGLKIKEEEPGAPARALGGVRTPLGEFICQLCKHQYADPFALAQHR
FT                   CSRIVRVEYRCPECDKVFSCPANLASHRRWHKPRPTPACAASKPPHAPLTPPDPSLATG
FT                   KENGRVPRTDDQHPQAPDSSGDGQHRDSAARPGLQALVYPEAARPQAPYPEVILGRHGP
FT                   GSSGASAGATSEVFVCPYCHKKFRRQAYLRKHLGTHETGSARAPTPGFGSERTAPLTFA
FT                   CPLCGAHFPSADIREKHRLWHAVREELLLPALVGAPSEAGPGGASDGSAQQIFSCKYCP
FT                   STFFSSPGLTRHINKCHPSESRQVLLLQMPLRPGC"
FT   gene            complement(30938588..>31033385)
FT                   /locus_tag="mCG_22351"
FT                   /note="gene_id=mCG22351.2"
FT   mRNA            complement(join(30938588..30938989,30947355..30947479,
FT                   30975103..30975230,30976844..30977002,30993568..30993723,
FT                   31000054..31000177,31007954..31008025,31010905..31011766,
FT                   31018408..31018591,31018988..31019122,31024260..31024328,
FT                   31027857..31027967,31029645..31029753,31032337..31032395,
FT                   31033260..>31033385))
FT                   /locus_tag="mCG_22351"
FT                   /product="mCG22351"
FT                   /note="gene_id=mCG22351.2 transcript_id=mCT21718.1 created
FT                   on 29-AUG-2002"
FT   CDS             complement(join(30938841..30938989,30947355..30947479,
FT                   30975103..30975230,30976844..30977002,30993568..30993723,
FT                   31000054..31000177,31007954..31008025,31010905..31011766,
FT                   31018408..31018591,31018988..31019122,31024260..31024328,
FT                   31027857..31027967,31029645..>31029707))
FT                   /codon_start=1
FT                   /locus_tag="mCG_22351"
FT                   /product="mCG22351"
FT                   /note="gene_id=mCG22351.2 transcript_id=mCT21718.1
FT                   protein_id=mCP3407.1"
FT                   /protein_id="EDL36723.1"
FT                   /translation="VHESHHPQIKEALNVICVSLKFTNKTVAHVACNMLHMLVHYVPRL
FT                   QIHQPQSPLKIIQILIATITHLLPSTEASSYEMDKRLVVSLLLCLLDWIMALPLKTLLQ
FT                   PVHATGAENDKTEKSVLNCIYKVLHGCVYGAQSFSNPKYFPISLSDLASVDYDPFMHLE
FT                   SLKEPEPLHSPDSERSSKLQPVTEVKTQMQQGLISIAARTVITHLVNHLGHYPMSGGPA
FT                   MLTSQVCENHDNHYSESTELSPELFESPNIQFFVLNNTTLVSCIQIRSEESMPGGGLAA
FT                   GLVSANSNVRIIVRDLSGKYSWDSAILYGPPIVSGLPEPTSFILSMSDQEKPEEPPTSN
FT                   ECLEDIAVKDGLSLQLRRFRETVPTWSTIREEEDVLDELLQYLGTTSPECLQRTGISLN
FT                   VPAPQPLCISEKQENDVINAILKQYTEEKEFVEKHFNDLNMKASEQDEPTPQKPQSAFY
FT                   YCRLLLSILGMNSWDKRRSFHLLKKNEKLLRELRNLDSRQCRETHKIAVFYVAEGQEDK
FT                   YSILTNIGGSQAYEDFVAGLGWEVNLTNHCGFMGGLQKNRSTGLTTPYFATSTVEVIFH
FT                   VSTRMPSDSDDSLTKKLRHLGNDEVHIVWSEHTRDYRRGIIPTEFGDVLIVIYPMKNHM
FT                   FSIQIMKKPEVPFFGPLFDGAIVNGKVLPIMVRSTAINASRALKSLIPLYQNFYEERAR
FT                   YLQTIVQHHLEPTTFEDFAAQVFSPAPYHHFPADAGSYPEIPPSDAAPAAQVDGADLAS
FT                   PMSPRTSKSRMSMKLRRSSGSANKS"
FT   gene            complement(31046967..>31155625)
FT                   /locus_tag="mCG_145561"
FT                   /note="gene_id=mCG145561.1"
FT   mRNA            complement(join(31046967..31047284,31051460..31051636,
FT                   31052591..31052807,31054082..31054206,31057272..31057439,
FT                   31072709..31072870,31073830..31074067,31075932..31076061,
FT                   31081612..31081760,31092418..31092552,31097026..31097223,
FT                   31105105..31105344,31110505..31110713,31111778..31111916,
FT                   31117271..31117386,31120660..31120837,31121913..31121956,
FT                   31124802..31124859,31129485..31129534,31130156..31130266,
FT                   31155118..>31155539))
FT                   /locus_tag="mCG_145561"
FT                   /product="mCG145561, transcript variant mCT184985"
FT                   /note="gene_id=mCG145561.1 transcript_id=mCT184985.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(31047121..31047284,31051460..31051636,
FT                   31052591..31052807,31054082..31054206,31057272..31057439,
FT                   31072709..31072870,31073830..31074067,31075932..31076061,
FT                   31081612..31081760,31092418..31092552,31097026..31097223,
FT                   31105105..31105344,31110505..31110713,31111778..31111916,
FT                   31117271..31117386,31120660..31120837,31121913..31121956,
FT                   31124802..31124859,31129485..31129534,31130156..31130266,
FT                   31155118..>31155292))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145561"
FT                   /product="mCG145561, isoform CRA_a"
FT                   /note="gene_id=mCG145561.1 transcript_id=mCT184985.0
FT                   protein_id=mCP105146.0 isoform=CRA_a"
FT                   /protein_id="EDL36721.1"
FT                   /translation="PLPRPPPALGRRDPAGRGRGGRRMFSKKPHGDVKKSTQKVLDTKK
FT                   DALTRLKHLRIVIENAESIDLKQFFDQHFSHIYYVFFENFVTIEASLKQKGHKSQREEL
FT                   DAILFIFEKILQLLPERIHQRWQFHSIGLILKKLLHTGNSLKIRREGVRLFLLWLQALQ
FT                   DNCSKEQLWMFSCLIPGFSAPQSEYGPRTLDNLINPPLSLQETQVTIEEVTPLVPPQSG
FT                   DKGQEDLTSYFLEALLKYIVIQVKSLEWKNKENQERGFSFLFSHFKKFYLPYIFPNICK
FT                   ENSLYHPVLDIPQIRPKPHYVMIKKDAETNETIYCTKEPFIQARVIVIRWLVSFWLEPK
FT                   PHSGPNIPGMEGEVLPKNIQRAAASLVSREESKNDTVDKVDKSAEPEQSHSNTSTLTER
FT                   EPSSSSLCSIDEEHLTDIEIVRRVFSSKRSNVNFVTEIFRQAFLLPICEAAAMRKVVKV
FT                   YQEWIQQEEKPLFMQEPEDTAITCSDIPCSETVADHDSAIEDGEKREEENGTSTSEHVR
FT                   NSSWTKNGSYQEAFHVCEEATEQNIQAGTQAVLQVFIINSSNIFLLEPANEIKNLLDEH
FT                   TDMCKRILNIYRYMVVQVSMDKKTWEQMLLVLLRVTESVLKMSSQAFLQFQGKKSMTLA
FT                   GRLAGPLFQTLIVAWIKANLNVYISRELWDDLLSVLSSLTYWEELATEWSLTMETLTKV
FT                   LARNLYSLDLSDLPLDKLSEQKQKKHKGKGVGHEFQKVSVDKSFSRGWSRDQPGQAPMR
FT                   QRSATTTGSPGTEKARSIVRQKTVDIDDAQILPRSTRVRHFSQSEDTGNEVFGALHEEQ
FT                   PLPRSSSTSDILEPFTVERAKVNKEDTSPKLPPLNSETGGNSANVPDLMDEFIAERLRS
FT                   GNASTMTRRGSSPGSLEIPKDLPDILNKQNQMRPVDDPGVPSEWTSPASAGSSDLMSSD
FT                   SHSDSFSAFQCEGRKFDNFGFGTDIGIPSSADVDLGSGHHQSTEEQEVASLTTLHLDSE
FT                   TSSLNQQAFSAEVATVTGSESASPVHSALGSRSQTPSPSTLSRAHIEQKDLQLDEKLHH
FT                   SVLQTPDDLGNA"
FT   mRNA            complement(join(<31056681..31057439,31072709..31072870,
FT                   31073830..31074067,31075932..31076061,31081612..31081760,
FT                   31092418..31092552,31097026..31097223,31105105..31105344,
FT                   31110505..31110713,31111778..31111916,31117271..31117386,
FT                   31120660..31120837,31121913..31121956,31124802..31124859,
FT                   31129485..31129534,31130156..31130266,31155118..>31155625))
FT                   /locus_tag="mCG_145561"
FT                   /product="mCG145561, transcript variant mCT193462"
FT                   /note="gene_id=mCG145561.1 transcript_id=mCT193462.0
FT                   created on 09-MAR-2004"
FT   CDS             complement(join(<31056681..31057439,31072709..31072870,
FT                   31073830..31074067,31075932..31076061,31081612..31081760,
FT                   31092418..31092552,31097026..31097223,31105105..31105344,
FT                   31110505..31110713,31111778..31111916,31117271..31117386,
FT                   31120660..31120837,31121913..31121956,31124802..31124859,
FT                   31129485..31129534,31130156..31130266,31155118..>31155292))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145561"
FT                   /product="mCG145561, isoform CRA_b"
FT                   /note="gene_id=mCG145561.1 transcript_id=mCT193462.0
FT                   protein_id=mCP114405.0 isoform=CRA_b"
FT                   /protein_id="EDL36722.1"
FT                   /translation="PLPRPPPALGRRDPAGRGRGGRRMFSKKPHGDVKKSTQKVLDTKK
FT                   DALTRLKHLRIVIENAESIDLKQFFDQHFSHIYYVFFENFVTIEASLKQKGHKSQREEL
FT                   DAILFIFEKILQLLPERIHQRWQFHSIGLILKKLLHTGNSLKIRREGVRLFLLWLQALQ
FT                   DNCSKEQLWMFSCLIPGFSAPQSEYGPRTLDNLINPPLSLQETQVTIEEVTPLVPPQSG
FT                   DKGQEDLTSYFLEALLKYIVIQVKSLEWKNKENQERGFSFLFSHFKKFYLPYIFPNICK
FT                   ENSLYHPVLDIPQIRPKPHYVMIKKDAETNETIYCTKEPFIQARVIVIRWLVSFWLEPK
FT                   PHSGPNIPGMEGEVLPKNIQRAAASLVSREESKNDTVDKVDKSAEPEQSHSNTSTLTER
FT                   EPSSSSLCSIDEEHLTDIEIVRRVFSSKRSNVNFVTEIFRQAFLLPICEAAAMRKVVKV
FT                   YQEWIQQEEKPLFMQEPEDTAITCSDIPCSETVADHDSAIEDGEKREEENGTSTSEHVR
FT                   NSSWTKNGSYQEAFHVCEEATEQNIQAGTQAVLQVFIINSSNIFLLEPANEIKNLLDEH
FT                   TDMCKRILNIYRYMVVQVSMDKKTWEQMLLVLLRVTESVLKMSSQAFLQFQGKKSMTLA
FT                   GRLAGPLFQTLIVAWIKANLNVYISRELWDDLLSVLSSLTYWEELATEWSLTMETLTKV
FT                   LARNLYSLDLSDLPLDKLSEQKQKKHKGKGVGHEFQKVSVDKSFSRGWSRDQPGQAPMR
FT                   QRSATTTGSPGTEKARSIVRQKTVDIDDAQILPRSTRVRHFSQSEDTGNEVFGALHEEQ
FT                   PLPRSSSTSDILEPFTVERAKGAVPVVDSSSRHAPSLQSSTEASSITRSTESHLTDTHS
FT                   RESSLEVGDSIYDHLCHLIGPVELADAALDQIQYIDLEGDDDLLSSLKEYFKENQESRS
FT                   KSELGKDTASQEVLIDVTREEIPSFHKVEYTGQEVKPENLMSFVGTSENTPFQKEPSSA
FT                   VFTSTLAPNHSDSYPRSQTAEKAKQLSLDEHSSDPSSDSLC"
FT   gene            31155066..31156036
FT                   /locus_tag="mCG_148265"
FT                   /note="gene_id=mCG148265.0"
FT   mRNA            31155066..31156036
FT                   /locus_tag="mCG_148265"
FT                   /product="mCG148265"
FT                   /note="gene_id=mCG148265.0 transcript_id=mCT188528.0
FT                   created on 13-JAN-2004"
FT   CDS             31155309..31155536
FT                   /codon_start=1
FT                   /locus_tag="mCG_148265"
FT                   /product="mCG148265"
FT                   /note="gene_id=mCG148265.0 transcript_id=mCT188528.0
FT                   protein_id=mCP108100.0"
FT                   /protein_id="EDL36720.1"
FT                   /translation="MRSPASAAAARAPLPGPPLAAAAARNLQPRLQYGGSAPRAAATRR
FT                   RGAAAAAQAAAGIPTAAERERSAAAPLLSP"
FT   gene            <31170859..31204195
FT                   /locus_tag="mCG_22342"
FT                   /note="gene_id=mCG22342.2"
FT   mRNA            join(<31170859..31171101,31176027..31176117,
FT                   31178852..31178979,31179740..31179819,31195542..31195625,
FT                   31195844..31195908,31200409..31200535,31202620..31202978,
FT                   31203856..31204193)
FT                   /locus_tag="mCG_22342"
FT                   /product="mCG22342, transcript variant mCT193429"
FT                   /note="gene_id=mCG22342.2 transcript_id=mCT193429.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(<31170860..31171101,31176027..31176117,
FT                   31178852..31178979,31179740..31179819,31194545..31194641,
FT                   31195542..31195712,31195856..31195908,31197588..31197627,
FT                   31200409..31200535,31202620..31204195)
FT                   /locus_tag="mCG_22342"
FT                   /product="mCG22342, transcript variant mCT21709"
FT                   /note="gene_id=mCG22342.2 transcript_id=mCT21709.1 created
FT                   on 05-SEP-2002"
FT   CDS             join(<31170861..31171101,31176027..31176117,
FT                   31178852..31178979,31179740..31179819,31194545..31194641,
FT                   31195542..31195712,31195856..31195908,31197588..31197627,
FT                   31200409..31200535,31202620..31202737)
FT                   /codon_start=1
FT                   /locus_tag="mCG_22342"
FT                   /product="mCG22342, isoform CRA_c"
FT                   /note="gene_id=mCG22342.2 transcript_id=mCT21709.1
FT                   protein_id=mCP3419.1 isoform=CRA_c"
FT                   /protein_id="EDL36719.1"
FT                   /translation="SVAGWVGAFGAPFTEAAVAGLGAGSGKRRRGWKMPVHSRGDKKET
FT                   NHHDEMEVDYAENEGSSSEDEDTESSSVSEDGDSSEMDDEDCERRRMECLDEMSNLEKQ
FT                   FTDLKDQLYKERLSQVDAKLQEVIAGKAPEYLEPLATLQENMQIRTKVAGIYRELCLES
FT                   VKNKYECEIQASRQHCESEKLLLYDTVQSELEEKIRRLEEDRHSIDITSELWNDELQSR
FT                   KKRKDPFSPDKKKPVVVSDILSALWVSTLWKPFRHGVEGTRRLMVHCVYMLQDLDILED
FT                   WTTIRKAMATLGPHRVKTEPPVKLEKHLHSARSEEGRLYYDGEWYIRGQTICIDRKDEC
FT                   PTSAVITTINHDEVWFKRPDGSKSKLYISQLQKGKYSIKHS"
FT   CDS             join(<31170861..31171101,31176027..31176117,
FT                   31178852..31178979,31179740..31179819,31195542..31195625,
FT                   31195844..31195855)
FT                   /codon_start=1
FT                   /locus_tag="mCG_22342"
FT                   /product="mCG22342, isoform CRA_b"
FT                   /note="gene_id=mCG22342.2 transcript_id=mCT193429.0
FT                   protein_id=mCP114418.0 isoform=CRA_b"
FT                   /protein_id="EDL36718.1"
FT                   /translation="SVAGWVGAFGAPFTEAAVAGLGAGSGKRRRGWKMPVHSRGDKKET
FT                   NHHDEMEVDYAENEGSSSEDEDTESSSVSEDGDSSEMDDEDCERRRMECLDEMSNLEKQ
FT                   FTDLKDQLYKERLSQVDAKLQEVIAGKAPEYLEPLATLQENMQIRTKVAGIYRELCLES
FT                   VKNKYECEIQASRQHCESCGTTSFSHGKRGRIRSAPTRRSRSLSQVHI"
FT   mRNA            join(<31171073..31171101,31176027..31176117,
FT                   31178852..31178979,31179740..31179819,31194545..31194641,
FT                   31195542..31195625,31195844..31195908,31197588..31197627,
FT                   31200409..31200535,31202620..31204193)
FT                   /locus_tag="mCG_22342"
FT                   /product="mCG22342, transcript variant mCT193428"
FT                   /note="gene_id=mCG22342.2 transcript_id=mCT193428.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<31171074..31171101,31176027..31176117,
FT                   31178852..31178979,31179740..31179819,31194545..31194641,
FT                   31195542..31195625,31195844..31195908,31197588..31197627,
FT                   31200409..31200535,31202620..31202737)
FT                   /codon_start=1
FT                   /locus_tag="mCG_22342"
FT                   /product="mCG22342, isoform CRA_a"
FT                   /note="gene_id=mCG22342.2 transcript_id=mCT193428.0
FT                   protein_id=mCP114417.0 isoform=CRA_a"
FT                   /protein_id="EDL36717.1"
FT                   /translation="SVSEDGDSSEMDDEDCERRRMECLDEMSNLEKQFTDLKDQLYKER
FT                   LSQVDAKLQEVIAGKAPEYLEPLATLQENMQIRTKVAGIYRELCLESVKNKYECEIQAS
FT                   RQHCESEKLLLYDTVQSELEEKIRRLEEDRHSIDITSELWNDELQSRKKRKDPFSPDKK
FT                   KPVVVSGPYIVYMLQDLDILEDWTTIRKAMATLGPHRVKTEPPVKLEKHLHSARSEEGR
FT                   LYYDGEWYIRGQTICIDRKDECPTSAVITTINHDEVWFKRPDGSKSKLYISQLQKGKYS
FT                   IKHS"
FT   gene            31523357..31524763
FT                   /pseudo
FT                   /locus_tag="mCG_22343"
FT                   /note="gene_id=mCG22343.1"
FT   mRNA            join(31523357..31523449,31523683..31523877,
FT                   31524407..31524763)
FT                   /pseudo
FT                   /locus_tag="mCG_22343"
FT                   /note="gene_id=mCG22343.1 transcript_id=mCT21710.1 created
FT                   on 05-SEP-2002"
FT   gene            <31587031..31600198
FT                   /locus_tag="mCG_145557"
FT                   /note="gene_id=mCG145557.0"
FT   mRNA            join(<31587031..31587127,31595130..31595276,
FT                   31597724..31597761,31599259..31600198)
FT                   /locus_tag="mCG_145557"
FT                   /product="mCG145557"
FT                   /note="gene_id=mCG145557.0 transcript_id=mCT184981.0
FT                   created on 05-JUN-2003"
FT   CDS             <31599892..31600134
FT                   /codon_start=1
FT                   /locus_tag="mCG_145557"
FT                   /product="mCG145557"
FT                   /note="gene_id=mCG145557.0 transcript_id=mCT184981.0
FT                   protein_id=mCP105139.0"
FT                   /protein_id="EDL36716.1"
FT                   /translation="ALLYPRDRLHKHKAQGPNSGVHCRIHPTIDLKFSLLIQRNIPQTQ
FT                   ELVLIPIYRSTQCFLPSFIIFLNSYMTISLIYLKG"
FT   gene            complement(31662099..31679616)
FT                   /gene="Mbip"
FT                   /locus_tag="mCG_15696"
FT                   /note="gene_id=mCG15696.1"
FT   mRNA            complement(join(31662099..31662579,31664009..31664047,
FT                   31669578..31669675,31671083..31671235,31671544..31671609,
FT                   31673981..31674077,31674137..31674383,31676016..31676189,
FT                   31679452..31679616))
FT                   /gene="Mbip"
FT                   /locus_tag="mCG_15696"
FT                   /product="MAP3K12 binding inhibitory protein 1, transcript
FT                   variant mCT19236"
FT                   /note="gene_id=mCG15696.1 transcript_id=mCT19236.2 created
FT                   on 05-SEP-2002"
FT   mRNA            complement(join(31662127..31662576,31664009..31664047,
FT                   31669578..31669675,31671083..31671235,31671544..31671609,
FT                   31673981..31674077,31674165..31674383,31676016..31676135,
FT                   31679452..31679577))
FT                   /gene="Mbip"
FT                   /locus_tag="mCG_15696"
FT                   /product="MAP3K12 binding inhibitory protein 1, transcript
FT                   variant mCT172854"
FT                   /note="gene_id=mCG15696.1 transcript_id=mCT172854.0 created
FT                   on 05-SEP-2002"
FT   CDS             complement(join(31662475..31662576,31664009..31664047,
FT                   31669578..31669675,31671083..31671235,31671544..31671609,
FT                   31673981..31674077,31674165..31674356))
FT                   /codon_start=1
FT                   /gene="Mbip"
FT                   /locus_tag="mCG_15696"
FT                   /product="MAP3K12 binding inhibitory protein 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG15696.1 transcript_id=mCT172854.0
FT                   protein_id=mCP95773.0 isoform=CRA_a"
FT                   /protein_id="EDL36714.1"
FT                   /translation="MKENSTATEIRQTEAETKSELRAIHPTEDLQDEGKPKDCDVGDVK
FT                   KTQNLFDPEVVQIKAGKAEIDRRISAFIERKQAEINENNVREFCNVIDCNQENSCARTD
FT                   AVFTPYPGFKSHVKVSRVVNTYGPQTRPEGIAGSGHKPTGMLRDCGNQAVEERLQNIEA
FT                   HLRLQTGGPVPRDIYQRIKKLEDKILELEGISPEYFQSVNFSGKRRKVQPPQNYSLAEL
FT                   DEKISALKRALLRKSREADSMAAHLP"
FT   CDS             complement(join(31662475..31662579,31664009..31664047,
FT                   31669578..31669675,31671083..31671158))
FT                   /codon_start=1
FT                   /gene="Mbip"
FT                   /locus_tag="mCG_15696"
FT                   /product="MAP3K12 binding inhibitory protein 1, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG15696.1 transcript_id=mCT19236.2
FT                   protein_id=mCP3427.2 isoform=CRA_b"
FT                   /protein_id="EDL36715.1"
FT                   /translation="MLRDCGNQAVEERLQNIEAHLRLQTGGPVPRDIYQRIKKLEDKIL
FT                   ELEGISPEYFQSVNFSGKRRKVQPPQQNYSLAELDEKISALKRALLRKSREADSMAAHL
FT                   P"
FT   gene            <31822939..>31863734
FT                   /locus_tag="mCG_1041801"
FT                   /note="gene_id=mCG1041801.0"
FT   mRNA            join(<31822939..31823136,31838032..31838138,
FT                   31839003..31839189,31851919..31851978,31852071..31852102,
FT                   31853561..31853649,31857813..31857945,31860924..31860957,
FT                   31863351..>31863734)
FT                   /locus_tag="mCG_1041801"
FT                   /product="mCG1041801"
FT                   /note="gene_id=mCG1041801.0 transcript_id=mCT159505.0
FT                   created on 24-SEP-2002"
FT   CDS             join(31822939..31823136,31838032..31838138,
FT                   31839003..31839189,31851919..31851978,31852071..31852102,
FT                   31853561..31853649,31857813..31857945,31860924..31860957,
FT                   31863351..31863734)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041801"
FT                   /product="mCG1041801"
FT                   /note="gene_id=mCG1041801.0 transcript_id=mCT159505.0
FT                   protein_id=mCP78511.0"
FT                   /protein_id="EDL36712.1"
FT                   /translation="MNVHSGLALSQPNICEDAAKPYCGMTDWSYWGYLSAAFLQIFVSH
FT                   QPTILQGRTGAHRSFGFLSLAEAECRGAAEPRALPPEEAGETENSTYLESKPRLGERSP
FT                   DQSSCSSPPFGALSSISAPRPDSLCSALIPAGNNSSRESEEEGEATPHSPTDSECRGSP
FT                   SPGICSKFDSEDTEAELNGGPLNGTIGELPGGLRDCENRSSTVLSYDDGTLIHRKRTGA
FT                   VPEFIGVSTLVHTRGAYVVSKGLEGVSSWSQTGATKIETHSWLDPLGPADLEAPRSGQI
FT                   PGSPKSVRPRKSANLPGLSKSKPDPNIANGAPSPDHLKISWKTLKQVHPYERPSTKQWH
FT                   GALSPRGPDSPADVNAGLANWTQTPLTLFSRAPSYLHLARPYLQCIPTNCDISFLVCLL
FT                   AFRTPALS"
FT   gene            complement(31824166..>31839389)
FT                   /locus_tag="mCG_146097"
FT                   /note="gene_id=mCG146097.0"
FT   mRNA            complement(join(31824166..31824753,31824984..31825119,
FT                   31826896..31827087,31837168..31837341,31837824..>31839389))
FT                   /locus_tag="mCG_146097"
FT                   /product="mCG146097"
FT                   /note="gene_id=mCG146097.0 transcript_id=mCT186200.0
FT                   created on 14-JUL-2003"
FT   CDS             complement(31837899..>31838150)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146097"
FT                   /product="mCG146097"
FT                   /note="gene_id=mCG146097.0 transcript_id=mCT186200.0
FT                   protein_id=mCP107276.0"
FT                   /protein_id="EDL36713.1"
FT                   /translation="GCPHLSPSLGLDSKYVLFSVSPASSGGSALGSAAPRHSASCVINP
FT                   EVGLTLTQSPDGRVTLSLKLSLFIRHFYLYQCCFHLEI"
FT   gene            complement(<31867482..31871388)
FT                   /gene="Titf1"
FT                   /locus_tag="mCG_142469"
FT                   /note="gene_id=mCG142469.0"
FT   mRNA            complement(join(<31867482..31868227,31869135..31869520,
FT                   31870789..31871388))
FT                   /gene="Titf1"
FT                   /locus_tag="mCG_142469"
FT                   /product="thyroid transcription factor 1"
FT                   /note="gene_id=mCG142469.0 transcript_id=mCT180508.0
FT                   created on 13-FEB-2003"
FT   CDS             complement(join(31867482..31868227,31869135..31869507))
FT                   /codon_start=1
FT                   /gene="Titf1"
FT                   /locus_tag="mCG_142469"
FT                   /product="thyroid transcription factor 1"
FT                   /note="gene_id=mCG142469.0 transcript_id=mCT180508.0
FT                   protein_id=mCP103430.0"
FT                   /protein_id="EDL36711.1"
FT                   /translation="MSMSPKHTTPFSVSDILSPLEESYKKVGMEGGGLGAPLAAYRQGQ
FT                   AAPPAAAMQQHAVGHHGAVTAAYHMTAAGVPQLSHSAVGGYCNGNLGNMSELPPYQDTM
FT                   RNSASGPGWYGANPDPRFPAISRFMGPASGMNMSGMGGLGSLGDVSKNMAPLPSAPRRK
FT                   RRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKRQAKD
FT                   KAAQQQLQQDSGGGGGGGGGAGCPQQQQAQQQSPRRVAVPVLVKDGKPCQAGAPAPGAA
FT                   SLQSHAQQQAQQQAQAAQAAAAAISVGSGGAGLGAHPGHQPGSAGQSPDLAHHAASPAG
FT                   LQGQVSSLSHLNSSGSDYGAMSCSTLLYGRTW"
FT   gene            31933274..31936767
FT                   /locus_tag="mCG_124340"
FT                   /note="gene_id=mCG124340.0"
FT   mRNA            join(31933274..31933380,31933775..31933880,
FT                   31934025..31934109,31936094..31936221,31936593..31936767)
FT                   /locus_tag="mCG_124340"
FT                   /product="mCG124340"
FT                   /note="gene_id=mCG124340.0 transcript_id=mCT125581.0
FT                   created on 05-SEP-2002"
FT   CDS             join(31933370..31933380,31933775..31933880,
FT                   31934025..31934048)
FT                   /codon_start=1
FT                   /locus_tag="mCG_124340"
FT                   /product="mCG124340"
FT                   /note="gene_id=mCG124340.0 transcript_id=mCT125581.0
FT                   protein_id=mCP78882.1"
FT                   /protein_id="EDL36710.1"
FT                   /translation="MWKVFEESGEMRSQLEITFEDGTRSEKPPASSLVTLFLQAAPFSL
FT                   L"
FT   gene            complement(31953823..31955557)
FT                   /gene="Nkx2-9"
FT                   /locus_tag="mCG_15692"
FT                   /note="gene_id=mCG15692.2"
FT   mRNA            complement(join(31953823..31954552,31955185..31955557))
FT                   /gene="Nkx2-9"
FT                   /locus_tag="mCG_15692"
FT                   /product="NK2 transcription factor related, locus 9
FT                   (Drosophila)"
FT                   /note="gene_id=mCG15692.2 transcript_id=mCT19235.2 created
FT                   on 24-FEB-2003"
FT   CDS             complement(join(31953993..31954552,31955185..31955332))
FT                   /codon_start=1
FT                   /gene="Nkx2-9"
FT                   /locus_tag="mCG_15692"
FT                   /product="NK2 transcription factor related, locus 9
FT                   (Drosophila)"
FT                   /note="gene_id=mCG15692.2 transcript_id=mCT19235.2
FT                   protein_id=mCP3411.2"
FT                   /db_xref="GOA:O70584"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017970"
FT                   /db_xref="InterPro:IPR020479"
FT                   /db_xref="MGI:MGI:1270158"
FT                   /db_xref="UniProtKB/Swiss-Prot:O70584"
FT                   /protein_id="EDL36709.1"
FT                   /translation="MATSGRLGFTVRSLLNLPEQDAKPRVRREQQTCVPQTAAWLESEC
FT                   SHYLSSDESGLETSPADSSQLASLRRESPGSDPEKRRKRRVLFSKAQTLELERRFRQQR
FT                   YLSAPEREQLARLLRLTPTQVKIWFQNHRYKLKRGRAPGITEPSDMAASSDLHAAPGLL
FT                   RRVVVPVLVHDRPPSNNGRGEGTSAVPQDKCSARLATACPVPGYTAFGPGSALGLFPAY
FT                   QHLAPPALVSWNW"
FT   gene            31970983..31971716
FT                   /locus_tag="mCG_148261"
FT                   /note="gene_id=mCG148261.0"
FT   mRNA            31970983..31971716
FT                   /locus_tag="mCG_148261"
FT                   /product="mCG148261"
FT                   /note="gene_id=mCG148261.0 transcript_id=mCT188524.0
FT                   created on 13-JAN-2004"
FT   CDS             31971063..31971395
FT                   /codon_start=1
FT                   /locus_tag="mCG_148261"
FT                   /product="mCG148261"
FT                   /note="gene_id=mCG148261.0 transcript_id=mCT188524.0
FT                   protein_id=mCP108093.0"
FT                   /protein_id="EDL36708.1"
FT                   /translation="MGSWKNHGRKKSGRHSASKRERKTQKPGMGSRAGHRLLFSLICLF
FT                   VCLFFIGYFLYLHFKFYPLSSPRNTFIPSLSPCFYEDVPLSTHSNVPTLRERAFTGPRA
FT                   ASPIDV"
FT   gene            <32046404..32062167
FT                   /gene="Pax9"
FT                   /locus_tag="mCG_15693"
FT                   /note="gene_id=mCG15693.2"
FT   mRNA            join(<32046404..32046799,32047509..32048135,
FT                   32050949..32051091,32060591..32062167)
FT                   /gene="Pax9"
FT                   /locus_tag="mCG_15693"
FT                   /product="paired box gene 9, transcript variant mCT19237"
FT                   /note="gene_id=mCG15693.2 transcript_id=mCT19237.2 created
FT                   on 29-AUG-2002"
FT   mRNA            join(<32046664..32048135,32050949..32051091,
FT                   32060591..32061272)
FT                   /gene="Pax9"
FT                   /locus_tag="mCG_15693"
FT                   /product="paired box gene 9, transcript variant mCT193493"
FT                   /note="gene_id=mCG15693.2 transcript_id=mCT193493.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<32046730..32046799,32047509..32048135,
FT                   32050949..32051091,32060591..32060845)
FT                   /codon_start=1
FT                   /gene="Pax9"
FT                   /locus_tag="mCG_15693"
FT                   /product="paired box gene 9, isoform CRA_a"
FT                   /note="gene_id=mCG15693.2 transcript_id=mCT19237.2
FT                   protein_id=mCP3412.2 isoform=CRA_a"
FT                   /protein_id="EDL36706.1"
FT                   /translation="EQEKSFFLGVRNWGRVGVLLRAMEPAFGEVNQLGGVFVNGRPLPN
FT                   AIRLRIVELAQLGIRPCDISRQLRVSHGCVSKILARYNETGSILPGAIGGSKPRVTTPT
FT                   VVKHIRTYKQRDPGIFAWEIRDRLLADGVCDKYNVPSVSSISRILRNKIGNLAQQGHYD
FT                   SYKQHQPAPQPALPYNHIYSYPSPITAAAAKVPTPPGVPAIPGSVALPRTWPSSHSVTD
FT                   ILGIRSITDQGVSDSSPYHSPKVEEWSSLGRNNFPAAAPHAVNGLEKGALEQEAKYGQA
FT                   PNGLPAVSSFVSASSMAPYPTPAQVSPYMTYSAAPSGYVAGHGWQHAGSTPLSPHNCDI
FT                   PASLAFKGMQAAREGSHSVTASAL"
FT   CDS             join(<32047349..32048135,32050949..32051091,
FT                   32060591..32060845)
FT                   /codon_start=1
FT                   /gene="Pax9"
FT                   /locus_tag="mCG_15693"
FT                   /product="paired box gene 9, isoform CRA_b"
FT                   /note="gene_id=mCG15693.2 transcript_id=mCT193493.0
FT                   protein_id=mCP114458.0 isoform=CRA_b"
FT                   /protein_id="EDL36707.1"
FT                   /translation="DVWLRPEQSGFGATPVLIEGCHNPAPGRSWRPSGRRLSQAVGARC
FT                   GALCAPFAEPAFGEVNQLGGVFVNGRPLPNAIRLRIVELAQLGIRPCDISRQLRVSHGC
FT                   VSKILARYNETGSILPGAIGGSKPRVTTPTVVKHIRTYKQRDPGIFAWEIRDRLLADGV
FT                   CDKYNVPSVSSISRILRNKIGNLAQQGHYDSYKQHQPAPQPALPYNHIYSYPSPITAAA
FT                   AKVPTPPGVPAIPGSVALPRTWPSSHSVTDILGIRSITDQGVSDSSPYHSPKVEEWSSL
FT                   GRNNFPAAAPHAVNGLEKGALEQEAKYGQAPNGLPAVSSFVSASSMAPYPTPAQVSPYM
FT                   TYSAAPSGYVAGHGWQHAGSTPLSPHNCDIPASLAFKGMQAAREGSHSVTASAL"
FT   gene            complement(32078110..>32209694)
FT                   /gene="Slc25a21"
FT                   /locus_tag="mCG_124335"
FT                   /note="gene_id=mCG124335.1"
FT   mRNA            complement(join(32078110..32078259,32089751..32089915,
FT                   32117240..32117392,32121418..32121477,32126591..32126657,
FT                   32209608..>32209694))
FT                   /gene="Slc25a21"
FT                   /locus_tag="mCG_124335"
FT                   /product="solute carrier family 25 (mitochondrial
FT                   oxodicarboxylate carrier), member 21"
FT                   /note="gene_id=mCG124335.1 transcript_id=mCT125576.1
FT                   created on 05-SEP-2002"
FT   CDS             complement(join(32078239..32078259,32089751..32089915,
FT                   32117240..32117392,32121418..32121477,32126591..32126657,
FT                   32209608..>32209693))
FT                   /codon_start=1
FT                   /gene="Slc25a21"
FT                   /locus_tag="mCG_124335"
FT                   /product="solute carrier family 25 (mitochondrial
FT                   oxodicarboxylate carrier), member 21"
FT                   /note="gene_id=mCG124335.1 transcript_id=mCT125576.1
FT                   protein_id=mCP78838.1"
FT                   /protein_id="EDL36705.1"
FT                   /translation="RFQVQRSVTDPQSYRTVRGSFQMIFRTEGLFGFYKGIIPPILAET
FT                   PKRAVKFSTFELYKKFLGYMSLSPGLTFLIAGLGSGLTEAVVVNPFEVVKVGLQVNRNL
FT                   FKEVTSHVFLLLRESNKKQPSTFAYARQIIKKEGLGFQGLNKGLTATLGRHGIFNMVYF
FT                   GFYHNVKNIIPSSKVPVKIP"
FT   gene            32582375..32862776
FT                   /locus_tag="mCG_1040730"
FT                   /note="gene_id=mCG1040730.1"
FT   mRNA            join(32582375..32582643,32655391..32655597,
FT                   32658347..32658473,32659695..32659800,32677921..32678050,
FT                   32684393..32684426,32684686..32684856,32721403..32721510,
FT                   32773607..32773701,32822569..32822799,32862041..32862776)
FT                   /locus_tag="mCG_1040730"
FT                   /product="mCG1040730"
FT                   /note="gene_id=mCG1040730.1 transcript_id=mCT124850.0
FT                   created on 02-APR-2003"
FT   gene            complement(<32624710..>32629981)
FT                   /locus_tag="mCG_49426"
FT                   /note="gene_id=mCG49426.1"
FT   mRNA            complement(join(<32624710..32625264,32629907..>32629981))
FT                   /locus_tag="mCG_49426"
FT                   /product="mCG49426"
FT                   /note="gene_id=mCG49426.1 transcript_id=mCT49609.0 created
FT                   on 24-SEP-2002"
FT   CDS             complement(join(32624710..32625264,32629907..32629981))
FT                   /codon_start=1
FT                   /locus_tag="mCG_49426"
FT                   /product="mCG49426"
FT                   /note="gene_id=mCG49426.1 transcript_id=mCT49609.0
FT                   protein_id=mCP26462.0"
FT                   /protein_id="EDL36704.1"
FT                   /translation="MAVTQKQTPDVSASLQSWRMCNKHSGEYQAQGAASTFRGTLEYFA
FT                   SEVLHKPLCDGTVDWRCLVAVLHEVLCGLPRFHSRNTAEMYGNILNKPLQLKPKITNSA
FT                   THLLEGLLQKDWTKGLSAMGDFMEIKSHIFFSLINWDDSINKITQPFNPNVSRSSYLQH
FT                   FSPEVTDESVPSSISRSPDSILVTARGKEAAEAFLSFSYIPPMDSF"
FT   CDS             join(32655464..32655597,32658347..32658473,
FT                   32659695..32659800,32677921..32678050,32684393..32684426,
FT                   32684686..32684856,32721403..32721510,32773607..32773701,
FT                   32822569..32822799,32862041..32862107)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1040730"
FT                   /product="mCG1040730"
FT                   /note="gene_id=mCG1040730.1 transcript_id=mCT124850.0
FT                   protein_id=mCP78903.1"
FT                   /db_xref="GOA:G3UVV8"
FT                   /db_xref="InterPro:IPR026175"
FT                   /db_xref="MGI:MGI:1920740"
FT                   /db_xref="UniProtKB/TrEMBL:G3UVV8"
FT                   /protein_id="EDL36703.1"
FT                   /translation="MNSEQSIRELGNEVPSEDLELPGRKPSNFQVLQPCRDEGASAECS
FT                   IVECGKNYEPVISHQVIPDLNKETSVAYLQKELEILRASNTKLQEKLAKEDKEKRRLKL
FT                   KLELQEKAAEADIAERTAALVEEVYFAQRERDEAIMCRLQLALKERDEAIAHVKHMEMS
FT                   LKMLENINPEENDMTLQELLNRINNADTGIAIQKNGAVIVDTIYKTKECRKRITAEEMS
FT                   AVLEERDAALSQCKRLHQELHRLKEQNQTSANNTRRPTAENNQERALKAKLLSMQQARE
FT                   TAVEQYKRLEEEIQTLRVYYSLHKSLSQEESLKDQFNHALSTYEEALKNRESVVSITQQ
FT                   QNEELATQLQQALTEHSHMELQLQCAVEASQAANEKVQKLERLVDVLRKKVGTGTVRTV
FT                   I"
FT   gene            complement(<32883847..32885291)
FT                   /locus_tag="mCG_53544"
FT                   /note="gene_id=mCG53544.1"
FT   mRNA            complement(join(<32883847..32884079,32885014..32885291))
FT                   /locus_tag="mCG_53544"
FT                   /product="mCG53544"
FT                   /note="gene_id=mCG53544.1 transcript_id=mCT53727.1 created
FT                   on 24-SEP-2002"
FT   CDS             complement(join(32883847..32884079,32885014..32885260))
FT                   /codon_start=1
FT                   /locus_tag="mCG_53544"
FT                   /product="mCG53544"
FT                   /note="gene_id=mCG53544.1 transcript_id=mCT53727.1
FT                   protein_id=mCP26437.1"
FT                   /protein_id="EDL36702.1"
FT                   /translation="MEDIMTKELQQFFCHRENVVDSLLSKLFRPFDFAAFTNAKAVQSV
FT                   CGEDLVTKEITVRICNAEPKQKSNRRLKGSGRFGGHPVHLTSNVCGRTSLRVALRIFCQ
FT                   TTTSVYTLFHQRSHHYTAQAVTFDSSVPLLATTLYVMGSHQRYGWAMEHEGSLYF"
FT   gene            complement(32906531..>32911674)
FT                   /gene="Foxa1"
FT                   /locus_tag="mCG_22881"
FT                   /note="gene_id=mCG22881.1"
FT   mRNA            complement(join(32906531..32909263,32911569..>32911674))
FT                   /gene="Foxa1"
FT                   /locus_tag="mCG_22881"
FT                   /product="forkhead box A1"
FT                   /note="gene_id=mCG22881.1 transcript_id=mCT21627.1 created
FT                   on 29-AUG-2002"
FT   CDS             complement(join(32907929..32909263,32911569..>32911673))
FT                   /codon_start=1
FT                   /gene="Foxa1"
FT                   /locus_tag="mCG_22881"
FT                   /product="forkhead box A1"
FT                   /note="gene_id=mCG22881.1 transcript_id=mCT21627.1
FT                   protein_id=mCP3399.0"
FT                   /protein_id="EDL36701.1"
FT                   /translation="LDGCVGRAGSRMLGTVKMEGHESNDWNSYYADTQEAYSSVPVSNM
FT                   NSGLGSMNSMNTYMTMNTMTTSGNMTPASFNMSYANTGLGAGLSPGAVAGMPGASAGAM
FT                   NSMTAAGVTAMGTALSPGGMGSMGAQPATSMNGLGPYAAAMNPCMSPMAYAPSNLGRSR
FT                   AGGGGDAKTFKRSYPHAKPPYSYISLITMAIQQAPSKMLTLSEIYQWIMDLFPYYRQNQ
FT                   QRWQNSIRHSLSFNDCFVKVARSPDKPGKGSYWTLHPDSGNMFENGCYLRRQKRFKCEK
FT                   QPGAGGGSGGGGSKGGPESRKDPSGPGNPSAESPLHRGVHGKASQLEGAPAPGPAASPQ
FT                   TLDHSGATATGGASELKSPASSSAPPISSGPGALASVPPSHPAHGLAPHESQLHLKGDP
FT                   HYSFNHPFSINNLMSSSEQQHKLDFKAYEQALQYSPYGATLPASLPLGSASVATRSPIE
FT                   PSALEPAYYQGVYSRPVLNTS"
FT   gene            <32930440..32987825
FT                   /gene="4921506M07Rik"
FT                   /locus_tag="mCG_22880"
FT                   /note="gene_id=mCG22880.1"
FT   mRNA            join(<32930440..32930560,32942243..32943127,
FT                   32982018..32982131,32983167..32983379,32987683..32987825)
FT                   /gene="4921506M07Rik"
FT                   /locus_tag="mCG_22880"
FT                   /product="RIKEN cDNA 4921506M07"
FT                   /note="gene_id=mCG22880.1 transcript_id=mCT21626.1 created
FT                   on 05-SEP-2002"
FT   CDS             join(<32930552..32930560,32942243..32943127,
FT                   32982018..32982131,32983167..32983379,32987683..32987811)
FT                   /codon_start=1
FT                   /gene="4921506M07Rik"
FT                   /locus_tag="mCG_22880"
FT                   /product="RIKEN cDNA 4921506M07"
FT                   /note="gene_id=mCG22880.1 transcript_id=mCT21626.1
FT                   protein_id=mCP3414.1"
FT                   /protein_id="EDL36699.1"
FT                   /translation="TSQVQFVKMSTIPKHFGLTAREESYMFKELEKIRQKTKKDYEQLR
FT                   QRLAARPTLKARYEDQEKEERPGTAGGSGEKKGHVSWAAKPSSGAQSGERPAAADLQGA
FT                   PHSARGSPGKPQRFSPRDFYMRSSAFRRHPPYKEAPAIAPQVGTTRPVILLRPRSRRKR
FT                   LREKGRGAPVTTRVSKGRAQESPVLDVTHTRYRLASSLSSLSSDIDDSARLRRLRIRTH
FT                   FQRDLVRWHHKPSSRSRREGSSASQGTAPLLGIRYLPKNIEEIIASLQSEAQQASDQTI
FT                   KELIQSILGQNYDIAMEDISLMEQMYLRPSQVQFEVPKEVEEKNFPPSITEHPVVPSIY
FT                   EELPETVSSIFQVEQEEAMKWVDRDENIAAFKSQETLDIVPPEDDGKPLDSALPTTDAK
FT                   LTSQPTLKVEPRGFMQIRGREVKPTYKSRPKKLPKPRIYVKPEDKKLIKK"
FT   gene            complement(32952175..>32984324)
FT                   /locus_tag="mCG_146313"
FT                   /note="gene_id=mCG146313.0"
FT   mRNA            complement(join(32952175..32952397,32953546..32956139,
FT                   32959082..32959332,32983079..32983230,32984159..>32984324))
FT                   /locus_tag="mCG_146313"
FT                   /product="mCG146313"
FT                   /note="gene_id=mCG146313.0 transcript_id=mCT186416.0
FT                   created on 14-JUL-2003"
FT   CDS             complement(32955065..>32955409)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146313"
FT                   /product="mCG146313"
FT                   /note="gene_id=mCG146313.0 transcript_id=mCT186416.0
FT                   protein_id=mCP107278.0"
FT                   /protein_id="EDL36700.1"
FT                   /translation="YEPRLFYKLTAPNNNNNNNNNKQKQKISLPSHRHSFHMSCVIVCI
FT                   CLAQRVALLEGVTLLEFVCHCGCGFKTLILAAWKSVFCQQSSDEDVELSAPLVPCFSGC
FT                   RHVPDLMILD"
FT   gene            complement(32998228..32998731)
FT                   /locus_tag="mCG_50296"
FT                   /note="gene_id=mCG50296.1"
FT   mRNA            complement(32998228..32998731)
FT                   /locus_tag="mCG_50296"
FT                   /product="mCG50296"
FT                   /note="gene_id=mCG50296.1 transcript_id=mCT50479.1 created
FT                   on 17-SEP-2002"
FT   CDS             complement(32998268..32998705)
FT                   /codon_start=1
FT                   /locus_tag="mCG_50296"
FT                   /product="mCG50296"
FT                   /note="gene_id=mCG50296.1 transcript_id=mCT50479.1
FT                   protein_id=mCP26467.0"
FT                   /protein_id="EDL36698.1"
FT                   /translation="MKFNPFVTSDRSKNHKRHFNARSHIRRKIMSSPLSKELRQKYNVC
FT                   SMPIQKDDEVQVVRGHYKGQQIGKVVQVYRKKYVIHIEQVHREKANSTTVHVGIHPSEV
FT                   VITRLKLDKDCKKILERKAKSRQVGKKKGKYKEETIEKMEE"
FT   gene            complement(33027120..33028573)
FT                   /locus_tag="mCG_1041796"
FT                   /note="gene_id=mCG1041796.0"
FT   mRNA            complement(join(33027120..33027238,33027917..33028045,
FT                   33028182..33028573))
FT                   /locus_tag="mCG_1041796"
FT                   /product="mCG1041796"
FT                   /note="gene_id=mCG1041796.0 transcript_id=mCT159500.0
FT                   created on 24-SEP-2002"
FT   CDS             complement(join(33027134..33027238,33027917..33028045,
FT                   33028182..33028259))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041796"
FT                   /product="mCG1041796"
FT                   /note="gene_id=mCG1041796.0 transcript_id=mCT159500.0
FT                   protein_id=mCP78459.1"
FT                   /protein_id="EDL36697.1"
FT                   /translation="MGSISDHQGSQPRMAVARQEKARCKMLEVSKGSRKYGHTIQDTVV
FT                   SGGPVHRAPPTLPTVNVAADAHFKVSLEGQSTWYSLVVSLGGQRSKNQQVCQRYIANV"
FT   gene            complement(33064146..33064493)
FT                   /locus_tag="mCG_1041542"
FT                   /note="gene_id=mCG1041542.1"
FT   mRNA            complement(33064146..33064493)
FT                   /locus_tag="mCG_1041542"
FT                   /product="mCG1041542"
FT                   /note="gene_id=mCG1041542.1 transcript_id=mCT159246.1
FT                   created on 17-SEP-2002"
FT   CDS             complement(33064238..33064390)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041542"
FT                   /product="mCG1041542"
FT                   /note="gene_id=mCG1041542.1 transcript_id=mCT159246.1
FT                   protein_id=mCP78392.1"
FT                   /protein_id="EDL36696.1"
FT                   /translation="MQANNAKAVSARAEAIKALVKPQAIKPKMPKGPSHKLSHLAFITH
FT                   PKLRK"
FT   gene            <33079570..33108157
FT                   /locus_tag="mCG_22879"
FT                   /note="gene_id=mCG22879.1"
FT   mRNA            join(<33079570..33079647,33084085..33084295,
FT                   33086916..33087068,33107220..33107445,33107836..33108157)
FT                   /locus_tag="mCG_22879"
FT                   /product="mCG22879"
FT                   /note="gene_id=mCG22879.1 transcript_id=mCT21625.1 created
FT                   on 05-SEP-2002"
FT   CDS             join(<33079571..33079647,33084085..33084295,
FT                   33086916..33087068,33107220..33107445,33107836..33107972)
FT                   /codon_start=1
FT                   /locus_tag="mCG_22879"
FT                   /product="mCG22879"
FT                   /note="gene_id=mCG22879.1 transcript_id=mCT21625.1
FT                   protein_id=mCP3410.1"
FT                   /protein_id="EDL36695.1"
FT                   /translation="QDFKQAALMSGTSVSLCQATATCHHRIKEFEGAVEFFTRAIKINP
FT                   HYVDAYIGRGNSYMEYSQEDAMIQAQKDFLKALHLDPSCLKARISLGYNLQAQGKFQKA
FT                   WIHFTVGIESNPKSYLAYEGRAVVCLQMSNYFAAMQDINCAIKASDYFSTALKFNPENE
FT                   YALMNRAVTNSVLKKYEEAEKDFSCAMERCPHWAALYFNRASFYVYLKKYKLAEEDLGI
FT                   GLSLKPDEAIMYNLRAQVRGKMGLIAEAMSDYNQALDLEECSTAM"
FT   gene            33548009..33550681
FT                   /gene="Sstr1"
FT                   /locus_tag="mCG_22882"
FT                   /note="gene_id=mCG22882.2"
FT   mRNA            join(33548009..33548121,33548487..33550130,
FT                   33550388..33550681)
FT                   /gene="Sstr1"
FT                   /locus_tag="mCG_22882"
FT                   /product="somatostatin receptor 1"
FT                   /note="gene_id=mCG22882.2 transcript_id=mCT21628.3 created
FT                   on 17-JUN-2003"
FT   CDS             33548834..33550009
FT                   /codon_start=1
FT                   /gene="Sstr1"
FT                   /locus_tag="mCG_22882"
FT                   /product="somatostatin receptor 1"
FT                   /note="gene_id=mCG22882.2 transcript_id=mCT21628.3
FT                   protein_id=mCP3401.0"
FT                   /db_xref="GOA:Q543T0"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000586"
FT                   /db_xref="InterPro:IPR001116"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:98327"
FT                   /db_xref="UniProtKB/TrEMBL:Q543T0"
FT                   /protein_id="EDL36694.1"
FT                   /translation="MFPNGTASSPSSSPSPSPGSCGEGACSRGPGSGAADGMEEPGRNA
FT                   SQNGTLSEGQGSAILISFIYSVVCLVGLCGNSMVIYVILRYAKMKTATNIYILNLAIAD
FT                   ELLMLSVPFLVTSTLLRHWPFGALLCRLVLSVDAVNMFTSIYCLTVLSVDRYVAVVHPI
FT                   KAARYRRPTVAKVVNLGVWVLSLLVILPIVVFSRTAANSDGTVACNMLMPEPAQRWLVG
FT                   FVLYTFLMGFLLPVGAICLCYVLIIAKMRMVALKAGWQQRKRSERKITLMVMMVVMVFV
FT                   ICWMPFYVVQLVNVFAEQDDATVSQLSVILGYANSCANPILYGFLSDNFKRSFQRILCL
FT                   SWMDNAAEEPVDYYATALKSRAYSVEDFQPENLESGGVFRNGTCASRISTL"
FT   gene            complement(33550763..33552263)
FT                   /locus_tag="mCG_148269"
FT                   /note="gene_id=mCG148269.0"
FT   mRNA            complement(join(33550763..33551664,33551717..33552263))
FT                   /locus_tag="mCG_148269"
FT                   /product="mCG148269"
FT                   /note="gene_id=mCG148269.0 transcript_id=mCT188532.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(33551243..33551416)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148269"
FT                   /product="mCG148269"
FT                   /note="gene_id=mCG148269.0 transcript_id=mCT188532.0
FT                   protein_id=mCP108103.0"
FT                   /protein_id="EDL36693.1"
FT                   /translation="MFPGMPGFQAFHSAPTKVNPHCHLFILTRQKPTVKKIILKSPNFT
FT                   GHKQNQEGLRKG"
FT   gene            complement(33604277..>33608847)
FT                   /gene="Clec14a"
FT                   /locus_tag="mCG_22876"
FT                   /note="gene_id=mCG22876.2"
FT   mRNA            complement(33604277..>33608847)
FT                   /gene="Clec14a"
FT                   /locus_tag="mCG_22876"
FT                   /product="C-type lectin domain family 14, member a"
FT                   /note="gene_id=mCG22876.2 transcript_id=mCT21622.2 created
FT                   on 29-AUG-2002"
FT   CDS             complement(33607012..>33608400)
FT                   /codon_start=1
FT                   /gene="Clec14a"
FT                   /locus_tag="mCG_22876"
FT                   /product="C-type lectin domain family 14, member a"
FT                   /note="gene_id=mCG22876.2 transcript_id=mCT21622.2
FT                   protein_id=mCP3403.1"
FT                   /protein_id="EDL36692.1"
FT                   /translation="VSRMRPALALCLLCPAFWPRPGNGEHPTADRAACSASGACYSLHH
FT                   ATFKRRAAEEACSLRGGTLSTVHSGSEFQAVLLLLRAGPGPGGGSKDLLFWVALERSIS
FT                   QCTQEKEPLRGFSWLHPDSEDSEDSPLPWVEEPQRSCTVRKCAALQATRGVEPAGWKEM
FT                   RCHLRTDGYLCKYQFEVLCPAPRPGAASNLSFQAPFRLSSSALDFSPPGTEVSAMCPGD
FT                   LSVSSTCIQEETSAHWDGLFPGTVLCPCSGRYLLAGKCVELPDCLDHLGDFTCECAVGF
FT                   ELGKDGRSCETKVEEQLTLEGTKLPTRNVTATPAGAVTNRTWPGQVYDKPGEMPQVTEI
FT                   LQWGTQSTLPTIQKTPQTKPKVTGTPSGSVVLNYTSSPPVSLTFDTSSTVVFILVSIAV
FT                   IVLVVLTITVLGLFKLCFHKSRSSRTGKGALDSPGVECDAEATSLHHSSTQCTDIGVKS
FT                   GTVA"
FT   gene            complement(33944628..33945339)
FT                   /locus_tag="mCG_1041642"
FT                   /note="gene_id=mCG1041642.1"
FT   mRNA            complement(33944628..33945339)
FT                   /locus_tag="mCG_1041642"
FT                   /product="mCG1041642"
FT                   /note="gene_id=mCG1041642.1 transcript_id=mCT159346.1
FT                   created on 17-SEP-2002"
FT   CDS             complement(33945243..33945293)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041642"
FT                   /product="mCG1041642"
FT                   /note="gene_id=mCG1041642.1 transcript_id=mCT159346.1
FT                   protein_id=mCP78628.1"
FT                   /protein_id="EDL36691.1"
FT                   /translation="MQRTIRKLGDIFARYN"
FT   gene            34113334..34114139
FT                   /locus_tag="mCG_1041577"
FT                   /note="gene_id=mCG1041577.1"
FT   mRNA            34113334..34114139
FT                   /locus_tag="mCG_1041577"
FT                   /product="mCG1041577"
FT                   /note="gene_id=mCG1041577.1 transcript_id=mCT159281.1
FT                   created on 17-SEP-2002"
FT   CDS             34113653..34113904
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041577"
FT                   /product="mCG1041577"
FT                   /note="gene_id=mCG1041577.1 transcript_id=mCT159281.1
FT                   protein_id=mCP78785.1"
FT                   /protein_id="EDL36690.1"
FT                   /translation="MMTLQTGSQIKQIQSGVDILVETPPPGHVKDHLQNGKLNLIQLKH
FT                   VVLDEVEKMSNMAYKKDSEDIPNIAFLCDLPSLVDYHC"
FT   gene            <34231297..>34292616
FT                   /locus_tag="mCG_53541"
FT                   /note="gene_id=mCG53541.1"
FT   mRNA            join(<34231297..34231445,34235979..34236104,
FT                   34260361..34260421,34266431..34266584,34272306..34272486,
FT                   34292487..>34292616)
FT                   /locus_tag="mCG_53541"
FT                   /product="mCG53541"
FT                   /note="gene_id=mCG53541.1 transcript_id=mCT53724.1 created
FT                   on 17-SEP-2002"
FT   CDS             join(34231297..34231445,34235979..34236104,
FT                   34260361..34260421,34266431..34266584,34272306..34272486,
FT                   34292487..34292616)
FT                   /codon_start=1
FT                   /locus_tag="mCG_53541"
FT                   /product="mCG53541"
FT                   /note="gene_id=mCG53541.1 transcript_id=mCT53724.1
FT                   protein_id=mCP26453.1"
FT                   /protein_id="EDL36689.1"
FT                   /translation="MIEVPPQALAQNPRLDLSVCDDPSTRMDTNLTLSHQMTPWLTELL
FT                   PQHRITLLKAMEGQELAATASGSSQQFVRELNEYLTMQKTLKAERAISMLQTCPVDCHI
FT                   LICVQVHFTPDQDQQAGTLGKTGASCQCRSFDVHPGRLYCRATESHNGIHVKLQTQPAD
FT                   EFRENPQQEYPVQNKQRKQGIKLGRSVRHLPNEEPDRSAERLRKMPVGIAQWYSACIHE
FT                   TRHKSHDMTVSLLWLAFAGERHHTLNVYSGCKENGNVANVLDIL"
FT   gene            complement(34268801..34299308)
FT                   /locus_tag="mCG_59842"
FT                   /note="gene_id=mCG59842.3"
FT   mRNA            complement(join(34268801..34270069,34282033..34282136,
FT                   34299253..34299308))
FT                   /locus_tag="mCG_59842"
FT                   /product="mCG59842"
FT                   /note="gene_id=mCG59842.3 transcript_id=mCT60025.3 created
FT                   on 11-JUN-2003"
FT   CDS             complement(34268900..34269097)
FT                   /codon_start=1
FT                   /locus_tag="mCG_59842"
FT                   /product="mCG59842"
FT                   /note="gene_id=mCG59842.3 transcript_id=mCT60025.3
FT                   protein_id=mCP26435.2"
FT                   /protein_id="EDL36688.1"
FT                   /translation="MPKAIREFILLCYLRNLVSETVHFSVTHCQYFSCVNCLNLQSILL
FT                   TMFVNKWLPPSICNFNNPIS"
FT   gene            complement(34308003..34360338)
FT                   /gene="Sec23a"
FT                   /locus_tag="mCG_20841"
FT                   /note="gene_id=mCG20841.2"
FT   mRNA            complement(join(34308003..34308389,34315273..34315338,
FT                   34317106..34317261,34319526..34319612,34321167..34321328,
FT                   34322855..34322932,34326756..34326909,34330862..34330968,
FT                   34333426..34333515,34334385..34334465,34337644..34337767,
FT                   34339267..34339382,34340422..34340580,34345482..34345626,
FT                   34346605..34346684,34350177..34350413,34352852..34352938,
FT                   34353621..34353678,34355352..34355597,34360208..34360338))
FT                   /gene="Sec23a"
FT                   /locus_tag="mCG_20841"
FT                   /product="SEC23A (S. cerevisiae)"
FT                   /note="gene_id=mCG20841.2 transcript_id=mCT21828.1 created
FT                   on 29-AUG-2002"
FT   CDS             complement(join(34308300..34308389,34315273..34315338,
FT                   34317106..34317261,34319526..34319612,34321167..34321328,
FT                   34322855..34322932,34326756..34326909,34330862..34330968,
FT                   34333426..34333515,34334385..34334465,34337644..34337767,
FT                   34339267..34339382,34340422..34340580,34345482..34345626,
FT                   34346605..34346684,34350177..34350413,34352852..34352938,
FT                   34353621..34353678,34355352..34355572))
FT                   /codon_start=1
FT                   /gene="Sec23a"
FT                   /locus_tag="mCG_20841"
FT                   /product="SEC23A (S. cerevisiae)"
FT                   /note="gene_id=mCG20841.2 transcript_id=mCT21828.1
FT                   protein_id=mCP3429.1"
FT                   /protein_id="EDL36687.1"
FT                   /translation="MTTYLEFIQQNEERDGVRFSWNVWPSSRLEATRMVVPVAALFTPL
FT                   KERPDLPPIQYEPVLCSRTTCRAVLNPLCQVDYRAKLWACNFCYQRNQFPPTYAGISEL
FT                   NQPAELLPQFSSIEYVVLRGPQMPLIFLYVVDTCIEDEDLQALKESMQMSLSLLPPTAL
FT                   VGLITFGRMVQVHELGCEGISKSYVFRGTKDLSAKQLQEMLGLSKVPVTQATRGPQVQQ
FT                   PPPSNRFLQPVQKIDMNLTDLLGELQRDPWPVPQGKRPLRSSGVALSIAVGLLECTFPN
FT                   TGARIMMFIGGPATQGPGMVVGDELKTPIRSWHDIEKDNAKYVKKGTKHFEALANRAAT
FT                   TGHVIDIYACALDQTGLLEMKCCPNLTGGYMVMGDSFNTSLFKQTFQRVFTKDIHGQFK
FT                   MGFGGTLEIKTSREIKISGAIGPCVSLNSKGPCVSENEIGTGGTCQWKICGLSPTTTLA
FT                   IYFEVVNQHNAPIPQGGRGAVQFVTQYQHSSGQRRIRVTTIARNWADAQTQIQNIAASF
FT                   DQEAAAILMARLAIYRAETEEGPDVLRWLDRQLIRLCQKFGEYHKDDPNSFRFSETFSL
FT                   YPQFMFHLRRSPFLQVFNNSPDESSYYRHHFMRQDLTQSLIMIQPILYAYSFSGPPEPV
FT                   LLDSSSILADRILLMDTFFQILIYHGETIAQWRKSGYQDMPEYENFRHLLQAPVDDAQE
FT                   ILHSRFPMPRYIDTEHGGSQARFLLSKVNPSQTHNNMYAWGQESGAPILTDDVSLQVFM
FT                   DHLKKLAVSSAA"
FT   gene            <34361752..34376827
FT                   /gene="Sip1"
FT                   /locus_tag="mCG_20843"
FT                   /note="gene_id=mCG20843.1"
FT   mRNA            join(<34361752..34361975,34362332..34362416,
FT                   34365228..34365323,34365532..34365589,34366373..34366486,
FT                   34368750..34368794,34370029..34370097,34373366..34373476,
FT                   34375214..34375272,34376096..34376827)
FT                   /gene="Sip1"
FT                   /locus_tag="mCG_20843"
FT                   /product="survivor of motor neuron protein interacting
FT                   protein 1, transcript variant mCT21933"
FT                   /note="gene_id=mCG20843.1 transcript_id=mCT21933.0 created
FT                   on 29-AUG-2002"
FT   mRNA            join(<34361816..34362416,34364437..34364570,
FT                   34365228..34365323,34365532..34365589,34366373..34366486,
FT                   34368750..34368794,34370029..34370097,34373366..34373476,
FT                   34375214..34375272,34376096..34376756)
FT                   /gene="Sip1"
FT                   /locus_tag="mCG_20843"
FT                   /product="survivor of motor neuron protein interacting
FT                   protein 1, transcript variant mCT193498"
FT                   /note="gene_id=mCG20843.1 transcript_id=mCT193498.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<34362264..34362416,34364437..34364570,
FT                   34365228..34365323,34365532..34365589,34366373..34366486,
FT                   34368750..34368794,34370029..34370097,34373366..34373476,
FT                   34375214..34375272,34376096..34376135)
FT                   /codon_start=1
FT                   /gene="Sip1"
FT                   /locus_tag="mCG_20843"
FT                   /product="survivor of motor neuron protein interacting
FT                   protein 1, isoform CRA_a"
FT                   /note="gene_id=mCG20843.1 transcript_id=mCT193498.0
FT                   protein_id=mCP114464.0 isoform=CRA_a"
FT                   /protein_id="EDL36685.1"
FT                   /translation="SKTHLSILQSEIISIMYVLLNCRIEAAQCPDVVVAQIDPKKLKRK
FT                   QSVNISVQRFSPLSSRWEHGSIQAGLAQEELRVLHLHPKAASGRLTPRQLGFPDASLRL
FT                   KVTLQHFSGNNNKWHIFQLFDRQVVHKHRNHWKSQQLDSNVAMPKSEDEEGWKKFCLGE
FT                   RLCAEGATGPSTEESPGIDYVQVGFPPLLSIVSRMNQTTITSVLEYLSNWFGERDFTPE
FT                   LGRWFYALLACLEKPLLPEAHSLIRQLARRCSEVRLLVGSKDDERVPALNLLICLVSRY
FT                   FDQRDLADEPS"
FT   CDS             join(<34362409..34362416,34365228..34365323,
FT                   34365532..34365589,34366373..34366486,34368750..34368794,
FT                   34370029..34370097,34373366..34373476,34375214..34375272,
FT                   34376096..34376135)
FT                   /codon_start=1
FT                   /gene="Sip1"
FT                   /locus_tag="mCG_20843"
FT                   /product="survivor of motor neuron protein interacting
FT                   protein 1, isoform CRA_b"
FT                   /note="gene_id=mCG20843.1 transcript_id=mCT21933.0
FT                   protein_id=mCP3402.0 isoform=CRA_b"
FT                   /protein_id="EDL36686.1"
FT                   /translation="TFLFPDASLRLKVTLQHFSGNNNKWHIFQLFDRQVVHKHRNHWKS
FT                   QQLDSNVAMPKSEDEEGWKKFCLGERLCAEGATGPSTEESPGIDYVQVGFPPLLSIVSR
FT                   MNQTTITSVLEYLSNWFGERDFTPELGRWFYALLACLEKPLLPEAHSLIRQLARRCSEV
FT                   RLLVGSKDDERVPALNLLICLVSRYFDQRDLADEPS"
FT   gene            complement(34388352..>34406648)
FT                   /gene="Trappc6b"
FT                   /locus_tag="mCG_144957"
FT                   /note="gene_id=mCG144957.0"
FT   mRNA            complement(join(34388352..34388895,34389472..34389565,
FT                   34393343..34393426,34395488..34395605,34396862..34396929,
FT                   34406364..>34406648))
FT                   /gene="Trappc6b"
FT                   /locus_tag="mCG_144957"
FT                   /product="trafficking protein particle complex 6B"
FT                   /note="gene_id=mCG144957.0 transcript_id=mCT184381.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(34388864..34388895,34389472..34389565,
FT                   34393343..34393426,34395488..34395605,34396862..34396929,
FT                   34406364..>34406480))
FT                   /codon_start=1
FT                   /gene="Trappc6b"
FT                   /locus_tag="mCG_144957"
FT                   /product="trafficking protein particle complex 6B"
FT                   /note="gene_id=mCG144957.0 transcript_id=mCT184381.0
FT                   protein_id=mCP105137.0"
FT                   /protein_id="EDL36684.1"
FT                   /translation="SEPTRRWRDRREMADEALFLLLHNEMVSGVYKSAEQGEVENGRCV
FT                   TKLESMGFRVGQGLIERFTKDTARFKDELDIMKFICKDFWTTVFKKQIDNLRTNHQGIY
FT                   VLQDNKFRLLIQLSAGKQYLEHASKYLAFTCGLIRGGLSNLGIKSIVTAEVSSMPACKF
FT                   QVMIQKL"
FT   gene            <34412181..34418614
FT                   /gene="Pnn"
FT                   /locus_tag="mCG_20834"
FT                   /note="gene_id=mCG20834.1"
FT   mRNA            join(<34412181..34412311,34412975..34413046,
FT                   34413483..34413551,34413924..34413996,34414100..34414194,
FT                   34414314..34414389,34415340..34415495,34415577..34415715,
FT                   34416623..34418614)
FT                   /gene="Pnn"
FT                   /locus_tag="mCG_20834"
FT                   /product="pinin"
FT                   /note="gene_id=mCG20834.1 transcript_id=mCT21821.1 created
FT                   on 29-AUG-2002"
FT   CDS             join(<34412181..34412311,34412975..34413046,
FT                   34413483..34413551,34413924..34413996,34414100..34414194,
FT                   34414314..34414389,34415340..34415495,34415577..34415715,
FT                   34416623..34418010)
FT                   /codon_start=1
FT                   /gene="Pnn"
FT                   /locus_tag="mCG_20834"
FT                   /product="pinin"
FT                   /note="gene_id=mCG20834.1 transcript_id=mCT21821.1
FT                   protein_id=mCP3409.0"
FT                   /protein_id="EDL36683.1"
FT                   /translation="ACCREKMAVAVRALQEQLEKAKESLKNVDENIRKLTGRDPNDVRP
FT                   IQARLLALSGPGGGRGRGSLLLRRGFSDSGGGPPAKQRDLEGAVSRLGGERRTRRESRQ
FT                   ESDPEDDDVKKPALQSSVVATSKERTRRDLIQDQNMDEKGKQRNRRIFGLLMGTLQKFK
FT                   QESTVATERQKRRQEIEQKLEVQAEEERKQVENERRELFEERRAKQTELRLLEQKVELA
FT                   QLQEEWNEHNAKIIKYIRTKTKPHLFYIPGRMCPATQKLIEESQRKMNALFEGRRIEFA
FT                   EQINKMEARPRRQSMKEKEHQVVRNEEQKAEQEEGKVAQREEELEETGNQHNDVEVEEA
FT                   GEEEEKEAGIVHSDAEKEQEEEEQKQEMEVKTEEEAEVREGEKQQDSQPEEVMDVLEMV
FT                   ESVKHVIAEQEVMETNQVESIEPSENETSKELEPEMEFDVEPDKECKSLSPGKENINSQ
FT                   EVEKESEEKEEKEEKEPEPQPEPVAQPQPPPQPLPQSQPHSQPHSQPQPVLQSQPLCQP
FT                   ETLPLAVLQPPPQVIQEQGNLLPERKDFPLESIKLPEVSVEPVLTVHSENKSKNKTRSR
FT                   SRGRARNKTSKSRSRSSSSSSSSSSSTSSSSGSSSSSGSSSSRSSSSSSSSTSGSSSRD
FT                   SSSSTSSSSESRSRSRGRGHNRDRKHRRSVDRKRRDTSGLERSHKSSKGGSSRDTKGSK
FT                   DKSSRPDRKRSISESSRSGKRSSRSERDRKSDRKDKRR"
FT   gene            <34426195..34427138
FT                   /locus_tag="mCG_20835"
FT                   /note="gene_id=mCG20835.0"
FT   mRNA            <34426195..34427138
FT                   /locus_tag="mCG_20835"
FT                   /product="mCG20835"
FT                   /note="gene_id=mCG20835.0 transcript_id=mCT21822.0 created
FT                   on 05-SEP-2002"
FT   CDS             <34426196..34427098
FT                   /codon_start=1
FT                   /locus_tag="mCG_20835"
FT                   /product="mCG20835"
FT                   /note="gene_id=mCG20835.0 transcript_id=mCT21822.0
FT                   protein_id=mCP3413.0"
FT                   /protein_id="EDL36682.1"
FT                   /translation="SSSGKHQMADDAGAAGGPGGPGGPGLGGRGGFRGGFGSGLRGRGR
FT                   GRGRGRGRGRGARGGKAEDKEWIPVTKLGRLVKDMKIKSLEEIYLFSLPIKESEIIDFF
FT                   LGASLKDEVLKIMPVQKQTRAGQRTRFKALVAIGDYNGHVGLGVKCSKEVATAIRGAII
FT                   LAKLSIVPVRRGYWGNKIGKPHTVPCKVTGRCGSVLVRLIPAPRGTGIVSAPVPKKLLM
FT                   MASIDDCYTSARGCTATLGNFAKATSYAISKTYSYLTPDLWKETVFTKSPYQEFTDHLV
FT                   KTHTRVSVQRTQAPAVATT"
FT   gene            complement(34439401..>34439957)
FT                   /locus_tag="mCG_20836"
FT                   /note="gene_id=mCG20836.1"
FT   mRNA            complement(34439401..>34439957)
FT                   /locus_tag="mCG_20836"
FT                   /product="mCG20836"
FT                   /note="gene_id=mCG20836.1 transcript_id=mCT21823.1 created
FT                   on 05-SEP-2002"
FT   CDS             complement(34439440..>34439931)
FT                   /codon_start=1
FT                   /locus_tag="mCG_20836"
FT                   /product="mCG20836"
FT                   /note="gene_id=mCG20836.1 transcript_id=mCT21823.1
FT                   protein_id=mCP3416.1"
FT                   /protein_id="EDL36681.1"
FT                   /translation="LAKMTNIKGKRRGTRYMFSRPFRKHDVVPLATYMRIYKKGDIVDI
FT                   KGMGTVQKGMPHKCYRGKTGRVYNVTQHAVGIIVNKQVKGKVLAKRINVRIEHIKHSKS
FT                   RDSFLKWVKENDQKKKEAKEKGTWGQLKCQPAPPREAHFVRTNGKEPELLEPIPYEFMA
FT                   "
FT   gene            <34441177..>34453820
FT                   /gene="Mia2"
FT                   /locus_tag="mCG_124768"
FT                   /note="gene_id=mCG124768.1"
FT   mRNA            join(<34441177..34441291,34447439..34447572,
FT                   34450441..34450527,34453803..>34453820)
FT                   /gene="Mia2"
FT                   /locus_tag="mCG_124768"
FT                   /product="melanoma inhibitory activity 2"
FT                   /note="gene_id=mCG124768.1 transcript_id=mCT126018.1
FT                   created on 05-SEP-2002"
FT   CDS             join(34441177..34441291,34447439..34447572,
FT                   34450441..34450527,34453803..>34453820)
FT                   /codon_start=1
FT                   /gene="Mia2"
FT                   /locus_tag="mCG_124768"
FT                   /product="melanoma inhibitory activity 2"
FT                   /note="gene_id=mCG124768.1 transcript_id=mCT126018.1
FT                   protein_id=mCP79074.1"
FT                   /protein_id="EDL36680.1"
FT                   /translation="MAEVSVQRILLLVVSLAKCLEGTKLLAHLKKCGDLECETLISRVL
FT                   ALRDYTGPDCRYLNFTTGEEISVYVKLGGDREDLWAGSKGKDFGFFPRDAVEIEEVFIS
FT                   EEVEMPTKSDFLCL"
FT   gene            <34476439..34535339
FT                   /gene="Mgea6"
FT                   /locus_tag="mCG_20840"
FT                   /note="gene_id=mCG20840.1"
FT   mRNA            join(<34476439..34476575,34481024..34481155,
FT                   34482546..34482567,34482663..34482751,34491499..34491525,
FT                   34492010..34492120,34493017..34493088,34494629..34494733,
FT                   34499523..34499645,34503421..34503535,34504759..34504805,
FT                   34505344..34505434,34508049..34508187,34514102..34514203,
FT                   34515426..34515486,34516125..34516160,34517687..34517754,
FT                   34519268..34519350,34521493..34521621,34525011..34525169,
FT                   34529348..34529464,34530890..34530948,34533473..34533707,
FT                   34534798..34535339)
FT                   /gene="Mgea6"
FT                   /locus_tag="mCG_20840"
FT                   /product="meningioma expressed antigen 6 (coiled-coil
FT                   proline-rich)"
FT                   /note="gene_id=mCG20840.1 transcript_id=mCT21827.2 created
FT                   on 05-SEP-2002"
FT   CDS             join(<34476441..34476575,34481024..34481155,
FT                   34482546..34482567,34482663..34482751,34491499..34491525,
FT                   34492010..34492120,34493017..34493088,34494629..34494733,
FT                   34499523..34499645,34503421..34503535,34504759..34504805,
FT                   34505344..34505434,34508049..34508187,34514102..34514203,
FT                   34515426..34515486,34516125..34516160,34517687..34517754,
FT                   34519268..34519350,34521493..34521621,34525011..34525169,
FT                   34529348..34529464,34530890..34530948,34533473..34533707,
FT                   34534798..34534961)
FT                   /codon_start=1
FT                   /gene="Mgea6"
FT                   /locus_tag="mCG_20840"
FT                   /product="meningioma expressed antigen 6 (coiled-coil
FT                   proline-rich)"
FT                   /note="gene_id=mCG20840.1 transcript_id=mCT21827.2
FT                   protein_id=mCP3421.2"
FT                   /protein_id="EDL36679.1"
FT                   /translation="SAAPIAPGLLLAGGPAARPPPVGAEMAGPGAAAGCARRVLEQLRW
FT                   VVAALPEDMRADFNPSGFSLELAVCVLSVGLLAVVLFLWRGFRSIRSRFYVGREKKLAL
FT                   ELSALIEEKCKLLDKVSIVQKEFVEGSQISEATYENLEQSKSKLEDEILLLEEKLEEER
FT                   AKHSEQDELMADISKRIQSLEDESKSLKSQVAEAKTTFRIFEINEERLKGAIKDALNEN
FT                   SQLQESQKQLLQETEMMKEQVNDLDKQKVALEESRAQAEQALSEKESQIETLVTSLLKM
FT                   KDWAAVLGEADDGNLDLDMKSGLENTAALDNQPKGALKKLIYAAKLNASLKALEGERNQ
FT                   VYTQLSEVDQVKEDLTEHIKSLESKQASLQSEKTEFESESQKLQQKLKVITELYQENEM
FT                   KLHRKLTVEENYRLEKEEKLSKVDEKISHATEELETCRQRAKDLEEELERTIHSYQGQV
FT                   ISHEKKAHDNWLAARTLERNLNDLRKENAHNRQKLTETEFKFELLEKDPYALDVPNTAF
FT                   GREHSPYGPSPLGRPPSETRAFLSPPTLLEGPLRLSPLLPGGGGRGSRGPENLLDHQMN
FT                   TERGESSYDRLSDAPRAPSDRSLSPPWEQDRRMTAHPPPGQPYSDPALQRQDRFYPNSG
FT                   RLSGPAELRSYNMPSLDKVDGPVPSEMESSGNGTKDNLGNSNVPDSPIPAECEAAGRGF
FT                   FPPPFPPVRDPLFPVDPRSQFMRRGPSFPPPPPGSIYAAPRDYFPPRDFPGPPLPPFPG
FT                   RTVYAPRGFPPYLPPRAGFFPPPPHPESRSELPPDLIPPSKEPAADPPETQEA"
FT   gene            complement(34545813..>34564613)
FT                   /locus_tag="mCG_20838"
FT                   /note="gene_id=mCG20838.2"
FT   mRNA            complement(join(34545813..34547835,34549467..34550152,
FT                   34551137..34551247,34564021..34564109,34564212..>34564611))
FT                   /locus_tag="mCG_20838"
FT                   /product="mCG20838, transcript variant mCT21825"
FT                   /note="gene_id=mCG20838.2 transcript_id=mCT21825.1 created
FT                   on 05-SEP-2002"
FT   mRNA            complement(join(34546548..34547835,34549467..34550152,
FT                   34551137..34551247,34564021..>34564613))
FT                   /locus_tag="mCG_20838"
FT                   /product="mCG20838, transcript variant mCT193471"
FT                   /note="gene_id=mCG20838.2 transcript_id=mCT193471.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(34547564..34547835,34549467..34550152,
FT                   34551137..34551247,34564021..>34564613))
FT                   /codon_start=1
FT                   /locus_tag="mCG_20838"
FT                   /product="mCG20838, isoform CRA_a"
FT                   /note="gene_id=mCG20838.2 transcript_id=mCT193471.0
FT                   protein_id=mCP114463.0 isoform=CRA_a"
FT                   /protein_id="EDL36677.1"
FT                   /translation="PRPPGARTRAGAARLVRWRRRQRLRLLQLRRLRGLLRGLRRRPGT
FT                   GGRRPSRMALCGQAAGAASLPSELIVHIFSFLPAPDRLRASASCSHWRECLFYPALWPQ
FT                   LRICLRVSPAEQPRLEFLMRKCGWFVRELRVEFAAENYLSGGGGPGDGGSGGGTDTGTG
FT                   GEDGEALQLSSRWLEVLRIYLELVLCVLLSIRNNRNLQKFSLFGDISVVHQQGSLSSTY
FT                   LSRVDPDGKKIKQIQQLFEEILSNSRQLKWLSCGFMLEIVTPTSLSSLSNPIANTMEHL
FT                   SLLDNNIPGNSTLITAVELERFVNLRSLALDFCDFTAEMARVLTDSNHVPLQRLSLLVH
FT                   NASVMLKSLDNMPNDEHWKALSRKSSSLRVYLMVFDIKSEDMLKILKPSIPLERVHFDS
FT                   YVTCVSGAIVDLISRQYDKFLTHFILMNDMIDTSGFPDLSDNRNEDPLVLLAWRCTKLT
FT                   LLAIHGYTVWAHNLIAIARLRGSDLKVLQVTEESIDFDQGELADQDVDPVQNLIEQVSL
FT                   GLGQSWHAVLDIESLSVFTEPNRHFYREMQSFSEDI"
FT   CDS             complement(join(34547564..34547835,34549467..34550152,
FT                   34551137..34551247,34564021..34564109,34564212..>34564610))
FT                   /codon_start=1
FT                   /locus_tag="mCG_20838"
FT                   /product="mCG20838, isoform CRA_b"
FT                   /note="gene_id=mCG20838.2 transcript_id=mCT21825.1
FT                   protein_id=mCP3425.1 isoform=CRA_b"
FT                   /protein_id="EDL36678.1"
FT                   /translation="RPPGARTRAGAARLVRWRRRQRLRLLQLRRLRGLLRGLRRRPGTG
FT                   GRRPSRMALCGQAAGAASLPSELIVHIFSFLPAPDRLRASASCSHWRECLFYPALWPQL
FT                   RICLRVSPAEQPRLEFLMRKCGWFVRELRALQLSSRWLEVLRIYLELVLCVLLSIRNNR
FT                   NLQKFSLFGDISVVHQQGSLSSTYLSRVDPDGKKIKQIQQLFEEILSNSRQLKWLSCGF
FT                   MLEIVTPTSLSSLSNPIANTMEHLSLLDNNIPGNSTLITAVELERFVNLRSLALDFCDF
FT                   TAEMARVLTDSNHVPLQRLSLLVHNASVMLKSLDNMPNDEHWKALSRKSSSLRVYLMVF
FT                   DIKSEDMLKILKPSIPLERVHFDSYVTCVSGAIVDLISRQYDKFLTHFILMNDMIDTSG
FT                   FPDLSDNRNEDPLVLLAWRCTKLTLLAIHGYTVWAHNLIAIARLRGSDLKVLQVTEESI
FT                   DFDQGELADQDVDPVQNLIEQVSLGLGQSWHAVLDIESLSVFTEPNRHFYREMQSFSED
FT                   I"
FT   gene            complement(34568943..34569786)
FT                   /locus_tag="mCG_1041788"
FT                   /note="gene_id=mCG1041788.1"
FT   mRNA            complement(34568943..34569786)
FT                   /locus_tag="mCG_1041788"
FT                   /product="mCG1041788"
FT                   /note="gene_id=mCG1041788.1 transcript_id=mCT159492.1
FT                   created on 24-SEP-2002"
FT   CDS             complement(34569165..34569437)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041788"
FT                   /product="mCG1041788"
FT                   /note="gene_id=mCG1041788.1 transcript_id=mCT159492.1
FT                   protein_id=mCP78859.1"
FT                   /protein_id="EDL36676.1"
FT                   /translation="MEDTQVNKTHRHTDREGSHFTSDIQCLCLMTKTTNKNKIATEKKK
FT                   TPVSLSTLVHAWTCTTSQAKCYFLTGSDSTSTPFLLKNNLPDGGD"
FT   gene            complement(<34662246..>34663292)
FT                   /locus_tag="mCG_1041576"
FT                   /note="gene_id=mCG1041576.0"
FT   mRNA            complement(<34662246..>34663292)
FT                   /locus_tag="mCG_1041576"
FT                   /product="mCG1041576"
FT                   /note="gene_id=mCG1041576.0 transcript_id=mCT159280.0
FT                   created on 17-SEP-2002"
FT   CDS             complement(<34662246..34663292)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041576"
FT                   /product="mCG1041576"
FT                   /note="gene_id=mCG1041576.0 transcript_id=mCT159280.0
FT                   protein_id=mCP78781.0"
FT                   /protein_id="EDL36675.1"
FT                   /translation="MGSSKRQRYGSGNALVSVVVKQERLSPEPSAPAASLSTAKPNASR
FT                   SPDKKKRKSSGRRSKSPPTKRSRSPHYSMVKVKQEREDHPLRGREDPQPREPSEQEHRR
FT                   ARNSDERARHRSHSRQRRSSDERPVSGQGRDRDSQNLKAQEEERDFHNARRQEHRQQNG
FT                   SAGSGEVQEEVIPHPAGNRNKEVPVKEKPCFELSGALLEDTNTFQGVVIKYNEPPEARI
FT                   PKKRWRLYPFKNDELLPVLYIHRQSAYLLGRHRRIADIPIDHPSCSKQHAVFQYRLVES
FT                   TRADGTVDRSVKPFIIDLCSANGTFLNNKRIEPQRYYELKESDVLKFGFSSRDYVLLHE
FT                   SSDISELEE"
FT   gene            complement(34680609..34681218)
FT                   /locus_tag="mCG_1041640"
FT                   /note="gene_id=mCG1041640.1"
FT   mRNA            complement(34680609..34681218)
FT                   /locus_tag="mCG_1041640"
FT                   /product="mCG1041640"
FT                   /note="gene_id=mCG1041640.1 transcript_id=mCT159344.1
FT                   created on 17-SEP-2002"
FT   CDS             complement(34681017..34681196)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041640"
FT                   /product="mCG1041640"
FT                   /note="gene_id=mCG1041640.1 transcript_id=mCT159344.1
FT                   protein_id=mCP78597.1"
FT                   /protein_id="EDL36674.1"
FT                   /translation="MNGTTHTVMQIGIELGKRTSVKDTCFSYVPDSRGFSLGSLLVFCQ
FT                   LNTSPVCLGGRNFN"
FT   gene            complement(<34698436..>34698957)
FT                   /locus_tag="mCG_49422"
FT                   /note="gene_id=mCG49422.1"
FT   mRNA            complement(<34698436..>34698957)
FT                   /locus_tag="mCG_49422"
FT                   /product="mCG49422"
FT                   /note="gene_id=mCG49422.1 transcript_id=mCT49605.1 created
FT                   on 17-SEP-2002"
FT   CDS             complement(34698436..34698957)
FT                   /codon_start=1
FT                   /locus_tag="mCG_49422"
FT                   /product="mCG49422"
FT                   /note="gene_id=mCG49422.1 transcript_id=mCT49605.1
FT                   protein_id=mCP26440.1"
FT                   /protein_id="EDL36673.1"
FT                   /translation="MPKGKKAKGKKVAPAPTVIKKQEDKRVVNPLFEKRPKNFSIGQDI
FT                   QPRRDVTSSNGPATSGCSGKEPSSISGSKYLLPLTSSPRPWTGKQLLNCLSLPTSTGQR
FT                   QSKRRSKGYWPALRRKLLAKGMSQLRDHLSSEQQSNTVTTLVDNKKAQLVVMAHDIDPI
FT                   ELVVFLPALC"
FT   gene            complement(<34978450..34979175)
FT                   /locus_tag="mCG_51439"
FT                   /note="gene_id=mCG51439.2"
FT   mRNA            complement(<34978450..34979175)
FT                   /locus_tag="mCG_51439"
FT                   /product="mCG51439"
FT                   /note="gene_id=mCG51439.2 transcript_id=mCT51622.2 created
FT                   on 17-SEP-2002"
FT   CDS             complement(34978450..34978710)
FT                   /codon_start=1
FT                   /locus_tag="mCG_51439"
FT                   /product="mCG51439"
FT                   /note="gene_id=mCG51439.2 transcript_id=mCT51622.2
FT                   protein_id=mCP36109.2"
FT                   /protein_id="EDL36672.1"
FT                   /translation="MVKGENSCTYYKCHYPPCTVIEKKLQEFNICRHCQVARYYGSQCQ
FT                   QKAWPAHKKHCQERKCPLSLSQSDDGLKSRQCCRFKVSSLS"
FT   gene            complement(<35247919..>35314233)
FT                   /locus_tag="mCG_1041574"
FT                   /note="gene_id=mCG1041574.0"
FT   mRNA            complement(join(<35247919..35248023,35267123..35267194,
FT                   35301159..35301260,35303196..35303468,35313925..>35314233))
FT                   /locus_tag="mCG_1041574"
FT                   /product="mCG1041574"
FT                   /note="gene_id=mCG1041574.0 transcript_id=mCT159278.0
FT                   created on 17-SEP-2002"
FT   CDS             complement(join(35247919..35248023,35267123..35267194,
FT                   35301159..35301260,35303196..35303468,35313925..35314233))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041574"
FT                   /product="mCG1041574"
FT                   /note="gene_id=mCG1041574.0 transcript_id=mCT159278.0
FT                   protein_id=mCP78766.0"
FT                   /protein_id="EDL36671.1"
FT                   /translation="MPFGKYAQICRELSHVGDAVVISCAKDGMKFSESEKMEMETLSCH
FT                   KQVLLIKKLQTEMKESVQQTSALRYLNFYTKATPLSPIVTHRISADVPLVAEHKITDML
FT                   SRTSKSEFWIKDCMLLSEWCLKLNSNFEHKELRETPISIFAGSDQGPVSSNMRRLAPYT
FT                   QMPEAVDCPCAAPVICTVLIQNDVFFTARMVKVTCRWQVIDRFLPEDLTVKMTSDCPNN
FT                   GVSGEQDSFHLHFIEYKNILINIFLLTEEKKFKVEVTRRISHRHLPHQRIEDEVMPSVT
FT                   GCRKT"
FT   gene            35698408..35699654
FT                   /locus_tag="mCG_1041781"
FT                   /note="gene_id=mCG1041781.1"
FT   mRNA            join(35698408..35698903,35698929..35699476,
FT                   35699526..35699654)
FT                   /locus_tag="mCG_1041781"
FT                   /product="mCG1041781"
FT                   /note="gene_id=mCG1041781.1 transcript_id=mCT159485.1
FT                   created on 23-SEP-2002"
FT   CDS             35699067..35699264
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041781"
FT                   /product="mCG1041781"
FT                   /note="gene_id=mCG1041781.1 transcript_id=mCT159485.1
FT                   protein_id=mCP78791.1"
FT                   /protein_id="EDL36670.1"
FT                   /translation="MLTSILSEVLPKVLGSQVSLTMNLPCRQPLTAESSELGGGVGSPY
FT                   GPPIVAPALDQQERHDHQSF"
FT   gene            35862997..35864378
FT                   /pseudo
FT                   /locus_tag="mCG_62976"
FT                   /note="gene_id=mCG62976.2"
FT   mRNA            join(35862997..35863741,35863756..35864171,
FT                   35864200..35864378)
FT                   /pseudo
FT                   /locus_tag="mCG_62976"
FT                   /note="gene_id=mCG62976.2 transcript_id=mCT63159.2 created
FT                   on 17-SEP-2002"
FT   gene            complement(35884111..35884654)
FT                   /pseudo
FT                   /locus_tag="mCG_1041638"
FT                   /note="gene_id=mCG1041638.1"
FT   mRNA            complement(join(35884111..35884248,35884508..35884654))
FT                   /pseudo
FT                   /locus_tag="mCG_1041638"
FT                   /note="gene_id=mCG1041638.1 transcript_id=mCT159342.1
FT                   created on 17-SEP-2002"
FT   gene            <36192595..>36206393
FT                   /locus_tag="mCG_1041637"
FT                   /note="gene_id=mCG1041637.0"
FT   mRNA            join(<36192595..36192684,36206301..>36206393)
FT                   /locus_tag="mCG_1041637"
FT                   /product="mCG1041637"
FT                   /note="gene_id=mCG1041637.0 transcript_id=mCT159341.0
FT                   created on 17-SEP-2002"
FT   CDS             join(36192595..36192684,36206301..36206393)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041637"
FT                   /product="mCG1041637"
FT                   /note="gene_id=mCG1041637.0 transcript_id=mCT159341.0
FT                   protein_id=mCP78565.0"
FT                   /protein_id="EDL36669.1"
FT                   /translation="MEIRVGGLWLTGQSTEEIRTQQGGNESGLMAAQLLGRAIGAGLFA
FT                   ITPEFELGTPESRSD"
FT   gene            <36491386..>36702777
FT                   /locus_tag="mCG_64176"
FT                   /note="gene_id=mCG64176.1"
FT   mRNA            join(<36491386..36491526,36525836..36525999,
FT                   36553425..36553523,36567939..36567996,36623019..36623066,
FT                   36642880..36643051,36677728..36677805,36700100..36700224,
FT                   36700843..36701015,36702010..36702092,36702548..>36702777)
FT                   /locus_tag="mCG_64176"
FT                   /product="mCG64176"
FT                   /note="gene_id=mCG64176.1 transcript_id=mCT64359.1 created
FT                   on 17-SEP-2002"
FT   CDS             join(36491386..36491526,36525836..36525999,
FT                   36553425..36553523,36567939..36567996,36623019..36623066,
FT                   36642880..36643051,36677728..36677805,36700100..36700224,
FT                   36700843..36701015,36702010..36702092,36702548..36702777)
FT                   /codon_start=1
FT                   /locus_tag="mCG_64176"
FT                   /product="mCG64176"
FT                   /note="gene_id=mCG64176.1 transcript_id=mCT64359.1
FT                   protein_id=mCP26385.1"
FT                   /protein_id="EDL36668.1"
FT                   /translation="MLGCVIQTAAPFAAQTLLHLSPDHCAINMKRLTQAHDSCTIFASH
FT                   ASRGPQNFLPSEEDYEVSAVFLRNPGHSAVGEDLLRNVHVHHKRFQVYHLTLKNLLSIL
FT                   SWSNAEVQTVSKTATQCSSCLLEKQNATRARASTPVADLQNANDLSGVTQAIEFNHLVA
FT                   LKDLIPTICGGHDGDPQPRKNVNIQYWPKPSSSPVIFAGGQDRFTEQAVIVRAFPTPPL
FT                   EVVPSEQYRSAGEISNVYPVAIWPECTTSPGAYSEGQRCKKERTNGRCHEQYNTDYSKQ
FT                   DTSREEKLRANLSHDFNRVISHAYSFRLPSVLSILDQVDISVAIIILAEDKSIEVIKHE
FT                   EFLYYTSTAQISRQGTGRLVTSVRTPSLLMEEHGGANRYAEECQVQGEQNQSAQPTFPI
FT                   TAGMLAGIADQYSTSIQHTTIPPPYQDQVRALSLAAWKKLNEGSGKSPISGINQKVT"
FT   gene            complement(36681788..36732419)
FT                   /locus_tag="mCG_1041571"
FT                   /note="gene_id=mCG1041571.1"
FT   mRNA            complement(join(36681788..36682137,36693766..36693859,
FT                   36732082..36732419))
FT                   /locus_tag="mCG_1041571"
FT                   /product="mCG1041571"
FT                   /note="gene_id=mCG1041571.1 transcript_id=mCT159275.1
FT                   created on 24-FEB-2003"
FT   CDS             complement(36732159..36732287)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041571"
FT                   /product="mCG1041571"
FT                   /note="gene_id=mCG1041571.1 transcript_id=mCT159275.1
FT                   protein_id=mCP78436.1"
FT                   /protein_id="EDL36667.1"
FT                   /translation="MVDLTCCLEKPAKYDDIIKVAKQASKDPLKGILGYTEDQVVS"
FT   gene            36831451..36831981
FT                   /pseudo
FT                   /locus_tag="mCG_1041779"
FT                   /note="gene_id=mCG1041779.1"
FT   mRNA            36831451..36831981
FT                   /pseudo
FT                   /locus_tag="mCG_1041779"
FT                   /note="gene_id=mCG1041779.1 transcript_id=mCT159483.1
FT                   created on 23-SEP-2002"
FT   gene            complement(<36872629..>36894209)
FT                   /locus_tag="mCG_124478"
FT                   /note="gene_id=mCG124478.0"
FT   mRNA            complement(join(<36872629..36872788,36888757..36888807,
FT                   36893918..>36894209))
FT                   /locus_tag="mCG_124478"
FT                   /product="mCG124478"
FT                   /note="gene_id=mCG124478.0 transcript_id=mCT125721.0
FT                   created on 05-SEP-2002"
FT   CDS             complement(join(<36872629..36872788,36888757..36888807,
FT                   36893918..>36894077))
FT                   /codon_start=1
FT                   /locus_tag="mCG_124478"
FT                   /product="mCG124478"
FT                   /note="gene_id=mCG124478.0 transcript_id=mCT125721.0
FT                   protein_id=mCP78969.0"
FT                   /protein_id="EDL36666.1"
FT                   /translation="LKELSLLNKYLWFTKVNKVYIQILIQNPKDLCLSGLNNFPSFSSF
FT                   LYILYPDKAVWGPSVCTDDESALEPVCGMNLGDQSLKMMWIKVSRNSQLYSEHLAIYPL
FT                   RDEKSHLCEVYSYKDKLHVG"
FT   gene            36897503..37222145
FT                   /gene="Lrfn5"
FT                   /locus_tag="mCG_20829"
FT                   /note="gene_id=mCG20829.2"
FT   mRNA            join(36897503..36897788,37036216..37036390,
FT                   37203638..37205042,37207542..37208254,37215218..37215261,
FT                   37221757..37222145)
FT                   /gene="Lrfn5"
FT                   /locus_tag="mCG_20829"
FT                   /product="leucine rich repeat and fibronectin type III
FT                   domain containing 5, transcript variant mCT21122"
FT                   /note="gene_id=mCG20829.2 transcript_id=mCT21122.2 created
FT                   on 27-MAY-2003"
FT   mRNA            join(<36897588..36897788,37036216..37036390,
FT                   37203638..37205042,37207542..37209488)
FT                   /gene="Lrfn5"
FT                   /locus_tag="mCG_20829"
FT                   /product="leucine rich repeat and fibronectin type III
FT                   domain containing 5, transcript variant mCT193456"
FT                   /note="gene_id=mCG20829.2 transcript_id=mCT193456.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<37203652..37205042,37207542..37208397)
FT                   /codon_start=1
FT                   /gene="Lrfn5"
FT                   /locus_tag="mCG_20829"
FT                   /product="leucine rich repeat and fibronectin type III
FT                   domain containing 5, isoform CRA_a"
FT                   /note="gene_id=mCG20829.2 transcript_id=mCT193456.0
FT                   protein_id=mCP114415.0 isoform=CRA_a"
FT                   /protein_id="EDL36664.1"
FT                   /translation="STMEKFLFYLFLIGIAVRAQICPKRCVCQILSPNLATLCAKKGLL
FT                   FVPPNIDRRTVELRLADNFVTNIKRKDFANMTSLVDLTLSRNTISFITPHAFADLRNLR
FT                   ALHLNSNRLTKITNDMFSGLSNLHHLILNNNQLTLISSTAFDDVFALEELDLSYNNLET
FT                   IPWDAVEKMVSLHTLSLDHNMIDNIPKGTFSHLHKMTRLDVTSNKLQKLPPDPLFQRAQ
FT                   VLATSGIISPSTFALSFGGNPLHCNCELLWLRRLSREDDLETCASPALLTGRYFWSIPE
FT                   EEFLCEPPLITRHTHEMRVLEGQRATLRCKARGDPEPAIHWISPEGKLISNATRSLVYD
FT                   NGTLDILITTVKDTGAFTCIASNPAGEATQTVDLHIIKLPHLLNSTNHIHEPDPGSSDI
FT                   STSTKSGSNASSSNGDTKMSQDKIVVAEATSSTALLKFNFQRNIPGIRMFQIQYNGTYD
FT                   DTLVYRMIPPTSKTFLVNNLASGTMYDLCVLAIYDDGITSLTATRVVGCIQFTTEQDYV
FT                   RCHFMQSQFLGGTMIIIIGGIIVASVLVFIIILMIRYKVCNNNGQHKVTKVSNVYSQTN
FT                   GAQMQGCSVTLPQSMSKQAMGHEENAQCCKVASDNAIQSSETCSSQDSSTTTSALPPTW
FT                   TSSAPVSQKQKRKTGTKPSAEPQSEAVTNVESQNTNRNNSTALQLASCPPDSVTEGPTS
FT                   QRAHTKPSKFLTVPAEGSRARHRASLSGGLKDSFHYGNSQLSLKRSMSMNAMWT"
FT   CDS             join(37203658..37205042,37207542..37208254,
FT                   37215218..37215261,37221757..37221774)
FT                   /codon_start=1
FT                   /gene="Lrfn5"
FT                   /locus_tag="mCG_20829"
FT                   /product="leucine rich repeat and fibronectin type III
FT                   domain containing 5, isoform CRA_b"
FT                   /note="gene_id=mCG20829.2 transcript_id=mCT21122.2
FT                   protein_id=mCP3332.2 isoform=CRA_b"
FT                   /protein_id="EDL36665.1"
FT                   /translation="MEKFLFYLFLIGIAVRAQICPKRCVCQILSPNLATLCAKKGLLFV
FT                   PPNIDRRTVELRLADNFVTNIKRKDFANMTSLVDLTLSRNTISFITPHAFADLRNLRAL
FT                   HLNSNRLTKITNDMFSGLSNLHHLILNNNQLTLISSTAFDDVFALEELDLSYNNLETIP
FT                   WDAVEKMVSLHTLSLDHNMIDNIPKGTFSHLHKMTRLDVTSNKLQKLPPDPLFQRAQVL
FT                   ATSGIISPSTFALSFGGNPLHCNCELLWLRRLSREDDLETCASPALLTGRYFWSIPEEE
FT                   FLCEPPLITRHTHEMRVLEGQRATLRCKARGDPEPAIHWISPEGKLISNATRSLVYDNG
FT                   TLDILITTVKDTGAFTCIASNPAGEATQTVDLHIIKLPHLLNSTNHIHEPDPGSSDIST
FT                   STKSGSNASSSNGDTKMSQDKIVVAEATSSTALLKFNFQRNIPGIRMFQIQYNGTYDDT
FT                   LVYRMIPPTSKTFLVNNLASGTMYDLCVLAIYDDGITSLTATRVVGCIQFTTEQDYVRC
FT                   HFMQSQFLGGTMIIIIGGIIVASVLVFIIILMIRYKVCNNNGQHKVTKVSNVYSQTNGA
FT                   QMQGCSVTLPQSMSKQAMGHEENAQCCKVASDNAIQSSETCSSQDSSTTTSALPPTWTS
FT                   SAPVSQKQKRKTGTKPSAEPQSEAVTNVESQNTNRNNSTALQLASCPPDSVTEGPTSQR
FT                   AHTKPNALLTNVDQNVQETQRLESI"
FT   gene            complement(37364028..>37368258)
FT                   /locus_tag="mCG_20828"
FT                   /note="gene_id=mCG20828.1"
FT   mRNA            complement(join(37364028..37365819,37368059..>37368258))
FT                   /locus_tag="mCG_20828"
FT                   /product="mCG20828"
FT                   /note="gene_id=mCG20828.1 transcript_id=mCT21121.1 created
FT                   on 23-SEP-2002"
FT   CDS             complement(join(37365270..37365819,37368059..>37368258))
FT                   /codon_start=1
FT                   /locus_tag="mCG_20828"
FT                   /product="mCG20828"
FT                   /note="gene_id=mCG20828.1 transcript_id=mCT21121.1
FT                   protein_id=mCP3329.1"
FT                   /protein_id="EDL36663.1"
FT                   /translation="SSFSQDALKLCCRRIRVCPVCVSSLARLLITQGHLVLKSREFYNI
FT                   AGTEETPPPPREAGRIQNCSGRRKVIPFGFRSASLEGSSSWTMSHRNKIPRHRWIILLM
FT                   LEILVPSISGELRWGIMSTFPLPMPVMHNAQIFPCFFTTDKELGLAYLPLDEQIQALLE
FT                   NRTFFLQGSLCFMLISLLQDKSQCISLYYQSAAWLRKSSWGITTDIKADAIVIRGWWPS
FT                   QKPGNKPISRLHNQEWHPFARKGPWKI"
FT   gene            complement(37437254..37437779)
FT                   /pseudo
FT                   /locus_tag="mCG_146380"
FT                   /note="gene_id=mCG146380.0"
FT   mRNA            complement(37437254..37437779)
FT                   /pseudo
FT                   /locus_tag="mCG_146380"
FT                   /note="gene_id=mCG146380.0 transcript_id=mCT186584.0
FT                   created on 16-JUL-2003"
FT   gene            <37534326..>37534889
FT                   /locus_tag="mCG_59291"
FT                   /note="gene_id=mCG59291.0"
FT   mRNA            <37534326..>37534889
FT                   /locus_tag="mCG_59291"
FT                   /product="mCG59291"
FT                   /note="gene_id=mCG59291.0 transcript_id=mCT59474.0 created
FT                   on 16-SEP-2002"
FT   CDS             37534326..37534889
FT                   /codon_start=1
FT                   /locus_tag="mCG_59291"
FT                   /product="mCG59291"
FT                   /note="gene_id=mCG59291.0 transcript_id=mCT59474.0
FT                   protein_id=mCP26389.0"
FT                   /protein_id="EDL36662.1"
FT                   /translation="MPHNSVRREDDHLPGYGGLGIMVMEAAIDDDALGQEFSVPGKKRR
FT                   SSTSWVDITQDFEDACQELKLGELLHDKLFCLFESMSAIEMMNPRMFAGMIRNQVNRKV
FT                   LNFEQAIKGGAIKIKDFSLTELLGIMDTCFCCLITWLKGHSLTQTMFTCLYIHNLDFIE
FT                   ERSCHESFCSGNLEDLRHCKGKTK"
FT   gene            38048773..38049312
FT                   /locus_tag="mCG_64379"
FT                   /note="gene_id=mCG64379.1"
FT   mRNA            38048773..38049312
FT                   /locus_tag="mCG_64379"
FT                   /product="mCG64379"
FT                   /note="gene_id=mCG64379.1 transcript_id=mCT64562.1 created
FT                   on 23-SEP-2002"
FT   CDS             38048798..38049220
FT                   /codon_start=1
FT                   /locus_tag="mCG_64379"
FT                   /product="mCG64379"
FT                   /note="gene_id=mCG64379.1 transcript_id=mCT64562.1
FT                   protein_id=mCP26387.0"
FT                   /db_xref="GOA:C0IQA4"
FT                   /db_xref="MGI:MGI:1920559"
FT                   /db_xref="UniProtKB/TrEMBL:C0IQA4"
FT                   /protein_id="EDL36661.1"
FT                   /translation="MEDTTEDPDESSSGTVSEATSSEKSSESSNAGEGRARSQKQRFRR
FT                   PAKGTAHENLPDIMNTVQSVLEENSEDKKKGRKRTILVFYYRQNGKKKQNQKKKKEQVP
FT                   KRSQNSNSDSPLPGTSQDPGPSPCSLPKRVRKWFFQ"
FT   gene            complement(<38426664..>38427250)
FT                   /locus_tag="mCG_19390"
FT                   /note="gene_id=mCG19390.0"
FT   mRNA            complement(join(<38426664..38426784,38426943..>38427250))
FT                   /locus_tag="mCG_19390"
FT                   /product="mCG19390"
FT                   /note="gene_id=mCG19390.0 transcript_id=mCT19031.0 created
FT                   on 05-SEP-2002"
FT   CDS             complement(join(38426664..38426784,38426943..38427250))
FT                   /codon_start=1
FT                   /locus_tag="mCG_19390"
FT                   /product="mCG19390"
FT                   /note="gene_id=mCG19390.0 transcript_id=mCT19031.0
FT                   protein_id=mCP3322.0"
FT                   /protein_id="EDL36660.1"
FT                   /translation="MNLPKEEKVPQNKITVGVGAIGMACAINILTKDLADELALVDVME
FT                   DKLKGKMMDLRHGGLFLKTTKIVSSKDNCVTVNSKLVIITVVDVSKREQADPIWSRETV
FT                   LGQNGISDVVIMPMTPEEESNLKNSADTLWGIQKELQF"
FT   gene            complement(39711932..39713483)
FT                   /locus_tag="mCG_56416"
FT                   /note="gene_id=mCG56416.2"
FT   mRNA            complement(join(39711932..39712764,39712824..39713247,
FT                   39713282..39713363,39713445..39713483))
FT                   /locus_tag="mCG_56416"
FT                   /product="mCG56416"
FT                   /note="gene_id=mCG56416.2 transcript_id=mCT56599.2 created
FT                   on 23-SEP-2002"
FT   CDS             complement(39712464..39712664)
FT                   /codon_start=1
FT                   /locus_tag="mCG_56416"
FT                   /product="mCG56416"
FT                   /note="gene_id=mCG56416.2 transcript_id=mCT56599.2
FT                   protein_id=mCP29229.2"
FT                   /protein_id="EDL36658.1"
FT                   /translation="MLFSPIDPLWVGLIVLVLFVLIYGLCYCLKLCVEAVKTGQKILTE
FT                   QQESMSEEEKGLKRKRKKKTQ"
FT   gene            39712757..39713397
FT                   /locus_tag="mCG_57121"
FT                   /note="gene_id=mCG57121.2"
FT   mRNA            join(39712757..39713214,39713328..39713397)
FT                   /locus_tag="mCG_57121"
FT                   /product="mCG57121"
FT                   /note="gene_id=mCG57121.2 transcript_id=mCT57304.2 created
FT                   on 23-SEP-2002"
FT   CDS             39712849..39713046
FT                   /codon_start=1
FT                   /locus_tag="mCG_57121"
FT                   /product="mCG57121"
FT                   /note="gene_id=mCG57121.2 transcript_id=mCT57304.2
FT                   protein_id=mCP37667.2"
FT                   /protein_id="EDL36659.1"
FT                   /translation="MLTSILSEVLSKLLGSQVSLTMNLPCRQPLTAESSELGGGVGSPY
FT                   GPPIVAPTLDQQERHDHQSF"
FT   gene            complement(39787257..>39790650)
FT                   /locus_tag="mCG_1041632"
FT                   /note="gene_id=mCG1041632.1"
FT   mRNA            complement(39787257..>39790650)
FT                   /locus_tag="mCG_1041632"
FT                   /product="mCG1041632"
FT                   /note="gene_id=mCG1041632.1 transcript_id=mCT159336.1
FT                   created on 16-SEP-2002"
FT   CDS             complement(39787426..39790650)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041632"
FT                   /product="mCG1041632"
FT                   /note="gene_id=mCG1041632.1 transcript_id=mCT159336.1
FT                   protein_id=mCP79016.0"
FT                   /protein_id="EDL36657.1"
FT                   /translation="MEECEEPEEPISLGRQEYRRRRRPSQPMVDKSQQTEITEKRKAMA
FT                   SVQPPAPKATHSIGNIPGSKDNYSRKEYESLRLSSQLQKTLMKRKHVQDMTDKSLQTEP
FT                   IVEEKVEVIFIDKTLKLEENTAGVGEIAPELPQSIPEVEIPTSRPTSHLIDRSQQTSCT
FT                   GDWSLIYICPKEKVDKEQQTYFSELEIIIRSIPGSSMTKSKEETIPIAQEDPLVEINGS
FT                   LEIEVLSPEELPDVMMSFTEGEISGELQALSNGEATVKGELFLTEEIPIQAPSPAEETS
FT                   AAETATTTAKDVVDIQAPPADKLSSVEAPADISPTLVQGALSDKPSDQQYPQGTEMAPS
FT                   ELPVEDLDPFSEEVLEKVQALTTDSMLEDLGIAESTIAEETSGKVQHPLSEETSKEVPA
FT                   EVHFPIAADFEESAILINEKFATDEVFEEYKPPIIEEVSADKATAEVQPPSAEDASEEV
FT                   APSEVLPPSTEQGTVEDLTAEVLSTPTEEGPTEVPPQPTEEGPAEVPPPLSEEGPAEVP
FT                   PAPAEEAPAEVLPPPAEEAPAEVPPPLTEEGPAEVPPTLTEEGPAEVPLAPAEEVPAEF
FT                   LPPPAEEVPAEVPPPLTEEGPAEVPPPLTEEGPEEVPPLPAEEAPTKVPPSPAEKGSAE
FT                   VSPPQTEEGPAEVPPPPAEEFPTEVPSSSAEEGSSEVPLPPTAERPEEAPPPATEEAPV
FT                   EVLPPATEEAPVEVLPPATEEAPVEVQSPAAEEGLAEVPPPPTEESPTHDVPTEVQVPQ
FT                   AKESPGQVLPLSGESTAEEASAQVQPPSFEKAPLESLPLEEVEKIHLDNLPFEVQPLPT
FT                   EDIAIGVPAESQALPADENPAREDTVETQPSSFEGAPIAENPIEAPLPASEADTGREDS
FT                   AVHPSSLAPTDEAPAEIQILQTDDIPTEMSPVENQPLPAEEGFPEVVSEEEATAAEVRF
FT                   PLSEGAPAQEATVEAQLTSVEESPKRASVDVQPLSPETPVEESPGVDLPLKTNEVTMQE
FT                   FRVEKMPAEDPLPPSEQTPADQVLLKEHRLSQVADISEKELESTTLTSDKMSEGIDSVP
FT                   EDVSGTKDDQISTFKIEGTIKIELKN"
FT   gene            <40100567..40102065
FT                   /locus_tag="mCG_120835"
FT                   /note="gene_id=mCG120835.0"
FT   mRNA            <40100567..40102065
FT                   /locus_tag="mCG_120835"
FT                   /product="mCG120835"
FT                   /note="gene_id=mCG120835.0 transcript_id=mCT122027.0
FT                   created on 05-SEP-2002"
FT   CDS             <40100629..40101408
FT                   /codon_start=1
FT                   /locus_tag="mCG_120835"
FT                   /product="mCG120835"
FT                   /note="gene_id=mCG120835.0 transcript_id=mCT122027.0
FT                   protein_id=mCP78504.0"
FT                   /protein_id="EDL36656.1"
FT                   /translation="LPSSLAAVSSDLFQQSVKTWWITMKCWACRDMPHLRTLKRRIENR
FT                   HLNGTRTKILKIKKKQKFKQVAEAYEVLSDAKKRDIYDKYGKEGLNGGGGGGGIHFDSP
FT                   FEFGFTFRNPDDVFREFFGGRDPFSFDFFEDPFDDFFGNRRGPRGSRSRGAGSFFSTFS
FT                   GFPSFGSGFPAFDTGFTPFGSLGHGGLTSFSSTSFGGSGMGNFKSISTSTKIVNGKKIT
FT                   TKRIVENGQERVEVEEDGQLKSLTINGKEHLLRLDNK"
FT   gene            <40232875..40239290
FT                   /gene="Gm527"
FT                   /locus_tag="mCG_15069"
FT                   /note="gene_id=mCG15069.1"
FT   mRNA            join(<40232875..40232892,40235505..40236030,
FT                   40237023..40237112,40238203..40238337,40238858..40239290)
FT                   /gene="Gm527"
FT                   /locus_tag="mCG_15069"
FT                   /product="gene model 527, (NCBI)"
FT                   /note="gene_id=mCG15069.1 transcript_id=mCT12612.1 created
FT                   on 05-SEP-2002"
FT   CDS             join(<40235510..40236030,40237023..40237112,
FT                   40238203..40238337,40238858..40239041)
FT                   /codon_start=1
FT                   /gene="Gm527"
FT                   /locus_tag="mCG_15069"
FT                   /product="gene model 527, (NCBI)"
FT                   /note="gene_id=mCG15069.1 transcript_id=mCT12612.1
FT                   protein_id=mCP13514.1"
FT                   /protein_id="EDL36655.1"
FT                   /translation="RHCLKRSKHQLKITITKIDHFGGLFFPWGGVFTIKAGRKAVSCTP
FT                   LYVEIRLKNTCTIDGFLMLLYVILNENESFPRELSLHFGREFVDCFLYLMDTYSFTTVK
FT                   LLWIWDKMEKQQYKSEVHKASLVIDLFGNEHDNFTKNLENLMSTIQGSYCSNWHCPTRV
FT                   QEDQQRTISINPPQEIPHGNLIRLAVDELFCSKIELCEERGCGGLREFSQRVFCHGAPP
FT                   FVVLNMQHWKPEDLAYVPYYLDLSDHKYLLEGATLFNKEEHHYSAAFQIDGHWMHYDGL
FT                   RNVNLILLNKPPEFLLLSSLVYIRATEK"
FT   gene            complement(40257581..40280690)
FT                   /gene="Btbd5"
FT                   /locus_tag="mCG_15068"
FT                   /note="gene_id=mCG15068.1"
FT   mRNA            complement(join(40257581..40258750,40265161..40265369,
FT                   40266523..40266966,40271989..40272887,40280562..40280690))
FT                   /gene="Btbd5"
FT                   /locus_tag="mCG_15068"
FT                   /product="BTB (POZ) domain containing 5, transcript variant
FT                   mCT12611"
FT                   /note="gene_id=mCG15068.1 transcript_id=mCT12611.1 created
FT                   on 05-SEP-2002"
FT   mRNA            complement(join(40258349..40258750,40265161..40265369,
FT                   40266523..40266966,40271989..40272887,40278454..>40278523))
FT                   /gene="Btbd5"
FT                   /locus_tag="mCG_15068"
FT                   /product="BTB (POZ) domain containing 5, transcript variant
FT                   mCT193454"
FT                   /note="gene_id=mCG15068.1 transcript_id=mCT193454.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(40258587..40258750,40265161..40265369,
FT                   40266523..40266966,40271989..40272887,40278454..>40278516))
FT                   /codon_start=1
FT                   /gene="Btbd5"
FT                   /locus_tag="mCG_15068"
FT                   /product="BTB (POZ) domain containing 5, isoform CRA_b"
FT                   /note="gene_id=mCG15068.1 transcript_id=mCT193454.0
FT                   protein_id=mCP114409.0 isoform=CRA_b"
FT                   /protein_id="EDL36654.1"
FT                   /translation="KIQQTLHVSKDLGSQVTNQTEMDHTAPTYMLANLTHLHSEQLLQG
FT                   LNLLRQHHELCDIILRVGDVKIHAHKVVLASISPYFKAMFTGNLSEKENSEVEFQCIDE
FT                   AALQAIVEYAYTGTVFISQDTVESLLPAANLLQIKLVLKECCAFLESQLDPGNCIGISR
FT                   FAETYGCHDLYLAATKFICQNFESVCQTEEFFELTHADLDEIVSNDCLNVATEETVFYA
FT                   LESWIKYDVQERQKYLAQLLNSVRLPLLSVKFLTRLYEANHLIRDDRTCKHLLNEALKY
FT                   HFMPEHRLSHQTVLMTRPRCAPKVLCAVGGKSGLFACLDSVEMYFPQNDSWIGLAPLNI
FT                   PRYEFGICVLDQKVFVIGGIETSVRPGMTVRKHENSVECWNPDTNTWTSLERMNESRST
FT                   LGVAVLAGEVFALGGYDGQSYLQSVEKYIPKIRQWQPVAPMTTTRSCFAAAVLDGMLYA
FT                   IGGYGPAHMNSVERYDPSKDSWEMVAPMADKRIHFGVGVMLGFIFVVGGHNGVSHLSSI
FT                   ERYDPHQNQWTVCRPMKEPRTGVGAAVIDNYLYVVGGHSGSSYLNTVQKYDPISDTWLD
FT                   SAGMIYCRCNFGLTAL"
FT   CDS             complement(join(40258587..40258750,40265161..40265369,
FT                   40266523..40266966,40271989..40272887))
FT                   /codon_start=1
FT                   /gene="Btbd5"
FT                   /locus_tag="mCG_15068"
FT                   /product="BTB (POZ) domain containing 5, isoform CRA_a"
FT                   /note="gene_id=mCG15068.1 transcript_id=mCT12611.1
FT                   protein_id=mCP13518.2 isoform=CRA_a"
FT                   /protein_id="EDL36653.1"
FT                   /translation="MDHTAPTYMLANLTHLHSEQLLQGLNLLRQHHELCDIILRVGDVK
FT                   IHAHKVVLASISPYFKAMFTGNLSEKENSEVEFQCIDEAALQAIVEYAYTGTVFISQDT
FT                   VESLLPAANLLQIKLVLKECCAFLESQLDPGNCIGISRFAETYGCHDLYLAATKFICQN
FT                   FESVCQTEEFFELTHADLDEIVSNDCLNVATEETVFYALESWIKYDVQERQKYLAQLLN
FT                   SVRLPLLSVKFLTRLYEANHLIRDDRTCKHLLNEALKYHFMPEHRLSHQTVLMTRPRCA
FT                   PKVLCAVGGKSGLFACLDSVEMYFPQNDSWIGLAPLNIPRYEFGICVLDQKVFVIGGIE
FT                   TSVRPGMTVRKHENSVECWNPDTNTWTSLERMNESRSTLGVAVLAGEVFALGGYDGQSY
FT                   LQSVEKYIPKIRQWQPVAPMTTTRSCFAAAVLDGMLYAIGGYGPAHMNSVERYDPSKDS
FT                   WEMVAPMADKRIHFGVGVMLGFIFVVGGHNGVSHLSSIERYDPHQNQWTVCRPMKEPRT
FT                   GVGAAVIDNYLYVVGGHSGSSYLNTVQKYDPISDTWLDSAGMIYCRCNFGLTAL"
FT   gene            40285363..40337318
FT                   /locus_tag="mCG_15073"
FT                   /note="gene_id=mCG15073.2"
FT   mRNA            join(40285363..40285396,40291821..40291938,
FT                   40293256..40293390,40295670..40295966,40297533..40297795,
FT                   40298411..40298582,40301474..40301571,40307627..40307722,
FT                   40310588..40310768,40311974..40312127,40317753..40317845,
FT                   40321392..40321497,40321948..40322183,40326186..40326312,
FT                   40327908..40328026,40331562..40331751,40333877..40334096,
FT                   40335059..40335145,40336185..40337318)
FT                   /locus_tag="mCG_15073"
FT                   /product="mCG15073"
FT                   /note="gene_id=mCG15073.2 transcript_id=mCT12615.2 created
FT                   on 05-SEP-2002"
FT   CDS             join(40317763..40317845,40321392..40321497,
FT                   40321948..40322183,40326186..40326312,40327908..40328026,
FT                   40331562..40331751,40333877..40334096,40335059..40335145,
FT                   40336185..40336450)
FT                   /codon_start=1
FT                   /locus_tag="mCG_15073"
FT                   /product="mCG15073"
FT                   /note="gene_id=mCG15073.2 transcript_id=mCT12615.2
FT                   protein_id=mCP13502.2"
FT                   /protein_id="EDL36652.1"
FT                   /translation="MDSLELRPFSKPDIALTEALRLLADEDWEKKMEGLNFVRCLAAFH
FT                   SDLLNTKLHETTFAVVQEVKNLRSGVSRAAVVCLGDLFTYLKKSMDQELDSAVRALLHK
FT                   AGESNTFIREDVDKALKAMVNNVTPARAVTSLINGGQRYYGRKMLFLMMGHPNFEKLLE
FT                   KYIPSKDLPYIKESVKNLRLKGLGEIPLDTASAKGRRSHPGSVGNTRSSSVSRDAFSSS
FT                   EREVTEVREVPRKSAPRNSLESAEYIKVITGLLNAKDFRDRINGIKQLLSDTENNQELV
FT                   VGNIVKIFDAFKSRLHDSNSKVNLVALETMHKMIPLLRDNLSPIINMLIPAIVDNNLNS
FT                   KNPGIYAAATNVVHALSQHVDNYLLLQPFCTKAQFLNGKAKQDMTEKLADIVTELYQRK
FT                   PHATEQKVLVVLWHLLGNMTHSGSLPGAGGNIRTATAKLSKALFTQMGQNLLNQAASQP
FT                   PHIKKSLEELLDVTVLSEL"
FT   gene            <40351141..40378164
FT                   /gene="Prpf39"
FT                   /locus_tag="mCG_15072"
FT                   /note="gene_id=mCG15072.1"
FT   mRNA            join(40351141..40351246,40357240..40357586,
FT                   40358011..40358136,40358322..40358390,40358494..40358656,
FT                   40358785..40358903,40362892..40363059,40368065..40368230,
FT                   40368750..40368857,40369935..40370099,40370213..40370312,
FT                   40370417..40370543,40371030..40371298,40372508..40372692,
FT                   40374650..40374724,40375930..40376044,40376203..40378164)
FT                   /gene="Prpf39"
FT                   /locus_tag="mCG_15072"
FT                   /product="PRP39 pre-mRNA processing factor 39 homolog
FT                   (yeast), transcript variant mCT12614"
FT                   /note="gene_id=mCG15072.1 transcript_id=mCT12614.2 created
FT                   on 05-SEP-2002"
FT   mRNA            join(<40351141..40351246,40357240..40357586,
FT                   40358011..40358136,40358322..40358390,40358494..40358656,
FT                   40358785..40358903,40362892..40363059,40368065..40368230,
FT                   40368750..40368857,40369935..40370099,40370213..40370312,
FT                   40370417..40370543,40371084..40371298,40372508..40372692,
FT                   40374650..40374724,40375930..40376044,40376203..40376937)
FT                   /gene="Prpf39"
FT                   /locus_tag="mCG_15072"
FT                   /product="PRP39 pre-mRNA processing factor 39 homolog
FT                   (yeast), transcript variant mCT193465"
FT                   /note="gene_id=mCG15072.1 transcript_id=mCT193465.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<40358540..40358656,40358785..40358903,
FT                   40362892..40363059,40368065..40368230,40368750..40368857,
FT                   40369935..40370099,40370213..40370299)
FT                   /codon_start=1
FT                   /gene="Prpf39"
FT                   /locus_tag="mCG_15072"
FT                   /product="PRP39 pre-mRNA processing factor 39 homolog
FT                   (yeast), isoform CRA_a"
FT                   /note="gene_id=mCG15072.1 transcript_id=mCT193465.0
FT                   protein_id=mCP114410.0 isoform=CRA_a"
FT                   /protein_id="EDL36650.1"
FT                   /translation="PKACPHNPVRMQGLLRFEDQDSARGDQNIAMFYPTSTQMVYRRGL
FT                   QAIPLSVDLWIHYINFLKETLDPGDQETNTTIRGTFEHAVLAAGTDFRSDKLWEMYINW
FT                   ENEQGNLREVTAVYDRILGIPTQLYSHHFQRFKEHVQNNLPRDLLTGEQFIQLRRELAS
FT                   VNGHSGDDGPPGDDLPSGIEDITDPAKLITEIENMRHRIIEIHQEMFNYNEHEVSKRWT
FT                   FEEGIKRPYFHVKPLEKAQLKNWKEYLEFEIENGTHERVVVLFERCVISCALYEEFWIK
FT                   EMVCLQPDLTAAYANLVASLRPSLQKLV"
FT   CDS             join(40358570..40358656,40358785..40358903,
FT                   40362892..40363059,40368065..40368230,40368750..40368857,
FT                   40369935..40370099,40370213..40370299)
FT                   /codon_start=1
FT                   /gene="Prpf39"
FT                   /locus_tag="mCG_15072"
FT                   /product="PRP39 pre-mRNA processing factor 39 homolog
FT                   (yeast), isoform CRA_b"
FT                   /note="gene_id=mCG15072.1 transcript_id=mCT12614.2
FT                   protein_id=mCP13521.2 isoform=CRA_b"
FT                   /protein_id="EDL36651.1"
FT                   /translation="MQGLLRFEDQDSARGDQNIAMFYPTSTQMVYRRGLQAIPLSVDLW
FT                   IHYINFLKETLDPGDQETNTTIRGTFEHAVLAAGTDFRSDKLWEMYINWENEQGNLREV
FT                   TAVYDRILGIPTQLYSHHFQRFKEHVQNNLPRDLLTGEQFIQLRRELASVNGHSGDDGP
FT                   PGDDLPSGIEDITDPAKLITEIENMRHRIIEIHQEMFNYNEHEVSKRWTFEEGIKRPYF
FT                   HVKPLEKAQLKNWKEYLEFEIENGTHERVVVLFERCVISCALYEEFWIKEMVCLQPDLT
FT                   AAYANLVASLRPSLQKLV"
FT   gene            complement(40377215..>40391655)
FT                   /gene="Fkbp3"
FT                   /locus_tag="mCG_15067"
FT                   /note="gene_id=mCG15067.2"
FT   mRNA            complement(join(40377215..40377519,40378457..40378554,
FT                   40380516..40380583,40381421..40381556,40383781..40383888,
FT                   40384730..40384831,40388594..40388710,40391638..>40391655))
FT                   /gene="Fkbp3"
FT                   /locus_tag="mCG_15067"
FT                   /product="FK506 binding protein 3, transcript variant
FT                   mCT12609"
FT                   /note="gene_id=mCG15067.2 transcript_id=mCT12609.1 created
FT                   on 29-AUG-2002"
FT   mRNA            complement(join(40377410..40377519,40378457..40378554,
FT                   40380516..40380583,40381421..40381556,40383781..40383888,
FT                   40384730..40384831,40390388..>40390526))
FT                   /gene="Fkbp3"
FT                   /locus_tag="mCG_15067"
FT                   /product="FK506 binding protein 3, transcript variant
FT                   mCT193451"
FT                   /note="gene_id=mCG15067.2 transcript_id=mCT193451.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(40377465..40377519,40378457..40378554,
FT                   40380516..40380583,40381421..40381556,40383781..40383888,
FT                   40384730..40384831,40388594..40388710,40391638..>40391655))
FT                   /codon_start=1
FT                   /gene="Fkbp3"
FT                   /locus_tag="mCG_15067"
FT                   /product="FK506 binding protein 3, isoform CRA_a"
FT                   /note="gene_id=mCG15067.2 transcript_id=mCT12609.1
FT                   protein_id=mCP13513.1 isoform=CRA_a"
FT                   /protein_id="EDL36648.1"
FT                   /translation="PPPPPKQGKMAAAVPQRAWTVEQLRSEQLPKKDIIKFLQDHGSDS
FT                   FLAEHKLLGNIKNVAKTANKDHLVNAYNHLFESKRFKGTETISKVSEQVKNVKLSDDKP
FT                   KDSKSEETLDEGPPKYTKSILKKGDKTNFPKKGDVVHCWYTGTLPDGTVFDTNIQTSSK
FT                   KKKNAKPLSFKVGVGKVIRGWDEALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPPNTK
FT                   LIFEVELVDID"
FT   CDS             complement(join(40377465..40377519,40378457..40378554,
FT                   40380516..40380583,40381421..40381556,40383781..40383888,
FT                   40384730..40384831,40390388..>40390405))
FT                   /codon_start=1
FT                   /gene="Fkbp3"
FT                   /locus_tag="mCG_15067"
FT                   /product="FK506 binding protein 3, isoform CRA_b"
FT                   /note="gene_id=mCG15067.2 transcript_id=mCT193451.0
FT                   protein_id=mCP114408.0 isoform=CRA_b"
FT                   /protein_id="EDL36649.1"
FT                   /translation="SPASDTFLAEHKLLGNIKNVAKTANKDHLVNAYNHLFESKRFKGT
FT                   ETISKVSEQVKNVKLSDDKPKDSKSEETLDEGPPKYTKSILKKGDKTNFPKKGDVVHCW
FT                   YTGTLPDGTVFDTNIQTSSKKKKNAKPLSFKVGVGKVIRGWDEALLTMSKGEKARLEIE
FT                   PEWAYGKKGQPDAKIPPNTKLIFEVELVDID"
FT   gene            <40390581..>40428651
FT                   /locus_tag="mCG_118968"
FT                   /note="gene_id=mCG118968.1"
FT   mRNA            join(<40390581..40390956,40391821..40391993,
FT                   40397819..40397896,40402945..40403103,40405706..40405837,
FT                   40407145..40407277,40408442..40408558,40409660..40409746,
FT                   40410510..40410694,40412091..40412297,40414037..40414241,
FT                   40416350..40416501,40417351..40417506,40419823..40421686,
FT                   40428566..>40428651)
FT                   /locus_tag="mCG_118968"
FT                   /product="mCG118968"
FT                   /note="gene_id=mCG118968.1 transcript_id=mCT120130.1
FT                   created on 02-APR-2003"
FT   CDS             join(40390581..40390956,40391821..40391993,
FT                   40397819..40397896,40402945..40403103,40405706..40405837,
FT                   40407145..40407277,40408442..40408558,40409660..40409746,
FT                   40410510..40410694,40412091..40412297,40414037..40414241,
FT                   40416350..40416501,40417351..40417506,40419823..40421686,
FT                   40428566..>40428651)
FT                   /codon_start=1
FT                   /locus_tag="mCG_118968"
FT                   /product="mCG118968"
FT                   /note="gene_id=mCG118968.1 transcript_id=mCT120130.1
FT                   protein_id=mCP78542.1"
FT                   /protein_id="EDL36647.1"
FT                   /translation="MAEALPEEDDEVLLVAAYEAERQLDPGDGGFCAAAGALWIYPTNC
FT                   PVRDYQLDISRSALFCNTLVCLPTGLGKTFIAAVVMYNFYRWFPSGKVVFMAPTKPLVT
FT                   QQMEACFHVMGIPQSHMAEMTGSTQAVNRKEIWSSRRVLFLTPQVMVNDLTRGAVPATH
FT                   VKCLVVDEAHKALGNYAYCQVVRELVKYTTHFRILALSATPGSDIKAVQQVITNLLIGK
FT                   IELRSEESPDILPYSHERRVEKLVVPLGEELGAIQKTYIQILETFASSLIHRNVLMKRD
FT                   IPNLTKYQIILARDQFRKNPSPNIVGIQQGIIEGEFALCISLYHGYELLQQMGMRSLYF
FT                   FLSGIMDGTKGMTRARNELSRNEDFMKLYTHLQSAFAPASTSDASAFQRGNKEKKFVYS
FT                   HPKLKKLEEVILEHFKSWNAKATTEKKCHESRVMIFSSFRDSVEEIAEMLLQHRPVIRV
FT                   MTFVGHASGKNTKGFTQKEQLQVVRQFRDGGYNTLVSTCVGEEGLDIGEVDLIICFDAQ
FT                   KSPIRLIQRMGRTGRKRQGRIVVILAEGREERTYNQSQSNKKNIYKAISGNRQVLRLYQ
FT                   GSPRMVPDKINPELHKMYITHGVYEPEKARSVQRRPFSSRGGIKASKSNKDGLLSEEEF
FT                   NLWSRLYRLGDSDQVKGVALPQSHFPSLQEDRVIQDPTTRIHQLSLSEWSLWQDRPLPT
FT                   HQVDHSDRCHHFISIMKMIEGMRHEEGECSYELKIRPFLQMEDVCSKYHAPRNGYNNVA
FT                   SVASSAHQKSSFRPSVDAGGSLTVIESEEEHADTVKQRDSKWTKITSLREKPCRAGRKG
FT                   QTCEHSEGEGEDGDAGSSDADGQSPAEADSQIDPPSGERMADVGGISILGAVTEEDNHP
FT                   GTLQMECQVTNKSCARYSLDSGYSSFSDEKSVSSNLFLPLEEELFTDRAAEQFYNCRPM
FT                   TEDVLANVERFLSRSPPSLSGLSDLVYDVTQGCEFDNASCSPYPEHEHSPRPVSPASHS
FT                   AGNSQQNLESNSAKRISHPTEKYCLPGTTHNKVSDRPSFCESDSEGHNIKYQNSGSNSC
FT                   AQIQADLENNFVDKNSHDDSEPPVLFTDEDESLLLFEDDFKNIEDGPEELNGASLPPFN
FT                   SISQPLRVSGKTLTSEMPPVSHFLISDELLLDDDSEPEDQIVCGAKSWKCQEGVEDGQE
FT                   ELRTDGQTFDCSVDLFSVTFDLGFRCSSGSDDEMLAGASDRTRTLGAADVSGRHSDKEI
FT                   KDAGGASGPLGRAISPIPTETAQWSPWAQNKEYASFHVASSSPVKQRVRSTPLSKSHAS
FT                   SKTGAHMLKTLDSTKEKAGGQGFKMALNPRLGHLGFSVEETKSSDQVFVHQSPRRTEVE
FT                   HLTSESEDDVFLRKTKKPKRNVLKSPE"
FT   gene            <40433206..40446491
FT                   /locus_tag="mCG_145564"
FT                   /note="gene_id=mCG145564.0"
FT   mRNA            join(<40433206..40433232,40435269..40435375,
FT                   40436316..40436876,40439598..40439970,40441279..40441570,
FT                   40445041..40446491)
FT                   /locus_tag="mCG_145564"
FT                   /product="mCG145564"
FT                   /note="gene_id=mCG145564.0 transcript_id=mCT184988.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<40433208..40433232,40435269..40435375,
FT                   40436316..40436876,40439598..40439970,40441279..40441570,
FT                   40445041..40445215)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145564"
FT                   /product="mCG145564"
FT                   /note="gene_id=mCG145564.0 transcript_id=mCT184988.0
FT                   protein_id=mCP105149.0"
FT                   /protein_id="EDL36646.1"
FT                   /translation="TQLSQAINDSEMRAIYMKSVRSPLMSTKYRMVREKRPNMNIFSQI
FT                   PEQDENYLEDSFCVDEEESCKSQSSEEEISVDFNLTKDSFTDEDIRYKTRYAVKIKQMN
FT                   KKQNYTRPRKKLSRIILPDDDSSEEENIPKDREHSVAGGHAAAEHTQQGQLWASGPSGS
FT                   SVPPQVLSDPSWNQSSRQRLQVQPSITDAVPRTLNVKAQSHNKIKSASPPCTGVESRKE
FT                   YGNHPVQLKADSQEHSDTSAAPCSTSLLHVAEGHTAPRHLQEGNRACILVDSREITTGL
FT                   EVISSLRTVHGLQVEICPLNGCDYIVSSRMVVVRRSQSEMLSNTSKNKFIEQMQRLQSM
FT                   FQRICVIVEKDREKAGDTSKKFRRTKCYDSLLTALVGAGIRILFSSGQEETADLLKELS
FT                   LVEQRKNAGIHIPAVLNTSKLEALPFYLSIPGISYITALNMCHQFSSVKKMANSSPEEI
FT                   STCAQVNHQKAEEIYKYIHYIFDMQMLPNDLNQERQKPDTCLTLGVAMKELS"
FT   gene            complement(40447530..>40487508)
FT                   /gene="C79407"
FT                   /locus_tag="mCG_15075"
FT                   /note="gene_id=mCG15075.1"
FT   mRNA            complement(join(40447530..40448417,40448596..40448650,
FT                   40451542..40451641,40453437..40453588,40455525..40455682,
FT                   40458005..40458174,40463509..40464337,40467475..40467617,
FT                   40468593..40468680,40469506..40469636,40471779..40471852,
FT                   40473182..40473648,40476190..40476815,40487358..>40487508))
FT                   /gene="C79407"
FT                   /locus_tag="mCG_15075"
FT                   /product="expressed sequence C79407"
FT                   /note="gene_id=mCG15075.1 transcript_id=mCT12314.2 created
FT                   on 05-SEP-2002"
FT   CDS             complement(join(40448323..40448417,40448596..40448650,
FT                   40451542..40451641,40453437..40453588,40455525..40455682,
FT                   40458005..40458174,40463509..40464337,40467475..40467617,
FT                   40468593..40468680,40469506..40469636,40471779..40471852,
FT                   40473182..40473648,40476190..>40476754))
FT                   /codon_start=1
FT                   /gene="C79407"
FT                   /locus_tag="mCG_15075"
FT                   /product="expressed sequence C79407"
FT                   /note="gene_id=mCG15075.1 transcript_id=mCT12314.2
FT                   protein_id=mCP13506.2"
FT                   /protein_id="EDL36645.1"
FT                   /translation="KEFCCHSPIKMIVTPLKHSGIHLSSGTLQRRNMPLDAVFIDSIPS
FT                   GTLTPLKDLVKYQKSSLKVNGHKKNQLLEIRTSNNKDLFQSTMLSEATLPNSSLDISVI
FT                   KPSMDRLRNEMIYESPGKIFQRMKAKVQRDKQEQLTRSSSMLGSPQGEHTKDFPPNTDK
FT                   KAQLQQTYICEEKQTSVQSNDPSLGDPPILNQEQKNVSASCISKKALTRAQFGGQVLHS
FT                   KESPVRITVSKKNTFVLGGIDCTYEKFENTDVNTISSLCVPIKNHSQSITSDNDVTTER
FT                   TAKEDITEPNEEMMSRRTILQDPIKNTSKIKRSSPRPNLTLSGRSQRKCTKLETVVKEV
FT                   KKYQAVHLQEWMIKVINNNTAICVEGKLVDMTDVYWHSNVIIERIKHNELRTLSGNIYI
FT                   LKGLIDSVSMKEAGYPCYLTRKFMFGFPHNWKEHIDKFLEQLRAEKKNKTRQETARVQE
FT                   KQKSKKKDAEDKETYVLQKASITYDLNDNSLERTEVPTDPLNSLEQPTSGKERRHPLLS
FT                   QKRAYVLITPLRNKKLIEQRCIDYSLSIEGISDFFKAKHQEESDSDIHGTPSSTSKSQE
FT                   TFEHRVGFEGNTKEDCNECDIITARHIQIPCPKSKQMLTNDFMKKNKLPSKLQKTENQI
FT                   GVSQYCRSSSHLSSEENEVEIKSRTRARNTKERLNRERENTNHITKDILLISETEGERA
FT                   CYITPKRPRSCYITPKRPRSSAKESHYKSAVSKDFLTEGKASDRTSRQLLDHLPGLTDD
FT                   EEWSEQELQKLHCAFTSLPKHKPGFWSDVAMAVGSRTADECQKKYTEEPQGQGSRKHGS
FT                   KKKQANKVQNGEKDSADAKTIKITAKVGTLKRKRQMRDCLEHLAKDNHDDFFTATPLQK
FT                   QRIQLPSFQYSQDDDFLLDMDRDPASPSSIITSPLRSTTPQCQHFSPSMLAAIERNNCD
FT                   RYVYQMQKNAKKYGKSNGGLVWGNIRKKTVKTDLSSPPPTRKALFNKDLGKNTDISKYF
FT                   IDDTESDEEEKDYYFSNSD"
FT   gene            complement(40502779..>40528255)
FT                   /locus_tag="mCG_144959"
FT                   /note="gene_id=mCG144959.0"
FT   mRNA            complement(join(40502779..40503012,40511583..40511644,
FT                   40517194..40517300,40528079..>40528255))
FT                   /locus_tag="mCG_144959"
FT                   /product="mCG144959"
FT                   /note="gene_id=mCG144959.0 transcript_id=mCT184383.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(40503003..40503012,40511583..40511644,
FT                   40517194..40517300,40528079..>40528139))
FT                   /codon_start=1
FT                   /locus_tag="mCG_144959"
FT                   /product="mCG144959"
FT                   /note="gene_id=mCG144959.0 transcript_id=mCT184383.0
FT                   protein_id=mCP105135.0"
FT                   /protein_id="EDL36644.1"
FT                   /translation="CSNAQPKKGRKQRAPWTALQGEDKGWNCCVFPTGWQWLAAIIVLQ
FT                   LTHGVRRYNLEIYSNWPVIFPFVGQNEAQSIRLP"
FT   gene            40540296..40543232
FT                   /locus_tag="mCG_15070"
FT                   /note="gene_id=mCG15070.2"
FT   mRNA            join(40540296..40542275,40542986..40543232)
FT                   /locus_tag="mCG_15070"
FT                   /product="mCG15070"
FT                   /note="gene_id=mCG15070.2 transcript_id=mCT12613.2 created
FT                   on 05-SEP-2002"
FT   CDS             40540543..40542246
FT                   /codon_start=1
FT                   /locus_tag="mCG_15070"
FT                   /product="mCG15070"
FT                   /note="gene_id=mCG15070.2 transcript_id=mCT12613.2
FT                   protein_id=mCP13519.1"
FT                   /protein_id="EDL36643.1"
FT                   /translation="MATEGRGKETNEIKTHFTTREGLYRLLPHSEYSRPNRVPFNSQGS
FT                   NPVRVSFVNLNDQTGNGNRLCFSVGRELYVYIYKGVRKAADLSKPIDKRIYKGTQPTCH
FT                   DFNHLTATAESVSLLVGFSAGQVQLIDPIKKETSKLFNEERLIDKSRVTCVKWVPGSDS
FT                   LFLVAHSSGNMYSYNVEHTYGTTAPHYQLLKQGESFAVHNCKSKSTRDLKWTVGEGALN
FT                   EFAFSPDGKFLACVSQDGFLRVFNFDSAELHGTMKSYFGGLLCLCWSPDGKYIVTGGED
FT                   DLVTVWSFLDCRVIARGRGHKSWVSVVAFDPYTTSVEESDPMEFSDSDKNFQDLLHFGR
FT                   DRANSTQSRLSKQNSTDSRPVSVTYRFGSVGQDTQLCLWDLTEDILFPHQPLSRARAHA
FT                   NVMNATGLPAGSNGSAVTTPGNSVPPPLPRSNSLPHSAVSNAASKGSVMDGAITSGVSK
FT                   FALLSLHDRKERHHEKDRKRNHSMGHISSKSSDKLNLVNKAKTDPAKTLGTSLCPRMED
FT                   VPLLEPLICKKIAHERLTVLVFLEDCIVTACQEGFICTWARPGKVSKFQP"
FT   gene            complement(40749933..40750341)
FT                   /locus_tag="mCG_1041764"
FT                   /note="gene_id=mCG1041764.0"
FT   mRNA            complement(40749933..40750341)
FT                   /locus_tag="mCG_1041764"
FT                   /product="mCG1041764"
FT                   /note="gene_id=mCG1041764.0 transcript_id=mCT159468.1
FT                   created on 23-SEP-2002"
FT   CDS             complement(40749978..40750271)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041764"
FT                   /product="mCG1041764"
FT                   /note="gene_id=mCG1041764.0 transcript_id=mCT159468.1
FT                   protein_id=mCP79100.1"
FT                   /protein_id="EDL36642.1"
FT                   /translation="MRGVKGELYKEQRSGHLLTWGPKSGARQWALWILSLEHRSSLTAV
FT                   GVRLGSGVTHVLGWHGNSGRNREEGTIIQLLQPQVPRKGGDNQLLEQGHLAC"
FT   gene            complement(41324913..>41325580)
FT                   /locus_tag="mCG_1041629"
FT                   /note="gene_id=mCG1041629.1"
FT   mRNA            complement(41324913..>41325580)
FT                   /locus_tag="mCG_1041629"
FT                   /product="mCG1041629"
FT                   /note="gene_id=mCG1041629.1 transcript_id=mCT159333.1
FT                   created on 16-SEP-2002"
FT   CDS             complement(41325449..41325580)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041629"
FT                   /product="mCG1041629"
FT                   /note="gene_id=mCG1041629.1 transcript_id=mCT159333.1
FT                   protein_id=mCP78967.1"
FT                   /protein_id="EDL36641.1"
FT                   /translation="MIVNGLDLKSNKWRYSATDPLGPCVCVEQGLSTWVGKAWMNDK"
FT   gene            complement(<41495631..>41534167)
FT                   /locus_tag="mCG_1041760"
FT                   /note="gene_id=mCG1041760.0"
FT   mRNA            complement(join(<41495631..41495711,41518748..41518986,
FT                   41526304..41526348,41534113..>41534167))
FT                   /locus_tag="mCG_1041760"
FT                   /product="mCG1041760"
FT                   /note="gene_id=mCG1041760.0 transcript_id=mCT159464.0
FT                   created on 20-SEP-2002"
FT   CDS             complement(join(41495631..41495711,41518748..41518986,
FT                   41526304..41526348,41534113..41534167))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041760"
FT                   /product="mCG1041760"
FT                   /note="gene_id=mCG1041760.0 transcript_id=mCT159464.0
FT                   protein_id=mCP79053.0"
FT                   /protein_id="EDL36640.1"
FT                   /translation="MGYKGTTPEWKCEILIYQGAVPSGPTDNWTCWTEAVKTGQKILIE
FT                   QQESMWEEEKGLKRKRKKKGDTVLPGGQKGQNKRAEVEEEGELASAPPPYASSAATYRW
FT                   TTCPEIWREDNKPVNRLEAVKMDFAMMIWLNPPVI"
FT   gene            complement(41599694..41600698)
FT                   /locus_tag="mCG_50176"
FT                   /note="gene_id=mCG50176.1"
FT   mRNA            complement(41599694..41600698)
FT                   /locus_tag="mCG_50176"
FT                   /product="mCG50176"
FT                   /note="gene_id=mCG50176.1 transcript_id=mCT50359.1 created
FT                   on 20-SEP-2002"
FT   CDS             complement(41600030..41600674)
FT                   /codon_start=1
FT                   /locus_tag="mCG_50176"
FT                   /product="mCG50176"
FT                   /note="gene_id=mCG50176.1 transcript_id=mCT50359.1
FT                   protein_id=mCP34837.0"
FT                   /protein_id="EDL36639.1"
FT                   /translation="MGRRPARCYRYCKNKPYPKSRFCRGVPDAKIRIFDLGRKKAKVDE
FT                   FPLCGHMVSDEYEQLSSEALEAARICANKYMVKSCGKDGFHIRVRLHPFHVIRINKMLS
FT                   CAGADRLQTGMRGAFGKPQGTVARVHIGQVIMSIRTKLQNKEHVIEALRRAKFKFPGRQ
FT                   KIHISKKWGFTKFNADEFEDKVAAKRLIPDGCGVKYIPERGPLDKWRALHS"
FT   gene            complement(41787415..>42005862)
FT                   /locus_tag="mCG_7332"
FT                   /note="gene_id=mCG7332.2"
FT   mRNA            complement(join(41787415..41788074,41789673..41789778,
FT                   41803182..41803312,41822563..41822721,41823124..41823279,
FT                   41829587..41829764,41866863..41867011,41885105..41885374,
FT                   41946469..41946762,41971477..41971806,42005593..>42005862))
FT                   /locus_tag="mCG_7332"
FT                   /product="mCG7332"
FT                   /note="gene_id=mCG7332.2 transcript_id=mCT6324.2 created on
FT                   05-SEP-2002"
FT   CDS             complement(join(41787986..41788074,41789673..41789778,
FT                   41803182..41803312,41822563..41822721,41823124..41823279,
FT                   41829587..41829764,41866863..41867011,41885105..41885374,
FT                   41946469..41946762,41971477..41971806,42005593..>42005860))
FT                   /codon_start=1
FT                   /locus_tag="mCG_7332"
FT                   /product="mCG7332"
FT                   /note="gene_id=mCG7332.2 transcript_id=mCT6324.2
FT                   protein_id=mCP13517.1"
FT                   /protein_id="EDL36638.1"
FT                   /translation="SPSIKLLVDDPIVVNPGEAITLVCVTTGGEPTPSLTWVRSFGTLP
FT                   EKIVLNGGTLTIPAITSDDAGTYSCIANNNVGNPAKKSTNIIVRALKKGRFWITPDPYH
FT                   KDDNIQIGREVKISCQVEAVPSEELTFSWFKNGRPLRSSERMVITQTDPDVSPGTTNLD
FT                   IIDLKFTDFGTYTCVASLKGGGISDISIDVNISSSTVPPNLTVPQEKSPLVTREGDTIE
FT                   LQCQVTGKPKPIILWSRADKEVAMPDGTMQMESYDGTLRIVNVSREMSGMYRCQTSQYN
FT                   GFNVKPREALVQLIVQYPPAVEPAFLEIRQGQDRSVTMSCRVLRAYPIRVLTYEWRLGN
FT                   KLLRTGQFDSQEYTEYPLKSLSNENYGVYNCSIINEAGAGRCSFLVTGKAYAPEFYYDT
FT                   YNPVWQNRHRVYSYSLQWTQMNPDAVDRIVAYRLGIRQAGQQRWWEQEIKINGNIQKGE
FT                   LITYNLTELIKPEAYEVRLTPLTKFGEGDSTIRVIKYTGEFHCGFEDGNICLFTQDDTD
FT                   NFDWTKQSTATRNTKYTPNTGPSADRSGSKEGFYMYIETSRPRLEGEKARLLSPVFSIA
FT                   PKNPYGPTNSAYCFSFFYHMYGQHIGVLNVYLRLKGQTTIENPLWSSSGNKGQRWNEAH
FT                   VNIYPITSFQLIFEGIRGPGIEGDIAIDDVSIAEGECAKQDLPTKNSVDGAVGILVHIW
FT                   LFPVIILISILSPRR"
FT   gene            complement(42032146..42184470)
FT                   /locus_tag="mCG_12198"
FT                   /note="gene_id=mCG12198.1"
FT   mRNA            complement(join(42032146..42032331,42038542..42038738,
FT                   42113295..42113464,42184350..42184470))
FT                   /locus_tag="mCG_12198"
FT                   /product="mCG12198"
FT                   /note="gene_id=mCG12198.1 transcript_id=mCT12626.1 created
FT                   on 13-SEP-2002"
FT   CDS             complement(join(42032313..42032331,42038542..42038675))
FT                   /codon_start=1
FT                   /locus_tag="mCG_12198"
FT                   /product="mCG12198"
FT                   /note="gene_id=mCG12198.1 transcript_id=mCT12626.1
FT                   protein_id=mCP13503.2"
FT                   /protein_id="EDL36637.1"
FT                   /translation="MREQCFSDVWPIPTPLCAIAGDVVRRYYYKDLTREWRFMSPFLPR
FT                   GKRRS"
FT   gene            complement(<42519801..>42573571)
FT                   /locus_tag="mCG_65397"
FT                   /note="gene_id=mCG65397.1"
FT   mRNA            complement(join(<42519801..42519859,42537634..42537822,
FT                   42538105..42538269,42538640..42539106,42539353..42539620,
FT                   42565951..42565981,42566130..42566231,42573470..>42573571))
FT                   /locus_tag="mCG_65397"
FT                   /product="mCG65397"
FT                   /note="gene_id=mCG65397.1 transcript_id=mCT65580.1 created
FT                   on 13-SEP-2002"
FT   CDS             complement(join(42519801..42519859,42537634..42537822,
FT                   42538105..42538269,42538640..42539106,42539353..42539620,
FT                   42565951..42565981,42566130..42566231,42573470..42573571))
FT                   /codon_start=1
FT                   /locus_tag="mCG_65397"
FT                   /product="mCG65397"
FT                   /note="gene_id=mCG65397.1 transcript_id=mCT65580.1
FT                   protein_id=mCP34832.1"
FT                   /protein_id="EDL36636.1"
FT                   /translation="MHRKKESTEQNGLLDKLNKCAHTPNSYSHVLHVRSEFSLGDQNYL
FT                   VGEESSSSWYLYAQRASDPYQCQKSQVSLDQLDSKQNSSWKTLDGRKGIKVSCNYRVSE
FT                   DVASPSLPRANASGGIGNELPALAPAELGKNQGWPRRGGREAGCCYPSEPITAVQADEH
FT                   QCLPCVNPGIPSKRRAPDAPLPSLGISAATAARKAAAQPGCPQQAAASLFRSGCQHSVS
FT                   PGGESPSAAPGSKLPPVSTAPTPSTWRGRRGSEEDSRYGWARVDGVRICSALGILPLLQ
FT                   VVVLGLCFWLRRLVLPPGAPSLLAGRSRLFGRAVAVAAAAEAARFASRGAPRAPARSCR
FT                   LPAPGARSRFPEEHLSSQLCFPSPPPAPPRRLRFSQAPVPGHLDSARAQVERALLAAGL
FT                   QKVPLRPPWAGYVHVHVKMDLVYGLVWLLTVLLEGISGQGVYDIECNLLQHSHFAFAGA
FT                   EE"
FT   gene            complement(<42661508..42661644)
FT                   /locus_tag="mCG_1041627"
FT                   /note="gene_id=mCG1041627.1"
FT   mRNA            complement(<42661508..42661644)
FT                   /locus_tag="mCG_1041627"
FT                   /product="mCG1041627"
FT                   /note="gene_id=mCG1041627.1 transcript_id=mCT159331.1
FT                   created on 13-SEP-2002"
FT   CDS             complement(42661508..42661639)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041627"
FT                   /product="mCG1041627"
FT                   /note="gene_id=mCG1041627.1 transcript_id=mCT159331.1
FT                   protein_id=mCP78940.1"
FT                   /protein_id="EDL36635.1"
FT                   /translation="MFYRPWEKDFQQSTKFKAFLKNFVILYCGIAWDVGSVLRSRTD"
FT   gene            42830650..>42830800
FT                   /locus_tag="mCG_1041563"
FT                   /note="gene_id=mCG1041563.1"
FT   mRNA            42830650..>42830800
FT                   /locus_tag="mCG_1041563"
FT                   /product="mCG1041563"
FT                   /note="gene_id=mCG1041563.1 transcript_id=mCT159267.1
FT                   created on 13-SEP-2002"
FT   CDS             42830686..>42830800
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041563"
FT                   /product="mCG1041563"
FT                   /note="gene_id=mCG1041563.1 transcript_id=mCT159267.1
FT                   protein_id=mCP79117.1"
FT                   /protein_id="EDL36634.1"
FT                   /translation="MVRYSLDPENPTKSCKSRGSNLRVHFKNTRETAQAIKG"
FT   gene            42964273..>42971158
FT                   /locus_tag="mCG_118662"
FT                   /note="gene_id=mCG118662.0"
FT   mRNA            join(42964273..42964635,42965162..42965318,
FT                   42970075..42970120,42970854..>42971158)
FT                   /locus_tag="mCG_118662"
FT                   /product="mCG118662"
FT                   /note="gene_id=mCG118662.0 transcript_id=mCT119821.0
FT                   created on 05-SEP-2002"
FT   CDS             join(42965186..42965318,42970075..42970120,
FT                   42970854..>42971158)
FT                   /codon_start=1
FT                   /locus_tag="mCG_118662"
FT                   /product="mCG118662"
FT                   /note="gene_id=mCG118662.0 transcript_id=mCT119821.0
FT                   protein_id=mCP79040.1"
FT                   /protein_id="EDL36633.1"
FT                   /translation="MESLRLEVEVLRKKEEPGGERSSGLVNETGKGPHDEKRKEDRLEG
FT                   RYCESIKVKQNRRTRWSSLGTIPTGQVLLRKELWVRPHLSSAKPCLCQFQPSSSCLAPL
FT                   HPEFHCSMVLLLLTSTPRHLSILRSSSLAQPFTDNSDYNHHYTLEIRYILFSLYCYL"
FT   gene            complement(<44386578..>44390752)
FT                   /locus_tag="mCG_1041748"
FT                   /note="gene_id=mCG1041748.0"
FT   mRNA            complement(join(<44386578..44386600,44390623..>44390752))
FT                   /locus_tag="mCG_1041748"
FT                   /product="mCG1041748"
FT                   /note="gene_id=mCG1041748.0 transcript_id=mCT159452.0
FT                   created on 18-SEP-2002"
FT   CDS             complement(join(<44386578..44386600,44390623..>44390752))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041748"
FT                   /product="mCG1041748"
FT                   /note="gene_id=mCG1041748.0 transcript_id=mCT159452.0
FT                   protein_id=mCP78676.0"
FT                   /protein_id="EDL36632.1"
FT                   /translation="WFTRSHRVLTHSSFRTTSPGRASSTEPSTTVGPYHSSSFLLISAA
FT                   AAAAAT"
FT   gene            <44393596..>44394405
FT                   /locus_tag="mCG_7607"
FT                   /note="gene_id=mCG7607.1"
FT   mRNA            join(<44393596..44393797,44393827..>44394405)
FT                   /locus_tag="mCG_7607"
FT                   /product="mCG7607"
FT                   /note="gene_id=mCG7607.1 transcript_id=mCT6771.1 created on
FT                   05-SEP-2002"
FT   CDS             join(<44393597..44393797,44393827..44394405)
FT                   /codon_start=1
FT                   /locus_tag="mCG_7607"
FT                   /product="mCG7607"
FT                   /note="gene_id=mCG7607.1 transcript_id=mCT6771.1
FT                   protein_id=mCP3224.0"
FT                   /protein_id="EDL36631.1"
FT                   /translation="SPFSALNNCCEVETCVNPVGILDLRLPLSIGLINSPAPRPLRTME
FT                   GNGSVDMFSEVLENQFLQAAKLKLDQIGEDELELLKEKRLAALRQAQQQKEEWLSKGHG
FT                   EYREIGSERDFFQEVKESEKVVCHFYRDTTFRCKILDRHLAILAKKHLETKFLKLNVEK
FT                   APFLCERLRIKVIPTLALLRDGKTQDYVVGFTDLGNTDDFTTETLEWRLGCSDVINYSG
FT                   NLMEPPFQSQKKFGTNFTKLEKKTIRGKKYDSDSDDD"
FT   gene            complement(44411978..>44428670)
FT                   /locus_tag="mCG_1041623"
FT                   /note="gene_id=mCG1041623.1"
FT   mRNA            complement(join(44411978..44412466,44412558..44412917,
FT                   44428619..>44428670))
FT                   /locus_tag="mCG_1041623"
FT                   /product="mCG1041623"
FT                   /note="gene_id=mCG1041623.1 transcript_id=mCT159327.1
FT                   created on 13-SEP-2002"
FT   CDS             complement(join(44412189..44412466,44412558..44412917,
FT                   44428619..44428670))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041623"
FT                   /product="mCG1041623"
FT                   /note="gene_id=mCG1041623.1 transcript_id=mCT159327.1
FT                   protein_id=mCP78893.1"
FT                   /protein_id="EDL36630.1"
FT                   /translation="MAFRSPTLRDETVGRHRACAERWASLRTTGTRATRVAARESPTTR
FT                   SGNTSWDRQPAASTKTGPRCIPTYTVRVRGSSKQYRALRLDVGNFSWGSECCIHKTRII
FT                   DVVYNASNNDLVRTKTLVNSCIVLIDRQHVVLAGSKKTIKEIQRKEKDCKIRSLLEEQL
FT                   QQGEPLVCIASRPGRCGRADGSETRSRSSICRRSKLGKANKPSFIALVIIKTTKPNPIS
FT                   FFSPDGS"
FT   gene            complement(44434851..>44436263)
FT                   /locus_tag="mCG_7602"
FT                   /note="gene_id=mCG7602.2"
FT   mRNA            complement(join(44434851..44434947,44435787..44435886,
FT                   44436123..>44436263))
FT                   /locus_tag="mCG_7602"
FT                   /product="mCG7602"
FT                   /note="gene_id=mCG7602.2 transcript_id=mCT6765.2 created on
FT                   29-AUG-2002"
FT   CDS             complement(join(44434939..44434947,44435787..44435886,
FT                   44436123..>44436196))
FT                   /codon_start=1
FT                   /locus_tag="mCG_7602"
FT                   /product="mCG7602"
FT                   /note="gene_id=mCG7602.2 transcript_id=mCT6765.2
FT                   protein_id=mCP3291.1"
FT                   /protein_id="EDL36629.1"
FT                   /translation="SEGKMGHQQLYWSHPRKFGQGSRSCRVCSNRHGLIRKYGLNMCRQ
FT                   CFRQYAKDIGFIKLD"
FT   gene            <44445729..44455977
FT                   /locus_tag="mCG_7609"
FT                   /note="gene_id=mCG7609.2"
FT   mRNA            join(<44445729..44445970,44448777..44448875,
FT                   44455546..44455973)
FT                   /locus_tag="mCG_7609"
FT                   /product="mCG7609, transcript variant mCT193440"
FT                   /note="gene_id=mCG7609.2 transcript_id=mCT193440.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(<44445730..44445970,44448777..44448875,
FT                   44451302..44452023,44455546..44455977)
FT                   /locus_tag="mCG_7609"
FT                   /product="mCG7609, transcript variant mCT6758"
FT                   /note="gene_id=mCG7609.2 transcript_id=mCT6758.1 created on
FT                   05-SEP-2002"
FT   CDS             join(<44445731..44445970,44448777..44448875,
FT                   44451302..44452023,44455546..44455786)
FT                   /codon_start=1
FT                   /locus_tag="mCG_7609"
FT                   /product="mCG7609, isoform CRA_b"
FT                   /note="gene_id=mCG7609.2 transcript_id=mCT6758.1
FT                   protein_id=mCP3169.1 isoform=CRA_b"
FT                   /protein_id="EDL36628.1"
FT                   /translation="SLRASGRLSCKMRLPCEVEVRSCHLPTLGLKSRGKGVRAVVSLCQ
FT                   APGRNELQPEARAEPGGHACLLVSTMKDRQGTSYKLRENIEQLFTKFVDEGKATVRLKE
FT                   PPVDICLSKANPGNLKTLLSAMRLAHRGCDVNTPLSTLKPVKTSEFEKYKTKMVITSKK
FT                   DYPLSKNFPYFLEHLQASYCSLARVDMRMLCLKNLTKLDLSHNCIKKLPATIGDLTHLQ
FT                   ELNLNDNQLETFSVPLCTSTLQKSLHSLDLSKNKIKALPVQFCQFRELTNLNLNDNELI
FT                   HLPFKIGQLTNLRFLSAARNKLRNLPSEFKMLSLEYLDLFGNTFEKPEVIPIIKLQVPL
FT                   TLLESCEQAVLFYRIPYGPDIIPYHLCQDLDTAKTCVCGRFCLQSFIQGTTTMNLHSVA
FT                   HTVVLVDSMGRTEAPVVSYFCSLTCFVKSSDMLN"
FT   CDS             join(<44445731..44445970,44448777..44448875,
FT                   44455546..44455563)
FT                   /codon_start=1
FT                   /locus_tag="mCG_7609"
FT                   /product="mCG7609, isoform CRA_a"
FT                   /note="gene_id=mCG7609.2 transcript_id=mCT193440.0
FT                   protein_id=mCP114442.0 isoform=CRA_a"
FT                   /protein_id="EDL36627.1"
FT                   /translation="SLRASGRLSCKMRLPCEVEVRSCHLPTLGLKSRGKGVRAVVSLCQ
FT                   APGRNELQPEARAEPGGHACLLVSTMKDRQGTSYKLRENIEQLFTKFVDEGKATVRLKE
FT                   PPVDICLSKDSIWP"
FT   gene            complement(44459662..>44460974)
FT                   /locus_tag="mCG_7611"
FT                   /note="gene_id=mCG7611.1"
FT   mRNA            complement(join(44459662..44460097,44460372..>44460599))
FT                   /locus_tag="mCG_7611"
FT                   /product="mCG7611, transcript variant mCT172871"
FT                   /note="gene_id=mCG7611.1 transcript_id=mCT172871.0 created
FT                   on 29-AUG-2002"
FT   mRNA            complement(join(44459673..44460097,44460915..>44460974))
FT                   /locus_tag="mCG_7611"
FT                   /product="mCG7611, transcript variant mCT6760"
FT                   /note="gene_id=mCG7611.1 transcript_id=mCT6760.0 created on
FT                   29-AUG-2002"
FT   mRNA            complement(join(44459680..44460097,44460597..>44460685))
FT                   /locus_tag="mCG_7611"
FT                   /product="mCG7611, transcript variant mCT172872"
FT                   /note="gene_id=mCG7611.1 transcript_id=mCT172872.0 created
FT                   on 29-AUG-2002"
FT   CDS             complement(join(44459748..44460097,44460915..>44460942))
FT                   /codon_start=1
FT                   /locus_tag="mCG_7611"
FT                   /product="mCG7611, isoform CRA_c"
FT                   /note="gene_id=mCG7611.1 transcript_id=mCT6760.0
FT                   protein_id=mCP3286.0 isoform=CRA_c"
FT                   /protein_id="EDL36626.1"
FT                   /translation="VGDRGGRSLVLIADTSTANMVNVPKTRRTFCKKCGKHQPHKVTQY
FT                   KKGKDSLYAQGKRRYDRKQSGYGGQTKPIFRKKAKTTKKIVLRLECVEPNCRSKRMLAI
FT                   KRCKHFELGGDKKRKGQVIQF"
FT   CDS             complement(join(44459748..44460097,44460597..>44460651))
FT                   /codon_start=1
FT                   /locus_tag="mCG_7611"
FT                   /product="mCG7611, isoform CRA_b"
FT                   /note="gene_id=mCG7611.1 transcript_id=mCT172872.0
FT                   protein_id=mCP95791.0 isoform=CRA_b"
FT                   /protein_id="EDL36625.1"
FT                   /translation="RGWGEGTSPVVAETTIFRFLIADTSTANMVNVPKTRRTFCKKCGK
FT                   HQPHKVTQYKKGKDSLYAQGKRRYDRKQSGYGGQTKPIFRKKAKTTKKIVLRLECVEPN
FT                   CRSKRMLAIKRCKHFELGGDKKRKGQVIQF"
FT   CDS             complement(join(44459748..44460097,44460372..>44460426))
FT                   /codon_start=1
FT                   /locus_tag="mCG_7611"
FT                   /product="mCG7611, isoform CRA_a"
FT                   /note="gene_id=mCG7611.1 transcript_id=mCT172871.0
FT                   protein_id=mCP95790.0 isoform=CRA_a"
FT                   /protein_id="EDL36624.1"
FT                   /translation="GRPQLAILCLSLPGHTPSVLIADTSTANMVNVPKTRRTFCKKCGK
FT                   HQPHKVTQYKKGKDSLYAQGKRRYDRKQSGYGGQTKPIFRKKAKTTKKIVLRLECVEPN
FT                   CRSKRMLAIKRCKHFELGGDKKRKGQVIQF"
FT   gene            44461107..44463374
FT                   /gene="Mgat2"
FT                   /locus_tag="mCG_50193"
FT                   /note="gene_id=mCG50193.2"
FT   mRNA            44461107..44463374
FT                   /gene="Mgat2"
FT                   /locus_tag="mCG_50193"
FT                   /product="mannoside acetylglucosaminyltransferase 2"
FT                   /note="gene_id=mCG50193.2 transcript_id=mCT50376.2 created
FT                   on 13-SEP-2002"
FT   CDS             44461586..44462914
FT                   /codon_start=1
FT                   /gene="Mgat2"
FT                   /locus_tag="mCG_50193"
FT                   /product="mannoside acetylglucosaminyltransferase 2"
FT                   /note="gene_id=mCG50193.2 transcript_id=mCT50376.2
FT                   protein_id=mCP26366.1"
FT                   /protein_id="EDL36623.1"
FT                   /translation="MRFRIYKRKVLILTLVVAACGFVLWSSNGRQRKSDALGPPLLDAE
FT                   PVRGAGHLAVSVGIRRVSNESAAPLVPAVPRPEVDNLTLRYRSLVYQLNFDQMLRNVGN
FT                   DGTWSPGELVLVVQVHNRPEYLRLLIDSLRKAQGIQEVLVIFSHDFWSAEINSLISRVD
FT                   FCPVLQVFFPFSIQLYPNEFPGSDPRDCPRDLKKNAALKLGCINAEYPDSFGHYREAKF
FT                   SQTKHHWWWKLHFVWERVKVLQDYTGLILFLEEDHYLAPDFYHVFKKMWKLKQQECPGC
FT                   DVLSLGTYTTIRSFYGIADKVDVKTWKSTEHNMGLALTRDAYQKLIECTDTFCTYDDYN
FT                   WDWTLQYLTLACLPKIWKVLVPQAPRIFHAGDCGMHHKKTCRPSTQSAQIESLLNSNKQ
FT                   YLFPETLVIGEKFPMAAISPPRKNGGWGDIRDHELCKSYRRLQ"
FT   gene            complement(44466022..>44475213)
FT                   /gene="1110034A24Rik"
FT                   /locus_tag="mCG_123640"
FT                   /note="gene_id=mCG123640.1"
FT   mRNA            complement(join(44466022..44467326,44469736..44469879,
FT                   44473420..>44474010))
FT                   /gene="1110034A24Rik"
FT                   /locus_tag="mCG_123640"
FT                   /product="RIKEN cDNA 1110034A24, transcript variant
FT                   mCT193469"
FT                   /note="gene_id=mCG123640.1 transcript_id=mCT193469.0
FT                   created on 09-MAR-2004"
FT   mRNA            complement(join(44466023..44467320,44469736..44469879,
FT                   44473420..44474826,44474923..>44475213))
FT                   /gene="1110034A24Rik"
FT                   /locus_tag="mCG_123640"
FT                   /product="RIKEN cDNA 1110034A24, transcript variant
FT                   mCT124874"
FT                   /note="gene_id=mCG123640.1 transcript_id=mCT124874.0
FT                   created on 05-SEP-2002"
FT   CDS             complement(join(44466820..44467320,44469736..44469879,
FT                   44473420..44474826,44474923..44475213))
FT                   /codon_start=1
FT                   /gene="1110034A24Rik"
FT                   /locus_tag="mCG_123640"
FT                   /product="RIKEN cDNA 1110034A24, isoform CRA_b"
FT                   /note="gene_id=mCG123640.1 transcript_id=mCT124874.0
FT                   protein_id=mCP78865.0 isoform=CRA_b"
FT                   /protein_id="EDL36622.1"
FT                   /translation="MAKAAASSALEDLDLSREEVQRFTSAFQDPEFRRMFSEYAAEITD
FT                   PENRRRYEEEITALERERGVDVRFVHPEPGHVLRTSLDGEHRCYVNVCSNSLYAGRNGA
FT                   RYTVYDVVFHPEALALARSHERFREMLDATALEAVEQQFGVRLDRRNAKTLKIKYKGMP
FT                   EAAVLRTPLPGGVPAQPEGEPPGLFPDPPYPYRYPAAAAANTARSPASPAPEAVQRPEP
FT                   TEPRCSVVQRHHVDLQDYRCSRDAAPSTVPHELVVTIELPLLRSVERAELEVKGKLLCL
FT                   DSRNPDYRLRLSLPYPVDDGRGKAQYNKARRQLVVTLPVALADARQEPPAATPEEPAEE
FT                   TGTDDVARTSAGDFAAAREESADGTGADHGEKSGVGAPDPGAAHAEGELVPEPEQDFGG
FT                   DSVAPLDLGKGTSPGDRSLPYSAFPGGDTESLCGDPGVQTNEEQERTRHDTAGSAMGDP
FT                   GTESIAPVCPPLQCNQDEDSLTLLIQVPGILPQTLHGHLSPVGYELCFSTQDSGYSCTL
FT                   QFAPENKLSTREPETSVSLNNAVIVLAKSPESHGLWREWYCGLNKESLEERLFINEENV
FT                   NGFLEEVLCSPLKQARSLAPPLIEVLQATDEQVQIHAEECSDPAGLQGKGKGVREGCPL
FT                   SEAEAADQSATSPAASDSAAAVEALKINTHGSAVDLQHGCPEVPHVLSGKPLQPEAKMD
FT                   PEFIRESSTTYSTEEKENIREPVISKGEKINGDHPSSLLNKTVVQNIPDFDTIKETNMQ
FT                   DGSVQIIRDHTTHCAFSFQNPLLYDLD"
FT   CDS             complement(join(44466820..44467326,44469736..44469879,
FT                   44473420..>44474010))
FT                   /codon_start=1
FT                   /gene="1110034A24Rik"
FT                   /locus_tag="mCG_123640"
FT                   /product="RIKEN cDNA 1110034A24, isoform CRA_a"
FT                   /note="gene_id=mCG123640.1 transcript_id=mCT193469.0
FT                   protein_id=mCP114399.0 isoform=CRA_a"
FT                   /protein_id="EDL36621.1"
FT                   /translation="GEKSGVGAPDPGAAHAEGELVPEPEQDFGGDSVAPLDLGKGTSPG
FT                   DRSLPYSAFPGGDTESLCGDPGVQTNEEQERTRHDTAGSAMGDPGTESIAPVCPPLQCN
FT                   QDEDSLTLLIQVPGILPQTLHGHLSPVGYELCFSTQDSGYSCTLQFAPENKLSTREPET
FT                   SVSLNNAVIVLAKSPESHGLWREWYCGLNKESLEERLFINEENVNGFLEEVLCSPLKQA
FT                   RSLAPPLIEVLQATDEQVQIHAELQECSDPAGLQGKGKGVREGCPLSEAEAADQSATSP
FT                   AASDSAAAVEALKINTHGSAVDLQHGCPEVPHVLSGKPLQPEAKMDPEFIRESSTTYST
FT                   EEKENIREPVISKGEKINGDHPSSLLNKTVVQNIPDFDTIKETNMQDGSVQIIRDHTTH
FT                   CAFSFQNPLLYDLD"
FT   gene            complement(<44488284..>44505202)
FT                   /gene="Pole2"
FT                   /locus_tag="mCG_7603"
FT                   /note="gene_id=mCG7603.3"
FT   mRNA            complement(join(<44488284..44488356,44489134..44489179,
FT                   44490740..44490823,44492220..44492294,44499026..44499119,
FT                   44499448..44499525,44500154..44500229,44503348..44503448,
FT                   44505107..>44505183))
FT                   /gene="Pole2"
FT                   /locus_tag="mCG_7603"
FT                   /product="polymerase (DNA directed), epsilon 2 (p59
FT                   subunit), transcript variant mCT6766"
FT                   /note="gene_id=mCG7603.3 transcript_id=mCT6766.2 created on
FT                   05-SEP-2002"
FT   CDS             complement(join(<44488284..44488356,44489134..44489179,
FT                   44490740..44490823,44492220..44492294,44499026..44499119,
FT                   44499448..44499525,44500154..44500229,44503348..44503448,
FT                   44505107..>44505183))
FT                   /codon_start=1
FT                   /gene="Pole2"
FT                   /locus_tag="mCG_7603"
FT                   /product="polymerase (DNA directed), epsilon 2 (p59
FT                   subunit), isoform CRA_b"
FT                   /note="gene_id=mCG7603.3 transcript_id=mCT6766.2
FT                   protein_id=mCP3101.2 isoform=CRA_b"
FT                   /protein_id="EDL36620.1"
FT                   /translation="IANMAPERLRSRTVSAFKLRGLLLRSEATKYLTEALQSVTELELE
FT                   ENLGKIIDAVEKQPLSSNMIERSVVEAAVQECSQSMDETIEHVFNIIGAFDIPRFIYNS
FT                   ERKKFLPLSMTNHAAPTLFGTARDKAELYLERYTILHQRTHRHELFTPPVIGSHLEESG
FT                   SKFQLKTIETLLGSTSKVGDVIVLGMITQLKEFHSGLYTEACFVLAEGWFEDQVFHANA
FT                   FGFPPTEPSSTT"
FT   mRNA            complement(join(<44489907..44489954,44490740..44490823,
FT                   44492220..44492294,44499026..44499119,44499448..44499525,
FT                   44500154..44500229,44503348..44503448,44505107..>44505202))
FT                   /gene="Pole2"
FT                   /locus_tag="mCG_7603"
FT                   /product="polymerase (DNA directed), epsilon 2 (p59
FT                   subunit), transcript variant mCT193432"
FT                   /note="gene_id=mCG7603.3 transcript_id=mCT193432.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(<44489907..44489954,44490740..44490823,
FT                   44492220..44492294,44499026..44499119,44499448..44499525,
FT                   44500154..44500229,44503348..44503448,44505107..>44505201))
FT                   /codon_start=1
FT                   /gene="Pole2"
FT                   /locus_tag="mCG_7603"
FT                   /product="polymerase (DNA directed), epsilon 2 (p59
FT                   subunit), isoform CRA_a"
FT                   /note="gene_id=mCG7603.3 transcript_id=mCT193432.0
FT                   protein_id=mCP114441.0 isoform=CRA_a"
FT                   /protein_id="EDL36619.1"
FT                   /translation="RRRWRQIANMAPERLRSRTVSAFKLRGLLLRSEATKYLTEALQSV
FT                   TELELEENLGKIIDAVEKQPLSSNMIERSVVEAAVQECSQSMDETIEHVFNIIGAFDIP
FT                   RFIYNSERKKFLPLSMTNHAAPTLFGTARDKAELYLERYTILHQRTHRHELFTPPVIGS
FT                   HLEESGSKFQLKTIETLLGSTSKVGDVIVLGMITQLKEGKFFLEDPTGTVQLDL"
FT   gene            44530001..44543311
FT                   /gene="Klhdc1"
FT                   /locus_tag="mCG_7610"
FT                   /note="gene_id=mCG7610.2"
FT   mRNA            join(44530001..44530118,44530558..44530676,
FT                   44532322..44532400,44535720..44535803,44537561..44537644,
FT                   44538107..44538165,44539039..44539151,44542771..44543311)
FT                   /gene="Klhdc1"
FT                   /locus_tag="mCG_7610"
FT                   /product="kelch domain containing 1"
FT                   /note="gene_id=mCG7610.2 transcript_id=mCT6759.2 created on
FT                   05-SEP-2002"
FT   CDS             join(44530005..44530118,44530558..44530676,
FT                   44532322..44532400,44535720..44535803,44537561..44537644,
FT                   44538107..44538165,44539039..44539151,44542771..44542847)
FT                   /codon_start=1
FT                   /gene="Klhdc1"
FT                   /locus_tag="mCG_7610"
FT                   /product="kelch domain containing 1"
FT                   /note="gene_id=mCG7610.2 transcript_id=mCT6759.2
FT                   protein_id=mCP3254.2"
FT                   /protein_id="EDL36618.1"
FT                   /translation="MHLMEGELPPSMSGSCGACIHGRLYVFGGYDDKGYSNRLYFVNLR
FT                   TRDGTYTWEKITKFDGQPPTPRDKLSCWVYKDRLIYFGGYGYRRHSELQECFDVHDASW
FT                   EEQIFWGWHNDVHVFDTKTRTWSQPEIKGGVPPQPRAAHSCAVLGNKGYVFGGRVLQTR
FT                   MNDLHYLNLDTWVWSGRISVNGESPKHRSWHTLTAITDDKLFLFGGLNADNIPLSDGWI
FT                   HNITTNCWKQLRHLPYTRPR"
FT   gene            44575783..44595397
FT                   /gene="Klhdc2"
FT                   /locus_tag="mCG_7606"
FT                   /note="gene_id=mCG7606.2"
FT   mRNA            join(44575783..44576516,44579597..44579676,
FT                   44585481..44585598,44588791..44588871,44588946..44589004,
FT                   44590353..44590462,44590781..44590853,44592121..44592208,
FT                   44593297..44593349,44593463..44595397)
FT                   /gene="Klhdc2"
FT                   /locus_tag="mCG_7606"
FT                   /product="kelch domain containing 2, transcript variant
FT                   mCT6770"
FT                   /note="gene_id=mCG7606.2 transcript_id=mCT6770.3 created on
FT                   12-JUN-2003"
FT   mRNA            join(44575783..44576516,44579597..44579676,
FT                   44585481..44585598,44588791..44588871,44590781..44590853,
FT                   44592121..44592208,44593297..44593349,44593463..44595397)
FT                   /gene="Klhdc2"
FT                   /locus_tag="mCG_7606"
FT                   /product="kelch domain containing 2, transcript variant
FT                   mCT185631"
FT                   /note="gene_id=mCG7606.2 transcript_id=mCT185631.0 created
FT                   on 12-JUN-2003"
FT   mRNA            join(44575783..44576516,44579597..44579676,
FT                   44585481..44585598,44588791..44588871,44588946..44589004,
FT                   44590353..44591829)
FT                   /gene="Klhdc2"
FT                   /locus_tag="mCG_7606"
FT                   /product="kelch domain containing 2, transcript variant
FT                   mCT185630"
FT                   /note="gene_id=mCG7606.2 transcript_id=mCT185630.0 created
FT                   on 12-JUN-2003"
FT   CDS             join(44576364..44576516,44579597..44579676,
FT                   44585481..44585598,44588791..44588871,44588946..44589004,
FT                   44590353..44590462,44590781..44590853,44592121..44592208,
FT                   44593297..44593349,44593463..44593586)
FT                   /codon_start=1
FT                   /gene="Klhdc2"
FT                   /locus_tag="mCG_7606"
FT                   /product="kelch domain containing 2, isoform CRA_d"
FT                   /note="gene_id=mCG7606.2 transcript_id=mCT6770.3
FT                   protein_id=mCP3190.3 isoform=CRA_d"
FT                   /protein_id="EDL36617.1"
FT                   /translation="MADGNEDARAEDLPGPAFENYEAMELACPAERSGHVAVSDGRHMF
FT                   VWGGYKSNQVRGLYDFYLPREELWIYNMETGRWKKINTEGDVPPSMSGSCAVCVDRVLY
FT                   LFGGHHSRGNTNKGKAPSPRAAHACATVGNKGFVFGGRYRDARMNDLHYLNLDTWEWNE
FT                   LIPQGVCPVGRSWHSLTPVSSDHLFLFGGFTTEKQPLSDAWTYCISKNEWIQFNHPYVE
FT                   KPRLWHTACASDEGEVIVFGGCANNLLVHHRAAHSNEVLIFSVQPKSLVRLSLEAVICF
FT                   KEMLANSWSCLPKHLLHSVNQRFGSNNTSGS"
FT   CDS             join(44576364..44576516,44579597..44579676,
FT                   44585481..44585598,44588791..44588871,44590781..44590853,
FT                   44592121..44592208,44593297..44593349,44593463..44593467)
FT                   /codon_start=1
FT                   /gene="Klhdc2"
FT                   /locus_tag="mCG_7606"
FT                   /product="kelch domain containing 2, isoform CRA_b"
FT                   /note="gene_id=mCG7606.2 transcript_id=mCT185631.0
FT                   protein_id=mCP106889.0 isoform=CRA_b"
FT                   /protein_id="EDL36615.1"
FT                   /translation="MADGNEDARAEDLPGPAFENYEAMELACPAERSGHVAVSDGRHMF
FT                   VWGGYKSNQVRGLYDFYLPREELWIYNMETGRWKKINTEGDVPPSMSGSCAVCVDRVLY
FT                   LFGGHHSRGNTNKGKAPSPRAAHACATVGNKGFVFGGRYRVMPGLTASVKMNGFSLIIL
FT                   MLKNQDYGTLLVRAMKEKSLFLVVVLTICWFITELHTVMKYLYFQFNQNLLYG"
FT   CDS             join(44576364..44576516,44579597..44579676,
FT                   44585481..44585598,44588791..44588871,44588946..44589004,
FT                   44590353..44590488)
FT                   /codon_start=1
FT                   /gene="Klhdc2"
FT                   /locus_tag="mCG_7606"
FT                   /product="kelch domain containing 2, isoform CRA_a"
FT                   /note="gene_id=mCG7606.2 transcript_id=mCT185630.0
FT                   protein_id=mCP106888.0 isoform=CRA_a"
FT                   /protein_id="EDL36614.1"
FT                   /translation="MADGNEDARAEDLPGPAFENYEAMELACPAERSGHVAVSDGRHMF
FT                   VWGGYKSNQVRGLYDFYLPREELWIYNMETGRWKKINTEGDVPPSMSGSCAVCVDRVLY
FT                   LFGGHHSRGNTNKGKAPSPRAAHACATVGNKGFVFGGRYRDARMNDLHYLNLDTWEWNE
FT                   LIPQGVCPVGRSWHSLTPVSSDHLFLFGGFTTEKQPLSESFSHTS"
FT   mRNA            join(<44582969..44583052,44583127..44583153,
FT                   44588973..44589004,44590353..44590462,44590781..44590853,
FT                   44592121..44592208,44593297..44593349,44593463..44595397)
FT                   /gene="Klhdc2"
FT                   /locus_tag="mCG_7606"
FT                   /product="kelch domain containing 2, transcript variant
FT                   mCT185632"
FT                   /note="gene_id=mCG7606.2 transcript_id=mCT185632.0 created
FT                   on 12-JUN-2003"
FT   CDS             join(<44582969..44583052,44583127..44583153,
FT                   44588973..44589004,44590353..44590462,44590781..44590853,
FT                   44592121..44592208,44593297..44593349,44593463..44593586)
FT                   /codon_start=1
FT                   /gene="Klhdc2"
FT                   /locus_tag="mCG_7606"
FT                   /product="kelch domain containing 2, isoform CRA_c"
FT                   /note="gene_id=mCG7606.2 transcript_id=mCT185632.0
FT                   protein_id=mCP106890.0 isoform=CRA_c"
FT                   /protein_id="EDL36616.1"
FT                   /translation="QGKAPSPRAAHACATVGNKGFVFGGRYRDARMNDLHYLNLDTWEW
FT                   NELIPQGVCPVGRSWHSLTPVSSDHLFLFGGFTTEKQPLSDAWTYCISKNEWIQFNHPY
FT                   VEKPRLWHTACASDEGEVIVFGGCANNLLVHHRAAHSNEVLIFSVQPKSLVRLSLEAVI
FT                   CFKEMLANSWSCLPKHLLHSVNQRFGSNNTSGS"
FT   gene            complement(44594358..>44640487)
FT                   /locus_tag="mCG_3169"
FT                   /note="gene_id=mCG3169.2"
FT   mRNA            complement(join(44594358..44595390,44595565..44595644,
FT                   44595729..44595772,44595873..44595973,44597737..44597769,
FT                   44599565..44599759,44600064..44600141,44601348..44601501,
FT                   44603684..44603733,44603838..44603880,44605461..44605710,
FT                   44607584..44607704,44607785..44607843,44608271..44608328,
FT                   44610977..44611089,44614391..44614453,44615175..44615278,
FT                   44621124..44621212,44623024..44623087,44624196..44624381,
FT                   44624578..44624786,44624878..44624955,44627434..44627496,
FT                   44627985..44628060,44628214..44628284,44629622..44629695,
FT                   44632159..44632245,44635612..44635679,44637093..44637241,
FT                   44637946..44638071,44639329..44639431,44639603..44639671,
FT                   44640372..>44640487))
FT                   /locus_tag="mCG_3169"
FT                   /product="mCG3169, transcript variant mCT1871"
FT                   /note="gene_id=mCG3169.2 transcript_id=mCT1871.2 created on
FT                   05-SEP-2002"
FT   mRNA            complement(join(44594854..44595390,44595565..44595644,
FT                   44595729..44595772,44595873..44595973,44597737..44597769,
FT                   44599565..44599759,44600064..44600141,44601348..44601501,
FT                   44603684..44603733,44603838..44603880,44605461..44605710,
FT                   44607584..44607704,44607785..44607843,44608271..44608328,
FT                   44610977..44611089,44614391..44614453,44615175..44615278,
FT                   44621124..44621212,44623024..44623087,44624196..44624361,
FT                   44624578..44624786,44624878..44624955,44627434..44627496,
FT                   44627985..44628060,44628214..44628284,44629622..44629695,
FT                   44632159..44632245,44635612..44635679,44637093..44637241,
FT                   44637946..44638071,44639329..44639431,44639603..44639671,
FT                   44640372..>44640487))
FT                   /locus_tag="mCG_3169"
FT                   /product="mCG3169, transcript variant mCT193490"
FT                   /note="gene_id=mCG3169.2 transcript_id=mCT193490.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(44595313..44595390,44595565..44595644,
FT                   44595729..44595772,44595873..44595973,44597737..44597769,
FT                   44599565..44599759,44600064..44600141,44601348..44601501,
FT                   44603684..44603733,44603838..44603880,44605461..44605710,
FT                   44607584..44607704,44607785..44607843,44608271..44608328,
FT                   44610977..44611089,44614391..44614453,44615175..44615278,
FT                   44621124..44621212,44623024..44623087,44624196..44624381,
FT                   44624578..44624786,44624878..44624955,44627434..44627496,
FT                   44627985..44628060,44628214..44628284,44629622..44629695,
FT                   44632159..44632245,44635612..44635679,44637093..44637241,
FT                   44637946..44638071,44639329..44639431,44639603..44639671,
FT                   44640372..>44640487))
FT                   /codon_start=1
FT                   /locus_tag="mCG_3169"
FT                   /product="mCG3169, isoform CRA_a"
FT                   /note="gene_id=mCG3169.2 transcript_id=mCT1871.2
FT                   protein_id=mCP3119.2 isoform=CRA_a"
FT                   /protein_id="EDL36612.1"
FT                   /translation="WSCVGSVPERTAVATRSLAMKSRFSTVDLRAVLAELNASLLGMRV
FT                   NNVYDVDNKTYLIRLQKPDFKATLLLESGIRIHTTEFEWPKNMMPSSFAMKCRKHLKSR
FT                   RLVSAKQLGVDRIVDFQFGSDEAAYHLIIELYDRGNIVLTDYEYLILNILRFRTDEADD
FT                   VKFAVRERYPIDHARAAEPLLTLERLTEVIAAAPKGEVLKRVLNPLLPYGPALIEHCLI
FT                   ESGFSGNAKVDEKLESKDIEKILVCVQRAEDYLRKTSNFNGKGYIIQKREAKPSLDADK
FT                   PAEDILTYEEFHPFLFSQHLQCPYIEFESFDKAVDEFYSKIEGQKIDLKALQQEKQALK
FT                   KLDNVRKDHENRLEALQQAQEIDKLKGELIEMNLQIVDRAIQVVRSALANQIDWTEIGV
FT                   IVKEAQAQGDPVACAIKELKLQTNHVTMLLRNPYLLSEEEDGDGDASIENSDAEAPKGK
FT                   KKKQKNKQLQKPQKNKPLLVDVDLSLSAYANAKKYYDHKRYAAKKTQRTVEAAEKAFKS
FT                   AEKKTKQTLKEVQTVTSIQKARKVYWFEKFLWFISSENYLIIGGRDQQQNEIIVKRYLT
FT                   PGDIYVHADLHGATSCVIKNPTGEPIPPRTLTEAGTMALCYSAAWDARVITSAWWVYHH
FT                   QVSKTAPTGEYLTTGSFMIRGKKNFLPPSYLMMGFSFLFKVDESCVWRHRGERKVRVQD
FT                   EDMETLTSCTSELMAEEMEQLEGGDSSEEETEELHGMPGDVELMTQVDQEDIAVHSGRD
FT                   ELSSEDGEAKAVTKDQEPIGEMKEEEEDTFEYPDTTIDLSHLQSQRPLQKLAPREESLN
FT                   SNDSKSQGRRHLSAKERREMKKKKLPCESGDLEVIEEKDKERESAVHTEAYQNTSKNVA
FT                   AGQPMKRGQKSKMKKMKEKYKDQDDEDRELIMKLLASAGSNKEEKGKKGKKGKPKDEPV
FT                   KKPPQKPRGGQRVLDVVKEPPSLQVLAHDLQDLAVDDPHDDKEEHDLDQQGNEENLFDS
FT                   LTGQPHPEDVLMFAIPICAPYTIMTNYKYKVKLTPGVQKKGKAAKTALNSFMHSKEATA
FT                   REKDLFRSVKDTDLSRNIPGKVKVSAPNLLHVKRK"
FT   CDS             complement(join(44595313..44595390,44595565..44595644,
FT                   44595729..44595772,44595873..44595973,44597737..44597769,
FT                   44599565..44599759,44600064..44600141,44601348..44601501,
FT                   44603684..44603733,44603838..44603880,44605461..44605710,
FT                   44607584..44607704,44607785..44607843,44608271..44608328,
FT                   44610977..44611089,44614391..44614453,44615175..44615278,
FT                   44621124..44621212,44623024..44623087,44624196..44624361,
FT                   44624578..>44624611))
FT                   /codon_start=1
FT                   /locus_tag="mCG_3169"
FT                   /product="mCG3169, isoform CRA_b"
FT                   /note="gene_id=mCG3169.2 transcript_id=mCT193490.0
FT                   protein_id=mCP114470.0 isoform=CRA_b"
FT                   /protein_id="EDL36613.1"
FT                   /translation="NCKPTTLRCCYEEEDGDGDASIENSDAEAPKGKKKKQKNKQLQKP
FT                   QKNKPLLVDVDLSLSAYANAKKYYDHKRYAAKKTQRTVEAAEKAFKSAEKKTKQTLKEV
FT                   QTVTSIQKARKVYWFEKFLWFISSENYLIIGGRDQQQNEIIVKRYLTPGDIYVHADLHG
FT                   ATSCVIKNPTGEPIPPRTLTEAGTMALCYSAAWDARVITSAWWVYHHQVSKTAPTGEYL
FT                   TTGSFMIRGKKNFLPPSYLMMGFSFLFKVDESCVWRHRGERKVRVQDEDMETLTSCTSE
FT                   LMAEEMEQLEGGDSSEEETEELHGMPGDVELMTQVDQEDIAVHSGRDELSSEDGEAKAV
FT                   TKDQEPIGEMKEEEEDTFEYPDTTIDLSHLQSQRPLQKLAPREESLNSNDSKSQGRRHL
FT                   SAKERREMKKKKLPCESGDLEVIEEKDKERESAVHTEAYQNTSKNVAAGQPMKRGQKSK
FT                   MKKMKEKYKDQDDEDRELIMKLLASAGSNKEEKGKKGKKGKPKDEPVKKPPQKPRGGQR
FT                   VLDVVKEPPSLQVLAHDLQDLAVDDPHDDKEEHDLDQQGNEENLFDSLTGQPHPEDVLM
FT                   FAIPICAPYTIMTNYKYKVKLTPGVQKKGKAAKTALNSFMHSKEATAREKDLFRSVKDT
FT                   DLSRNIPGKVKVSAPNLLHVKRK"
FT   gene            complement(44653853..44655914)
FT                   /locus_tag="mCG_123639"
FT                   /note="gene_id=mCG123639.0"
FT   mRNA            complement(join(44653853..44655531,44655752..44655914))
FT                   /locus_tag="mCG_123639"
FT                   /product="mCG123639"
FT                   /note="gene_id=mCG123639.0 transcript_id=mCT124873.0
FT                   created on 05-SEP-2002"
FT   CDS             complement(44653855..44653971)
FT                   /codon_start=1
FT                   /locus_tag="mCG_123639"
FT                   /product="mCG123639"
FT                   /note="gene_id=mCG123639.0 transcript_id=mCT124873.0
FT                   protein_id=mCP78863.1"
FT                   /protein_id="EDL36611.1"
FT                   /translation="MPLTPALERQRLMNISEIEANLVYILSSRPSQGYKVRS"
FT   gene            <44655711..44657210
FT                   /locus_tag="mCG_3164"
FT                   /note="gene_id=mCG3164.0"
FT   mRNA            <44655711..44657210
FT                   /locus_tag="mCG_3164"
FT                   /product="mCG3164"
FT                   /note="gene_id=mCG3164.0 transcript_id=mCT1874.1 created on
FT                   29-AUG-2002"
FT   CDS             <44656139..44656714
FT                   /codon_start=1
FT                   /locus_tag="mCG_3164"
FT                   /product="mCG3164"
FT                   /note="gene_id=mCG3164.0 transcript_id=mCT1874.1
FT                   protein_id=mCP3203.0"
FT                   /protein_id="EDL36610.1"
FT                   /translation="GDPGHLNAPGPGSSDAMGKVLSKIFGNKEMRILMLGLDAAGKTTI
FT                   LYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVV
FT                   DCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDR
FT                   NWYVQPSCATSGDGLYEGLTWLTSNYKS"
FT   gene            complement(44658626..>44659284)
FT                   /locus_tag="mCG_1041622"
FT                   /note="gene_id=mCG1041622.1"
FT   mRNA            complement(44658626..>44659284)
FT                   /locus_tag="mCG_1041622"
FT                   /product="mCG1041622"
FT                   /note="gene_id=mCG1041622.1 transcript_id=mCT159326.1
FT                   created on 13-SEP-2002"
FT   CDS             complement(44658668..>44658850)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041622"
FT                   /product="mCG1041622"
FT                   /note="gene_id=mCG1041622.1 transcript_id=mCT159326.1
FT                   protein_id=mCP78600.0"
FT                   /protein_id="EDL36609.1"
FT                   /translation="DTKKWLSTNLSVTSRTLHLRINMRVSSFLQFRHLYLCAYFVSGCY
FT                   YSIDICITIFMYLRM"
FT   gene            complement(44745608..44748213)
FT                   /locus_tag="mCG_1041746"
FT                   /note="gene_id=mCG1041746.0"
FT   mRNA            complement(join(44745608..44746235,44747848..44748213))
FT                   /locus_tag="mCG_1041746"
FT                   /product="mCG1041746"
FT                   /note="gene_id=mCG1041746.0 transcript_id=mCT159450.0
FT                   created on 18-SEP-2002"
FT   CDS             complement(44745754..44745981)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041746"
FT                   /product="mCG1041746"
FT                   /note="gene_id=mCG1041746.0 transcript_id=mCT159450.0
FT                   protein_id=mCP78643.1"
FT                   /protein_id="EDL36608.1"
FT                   /translation="MSGNGTVKHNEGNHCLTRVRTSVPPTAPGRRPNNQKKETGSANNA
FT                   LYLESLCREYLLQVGAFHWLRFSHLSCHYN"
FT   gene            complement(44754379..44756329)
FT                   /locus_tag="mCG_148268"
FT                   /note="gene_id=mCG148268.0"
FT   mRNA            complement(join(44754379..44755309,44756271..44756329))
FT                   /locus_tag="mCG_148268"
FT                   /product="mCG148268"
FT                   /note="gene_id=mCG148268.0 transcript_id=mCT188531.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(44755052..44755273)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148268"
FT                   /product="mCG148268"
FT                   /note="gene_id=mCG148268.0 transcript_id=mCT188531.0
FT                   protein_id=mCP108102.0"
FT                   /protein_id="EDL36607.1"
FT                   /translation="MTNWVIKTTSLGSLGACSLGQCPSSSPQQNGLCGFETLHGDPTSS
FT                   QGCSSCLSEASSHLPPRSVRMEEIEPFS"
FT   gene            <44829385..44830187
FT                   /locus_tag="mCG_50708"
FT                   /note="gene_id=mCG50708.1"
FT   mRNA            <44829385..44830187
FT                   /locus_tag="mCG_50708"
FT                   /product="mCG50708"
FT                   /note="gene_id=mCG50708.1 transcript_id=mCT50891.1 created
FT                   on 13-SEP-2002"
FT   CDS             44829385..44829726
FT                   /codon_start=1
FT                   /locus_tag="mCG_50708"
FT                   /product="mCG50708"
FT                   /note="gene_id=mCG50708.1 transcript_id=mCT50891.1
FT                   protein_id=mCP26315.0"
FT                   /protein_id="EDL36606.1"
FT                   /translation="MADVEDGEEPCVLSLHSGSAGSKSGGDKMFSLKKWNAVAMWSWDV
FT                   ECDTCAICRVQVMDACLRCQAENKQEDCVVVWGECNHSFHNCCMSLWVKQNNRCPLCQQ
FT                   DWVVQRIGK"
FT   gene            complement(44851587..44857058)
FT                   /locus_tag="mCG_3173"
FT                   /note="gene_id=mCG3173.1"
FT   mRNA            complement(join(44851587..44851809,44851815..44851868,
FT                   44853836..44853940,44855049..44855168,44856227..44856296,
FT                   44856482..44856581,44856672..44857058))
FT                   /locus_tag="mCG_3173"
FT                   /product="mCG3173, transcript variant mCT1878"
FT                   /note="gene_id=mCG3173.1 transcript_id=mCT1878.2 created on
FT                   05-SEP-2002"
FT   mRNA            complement(join(44851677..44851868,44853836..44853940,
FT                   44855049..44855168,44856227..44856296,44856471..44856581,
FT                   44856672..>44856926))
FT                   /locus_tag="mCG_3173"
FT                   /product="mCG3173, transcript variant mCT193513"
FT                   /note="gene_id=mCG3173.1 transcript_id=mCT193513.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(44851854..44851868,44853836..44853940,
FT                   44855049..44855168,44856227..44856296,44856471..44856581,
FT                   44856672..>44856925))
FT                   /codon_start=1
FT                   /locus_tag="mCG_3173"
FT                   /product="mCG3173, isoform CRA_b"
FT                   /note="gene_id=mCG3173.1 transcript_id=mCT193513.0
FT                   protein_id=mCP114471.0 isoform=CRA_b"
FT                   /protein_id="EDL36605.1"
FT                   /translation="VEPEVEDPLWSFVRVLEKRDGTVLRLQQYGSGGVGCVVWDAAIVL
FT                   SKYLETPGFSGDGAHALSRRSVLELGSGTGAVGLMAATLGADVIVTDLEELQDLLKMNI
FT                   DMNKHLVTGSVQAKVLKWGEDIEDLMSPDYILMADCIYYEESLEPLLKTLKDLSGSETC
FT                   IICCYEQRTMGKNPEIEKKYFELLQLDFDFEEIPLDKHDEEYRSEDIHIVYIRKKKPKP
FT                   PS"
FT   CDS             complement(join(44856291..44856296,44856482..44856581,
FT                   44856672..44857033))
FT                   /codon_start=1
FT                   /locus_tag="mCG_3173"
FT                   /product="mCG3173, isoform CRA_a"
FT                   /note="gene_id=mCG3173.1 transcript_id=mCT1878.2
FT                   protein_id=mCP3109.2 isoform=CRA_a"
FT                   /protein_id="EDL36604.1"
FT                   /translation="MRLGRPPCRWEVRVLRGRDVTACRSLRRAGAGMAAAVEPEVEDPL
FT                   WSFVRVLEKRDGTVLRLQQYGSGGVGCVVWDAAIVLSKYLETPGFSGDGAHALSRRSVL
FT                   ELGSGTGAVGLMAATLGADVIVTDLEELQDLLKMNIDMNKHLVTGSVQAKG"
FT   gene            complement(44857710..44933490)
FT                   /locus_tag="mCG_3171"
FT                   /note="gene_id=mCG3171.1"
FT   mRNA            complement(join(44857710..44859575,44860552..44860661,
FT                   44864646..44864907,44866881..44866997,44870593..44870765,
FT                   44872715..44872832,44877615..44877777,44877924..44878043,
FT                   44881343..44881565,44884650..44884753,44888458..44888580,
FT                   44890104..44890185,44890675..44891330,44891877..44892004,
FT                   44900846..44900944,44905646..44905756,44909171..44909314,
FT                   44913638..44913844,44921973..44922137,44924127..44924258,
FT                   44933365..44933490))
FT                   /locus_tag="mCG_3171"
FT                   /product="mCG3171"
FT                   /note="gene_id=mCG3171.1 transcript_id=mCT1870.1 created on
FT                   05-SEP-2002"
FT   CDS             complement(join(44859066..44859575,44860552..44860661,
FT                   44864646..44864907,44866881..44866997,44870593..44870765,
FT                   44872715..44872832,44877615..44877777,44877924..44878043,
FT                   44881343..44881565,44884650..44884753,44888458..44888580,
FT                   44890104..44890185,44890675..44891330,44891877..44892004,
FT                   44900846..44900944,44905646..44905756,44909171..44909314,
FT                   44913638..44913844,44921973..44922137,44924127..44924258,
FT                   44933365..44933397))
FT                   /codon_start=1
FT                   /locus_tag="mCG_3171"
FT                   /product="mCG3171"
FT                   /note="gene_id=mCG3171.1 transcript_id=mCT1870.1
FT                   protein_id=mCP3188.2"
FT                   /protein_id="EDL36603.1"
FT                   /translation="MAQPRTVQDVEERVQKTFPHPIDKWAIADAQSAIEKRKRRNPLLL
FT                   PVDKIHPSLKEVLGYKVDYHVSLYIVAVLEYISADILKLAGNYVFNIRHYEISQQDIKV
FT                   SMCADKVLMDMFDQDDDIGLVSLCEDEPCSSGELNYYDLVRTEIAEERQYLRELNMIIK
FT                   VFREAFLLDRKLFKPSEIEKIFSNISDIHELTVKLLGLIEDTVEMTDESSPHPLAGSCF
FT                   EDLAEEQAFDPYETLSQDILAPEFNDHFSKLMARPAVALHFQSIADGFKEAVRYVLPRL
FT                   MLVPVYHCWHYFELLKQLKACSEEQEDKECLNQAITALMNLQGSMDRIYKQHSPRRRPG
FT                   DPVCLFYNRQLRSKHLAIKKMNEIQKNIDGWEGKDIGQCCNEFIMEGPLTRIGAKHERH
FT                   IFLFDGLMISCKPNHGQTRLPGYSSAEYRLKEKFVMRKIQICDKEDACEYRHAFELVSK
FT                   DENSVIFAAKSAEEKNNWMAALISLHYRSTLDRMLDSVLLKEENEQPLRLPSPDMYRFV
FT                   VTDSEENIVFEDNLQSRSGIPIIKGGTVVKLIERLTYHMYADPNFVRTFLTTYRSFCKP
FT                   QELLNLLIERFEIPEPEPTEADKLALEKGEQPISADLKRFRKEYVQPVQLRVLNVFRHW
FT                   VEHHYYDFERDLELLERLESFISSVRGKAMKKWVESIAKIIKRKKQAQANGISHNITFE
FT                   SSPPPVEWHISRTGQFETFDLMTLHPIEIARQLTLLESDLYRKVQPSELVGSVWTKEDK
FT                   EINSPNLLKMIRHTTNLTLWFEKCIVEAENFEERVAVLSRIVEILQVFQDLNNFNGVLE
FT                   IVSAVNSVSVYRLDHTFEALQERKRRILDDAVELSQDHFKKYLVKLKSINPPCVPFFGI
FT                   YLTNILKTEEGNSDFLKRKGKDLINFSKRRKVAEITGEIQQYQNQPYCLRTEPEMRRFF
FT                   ENLNPMGILSEKEFTDYLFNKSLEIEPRNCKQPPRFPRKSTFSLKSPGIRPNAGRHGST
FT                   SGTLRGHPTPLEREPYKISFSRIAETELESTVSAPTSPNTPSTPPVSASSDHSVFLDVD
FT                   LNSSCETFFSSCGSLHKLSEEPLIPPPLPPRKKFDHDALNSKGAVKSDDDPPAIPPRQP
FT                   PPPKVKPRVPVLMGTFDGPVPSPPPPPPRDPLPDTPPPVPLRPPEHFINCPFNLQPPPL
FT                   GHPHRDPDWLRDVSTCPNSPSTPPTTPSPRIPRSCHLLSSSHSSLAHLPAPPVPPRQNS
FT                   SPLLPKLPPKTYKRELSHPPLYRLPLLENAETPQ"
FT   gene            complement(44965920..>45000301)
FT                   /gene="L2hgdh"
FT                   /locus_tag="mCG_3172"
FT                   /note="gene_id=mCG3172.1"
FT   mRNA            complement(join(44965920..44967981,44974971..44975102,
FT                   44976769..44976926,44977688..44977855,44981250..44981284,
FT                   44982609..44982771,44988101..44988232,44996793..44996944,
FT                   44997558..44997673,45000146..>45000301))
FT                   /gene="L2hgdh"
FT                   /locus_tag="mCG_3172"
FT                   /product="L-2-hydroxyglutarate dehydrogenase"
FT                   /note="gene_id=mCG3172.1 transcript_id=mCT1868.1 created on
FT                   05-SEP-2002"
FT   CDS             complement(join(44967786..44967981,44974971..44975102,
FT                   44976769..44976926,44977688..44977855,44981250..44981284,
FT                   44982609..44982771,44988101..44988232,44996793..44996944,
FT                   44997558..44997673,45000146..>45000300))
FT                   /codon_start=1
FT                   /gene="L2hgdh"
FT                   /locus_tag="mCG_3172"
FT                   /product="L-2-hydroxyglutarate dehydrogenase"
FT                   /note="gene_id=mCG3172.1 transcript_id=mCT1868.1
FT                   protein_id=mCP3266.1"
FT                   /protein_id="EDL36602.1"
FT                   /translation="VAQAMWPTLRYVGGVCGLARYCVAGGFLRASGPASGVPGLLCGGG
FT                   RRSSSTSSFDIVIVGGGIVGLASARTLILKHPGLSIGVVEKEKDLALHQTGHNSGVIHS
FT                   GIYYKPESLKAKLCVEGAALIYEYCNLKGIPYRQCGKLIVAVEQEEIPRLQALYERGLQ
FT                   NGVEGLRLIQQEDIKKKEPYCRGLMAIDCPYTGIVNYQQVALSFAQDFQEAGGSILRDF
FT                   EVKGIEIAKENSSRSKDGMNYPIAVKNSKGKEIRCRYVVTCAGLYSDRISELSGCNPDP
FT                   QIVPFRGDYLVLKPEKGYLVKGNIYPVPDSRFPFLGVHFTPRLDGTIWLGPNAVLAFKR
FT                   EGYRPFDFDARDVMEVILKSGFINLVFQHFSYGVNEMYKACFLSETVKHLQKFIPEITI
FT                   SDVLRGPAGVRAQALDRDGNLVEDFVFDGGTGEIADRVLHVRNAPSPAATSSLAISRMI
FT                   AEEAQQRFKL"
FT   gene            <45000454..45025664
FT                   /gene="Atp5s"
FT                   /locus_tag="mCG_3163"
FT                   /note="gene_id=mCG3163.1"
FT   mRNA            join(<45000454..45000506,45018998..45019108,
FT                   45021915..45022123,45022661..45022832,45024729..45025664)
FT                   /gene="Atp5s"
FT                   /locus_tag="mCG_3163"
FT                   /product="ATP synthase, H+ transporting, mitochondrial F0
FT                   complex, subunit s, transcript variant mCT1877"
FT                   /note="gene_id=mCG3163.1 transcript_id=mCT1877.1 created on
FT                   29-AUG-2002"
FT   CDS             join(<45000454..45000506,45018998..45019108,
FT                   45021915..45022123,45022661..45022832,45024729..45024843)
FT                   /codon_start=1
FT                   /gene="Atp5s"
FT                   /locus_tag="mCG_3163"
FT                   /product="ATP synthase, H+ transporting, mitochondrial F0
FT                   complex, subunit s, isoform CRA_b"
FT                   /note="gene_id=mCG3163.1 transcript_id=mCT1877.1
FT                   protein_id=mCP3176.1 isoform=CRA_b"
FT                   /protein_id="EDL36601.1"
FT                   /translation="EGKDRGRRAGQAQGRSTPSMMMFGKISRQLCSLKKIPWSCDSRYF
FT                   WEWLNTVFNKVDYERLRDVGPDRAASEWLLRCGAKVRYCGHQKWLHDYNTLPGSSIDRY
FT                   KIQAIDATDSCIMDIGLDHMVGLEHVEKITLCKCHYIEDNCLQRLSQLENLRKSLLELE
FT                   IIACGNVTDNGVIALRHFRNLKYLFLSDLPGVKDKEYLAQVFKTALPSLELKLNLK"
FT   mRNA            join(<45000466..45000506,45000947..45001046,
FT                   45018998..45019108,45021915..45022123,45022661..45022832,
FT                   45024729..45025489)
FT                   /gene="Atp5s"
FT                   /locus_tag="mCG_3163"
FT                   /product="ATP synthase, H+ transporting, mitochondrial F0
FT                   complex, subunit s, transcript variant mCT172864"
FT                   /note="gene_id=mCG3163.1 transcript_id=mCT172864.0 created
FT                   on 29-AUG-2002"
FT   CDS             join(<45001039..45001046,45018998..45019108,
FT                   45021915..45022123,45022661..45022832,45024729..45024843)
FT                   /codon_start=1
FT                   /gene="Atp5s"
FT                   /locus_tag="mCG_3163"
FT                   /product="ATP synthase, H+ transporting, mitochondrial F0
FT                   complex, subunit s, isoform CRA_a"
FT                   /note="gene_id=mCG3163.1 transcript_id=mCT172864.0
FT                   protein_id=mCP95783.0 isoform=CRA_a"
FT                   /protein_id="EDL36600.1"
FT                   /translation="ALRSMMMFGKISRQLCSLKKIPWSCDSRYFWEWLNTVFNKVDYER
FT                   LRDVGPDRAASEWLLRCGAKVRYCGHQKWLHDYNTLPGSSIDRYKIQAIDATDSCIMDI
FT                   GLDHMVGLEHVEKITLCKCHYIEDNCLQRLSQLENLRKSLLELEIIACGNVTDNGVIAL
FT                   RHFRNLKYLFLSDLPGVKDKEYLAQVFKTALPSLELKLNLK"
FT   gene            complement(45027660..45071943)
FT                   /gene="Cdkl1"
FT                   /locus_tag="mCG_3170"
FT                   /note="gene_id=mCG3170.1"
FT   mRNA            complement(join(45027660..45028411,45029862..45030017,
FT                   45031772..45031828,45035153..45035235,45037457..45037657,
FT                   45038219..45038309,45041343..45041415,45050659..45050780,
FT                   45071220..45071497,45071876..45071943))
FT                   /gene="Cdkl1"
FT                   /locus_tag="mCG_3170"
FT                   /product="cyclin-dependent kinase-like 1 (CDC2-related
FT                   kinase)"
FT                   /note="gene_id=mCG3170.1 transcript_id=mCT1869.1 created on
FT                   05-SEP-2002"
FT   CDS             complement(join(45028304..45028411,45029862..45030017,
FT                   45031772..45031828,45035153..45035235,45037457..45037657,
FT                   45038219..45038309,45041343..45041415,45050659..45050780,
FT                   45071220..45071387))
FT                   /codon_start=1
FT                   /gene="Cdkl1"
FT                   /locus_tag="mCG_3170"
FT                   /product="cyclin-dependent kinase-like 1 (CDC2-related
FT                   kinase)"
FT                   /note="gene_id=mCG3170.1 transcript_id=mCT1869.1
FT                   protein_id=mCP3155.1"
FT                   /db_xref="GOA:Q14BG3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="MGI:MGI:1918341"
FT                   /db_xref="UniProtKB/TrEMBL:Q14BG3"
FT                   /protein_id="EDL36599.1"
FT                   /translation="MEKYEKIGKIGEGSYGVVFKCRNRDTGQIVAIKRFLETEDDPVIK
FT                   KIALREIRMLKQLKHPNLVNLLEVFRRKRRLHLVFEYCDHTVLHELDRYQRGVPEPLVK
FT                   NITWQTLQAVNFCHKHNCIHRDVKPENILITKQSAIKLCDFGFARLLTGPGDYYTDYVA
FT                   TRWYRSPELLVGDTQYGPPVDVWAIGCVFAELLSGVPLWPGKSDVDQLYLIRKTLGDLI
FT                   PRHQQVFSMNQYFSGVKIPDPEDMETLELKFPNISYSALGFLKGCLHMDPAERLTCEQL
FT                   LQHPYFDSIREVGELTRQHDKPARKTLRQSRKHLTGLQYLPQLTSSRILPALDNKKYHC
FT                   STKRFNYHFPNI"
FT   gene            45071520..45123124
FT                   /locus_tag="mCG_1041621"
FT                   /note="gene_id=mCG1041621.2"
FT   mRNA            join(45071520..45072632,45073414..45073637,
FT                   45075220..45075741)
FT                   /locus_tag="mCG_1041621"
FT                   /product="mCG1041621, transcript variant mCT185767"
FT                   /note="gene_id=mCG1041621.2 transcript_id=mCT185767.0
FT                   created on 16-JUN-2003"
FT   mRNA            join(45071567..45071684,45083317..45083446,
FT                   45103062..45103115,45106088..45106367,45108559..45108752,
FT                   45117205..45117299,45121637..45121759,45122684..45123124)
FT                   /locus_tag="mCG_1041621"
FT                   /product="mCG1041621, transcript variant mCT159325"
FT                   /note="gene_id=mCG1041621.2 transcript_id=mCT159325.2
FT                   created on 16-JUN-2003"
FT   CDS             join(45072459..45072632,45073414..45073557)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041621"
FT                   /product="mCG1041621, isoform CRA_a"
FT                   /note="gene_id=mCG1041621.2 transcript_id=mCT185767.0
FT                   protein_id=mCP107025.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q9D556"
FT                   /db_xref="MGI:MGI:1921974"
FT                   /db_xref="UniProtKB/TrEMBL:Q9D556"
FT                   /protein_id="EDL36597.1"
FT                   /translation="MLGAEVLVCWRQGYSRENARCETWPTRGKERAMQMYTELKRKLGL
FT                   GIPSVTAAWQRVEMCSRFRILRDLWKFFGANTSLFPSGLQFSLGTWQKAEGQTNKQTKP
FT                   L"
FT   gene            complement(45084998..45180398)
FT                   /gene="Map4k5"
FT                   /locus_tag="mCG_3167"
FT                   /note="gene_id=mCG3167.2"
FT   mRNA            complement(join(45084998..45086591,45088436..45088491,
FT                   45090450..45090520,45092516..45092608,45094378..45094446,
FT                   45096997..45097174,45097532..45097635,45099264..45099322,
FT                   45099626..45099740,45104046..45104106,45104665..45104744,
FT                   45105823..45105907,45106984..45107025,45107529..45107626,
FT                   45108614..45108770,45109276..45109318,45111684..45111751,
FT                   45112807..45112865,45119265..45119343,45123164..45123280,
FT                   45124131..45124212,45125600..45125662,45126925..45127056,
FT                   45130779..45130851,45132058..45132100,45132186..45132233,
FT                   45133931..45133986,45137511..45137575,45138003..45138093,
FT                   45156960..45157017,45179886..45180398))
FT                   /gene="Map4k5"
FT                   /locus_tag="mCG_3167"
FT                   /product="mitogen-activated protein kinase kinase kinase
FT                   kinase 5, transcript variant mCT1873"
FT                   /note="gene_id=mCG3167.2 transcript_id=mCT1873.3 created on
FT                   16-JUN-2003"
FT   mRNA            complement(join(45084998..45086591,45088436..45088491,
FT                   45090450..45090520,45092516..45092608,45094378..45094446,
FT                   45096997..45097174,45097532..45097635,45099264..45099322,
FT                   45099626..45099740,45104046..45104106,45104665..45104744,
FT                   45105823..45105907,45106984..45107025,45107529..45107626,
FT                   45108614..45108770,45109276..45109318,45111684..45111751,
FT                   45112807..45112865,45119265..45119343,45123164..45123280,
FT                   45124131..45124212,45125600..45125662,45126925..45127056,
FT                   45130779..45130851,45132058..45132100,45132186..45132233,
FT                   45133931..45133986,45137511..45137575,45138003..45138093,
FT                   45179886..>45180336))
FT                   /gene="Map4k5"
FT                   /locus_tag="mCG_3167"
FT                   /product="mitogen-activated protein kinase kinase kinase
FT                   kinase 5, transcript variant mCT193486"
FT                   /note="gene_id=mCG3167.2 transcript_id=mCT193486.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(45084998..45086591,45088436..45088491,
FT                   45090450..45090520,45092516..45092608,45094378..45094446,
FT                   45096997..45097174,45097532..45097635,45099264..45099322,
FT                   45099626..45099740,45104046..45104106,45104665..45104744,
FT                   45105823..45105907,45106984..45107025,45107529..45107626,
FT                   45108614..45108770,45109276..45109318,45111684..45111751,
FT                   45112807..45112865,45119265..45119343,45123221..45123280,
FT                   45124131..45124212,45125600..45125662,45126925..45127056,
FT                   45130779..45130851,45132058..45132100,45132186..45132233,
FT                   45133931..45133986,45137511..45137575,45138003..45138093,
FT                   45156960..45157017,45179886..>45180244))
FT                   /gene="Map4k5"
FT                   /locus_tag="mCG_3167"
FT                   /product="mitogen-activated protein kinase kinase kinase
FT                   kinase 5, transcript variant mCT193487"
FT                   /note="gene_id=mCG3167.2 transcript_id=mCT193487.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(45086504..45086591,45088436..45088491,
FT                   45090450..45090520,45092516..45092608,45094378..45094446,
FT                   45096997..45097174,45097532..45097635,45099264..45099322,
FT                   45099626..45099740,45104046..45104106,45104665..45104744,
FT                   45105823..45105907,45106984..45107025,45107529..45107626,
FT                   45108614..45108770,45109276..45109318,45111684..45111751,
FT                   45112807..45112865,45119265..45119343,45123221..45123280,
FT                   45124131..45124212,45125600..45125662,45126925..45127056,
FT                   45130779..45130851,45132058..45132100,45132186..45132233,
FT                   45133931..45133986,45137511..45137575,45138003..45138093,
FT                   45156960..45157017,45179886..>45180242))
FT                   /codon_start=1
FT                   /gene="Map4k5"
FT                   /locus_tag="mCG_3167"
FT                   /product="mitogen-activated protein kinase kinase kinase
FT                   kinase 5, isoform CRA_c"
FT                   /note="gene_id=mCG3167.2 transcript_id=mCT193487.0
FT                   protein_id=mCP114469.0 isoform=CRA_c"
FT                   /protein_id="EDL36595.1"
FT                   /translation="EDAGLRRRRSAKNGRPLGYGRRGAWRDRRGPEAAGVAPRDAPRAR
FT                   SRRCRRSCEPRLHVGKRRAPSLAGDGCGGQSPGLGAAKMEAPLRPAADILRRNPQHDYE
FT                   LVQRVGSGTYGDVYKARNVHTGELAAVKIIKLEPGDDFSLIQQEIFMVKECKHCNIVAY
FT                   FGSYLSREKLWICMEYCGGGSLQDIYHVTGPLSEMQIAYVCRETLQGLAYLHTKGKMHR
FT                   DIKGANILLTDHGDVKLADFGVAAKITATIAKRKSFIGTPYWMAPEVAAVEKNGGYNQL
FT                   CDIWAVGITAIELGELQPPMFDLHPMRALFLMSKSNFQPPKLKDKTKWSSTFHNFVKIA
FT                   LTKNPKKRPTAERLLTHTFVGQPGLSRALAVELLDKPHAIIRHTIRSTNRNSRAERTAS
FT                   EINFDKLQFEPPLRKETEARDEMGLSSEPNFILHWNPFVDGANTGRSTSKRAIPPPLPP
FT                   KPRVNTYPEDSLPDEEKSSTIKRCPDLEARAPQVLRRQSSPSCVPVAETSSSIGNGDGI
FT                   SKLISENTEGSAQAPQLPRKKDKRDFPKPTINGLPPTPKVLMGACFSKVFDGCPLKINC
FT                   ATSWIHPDTKDQYIIFGTEDGIYTLNLNELHEATMEQLFPRKCTWLYVINNTLMSLSGK
FT                   TFQLYSHNLIALFEQAKKPGLAAHIQTHRFPDRILPRKFALTTKIPDTKGCHKCCIVRN
FT                   PYTGHKYLCGALQSGIVLLQWYEPMQKFMLIKHFDFPLPSPLNVFEMLVIPEQEYPMVC
FT                   VAISKGSDSSQVVQFETINLNSASSWFTEIGAGSQQLDSIHVTQLERDTVLVCLDKFVK
FT                   IVNLQGKLKSSKKLASELSFDFRIESVVCLQDSVLAFWKHGMQGKSFKSDEVTQEISDE
FT                   TRVFRLLGSDRVVVLESRPTENPAAHSNLYILAGHENSY"
FT   CDS             complement(join(45086504..45086591,45088436..45088491,
FT                   45090450..45090520,45092516..45092608,45094378..45094446,
FT                   45096997..45097174,45097532..45097635,45099264..45099322,
FT                   45099626..45099740,45104046..45104106,45104665..45104744,
FT                   45105823..45105907,45106984..45107025,45107529..45107626,
FT                   45108614..45108770,45109276..45109318,45111684..45111751,
FT                   45112807..45112865,45119265..45119343,45123164..45123280,
FT                   45124131..45124212,45125600..45125662,45126925..45127056,
FT                   45130779..45130851,45132058..45132100,45132186..45132233,
FT                   45133931..45133986,45137511..45137575,45138003..45138093,
FT                   45179886..>45180123))
FT                   /codon_start=1
FT                   /gene="Map4k5"
FT                   /locus_tag="mCG_3167"
FT                   /product="mitogen-activated protein kinase kinase kinase
FT                   kinase 5, isoform CRA_b"
FT                   /note="gene_id=mCG3167.2 transcript_id=mCT193486.0
FT                   protein_id=mCP114468.0 isoform=CRA_b"
FT                   /protein_id="EDL36594.1"
FT                   /translation="RPPRSLSPVQAQLRAEAPCWEAPRALVSGRRLRRAEPRTGRSEDG
FT                   GPAEACRRHPETEPAARLRAGAEGRQRHLRGRVQGDDFSLIQQEIFMVKECKHCNIVAY
FT                   FGSYLSREKLWICMEYCGGGSLQDIYHVTGPLSEMQIAYVCRETLQGLAYLHTKGKMHR
FT                   DIKGANILLTDHGDVKLADFGVAAKITATIAKRKSFIGTPYWMAPEVAAVEKNGGYNQL
FT                   CDIWAVGITAIELGELQPPMFDLHPMRALFLMSKSNFQPPKLKDKTKWSSTFHNFVKIA
FT                   LTKNPKKRPTAERLLTHTFVGQPGLSRALAVELLDKVSNPDNHAPYSEGDEDDLEPHAI
FT                   IRHTIRSTNRNSRAERTASEINFDKLQFEPPLRKETEARDEMGLSSEPNFILHWNPFVD
FT                   GANTGRSTSKRAIPPPLPPKPRVNTYPEDSLPDEEKSSTIKRCPDLEARAPQVLRRQSS
FT                   PSCVPVAETSSSIGNGDGISKLISENTEGSAQAPQLPRKKDKRDFPKPTINGLPPTPKV
FT                   LMGACFSKVFDGCPLKINCATSWIHPDTKDQYIIFGTEDGIYTLNLNELHEATMEQLFP
FT                   RKCTWLYVINNTLMSLSGKTFQLYSHNLIALFEQAKKPGLAAHIQTHRFPDRILPRKFA
FT                   LTTKIPDTKGCHKCCIVRNPYTGHKYLCGALQSGIVLLQWYEPMQKFMLIKHFDFPLPS
FT                   PLNVFEMLVIPEQEYPMVCVAISKGSDSSQVVQFETINLNSASSWFTEIGAGSQQLDSI
FT                   HVTQLERDTVLVCLDKFVKIVNLQGKLKSSKKLASELSFDFRIESVVCLQDSVLAFWKH
FT                   GMQGKSFKSDEVTQEISDETRVFRLLGSDRVVVLESRPTENPAAHSNLYILAGHENSY"
FT   CDS             complement(join(45086504..45086591,45088436..45088491,
FT                   45090450..45090520,45092516..45092608,45094378..45094446,
FT                   45096997..45097174,45097532..45097635,45099264..45099322,
FT                   45099626..45099740,45104046..45104106,45104665..45104744,
FT                   45105823..45105907,45106984..45107025,45107529..45107626,
FT                   45108614..45108770,45109276..45109318,45111684..45111751,
FT                   45112807..45112865,45119265..45119343,45123164..45123280,
FT                   45124131..45124212,45125600..45125662,45126925..45127056,
FT                   45130779..45130851,45132058..45132100,45132186..45132233,
FT                   45133931..45133986,45137511..45137575,45138003..45138093,
FT                   45156960..45157017,45179886..45179993))
FT                   /codon_start=1
FT                   /gene="Map4k5"
FT                   /locus_tag="mCG_3167"
FT                   /product="mitogen-activated protein kinase kinase kinase
FT                   kinase 5, isoform CRA_a"
FT                   /note="gene_id=mCG3167.2 transcript_id=mCT1873.3
FT                   protein_id=mCP3267.3 isoform=CRA_a"
FT                   /protein_id="EDL36593.1"
FT                   /translation="MEAPLRPAADILRRNPQHDYELVQRVGSGTYGDVYKARNVHTGEL
FT                   AAVKIIKLEPGDDFSLIQQEIFMVKECKHCNIVAYFGSYLSREKLWICMEYCGGGSLQD
FT                   IYHVTGPLSEMQIAYVCRETLQGLAYLHTKGKMHRDIKGANILLTDHGDVKLADFGVAA
FT                   KITATIAKRKSFIGTPYWMAPEVAAVEKNGGYNQLCDIWAVGITAIELGELQPPMFDLH
FT                   PMRALFLMSKSNFQPPKLKDKTKWSSTFHNFVKIALTKNPKKRPTAERLLTHTFVGQPG
FT                   LSRALAVELLDKVSNPDNHAPYSEGDEDDLEPHAIIRHTIRSTNRNSRAERTASEINFD
FT                   KLQFEPPLRKETEARDEMGLSSEPNFILHWNPFVDGANTGRSTSKRAIPPPLPPKPRVN
FT                   TYPEDSLPDEEKSSTIKRCPDLEARAPQVLRRQSSPSCVPVAETSSSIGNGDGISKLIS
FT                   ENTEGSAQAPQLPRKKDKRDFPKPTINGLPPTPKVLMGACFSKVFDGCPLKINCATSWI
FT                   HPDTKDQYIIFGTEDGIYTLNLNELHEATMEQLFPRKCTWLYVINNTLMSLSGKTFQLY
FT                   SHNLIALFEQAKKPGLAAHIQTHRFPDRILPRKFALTTKIPDTKGCHKCCIVRNPYTGH
FT                   KYLCGALQSGIVLLQWYEPMQKFMLIKHFDFPLPSPLNVFEMLVIPEQEYPMVCVAISK
FT                   GSDSSQVVQFETINLNSASSWFTEIGAGSQQLDSIHVTQLERDTVLVCLDKFVKIVNLQ
FT                   GKLKSSKKLASELSFDFRIESVVCLQDSVLAFWKHGMQGKSFKSDEVTQEISDETRVFR
FT                   LLGSDRVVVLESRPTENPAAHSNLYILAGHENSY"
FT   CDS             join(45108719..45108752,45117205..45117299,
FT                   45121637..45121675)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041621"
FT                   /product="mCG1041621, isoform CRA_b"
FT                   /note="gene_id=mCG1041621.2 transcript_id=mCT159325.2
FT                   protein_id=mCP78584.1 isoform=CRA_b"
FT                   /protein_id="EDL36598.1"
FT                   /translation="MIFLHLGGCLQDTAKRRTTMCAPGQWMTRSRRRRDSPDKTLAEGQ
FT                   GQSHITMPRI"
FT   gene            45124929..45134903
FT                   /locus_tag="mCG_1041620"
FT                   /note="gene_id=mCG1041620.0"
FT   mRNA            join(45124929..45124987,45126609..45126708,
FT                   45128872..45129004,45133343..45134903)
FT                   /locus_tag="mCG_1041620"
FT                   /product="mCG1041620"
FT                   /note="gene_id=mCG1041620.0 transcript_id=mCT159324.0
FT                   created on 13-SEP-2002"
FT   CDS             45134574..45134771
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041620"
FT                   /product="mCG1041620"
FT                   /note="gene_id=mCG1041620.0 transcript_id=mCT159324.0
FT                   protein_id=mCP78570.1"
FT                   /protein_id="EDL36596.1"
FT                   /translation="MNFLEQVPQNRQAWFRTLPKIKRNQMISGKQIFLYHEIENPYARI
FT                   PSGASKQRLLYTGGNWCAAC"
FT   gene            <45180501..45250902
FT                   /gene="Spg3a"
FT                   /locus_tag="mCG_140735"
FT                   /note="gene_id=mCG140735.1"
FT   mRNA            join(<45180501..45180577,45195023..45195210,
FT                   45213314..45213561,45218894..45219028,45219575..45219679,
FT                   45222228..45222278,45224440..45224496,45233581..45233673,
FT                   45234815..45234953,45240801..45240928,45241817..45241873,
FT                   45242677..45242748,45245968..45246415,45250044..45250847)
FT                   /gene="Spg3a"
FT                   /locus_tag="mCG_140735"
FT                   /product="spastic paraplegia 3A homolog (human), transcript
FT                   variant mCT193477"
FT                   /note="gene_id=mCG140735.1 transcript_id=mCT193477.0
FT                   created on 09-MAR-2004"
FT   mRNA            join(45180514..45180577,45195023..45195210,
FT                   45213314..45213561,45218894..45219028,45219575..45219679,
FT                   45222228..45222278,45224440..45224500,45233587..45233673,
FT                   45234815..45234953,45240801..45240928,45241817..45241873,
FT                   45242677..45242748,45245968..45246399,45250044..45250902)
FT                   /gene="Spg3a"
FT                   /locus_tag="mCG_140735"
FT                   /product="spastic paraplegia 3A homolog (human), transcript
FT                   variant mCT171118"
FT                   /note="gene_id=mCG140735.1 transcript_id=mCT171118.0
FT                   created on 23-JUL-2002"
FT   CDS             join(<45195099..45195210,45213314..45213561,
FT                   45218894..45219028,45219575..45219679,45222228..45222278,
FT                   45224440..45224496,45233581..45233673,45234815..45234953,
FT                   45240801..45240928,45241817..45241873,45242677..45242748,
FT                   45245968..45246415,45250044..45250159)
FT                   /codon_start=1
FT                   /gene="Spg3a"
FT                   /locus_tag="mCG_140735"
FT                   /product="spastic paraplegia 3A homolog (human), isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG140735.1 transcript_id=mCT193477.0
FT                   protein_id=mCP114454.0 isoform=CRA_b"
FT                   /protein_id="EDL36592.1"
FT                   /translation="LPETCGALEKTARAVTAPRHTSPQTAMAKSRRDRNSWGGFSEKSS
FT                   DWSSEEEEPVRKAGPVQVLIVKDDHSFELDEAALNRILLSQAVRDKEVVAVSVAGAFRK
FT                   GKSFLMDFMLRYMYNQESVDWVGDYNEPLTGFSWRGGSERETTGIQIWSEVFLINKLDG
FT                   KKVAVLLMDTQGTFDSQSTLRDSATVFALSTMISSIQVYNLSQNVQEDDLQHLQLFTEY
FT                   GRLAMEETFLKPFQSLIFLVRDWSFPYEFSYGADGGAKFLEKRLKVSGNQHEELQNVRK
FT                   HIHSCFTNISCFLLPHPGLKVATNPNFDGKLKEIDDEFIKNLKILIPWLLSPERLDIKE
FT                   INGNKITCRGLLEYFKAYIKIYQGEELPHPKSMLQATAEANNLAAVATAKDTYNKKMEE
FT                   VCGGDKPFLAPNDLQSKHLQLKEESVKLFRGVKKMGGEEFSRRYLQQLESEIDELYIQY
FT                   IKHNDSKNIFHAARTPATLFVVIFITYVIAGVTGFIGLDIIASLCNMIMGLTLITLCTW
FT                   AYIRYSGEYRELGAVIDQVAAALWDQVRVPSGVIQALQCSSNPQTPVSPSFPCTQVRAY
FT                   STTGKEENLI"
FT   CDS             join(45195177..45195210,45213314..45213561,
FT                   45218894..45219028,45219575..45219679,45222228..45222278,
FT                   45224440..45224500,45233587..45233639)
FT                   /codon_start=1
FT                   /gene="Spg3a"
FT                   /locus_tag="mCG_140735"
FT                   /product="spastic paraplegia 3A homolog (human), isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG140735.1 transcript_id=mCT171118.0
FT                   protein_id=mCP94036.0 isoform=CRA_a"
FT                   /protein_id="EDL36591.1"
FT                   /translation="MAKSRRDRNSWGGFSEKSSDWSSEEEEPVRKAGPVQVLIVKDDHS
FT                   FELDEAALNRILLSQAVRDKEVVAVSVAGAFRKGKSFLMDFMLRYMYNQESVDWVGDYN
FT                   EPLTGFSWRGGSERETTGIQIWSEVFLINKLDGKKVAVLLMDTQGTFDSQSTLRDSATV
FT                   FALSTMISSIQVYNLSQNVQEDDLQHLQLFTEYGRLAMEETFLKPFQVDISCSRLEFPI
FT                   RIFIWS"
FT   gene            complement(45207820..45208900)
FT                   /pseudo
FT                   /locus_tag="mCG_123631"
FT                   /note="gene_id=mCG123631.1"
FT   mRNA            complement(45207820..45208900)
FT                   /pseudo
FT                   /locus_tag="mCG_123631"
FT                   /note="gene_id=mCG123631.1 transcript_id=mCT124865.1
FT                   created on 26-JUN-2003"
FT   gene            complement(45251821..45271468)
FT                   /gene="Sav1"
FT                   /locus_tag="mCG_3161"
FT                   /note="gene_id=mCG3161.2"
FT   mRNA            complement(join(45251821..45253163,45255886..45256029,
FT                   45262784..45263054,45271025..45271468))
FT                   /gene="Sav1"
FT                   /locus_tag="mCG_3161"
FT                   /product="salvador homolog 1 (Drosophila)"
FT                   /note="gene_id=mCG3161.2 transcript_id=mCT1881.2 created on
FT                   18-JUN-2003"
FT   CDS             complement(join(45252956..45253163,45255886..45256029,
FT                   45262784..45263054,45271025..45271463))
FT                   /codon_start=1
FT                   /gene="Sav1"
FT                   /locus_tag="mCG_3161"
FT                   /product="salvador homolog 1 (Drosophila)"
FT                   /note="gene_id=mCG3161.2 transcript_id=mCT1881.2
FT                   protein_id=mCP3249.1"
FT                   /protein_id="EDL36589.1"
FT                   /translation="MPSFIRHGPTIPRRTDLCLPDSSATAFSASGDGVVSRNQSFLRTA
FT                   IQRTPHEVMRRESHRLSAPSYLVRSLADVPRECGSSQSFLTEVNFAVENGDSGSRYFFS
FT                   DNFFDGQRRRPLGDRAQEDYRYYEYNHDLFQRMPQSQGRHTSGIGRVTATSLGNLTNHG
FT                   SEDLPLPPGWSVDWTMRGRKYYIDHNTNTTHWSHPLEREGLPPGWERVESSEFGTYYVD
FT                   HTNKRAQYRHPCAPSVPRYDQPPPITYQPQQTERNQSLLVPANPYHTAEIPDWLQVYAR
FT                   APVKYDHILKWELFQLADLDTYQGMLKLLFMKELEQIVKLYEAYRQALLTELENRKQRQ
FT                   QWYAQQHGKTFLS"
FT   gene            45256019..45256526
FT                   /locus_tag="mCG_1041562"
FT                   /note="gene_id=mCG1041562.1"
FT   mRNA            45256019..45256526
FT                   /locus_tag="mCG_1041562"
FT                   /product="mCG1041562"
FT                   /note="gene_id=mCG1041562.1 transcript_id=mCT159266.1
FT                   created on 13-SEP-2002"
FT   CDS             45256122..45256325
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041562"
FT                   /product="mCG1041562"
FT                   /note="gene_id=mCG1041562.1 transcript_id=mCT159266.1
FT                   protein_id=mCP79110.0"
FT                   /db_xref="GOA:Q05CB6"
FT                   /db_xref="InterPro:IPR010339"
FT                   /db_xref="InterPro:IPR027238"
FT                   /db_xref="MGI:MGI:3781262"
FT                   /db_xref="UniProtKB/TrEMBL:Q05CB6"
FT                   /protein_id="EDL36590.1"
FT                   /translation="MIIRTMLYTPQEMKQITEIQAQTEGINISEEALSHLGEIGTKTTP
FT                   TYSVQLLTPANLLAKINWRDKH"
FT   gene            45267697..45269721
FT                   /pseudo
FT                   /locus_tag="mCG_3165"
FT                   /note="gene_id=mCG3165.1"
FT   mRNA            join(45267697..45267971,45268572..45268779,
FT                   45269044..45269721)
FT                   /pseudo
FT                   /locus_tag="mCG_3165"
FT                   /note="gene_id=mCG3165.1 transcript_id=mCT1875.1 created on
FT                   05-SEP-2002"
FT   gene            <45273644..45274123
FT                   /locus_tag="mCG_1041744"
FT                   /note="gene_id=mCG1041744.1"
FT   mRNA            <45273644..45274123
FT                   /locus_tag="mCG_1041744"
FT                   /product="mCG1041744"
FT                   /note="gene_id=mCG1041744.1 transcript_id=mCT159448.1
FT                   created on 18-SEP-2002"
FT   CDS             45273644..45273955
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041744"
FT                   /product="mCG1041744"
FT                   /note="gene_id=mCG1041744.1 transcript_id=mCT159448.1
FT                   protein_id=mCP78627.0"
FT                   /protein_id="EDL36588.1"
FT                   /translation="MLGKPTRTGRPSPAGRGRGCVRRLATGGRLTGRVWRPSRPSVRLR
FT                   GPAPAAGELESGRSGARWAASGSRLGLAYRPASRNRSRVSWLLREGSPRVCWDREGYT"
FT   gene            complement(45305285..>45398602)
FT                   /gene="Nin"
FT                   /locus_tag="mCG_3160"
FT                   /note="gene_id=mCG3160.2"
FT   mRNA            complement(join(45305285..45305807,45307404..45307601,
FT                   45311950..45312051,45313324..45313473,45314582..45314761,
FT                   45316561..45316707,45317458..45317571,45318232..45318354,
FT                   45321728..45321841,45325110..45325322,45327161..45327230,
FT                   45327329..45327454,45328706..45330826,45331721..45332211,
FT                   45333712..45333833,45335587..45335725,45337352..45337441,
FT                   45337819..45337929,45340984..45341158,45341427..45341567,
FT                   45341898..45342034,45342475..45342642,45343255..45343401,
FT                   45347760..45347950,45349298..45349337,45364719..45364888,
FT                   45377115..45377196,45389283..45389486,45398077..45398123,
FT                   45398495..>45398566))
FT                   /gene="Nin"
FT                   /locus_tag="mCG_3160"
FT                   /product="ninein, transcript variant mCT193476"
FT                   /note="gene_id=mCG3160.2 transcript_id=mCT193476.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(45305299..45305807,45307404..45307601,
FT                   45311977..45312051,45313324..45313473,45314582..45314761,
FT                   45316561..45316707,45317458..45317571,45318232..45318354,
FT                   45321728..45321841,45325110..45325322,45327161..45327230,
FT                   45327329..45327454,45328706..45330826,45331721..45332211,
FT                   45333712..45333833,45335587..45335725,45337352..45337441,
FT                   45337819..45337929,45340984..45341158,45341427..45341567,
FT                   45341898..45342034,45342475..45342642,45343255..45343401,
FT                   45347760..45347950,45349298..45349337,45364719..45364888,
FT                   45377115..45377196,45389283..45389486,45398077..45398123,
FT                   45398495..>45398602))
FT                   /gene="Nin"
FT                   /locus_tag="mCG_3160"
FT                   /product="ninein, transcript variant mCT1880"
FT                   /note="gene_id=mCG3160.2 transcript_id=mCT1880.1 created on
FT                   29-AUG-2002"
FT   CDS             complement(join(45305745..45305807,45307404..45307601,
FT                   45311977..45312051,45313324..45313473,45314582..45314761,
FT                   45316561..45316707,45317458..45317571,45318232..45318354,
FT                   45321728..45321841,45325110..45325322,45327161..45327230,
FT                   45327329..45327454,45328706..45330826,45331721..45332211,
FT                   45333712..45333833,45335587..45335725,45337352..45337441,
FT                   45337819..45337929,45340984..45341158,45341427..45341567,
FT                   45341898..45342034,45342475..45342642,45343255..45343401,
FT                   45347760..45347950,45349298..45349337,45364719..45364888,
FT                   45377115..45377196,45389283..45389486,45398077..45398123,
FT                   45398495..>45398600))
FT                   /codon_start=1
FT                   /gene="Nin"
FT                   /locus_tag="mCG_3160"
FT                   /product="ninein, isoform CRA_a"
FT                   /note="gene_id=mCG3160.2 transcript_id=mCT1880.1
FT                   protein_id=mCP3154.1 isoform=CRA_a"
FT                   /protein_id="EDL36586.1"
FT                   /translation="GSKRAGRGRPVPPGQARESRGHGLCGGAGRLSPGLELRRRPAWAL
FT                   PRGRRKVSAVGYGMDEVEEDQHEARLKELFDSFDTLGTGSLGQEELTDLCHVLCLEDVG
FT                   PVLQQTLLQDNLLGRVHFDQFKEALILILSRTLSSEEHFEESDCSPEAQPKYVRGGKRY
FT                   GRRSLPEFQESGEEIEEVTVLEPLEEEARSSPIPAGDCGEHWKTQRSEEYEAEGQLRFW
FT                   NPDDLNASHGGSCPPPDWIEEKLQEVCEDLGITRDGHLNRKKLVSICEQYGLQNVDGAM
FT                   LEEVFLSLDPDGTMSVEDFFYGLFKTGKSLTPSASTPYRQLKRHLSMQSFDESGRRTAT
FT                   SSAMTSTIGFRVFSCLDDGMGQASVERILDTWQEEGIENSQEILKALDFSLDGNINLTE
FT                   LTLALENELLVTKNGIHQAALASFKAEIRHLLERVDQVVREKEKLRSDLDKAEKLKSLM
FT                   ASEVDDHHAAIERRNEYNLRKLDEEYKERIAALKNELRQEREQMLQQVGKQRVELEQEI
FT                   QKAKTEENYIRDRLALSLKENNRLETELLENAEKLAEYESLTQKLQRSLENVLAEKFGD
FT                   LDPSSAEFFLQEERLAQMRNEYEQQCRLLQDQVDELQSELEEYQAQGRVLRLPLKNSLS
FT                   EELDGHSGGIEPDQGPGSEECNPLNMSIEAELVIEQMKEQHHRDLCHLRLELEDKVRHY
FT                   EKQLDDTRVASEQEQAAMKQKYEQGVHTLEKRVSELRSEIADLEGQAAVLREAHHKASC
FT                   RHEEEKRQLQMAFDEEKAQLQEELRQEHERELQARLQQAAESFRQEREGLAQAAWTEEK
FT                   VRGLEQSYQEQLLSLEEKHALEKEELREELSEHHRRELQEGREEMETECNRRVSQIEAQ
FT                   CQADCEKVTEHCEQTLQSLEVRHRQELRDLLDQHLEERSQWEFEKDELTQECTDAQEQL
FT                   KEALQRERATAAAMKQEQEILERTYKDRLNILSTEREQLLQDLKDLQNASESQHGLLSG
FT                   QILELKRSQERELRDQGQALCQTGVSEQLASQQLERLRVEHEQERREMTGKLAALESAH
FT                   RASLERADQEKAEMSTEICRLQNTVKDMQQAASLLMLQGGCQATAGEEAEGDGAMSLLQ
FT                   QGEQLLEENGDVLISLQRAHEHAVKENAKMATEISRLQQRLKKLEPGSVISSCLEEGTS
FT                   EISGSSREQVEPIMKQGPATKHFLSDLGDHEARDLASTGTSSVQRQKCKTEASEASLDC
FT                   FSELENSEDTRTESWDLKSQISQLREQLTVLRADCDRASERKQDLLFDISVLKKKLKML
FT                   ERLPEASSRYKVLYEDAARENSCLQEELRLVETRYEESLDSNKELTAEVYRLQDEMKKM
FT                   EEVMETFLSLEKSYDEVKVENEELRALVLRLQGKMEKVLGRAALQGDSYALWEAPSENL
FT                   EVASDEKMLELRQTPKECTPKVVSMHHIIEECTQETQCCEQGSTKLLARIKAHEIAWFH
FT                   RAIKTHPEKPSAQNRVIPEGSAALLGLQDKHLQQEATIAELELEKQKLQELTRNLRERV
FT                   TALVRQKDAPSQGQKEEELKAMMQDLQITCGEMQRKVELLRYESEKLQEENSILRNEIT
FT                   TLNEEDSISNLKLEELNGSQEELWQKIETIEQEKASIQTMVEKLKKQVSDLKIKNQQLD
FT                   SENIELSQKNSQNKEELKTLNQRLAEMLCQREEPGACTSEKWEQENASLKEELDHYKVQ
FT                   TSTLVSSLEAELSEVKLQTHVMEQENLLLKDELERLKQLHRCPDLSDFQQKMSSILSYN
FT                   EKLLKEKEVLSEELKSCADKLAESSLLEHRIATMKQEQTAWEEQSESLKSQLAVSQAKV
FT                   QNLEDVLQNVNLQMAEIESDLQVTRQEKEALKQEVMSLHRQLQNAIDKDWVSETAPHLS
FT                   GLRGQQRRLSWDKLDHLMNEEPQLLCQESKRLQTVVQNTQADLTHSREKVRQLESNLLP
FT                   TKHQKQLNQPCTVKSTEQEKLTLKRECEQSQKEQSPTSRKVGQMGSLERGLETIHLENE
FT                   GLKKKQMQPLRSTVTRSPSSHWDLQLLQQQACPMVPREQFLQLQQQLLQAEKRSQHLQE
FT                   ELENRTSETNTPQALLLEQRAVHADSCRRIGHL"
FT   CDS             complement(join(45305745..45305807,45307404..45307601,
FT                   45311950..45312051,45313324..45313473,45314582..45314761,
FT                   45316561..45316707,45317458..45317571,45318232..45318354,
FT                   45321728..45321841,45325110..45325322,45327161..45327230,
FT                   45327329..45327454,45328706..45330826,45331721..45332211,
FT                   45333712..45333833,45335587..45335725,45337352..45337441,
FT                   45337819..45337929,45340984..45341158,45341427..45341567,
FT                   45341898..45342034,45342475..45342642,45343255..45343401,
FT                   45347760..45347950,45349298..45349337,45364719..45364888,
FT                   45377115..45377196,45389283..45389486,45398077..45398123,
FT                   45398495..>45398564))
FT                   /codon_start=1
FT                   /gene="Nin"
FT                   /locus_tag="mCG_3160"
FT                   /product="ninein, isoform CRA_b"
FT                   /note="gene_id=mCG3160.2 transcript_id=mCT193476.0
FT                   protein_id=mCP114467.0 isoform=CRA_b"
FT                   /protein_id="EDL36587.1"
FT                   /translation="PGQARESRGHGLCGGAGRLSPGLELRRRPAWALPRGRRKVSAVGY
FT                   GMDEVEEDQHEARLKELFDSFDTLGTGSLGQEELTDLCHVLCLEDVGPVLQQTLLQDNL
FT                   LGRVHFDQFKEALILILSRTLSSEEHFEESDCSPEAQPKYVRGGKRYGRRSLPEFQESG
FT                   EEIEEVTVLEPLEEEARSSPIPAGDCGEHWKTQRSEEYEAEGQLRFWNPDDLNASHGGS
FT                   CPPPDWIEEKLQEVCEDLGITRDGHLNRKKLVSICEQYGLQNVDGAMLEEVFLSLDPDG
FT                   TMSVEDFFYGLFKTGKSLTPSASTPYRQLKRHLSMQSFDESGRRTATSSAMTSTIGFRV
FT                   FSCLDDGMGQASVERILDTWQEEGIENSQEILKALDFSLDGNINLTELTLALENELLVT
FT                   KNGIHQAALASFKAEIRHLLERVDQVVREKEKLRSDLDKAEKLKSLMASEVDDHHAAIE
FT                   RRNEYNLRKLDEEYKERIAALKNELRQEREQMLQQVGKQRVELEQEIQKAKTEENYIRD
FT                   RLALSLKENNRLETELLENAEKLAEYESLTQKLQRSLENVLAEKFGDLDPSSAEFFLQE
FT                   ERLAQMRNEYEQQCRLLQDQVDELQSELEEYQAQGRVLRLPLKNSLSEELDGHSGGIEP
FT                   DQGPGSEECNPLNMSIEAELVIEQMKEQHHRDLCHLRLELEDKVRHYEKQLDDTRVASE
FT                   QEQAAMKQKYEQGVHTLEKRVSELRSEIADLEGQAAVLREAHHKASCRHEEEKRQLQMA
FT                   FDEEKAQLQEELRQEHERELQARLQQAAESFRQEREGLAQAAWTEEKVRGLEQSYQEQL
FT                   LSLEEKHALEKEELREELSEHHRRELQEGREEMETECNRRVSQIEAQCQADCEKVTEHC
FT                   EQTLQSLEVRHRQELRDLLDQHLEERSQWEFEKDELTQECTDAQEQLKEALQRERATAA
FT                   AMKQEQEILERTYKDRLNILSTEREQLLQDLKDLQNASESQHGLLSGQILELKRSQERE
FT                   LRDQGQALCQTGVSEQLASQQLERLRVEHEQERREMTGKLAALESAHRASLERADQEKA
FT                   EMSTEICRLQNTVKDMQQAASLLMLQGGCQATAGEEAEGDGAMSLLQQGEQLLEENGDV
FT                   LISLQRAHEHAVKENAKMATEISRLQQRLKKLEPGSVISSCLEEGTSEISGSSREQVEP
FT                   IMKQGPATKHFLSDLGDHEARDLASTGTSSVQRQKCKTEASEASLDCFSELENSEDTRT
FT                   ESWDLKSQISQLREQLTVLRADCDRASERKQDLLFDISVLKKKLKMLERLPEASSRYKV
FT                   LYEDAARENSCLQEELRLVETRYEESLDSNKELTAEVYRLQDEMKKMEEVMETFLSLEK
FT                   SYDEVKVENEELRALVLRLQGKMEKVLGRAALQGDSYALWEAPSENLEVASDEKMLELR
FT                   QTPKECTPKVVSMHHIIEECTQETQCCEQGSTKLLARIKAHEIAWFHRAIKTHPEKPSA
FT                   QNRVIPEGSAALLGLQDKHLQQEATIAELELEKQKLQELTRNLRERVTALVRQKDAPSQ
FT                   GQKEEELKAMMQDLQITCGEMQRKVELLRYESEKLQEENSILRNEITTLNEEDSISNLK
FT                   LEELNGSQEELWQKIETIEQEKASIQTMVEKLKKQVSDLKIKNQQLDSENIELSQKNSQ
FT                   NKEELKTLNQRLAEMLCQREEPGACTSEKWEQENASLKEELDHYKVQTSTLVSSLEAEL
FT                   SEVKLQTHVMEQENLLLKDELERLKQLHRCPDLSDFQQKMSSILSYNEKLLKEKEVLSE
FT                   ELKSCADKLAESSLLEHRIATMKQEQTAWEEQSESLKSQLAVSQAKVQNLEDVLQNVNL
FT                   QMAEIESDLQVTRQEKEALKQEVMSLHRQLQNAIDKDWVSETAPHLSGLRGQQRRLSWD
FT                   KLDHLMNEEPQLLCQESKRLQTVVQNTQADLTHSREKVRQLESNLLPTKHQKQLNQPCT
FT                   VKSTEQEKLTLKRECEQSQKEQSPTSRKVGQMGSLERGLETIHLENEGLKKKQVRLDEK
FT                   LMEMQPLRSTVTRSPSSHWDLQLLQQQACPMVPREQFLQLQQQLLQAEKRSQHLQEELE
FT                   NRTSETNTPQALLLEQRAVHADSCRRIGHL"
FT   gene            45398354..45399883
FT                   /locus_tag="mCG_148252"
FT                   /note="gene_id=mCG148252.0"
FT   mRNA            45398354..45399883
FT                   /locus_tag="mCG_148252"
FT                   /product="mCG148252"
FT                   /note="gene_id=mCG148252.0 transcript_id=mCT188515.0
FT                   created on 13-JAN-2004"
FT   CDS             45399039..45399443
FT                   /codon_start=1
FT                   /locus_tag="mCG_148252"
FT                   /product="mCG148252"
FT                   /note="gene_id=mCG148252.0 transcript_id=mCT188515.0
FT                   protein_id=mCP108086.0"
FT                   /protein_id="EDL36585.1"
FT                   /translation="MGKGPKKQRTLESIEASGHPTFSRSISSCPPHSRRCPAPCINFGE
FT                   CSQPSVTAAQNRKSLELVVLLPSRLLGGSPSCCFLPCLLYMLPSKPVLTISKCSSLSYA
FT                   SKYQVVKQDCKSRLEVEGGMGPEATSLQDP"
FT   gene            complement(45477254..>45516372)
FT                   /locus_tag="mCG_3168"
FT                   /note="gene_id=mCG3168.2"
FT   mRNA            complement(join(45477254..45477913,45480560..45480626,
FT                   45481054..45481188,45482313..45482505,45483780..45483921,
FT                   45484027..45484085,45484207..45484354,45484469..45484570,
FT                   45485223..45485337,45486507..45486670,45486997..45487086,
FT                   45488134..45488226,45488698..45488841,45493266..45493423,
FT                   45494650..45494761,45497944..45498075,45502804..45502907,
FT                   45504379..45504457,45507592..45507693,45512110..>45512395))
FT                   /locus_tag="mCG_3168"
FT                   /product="mCG3168, transcript variant mCT1872"
FT                   /note="gene_id=mCG3168.2 transcript_id=mCT1872.1 created on
FT                   29-AUG-2002"
FT   mRNA            complement(join(45477568..45477913,45480560..45480626,
FT                   45481054..45481188,45482313..45482520,45483780..45483921,
FT                   45484027..45484085,45484207..45484354,45484469..45484570,
FT                   45485223..45485337,45486507..45486670,45486997..45487143,
FT                   45488134..45488226,45488698..45488841,45493341..45493423,
FT                   45494650..45494761,45497944..45498075,45502804..45502907,
FT                   45504379..45504457,45507592..45507693,45515854..>45516372))
FT                   /locus_tag="mCG_3168"
FT                   /product="mCG3168, transcript variant mCT172851"
FT                   /note="gene_id=mCG3168.2 transcript_id=mCT172851.0 created
FT                   on 29-AUG-2002"
FT   CDS             complement(join(45477755..45477913,45480560..45480626,
FT                   45481054..45481188,45482313..45482520,45483780..45483921,
FT                   45484027..45484085,45484207..45484354,45484469..45484570,
FT                   45485223..45485337,45486507..45486670,45486997..45487143,
FT                   45488134..45488226,45488698..45488841,45493341..45493423,
FT                   45494650..45494761,45497944..45498075,45502804..45502907,
FT                   45504379..45504457,45507592..45507693,45515854..>45515889))
FT                   /codon_start=1
FT                   /locus_tag="mCG_3168"
FT                   /product="mCG3168, isoform CRA_a"
FT                   /note="gene_id=mCG3168.2 transcript_id=mCT172851.0
FT                   protein_id=mCP95770.0 isoform=CRA_a"
FT                   /protein_id="EDL36583.1"
FT                   /translation="TCCILESCGGIKRVYYLSLEFYMGRTLQNTMINLGLQNACDEAIY
FT                   QLGLDMEELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGIRYEYGIFNQKIRE
FT                   GWQVEEADDWLRHGNPWEKARPEFMLPVHFYGRVEHTQTGTKWVDTQVVLALPYDTPVP
FT                   GYMNNTVNTMRLWSARAPNDFNLQDFNVGDYIQAVLDRNLAENISRVLYPNDNFFEGKE
FT                   LRLKQEYFVVAATLQDVIRRFKASKFGSKDGVGTVFDAFPDQVAIQLNDTHPALAIPEL
FT                   MRIFVDIEKLPWAKAWEITKKTFAYTNHTVLPEALERWPVELVEKLLPRHLEIIYEINQ
FT                   KHLDRIVALFPKDISRMRRMSLIEEEGGKRINMAHLCIVGCHAVNGVAKIHSDIVKTQV
FT                   FKDFSELEPDKFQNKTNGITPRRWLLLCNPGLADLIAEKIGEDYVKDLSQLTKLHSFVS
FT                   DDIFLREIAKVKQENKLKFSQFLEKEYKVKINPSSMFDVHVKRIHEYKRQLLNCLHVIT
FT                   MYNRIKKDPKKFFVPRTVIIGGKAAPGYHMAKMIIKLITSVAEVVNNDPMVGSKLKVIF
FT                   LENYRVSLAEKVIPATDLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEA
FT                   GEENLFIFGMRVDDVAALDKKGYEAKEYYEALPELKLVIDQIDNGFFSPNQPDLFKDII
FT                   NMLFYHDRFKVFADYEAYVKCQEKVSQLYMNQKAWNTMVLKNIAASGKFSSDRTIKEYA
FT                   KDIWNMEPSDLKISLSNESSNGG"
FT   CDS             complement(join(45477755..45477913,45480560..45480626,
FT                   45481054..45481188,45482313..45482505,45483780..45483921,
FT                   45484027..45484085,45484207..45484354,45484469..45484570,
FT                   45485223..45485337,45486507..45486670,45486997..45487086,
FT                   45488134..45488226,45488698..45488841,45493266..45493423,
FT                   45494650..45494761,45497944..45498075,45502804..45502907,
FT                   45504379..45504457,45507592..45507693,45512110..>45512394))
FT                   /codon_start=1
FT                   /locus_tag="mCG_3168"
FT                   /product="mCG3168, isoform CRA_b"
FT                   /note="gene_id=mCG3168.2 transcript_id=mCT1872.1
FT                   protein_id=mCP3247.1 isoform=CRA_b"
FT                   /protein_id="EDL36584.1"
FT                   /translation="LQPGDRSVLPPPATMAKPLTDQEKRRQISIRGIVGVENVAELKKG
FT                   FNRHLHFTLVKDRNVATPRDYYFALAHTVRDHLVGRWIRTQQHYYDKCPKRVYYLSLEF
FT                   YMGRTLQNTMINLGLQNACDEAIYQLGLDMEELEEIEEDAGLGNGGLGRLAACFLDSMA
FT                   TLGLAAYGYGIRYEYGIFNQKIREGWQVEEADDWLRHGNPWEKARPEFMLPVHFYGRVE
FT                   HTQTGTKWVDTQVVLALPYDTPVPGYMNNTVNTMRLWSARAPNDFNLQDFNVGDYIQAV
FT                   LDRNLAENISRVLYPNDNVSNAGPAWATYFPESLQEPMKHEYRFFEGKELRLKQEYFVV
FT                   AATLQDVIRRFKASKFGSKDGVGTVFDAFPDQVAIQLNDTHPALAIPELMRIFVDIEKL
FT                   PWAKALERWPVELVEKLLPRHLEIIYEINQKHLDRIVALFPKDISRMRRMSLIEEEGGK
FT                   RINMAHLCIVGCHAVNGVAKIHSDIVKTQVFKDFSELEPDKFQNKTNGITPRRWLLLCN
FT                   PGLADLIAEKIGEDYVKDLSQLTKLHSFVSDDIFLREIAKVKQENKLKFSQFLEKEYKV
FT                   KINPSSMFDVHVKRIHEYKRQLLNCLHVITMYNRIKKDPKKFFVPRTVIIGGKAAPGYH
FT                   MAKMIIKLITSVAEVVNNDPMVGSKLKVIFLENYRVSLAEKDLSEQISTAGTEASGTGN
FT                   MKFMLNGALTIGTMDGANVEMAEEAGEENLFIFGMRVDDVAALDKKGYEAKEYYEALPE
FT                   LKLVIDQIDNGFFSPNQPDLFKDIINMLFYHDRFKVFADYEAYVKCQEKVSQLYMNQKA
FT                   WNTMVLKNIAASGKFSSDRTIKEYAKDIWNMEPSDLKISLSNESSNGG"
FT   gene            complement(45529319..45638713)
FT                   /gene="Trim9"
FT                   /locus_tag="mCG_120494"
FT                   /note="gene_id=mCG120494.3"
FT   mRNA            complement(join(45529319..45531233,45533047..45533209,
FT                   45535839..45536088,45536848..45536871,45537271..45537312,
FT                   45539864..45540052,45552049..45552081,45552877..45553015,
FT                   45565444..45565597,45566721..45566831,45580732..45580854,
FT                   45582727..45582822,45637446..>45638418))
FT                   /gene="Trim9"
FT                   /locus_tag="mCG_120494"
FT                   /product="tripartite motif protein 9, transcript variant
FT                   mCT193497"
FT                   /note="gene_id=mCG120494.3 transcript_id=mCT193497.0
FT                   created on 09-MAR-2004"
FT   mRNA            complement(join(45529322..45531233,45533047..45533209,
FT                   45535785..45536088,45536848..45536871,45537271..45537312,
FT                   45539864..45540052,45552049..45552081,45552877..45553015,
FT                   45565444..45565597,45566721..45566831,45580732..45580854,
FT                   45582727..45582822,45637446..45638713))
FT                   /gene="Trim9"
FT                   /locus_tag="mCG_120494"
FT                   /product="tripartite motif protein 9, transcript variant
FT                   mCT121684"
FT                   /note="gene_id=mCG120494.3 transcript_id=mCT121684.2
FT                   created on 16-JUN-2003"
FT   mRNA            complement(join(45529322..45531233,45533047..45533209,
FT                   45535839..45536088,45536848..45536871,45537271..45537312,
FT                   45552877..45553015,45565444..45565597,45566721..45566831,
FT                   45580732..45580854,45582727..45582822,45637446..>45638432))
FT                   /gene="Trim9"
FT                   /locus_tag="mCG_120494"
FT                   /product="tripartite motif protein 9, transcript variant
FT                   mCT193496"
FT                   /note="gene_id=mCG120494.3 transcript_id=mCT193496.0
FT                   created on 09-MAR-2004"
FT   mRNA            complement(join(45532515..45533209,45535785..45536088,
FT                   45536848..45536871,45537271..45537312,45539864..45540052,
FT                   45552049..45552081,45552877..45553015,45565444..45565597,
FT                   45566721..45566831,45580732..45580854,45582727..45582822,
FT                   45637446..>45638428))
FT                   /gene="Trim9"
FT                   /locus_tag="mCG_120494"
FT                   /product="tripartite motif protein 9, transcript variant
FT                   mCT193494"
FT                   /note="gene_id=mCG120494.3 transcript_id=mCT193494.0
FT                   created on 09-MAR-2004"
FT   mRNA            complement(join(45532517..45533209,45535839..45536088,
FT                   45536848..45536871,45537271..45537312,45539864..45540052,
FT                   45552049..45552078,45552877..45553015,45565444..45565597,
FT                   45566721..45566831,45580732..45580854,45582727..45582822,
FT                   45637446..>45638189))
FT                   /gene="Trim9"
FT                   /locus_tag="mCG_120494"
FT                   /product="tripartite motif protein 9, transcript variant
FT                   mCT193495"
FT                   /note="gene_id=mCG120494.3 transcript_id=mCT193495.0
FT                   created on 09-MAR-2004"
FT   mRNA            complement(join(45548549..45551309,45552049..45552081,
FT                   45552877..45553015,45565444..45565597,45566721..45566831,
FT                   45580732..45580854,45582727..45582822,45637446..45638713))
FT                   /gene="Trim9"
FT                   /locus_tag="mCG_120494"
FT                   /product="tripartite motif protein 9, transcript variant
FT                   mCT185774"
FT                   /note="gene_id=mCG120494.3 transcript_id=mCT185774.0
FT                   created on 16-JUN-2003"
FT   CDS             complement(join(45552939..45553015,45565444..45565597,
FT                   45566721..45566831,45580732..45580854,45582727..45582822,
FT                   45637446..>45638396))
FT                   /codon_start=1
FT                   /gene="Trim9"
FT                   /locus_tag="mCG_120494"
FT                   /product="tripartite motif protein 9, isoform CRA_b"
FT                   /note="gene_id=mCG120494.3 transcript_id=mCT193494.0
FT                   protein_id=mCP114444.0 isoform=CRA_b"
FT                   /protein_id="EDL36579.1"
FT                   /translation="ATGEGATTAAAGQGAGHHRPIGCFARSGPLRRSRCCLASSQVPME
FT                   EMEEELKCPVCGSFYREPIILPCSHNLCQACARNILVQTPESESPQSRRASGSGVSDYD
FT                   YLDLDKMSLYSEADSGYGSYGGFASAPTTPCQKSPNGVRVFPPAMPPPPTHLSPALAPV
FT                   PRNSCITCPQCHRSLILDDRGLRGFPKNRVLEGVIDRYQQSKAAALKCQLCEKAPKEAT
FT                   VMCEQCDVFYCDPCRLRCHPPRGPLAKHRLVPPAQGRVSRRLSPRKVSTCTDHELENHS
FT                   MYCVQCKMPVCYQCLEEGKHSSHEVKALGAMWKLHKSQLSQALNGLSDRAKEAKEFLVQ
FT                   LRTMVQQIQENSVEFEACLVAQCDALIDALNRRKAQLLARVNKEHEHKLKVVRDQISHC
FT                   TVKLRQTTGLMEYCLEVIKENDPSGFLQISDALIRRVHLTEDQWGKGTLTPRMTTDFDL
FT                   SLDNSPLLQSIHQLDFVQVKGSVCWKRNNVHSGRPSLQQHIQRSG"
FT   CDS             complement(join(45552939..45553015,45565444..45565597,
FT                   45566721..45566831,45580732..45580854,45582727..45582822,
FT                   45637446..>45638396))
FT                   /codon_start=1
FT                   /gene="Trim9"
FT                   /locus_tag="mCG_120494"
FT                   /product="tripartite motif protein 9, isoform CRA_b"
FT                   /note="gene_id=mCG120494.3 transcript_id=mCT193496.0
FT                   protein_id=mCP114446.0 isoform=CRA_b"
FT                   /protein_id="EDL36581.1"
FT                   /translation="ATGEGATTAAAGQGAGHHRPIGCFARSGPLRRSRCCLASSQVPME
FT                   EMEEELKCPVCGSFYREPIILPCSHNLCQACARNILVQTPESESPQSRRASGSGVSDYD
FT                   YLDLDKMSLYSEADSGYGSYGGFASAPTTPCQKSPNGVRVFPPAMPPPPTHLSPALAPV
FT                   PRNSCITCPQCHRSLILDDRGLRGFPKNRVLEGVIDRYQQSKAAALKCQLCEKAPKEAT
FT                   VMCEQCDVFYCDPCRLRCHPPRGPLAKHRLVPPAQGRVSRRLSPRKVSTCTDHELENHS
FT                   MYCVQCKMPVCYQCLEEGKHSSHEVKALGAMWKLHKSQLSQALNGLSDRAKEAKEFLVQ
FT                   LRTMVQQIQENSVEFEACLVAQCDALIDALNRRKAQLLARVNKEHEHKLKVVRDQISHC
FT                   TVKLRQTTGLMEYCLEVIKENDPSGFLQISDALIRRVHLTEDQWGKGTLTPRMTTDFDL
FT                   SLDNSPLLQSIHQLDFVQVKGSVCWKRNNVHSGRPSLQQHIQRSG"
FT   CDS             complement(join(45552939..45553015,45565444..45565597,
FT                   45566721..45566831,45580732..45580854,45582727..45582822,
FT                   45637446..>45638396))
FT                   /codon_start=1
FT                   /gene="Trim9"
FT                   /locus_tag="mCG_120494"
FT                   /product="tripartite motif protein 9, isoform CRA_b"
FT                   /note="gene_id=mCG120494.3 transcript_id=mCT193497.0
FT                   protein_id=mCP114447.0 isoform=CRA_b"
FT                   /protein_id="EDL36582.1"
FT                   /translation="ATGEGATTAAAGQGAGHHRPIGCFARSGPLRRSRCCLASSQVPME
FT                   EMEEELKCPVCGSFYREPIILPCSHNLCQACARNILVQTPESESPQSRRASGSGVSDYD
FT                   YLDLDKMSLYSEADSGYGSYGGFASAPTTPCQKSPNGVRVFPPAMPPPPTHLSPALAPV
FT                   PRNSCITCPQCHRSLILDDRGLRGFPKNRVLEGVIDRYQQSKAAALKCQLCEKAPKEAT
FT                   VMCEQCDVFYCDPCRLRCHPPRGPLAKHRLVPPAQGRVSRRLSPRKVSTCTDHELENHS
FT                   MYCVQCKMPVCYQCLEEGKHSSHEVKALGAMWKLHKSQLSQALNGLSDRAKEAKEFLVQ
FT                   LRTMVQQIQENSVEFEACLVAQCDALIDALNRRKAQLLARVNKEHEHKLKVVRDQISHC
FT                   TVKLRQTTGLMEYCLEVIKENDPSGFLQISDALIRRVHLTEDQWGKGTLTPRMTTDFDL
FT                   SLDNSPLLQSIHQLDFVQVKGSVCWKRNNVHSGRPSLQQHIQRSG"
FT   CDS             complement(join(45552939..45553015,45565444..45565597,
FT                   45566721..45566831,45580732..45580854,45582727..45582822,
FT                   45637446..45638267))
FT                   /codon_start=1
FT                   /gene="Trim9"
FT                   /locus_tag="mCG_120494"
FT                   /product="tripartite motif protein 9, isoform CRA_a"
FT                   /note="gene_id=mCG120494.3 transcript_id=mCT121684.2
FT                   protein_id=mCP78981.2 isoform=CRA_a"
FT                   /protein_id="EDL36577.1"
FT                   /translation="MEEMEEELKCPVCGSFYREPIILPCSHNLCQACARNILVQTPESE
FT                   SPQSRRASGSGVSDYDYLDLDKMSLYSEADSGYGSYGGFASAPTTPCQKSPNGVRVFPP
FT                   AMPPPPTHLSPALAPVPRNSCITCPQCHRSLILDDRGLRGFPKNRVLEGVIDRYQQSKA
FT                   AALKCQLCEKAPKEATVMCEQCDVFYCDPCRLRCHPPRGPLAKHRLVPPAQGRVSRRLS
FT                   PRKVSTCTDHELENHSMYCVQCKMPVCYQCLEEGKHSSHEVKALGAMWKLHKSQLSQAL
FT                   NGLSDRAKEAKEFLVQLRTMVQQIQENSVEFEACLVAQCDALIDALNRRKAQLLARVNK
FT                   EHEHKLKVVRDQISHCTVKLRQTTGLMEYCLEVIKENDPSGFLQISDALIRRVHLTEDQ
FT                   WGKGTLTPRMTTDFDLSLDNSPLLQSIHQLDFVQVKGSVCWKRNNVHSGRPSLQQHIQR
FT                   SG"
FT   CDS             complement(join(45552939..45553015,45565444..45565597,
FT                   45566721..45566831,45580732..45580854,45582727..45582822,
FT                   45637446..45638267))
FT                   /codon_start=1
FT                   /gene="Trim9"
FT                   /locus_tag="mCG_120494"
FT                   /product="tripartite motif protein 9, isoform CRA_a"
FT                   /note="gene_id=mCG120494.3 transcript_id=mCT185774.0
FT                   protein_id=mCP107032.0 isoform=CRA_a"
FT                   /protein_id="EDL36578.1"
FT                   /translation="MEEMEEELKCPVCGSFYREPIILPCSHNLCQACARNILVQTPESE
FT                   SPQSRRASGSGVSDYDYLDLDKMSLYSEADSGYGSYGGFASAPTTPCQKSPNGVRVFPP
FT                   AMPPPPTHLSPALAPVPRNSCITCPQCHRSLILDDRGLRGFPKNRVLEGVIDRYQQSKA
FT                   AALKCQLCEKAPKEATVMCEQCDVFYCDPCRLRCHPPRGPLAKHRLVPPAQGRVSRRLS
FT                   PRKVSTCTDHELENHSMYCVQCKMPVCYQCLEEGKHSSHEVKALGAMWKLHKSQLSQAL
FT                   NGLSDRAKEAKEFLVQLRTMVQQIQENSVEFEACLVAQCDALIDALNRRKAQLLARVNK
FT                   EHEHKLKVVRDQISHCTVKLRQTTGLMEYCLEVIKENDPSGFLQISDALIRRVHLTEDQ
FT                   WGKGTLTPRMTTDFDLSLDNSPLLQSIHQLDFVQVKGSVCWKRNNVHSGRPSLQQHIQR
FT                   SG"
FT   CDS             complement(join(45552939..45553015,45565444..45565597,
FT                   45566721..45566831,45580732..45580854,45582727..45582822,
FT                   45637446..>45638189))
FT                   /codon_start=1
FT                   /gene="Trim9"
FT                   /locus_tag="mCG_120494"
FT                   /product="tripartite motif protein 9, isoform CRA_c"
FT                   /note="gene_id=mCG120494.3 transcript_id=mCT193495.0
FT                   protein_id=mCP114445.0 isoform=CRA_c"
FT                   /protein_id="EDL36580.1"
FT                   /translation="HNLCQACARNILVQTPESESPQSRRASGSGVSDYDYLDLDKMSLY
FT                   SEADSGYGSYGGFASAPTTPCQKSPNGVRVFPPAMPPPPTHLSPALAPVPRNSCITCPQ
FT                   CHRSLILDDRGLRGFPKNRVLEGVIDRYQQSKAAALKCQLCEKAPKEATVMCEQCDVFY
FT                   CDPCRLRCHPPRGPLAKHRLVPPAQGRVSRRLSPRKVSTCTDHELENHSMYCVQCKMPV
FT                   CYQCLEEGKHSSHEVKALGAMWKLHKSQLSQALNGLSDRAKEAKEFLVQLRTMVQQIQE
FT                   NSVEFEACLVAQCDALIDALNRRKAQLLARVNKEHEHKLKVVRDQISHCTVKLRQTTGL
FT                   MEYCLEVIKENDPSGFLQISDALIRRVHLTEDQWGKGTLTPRMTTDFDLSLDNSPLLQS
FT                   IHQLDFVQVKGSVCWKRNNVHSGRPSLQQHIQRSG"
FT   gene            <45744040..45758960
FT                   /gene="Txndc1"
FT                   /locus_tag="mCG_5759"
FT                   /note="gene_id=mCG5759.1"
FT   mRNA            join(<45744040..45744245,45746927..45747042,
FT                   45747496..45747541,45749690..45749818,45751256..45751301,
FT                   45751390..45751491,45755339..45755405,45756917..45758960)
FT                   /gene="Txndc1"
FT                   /locus_tag="mCG_5759"
FT                   /product="thioredoxin domain containing 1"
FT                   /note="gene_id=mCG5759.1 transcript_id=mCT4923.2 created on
FT                   05-SEP-2002"
FT   CDS             join(<45744085..45744245,45746927..45747042,
FT                   45747496..45747541,45749690..45749818,45751256..45751301,
FT                   45751390..45751491,45755339..45755405,45756917..45757095)
FT                   /codon_start=1
FT                   /gene="Txndc1"
FT                   /locus_tag="mCG_5759"
FT                   /product="thioredoxin domain containing 1"
FT                   /note="gene_id=mCG5759.1 transcript_id=mCT4923.2
FT                   protein_id=mCP3145.2"
FT                   /protein_id="EDL36576.1"
FT                   /translation="AADMAHLGRLMVPLAALVLLLWAVPGAHGRRNNVRVLTDENWTSL
FT                   LEGEWMIEFYAPWCPACQNLQPEWESFAEWGEDLEVKVAKVDVTEQTGLSGRFIITALP
FT                   SIYHCKDGEFRRYVGPRTKKDFINFVSDKEWKNIEPISSWFGPSSVLMTMMSALFQLSV
FT                   YIRTSHSYFVHDLGIPAWGSYLVFAFATVLSGLLLGLCMIFVADCLCPSKRRKPQQQYA
FT                   KKTSPEFSQPLKKVEEEQEADEEDVSEEEAEDREGASKATSQSSIRQRCVGLPSATDTS
FT                   "
FT   gene            45832973..45835306
FT                   /locus_tag="mCG_1041741"
FT                   /note="gene_id=mCG1041741.0"
FT   mRNA            join(45832973..45833272,45834994..45835306)
FT                   /locus_tag="mCG_1041741"
FT                   /product="mCG1041741"
FT                   /note="gene_id=mCG1041741.0 transcript_id=mCT159445.0
FT                   created on 18-SEP-2002"
FT   CDS             45835100..45835222
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041741"
FT                   /product="mCG1041741"
FT                   /note="gene_id=mCG1041741.0 transcript_id=mCT159445.0
FT                   protein_id=mCP78593.1"
FT                   /protein_id="EDL36575.1"
FT                   /translation="MLHHWPGCLLFPCAWTPGLSGTSKSMTPTRLTLCMDALLL"
FT   gene            45945610..45982256
FT                   /locus_tag="mCG_1041740"
FT                   /note="gene_id=mCG1041740.0"
FT   mRNA            join(45945610..45945665,45947055..45947146,
FT                   45981951..45982256)
FT                   /locus_tag="mCG_1041740"
FT                   /product="mCG1041740"
FT                   /note="gene_id=mCG1041740.0 transcript_id=mCT159444.0
FT                   created on 18-SEP-2002"
FT   CDS             join(45947076..45947146,45981951..45982056)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041740"
FT                   /product="mCG1041740"
FT                   /note="gene_id=mCG1041740.0 transcript_id=mCT159444.0
FT                   protein_id=mCP78581.1"
FT                   /protein_id="EDL36574.1"
FT                   /translation="MAPERWAVPDTEKEGFDQSSMVSLTQFQGLQSPQCPRQKQVHFFL
FT                   CKAKSLSTPLRRD"
FT   gene            <46114442..46191309
FT                   /gene="Frmd6"
FT                   /locus_tag="mCG_5760"
FT                   /note="gene_id=mCG5760.1"
FT   mRNA            join(<46114442..46114557,46152766..46153031,
FT                   46161381..46161471,46166048..46166151,46167617..46167795,
FT                   46169828..46170014,46172859..46173014,46176898..46176966,
FT                   46179021..46179195,46182696..46183031,46183966..46184097,
FT                   46186431..46186522,46188460..46191309)
FT                   /gene="Frmd6"
FT                   /locus_tag="mCG_5760"
FT                   /product="FERM domain containing 6, transcript variant
FT                   mCT4932"
FT                   /note="gene_id=mCG5760.1 transcript_id=mCT4932.1 created on
FT                   04-SEP-2002"
FT   mRNA            join(<46114498..46114557,46152766..46153031,
FT                   46161381..46161471,46166048..46166151,46167617..46167693,
FT                   46169828..46170014,46172859..46173014,46176113..46176178,
FT                   46176898..46176966,46179021..46179195,46182696..46183031,
FT                   46183966..46184097,46186431..46186522,46188460..46191308)
FT                   /gene="Frmd6"
FT                   /locus_tag="mCG_5760"
FT                   /product="FERM domain containing 6, transcript variant
FT                   mCT193453"
FT                   /note="gene_id=mCG5760.1 transcript_id=mCT193453.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(<46114673..46115117,46152766..46153031,
FT                   46161381..46161471,46166048..46166127,46167617..46167693,
FT                   46169828..46170014,46172859..46173014,46176113..46176178,
FT                   46176898..46176966,46179021..46179195,46182696..46183031,
FT                   46183966..46184738)
FT                   /gene="Frmd6"
FT                   /locus_tag="mCG_5760"
FT                   /product="FERM domain containing 6, transcript variant
FT                   mCT193452"
FT                   /note="gene_id=mCG5760.1 transcript_id=mCT193452.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<46152795..46153031,46161381..46161471,
FT                   46166048..46166151,46167617..46167795,46169828..46170014,
FT                   46172859..46173014,46176898..46176966,46179021..46179195,
FT                   46182696..46183031,46183966..46184097,46186431..46186522,
FT                   46188460..46188744)
FT                   /codon_start=1
FT                   /gene="Frmd6"
FT                   /locus_tag="mCG_5760"
FT                   /product="FERM domain containing 6, isoform CRA_c"
FT                   /note="gene_id=mCG5760.1 transcript_id=mCT4932.1
FT                   protein_id=mCP3185.1 isoform=CRA_c"
FT                   /protein_id="EDL36572.1"
FT                   /translation="NLHCGAPRCFRWPYDEEEKLALECWEPEKLLSTQRPQPAHWPAHN
FT                   TMNKLTFHNNKAMQDRRRVCIFLPNDKSVSIIINVKILCHQLLVQVCDLLRLKDSHLFG
FT                   LSVIQNNEHVYMELSQKLYKYCPKEWKKEASKVRQYEVTWGIDQFGPPMIIHFRVQYYV
FT                   ENGKLIRYENRPRAGASVPSAALLSADTKHILVPALPAFRLDRIARYYYYWHLRKQVLH
FT                   SQCVLREEAYFLLAAFALQADLGNFKRKLHHGDYFEPEAYFPAWVVSKRGKDYILKHIP
FT                   NMHKDQFALTASEAYLKYIKEAVRLDDVAIHYYRLYKNLEEEKQLLYDFPWTNVGKLVF
FT                   VGKKFEILPDGLPSARKLVYYTGCPTRSRHLLQLLSNSHRLYMNLQPVLRHLRKQEENE
FT                   EKKQYRESYISDNLDLDMDPLEKRSRASGSSAGSVKHKRLSRHSTASHSSSHTSGIEAD
FT                   TKPRDPGPEDSCSGSAMHRKLKTCSSMTSHGSSHTSGVESGGKDRLEEDSQDEEIEMLV
FT                   DDPRDLEPMPEESLEVSPEMCIYITEDMLLSRKLNGHSGLIVKEIGSSTSSSSETVVRL
FT                   RGQSTDSLPQTICRKPKTSTDRHSLSLDDIRLYQKDFLRIAGLCQDTAQSYTFGCGHEL
FT                   DESGLYCNSCLAQQCVNIQDAFPVKRASKYFSLDLTHDEVPEFVV"
FT   CDS             join(<46152795..46153031,46161381..46161471,
FT                   46166048..46166151,46167617..46167693,46169828..46170014,
FT                   46172859..46173014,46176113..46176178,46176898..46176966,
FT                   46179021..46179195,46182696..46183031,46183966..46184097,
FT                   46186431..46186522,46188460..46188744)
FT                   /codon_start=1
FT                   /gene="Frmd6"
FT                   /locus_tag="mCG_5760"
FT                   /product="FERM domain containing 6, isoform CRA_b"
FT                   /note="gene_id=mCG5760.1 transcript_id=mCT193453.0
FT                   protein_id=mCP114435.0 isoform=CRA_b"
FT                   /protein_id="EDL36571.1"
FT                   /translation="NLHCGAPRCFRWPYDEEEKLALECWEPEKLLSTQRPQPAHWPAHN
FT                   TMNKLTFHNNKAMQDRRRVCIFLPNDKSVSIIINVKILCHQLLVQVCDLLRLKDSHLFG
FT                   LSVIQNNEHVYMELSQKLYKYCPKEWKKEASKVRQYEVTWGIDQFGPPMIIHFRVQYYV
FT                   ENGKLISDRIARYYYYWHLRKQVLHSQCVLREEAYFLLAAFALQADLGNFKRKLHHGDY
FT                   FEPEAYFPAWVVSKRGKDYILKHIPNMHKDQFALTASEAYLKYIKEAVRLDDVAIHYYR
FT                   LYKDKREAEGSLTLGLTMRGIQIFQNLEEEKQLLYDFPWTNVGKLVFVGKKFEILPDGL
FT                   PSARKLVYYTGCPTRSRHLLQLLSNSHRLYMNLQPVLRHLRKQEENEEKKQYRESYISD
FT                   NLDLDMDPLEKRSRASGSSAGSVKHKRLSRHSTASHSSSHTSGIEADTKPRDPGPEDSC
FT                   SGSAMHRKLKTCSSMTSHGSSHTSGVESGGKDRLEEDSQDEEIEMLVDDPRDLEPMPEE
FT                   SLEVSPEMCIYITEDMLLSRKLNGHSGLIVKEIGSSTSSSSETVVRLRGQSTDSLPQTI
FT                   CRKPKTSTDRHSLSLDDIRLYQKDFLRIAGLCQDTAQSYTFGCGHELDESGLYCNSCLA
FT                   QQCVNIQDAFPVKRASKYFSLDLTHDEVPEFVV"
FT   CDS             join(<46152795..46153031,46161381..46161471,
FT                   46166048..46166127,46167617..46167693,46169828..46170014,
FT                   46172859..46173014,46176113..46176178,46176898..46176966,
FT                   46179021..46179195,46182696..46183031,46183966..46184321)
FT                   /codon_start=1
FT                   /gene="Frmd6"
FT                   /locus_tag="mCG_5760"
FT                   /product="FERM domain containing 6, isoform CRA_a"
FT                   /note="gene_id=mCG5760.1 transcript_id=mCT193452.0
FT                   protein_id=mCP114434.0 isoform=CRA_a"
FT                   /protein_id="EDL36570.1"
FT                   /translation="NLHCGAPRCFRWPYDEEEKLALECWEPEKLLSTQRPQPAHWPAHN
FT                   TMNKLTFHNNKAMQDRRRVCIFLPNDKSVSIIINVKILCHQLLVQVCDLLRLKDSHLFG
FT                   LSVIQNNEHVYMELSQKLYKYCPKEWKKEASKGIDQFGPPMIIHFRVQYYVENGKLISD
FT                   RIARYYYYWHLRKQVLHSQCVLREEAYFLLAAFALQADLGNFKRKLHHGDYFEPEAYFP
FT                   AWVVSKRGKDYILKHIPNMHKDQFALTASEAYLKYIKEAVRLDDVAIHYYRLYKDKREA
FT                   EGSLTLGLTMRGIQIFQNLEEEKQLLYDFPWTNVGKLVFVGKKFEILPDGLPSARKLVY
FT                   YTGCPTRSRHLLQLLSNSHRLYMNLQPVLRHLRKQEENEEKKQYRESYISDNLDLDMDP
FT                   LEKRSRASGSSAGSVKHKRLSRHSTASHSSSHTSGIEADTKPRDPGPEDSCSGSAMHRK
FT                   LKTCSSMTSHGSSHTSGVESGGKDRLEEDSQDEEIEMLVDDPRDLEPMPEESLEVSPEM
FT                   CIYITEDMLLSRKLNGHSGELLGQAVACRSPQAGTSKNRTVVGTLNPPGRRATAGGLIP
FT                   GQVPSVEEMGEGTRVVSMFCSARFSEASSVGLI"
FT   gene            complement(<46158873..46159635)
FT                   /locus_tag="mCG_1041739"
FT                   /note="gene_id=mCG1041739.0"
FT   mRNA            complement(join(<46158873..46159592,46159608..46159635))
FT                   /locus_tag="mCG_1041739"
FT                   /product="mCG1041739"
FT                   /note="gene_id=mCG1041739.0 transcript_id=mCT159443.0
FT                   created on 18-SEP-2002"
FT   CDS             complement(<46158873..46159034)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041739"
FT                   /product="mCG1041739"
FT                   /note="gene_id=mCG1041739.0 transcript_id=mCT159443.0
FT                   protein_id=mCP78577.1"
FT                   /protein_id="EDL36573.1"
FT                   /translation="MSYSELRGHYIFLFCIYVCLYKCMYFYMCVNGVCVGGGSQRSILF
FT                   ENLFAVGPL"
FT   gene            46230732..46250836
FT                   /gene="Actr10"
FT                   /locus_tag="mCG_115175"
FT                   /note="gene_id=mCG115175.0"
FT   mRNA            join(46230732..46230819,46231887..46231995,
FT                   46235930..46236037,46238182..46238249,46241429..46241508,
FT                   46243098..46243133,46244817..46244896,46245144..46245217,
FT                   46246576..46246657,46248387..46248588,46250421..46250836)
FT                   /gene="Actr10"
FT                   /locus_tag="mCG_115175"
FT                   /product="ARP10 actin-related protein 10 homolog (S.
FT                   cerevisiae)"
FT                   /note="gene_id=mCG115175.0 transcript_id=mCT116275.0
FT                   created on 02-APR-2003"
FT   CDS             join(46235963..46236037,46238182..46238249,
FT                   46241429..46241508,46243098..46243133,46244817..46244896,
FT                   46245144..46245217,46246576..46246657,46248387..46248588,
FT                   46250421..46250602)
FT                   /codon_start=1
FT                   /gene="Actr10"
FT                   /locus_tag="mCG_115175"
FT                   /product="ARP10 actin-related protein 10 homolog (S.
FT                   cerevisiae)"
FT                   /note="gene_id=mCG115175.0 transcript_id=mCT116275.0
FT                   protein_id=mCP78558.1"
FT                   /protein_id="EDL36569.1"
FT                   /translation="MALLTLGINSAMVLDCGYRESLVLPIYEGIPILNCWGALPLGGKA
FT                   LHKELETQLLEQCTVDTGAAKGQSLPSVMGSVPEGVLEDIKVRTCFVSDLKRGLQIQAA
FT                   KFNIDGNNERPTPPPNVDYPLDGEKILHVLGSIRDSVVEILFEQDNEEKSVATLILDSL
FT                   LQCPIDTRKQLAENLVIIGGTSMLPGFLHRLLAEIRYLVEKPKYKKTLGTKNFRIHTPP
FT                   AKANCVAWLGGAVFGALQDILGSRSISKEYYNQTGRIPDWCSLNNPPLEMMFDVGKAQP
FT                   PLMKRAFSTEK"
FT   gene            46255161..46255616
FT                   /locus_tag="mCG_1041737"
FT                   /note="gene_id=mCG1041737.0"
FT   mRNA            join(46255161..46255390,46255558..46255616)
FT                   /locus_tag="mCG_1041737"
FT                   /product="mCG1041737"
FT                   /note="gene_id=mCG1041737.0 transcript_id=mCT159441.0
FT                   created on 18-SEP-2002"
FT   CDS             46255270..46255314
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041737"
FT                   /product="mCG1041737"
FT                   /note="gene_id=mCG1041737.0 transcript_id=mCT159441.0
FT                   protein_id=mCP78543.1"
FT                   /protein_id="EDL36568.1"
FT                   /translation="MSVFCSSQAGDFIH"
FT   gene            <46263239..46283154
FT                   /gene="Psma3"
FT                   /locus_tag="mCG_5751"
FT                   /note="gene_id=mCG5751.2"
FT   mRNA            join(<46263239..46263318,46267287..46267369,
FT                   46271976..46272099,46273150..46273251,46273329..46273402,
FT                   46275520..46275592,46279142..46279188,46281674..>46281750)
FT                   /gene="Psma3"
FT                   /locus_tag="mCG_5751"
FT                   /product="proteasome (prosome, macropain) subunit, alpha
FT                   type 3, transcript variant mCT193433"
FT                   /note="gene_id=mCG5751.2 transcript_id=mCT193433.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<46263241..46263318,46267287..46267369,
FT                   46271976..46272099,46273150..46273251,46273329..46273402,
FT                   46275520..46275592,46279142..46279188,46281674..>46281750)
FT                   /codon_start=1
FT                   /gene="Psma3"
FT                   /locus_tag="mCG_5751"
FT                   /product="proteasome (prosome, macropain) subunit, alpha
FT                   type 3, isoform CRA_a"
FT                   /note="gene_id=mCG5751.2 transcript_id=mCT193433.0
FT                   protein_id=mCP114429.0 isoform=CRA_a"
FT                   /protein_id="EDL36563.1"
FT                   /translation="GVGAALEAWKRSAACRVSTMSSIGTGYDLSASTFSPDGRVFQVEY
FT                   AMKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYEEGSNKRLFNVDRHVGMAVAGLLADA
FT                   RSLADIAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYSAVRPFGCSFMLGSYSAN
FT                   DGAQLYMIDPSGVSYMKEMTCRDVVKEVAKIIYIVHDEVKDKAFELELSWVGECKL"
FT   mRNA            join(<46263241..46263318,46267287..46267393,
FT                   46271976..46272099,46273150..46273251,46273329..46273402,
FT                   46275520..46275592,46277080..46277145,46279142..46279188,
FT                   46281674..>46281735)
FT                   /gene="Psma3"
FT                   /locus_tag="mCG_5751"
FT                   /product="proteasome (prosome, macropain) subunit, alpha
FT                   type 3, transcript variant mCT193436"
FT                   /note="gene_id=mCG5751.2 transcript_id=mCT193436.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(<46263255..46263318,46267287..46267369,
FT                   46271981..46272099,46273150..46273251,46273329..46273402,
FT                   46275520..46275592,46277080..46277145,46279142..46279188,
FT                   46281674..46281741,46282161..46282225,46283006..46283098)
FT                   /gene="Psma3"
FT                   /locus_tag="mCG_5751"
FT                   /product="proteasome (prosome, macropain) subunit, alpha
FT                   type 3, transcript variant mCT193435"
FT                   /note="gene_id=mCG5751.2 transcript_id=mCT193435.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(<46263256..46263318,46267287..46267369,
FT                   46271976..46272099,46273150..46273251,46273329..46273402,
FT                   46275520..46275592,46277080..46277145,46279142..46279188,
FT                   46281674..46281741,46282161..46282225,46283006..46283154)
FT                   /gene="Psma3"
FT                   /locus_tag="mCG_5751"
FT                   /product="proteasome (prosome, macropain) subunit, alpha
FT                   type 3, transcript variant mCT4933"
FT                   /note="gene_id=mCG5751.2 transcript_id=mCT4933.1 created on
FT                   29-AUG-2002"
FT   CDS             join(<46263256..46263318,46267287..46267369,
FT                   46271976..46272099,46273150..46273251,46273329..46273402,
FT                   46275520..46275592,46277080..46277145,46279142..46279188,
FT                   46281674..46281741,46282161..46282225,46283006..46283050)
FT                   /codon_start=1
FT                   /gene="Psma3"
FT                   /locus_tag="mCG_5751"
FT                   /product="proteasome (prosome, macropain) subunit, alpha
FT                   type 3, isoform CRA_e"
FT                   /note="gene_id=mCG5751.2 transcript_id=mCT4933.1
FT                   protein_id=mCP3252.1 isoform=CRA_e"
FT                   /protein_id="EDL36567.1"
FT                   /translation="LEAWKRSAACRVSTMSSIGTGYDLSASTFSPDGRVFQVEYAMKAV
FT                   ENSSTAIGIRCKDGVVFGVEKLVLSKLYEEGSNKRLFNVDRHVGMAVAGLLADARSLAD
FT                   IAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYSAVRPFGCSFMLGSYSANDGAQL
FT                   YMIDPSGVSYGYWGCAIGKARQAAKTEIEKLQMKEMTCRDVVKEVAKIIYIVHDEVKDK
FT                   AFELELSWVGELTKGRHEIVPKDIREEAEKYAKESLKEEDESDDDNM"
FT   mRNA            join(<46263268..46263318,46267287..46267369,
FT                   46271976..46272099,46273150..46273402,46275520..46275592,
FT                   46277080..46277145,46279142..46279188,46281674..46281745)
FT                   /gene="Psma3"
FT                   /locus_tag="mCG_5751"
FT                   /product="proteasome (prosome, macropain) subunit, alpha
FT                   type 3, transcript variant mCT193434"
FT                   /note="gene_id=mCG5751.2 transcript_id=mCT193434.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<46263268..46263318,46267287..46267369,
FT                   46271976..46272099,46273150..46273260)
FT                   /codon_start=1
FT                   /gene="Psma3"
FT                   /locus_tag="mCG_5751"
FT                   /product="proteasome (prosome, macropain) subunit, alpha
FT                   type 3, isoform CRA_b"
FT                   /note="gene_id=mCG5751.2 transcript_id=mCT193434.0
FT                   protein_id=mCP114430.0 isoform=CRA_b"
FT                   /protein_id="EDL36564.1"
FT                   /translation="KRSAACRVSTMSSIGTGYDLSASTFSPDGRVFQVEYAMKAVENSS
FT                   TAIGIRCKDGVVFGVEKLVLSKLYEEGSNKRLFNVDRHVGMAVAGLLADARSLADIARE
FT                   EASNFRSNFGYNIPLKVS"
FT   CDS             join(<46267351..46267369,46271981..46272099,
FT                   46273150..46273251,46273329..46273402,46275520..46275592,
FT                   46277080..46277145,46279142..46279188,46281674..46281741,
FT                   46282161..46282225,46283006..46283050)
FT                   /codon_start=1
FT                   /gene="Psma3"
FT                   /locus_tag="mCG_5751"
FT                   /product="proteasome (prosome, macropain) subunit, alpha
FT                   type 3, isoform CRA_c"
FT                   /note="gene_id=mCG5751.2 transcript_id=mCT193435.0
FT                   protein_id=mCP114431.0 isoform=CRA_c"
FT                   /protein_id="EDL36565.1"
FT                   /translation="RLWKTVAIGIRCKDGVVFGVEKLVLSKLYEEGSNKRLFNVDRHVG
FT                   MAVAGLLADARSLADIAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYSAVRPFGC
FT                   SFMLGSYSANDGAQLYMIDPSGVSYGYWGCAIGKARQAAKTEIEKLQMKEMTCRDVVKE
FT                   VAKIIYIVHDEVKDKAFELELSWVGELTKGRHEIVPKDIREEAEKYAKESLKEEDESDD
FT                   DNM"
FT   CDS             join(<46267374..46267393,46271976..46272099,
FT                   46273150..46273251,46273329..46273402,46275520..46275592,
FT                   46277080..46277145,46279142..46279188,46281674..>46281735)
FT                   /codon_start=1
FT                   /gene="Psma3"
FT                   /locus_tag="mCG_5751"
FT                   /product="proteasome (prosome, macropain) subunit, alpha
FT                   type 3, isoform CRA_d"
FT                   /note="gene_id=mCG5751.2 transcript_id=mCT193436.0
FT                   protein_id=mCP114432.0 isoform=CRA_d"
FT                   /protein_id="EDL36566.1"
FT                   /translation="EALFDLNTAIGIRCKDGVVFGVEKLVLSKLYEEGSNKRLFNVDRH
FT                   VGMAVAGLLADARSLADIAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYSAVRPF
FT                   GCSFMLGSYSANDGAQLYMIDPSGVSYGYWGCAIGKARQAAKTEIEKLQMKEMTCRDVV
FT                   KEVAKIIYIVHDEVKDKAFELELSWV"
FT   gene            complement(46280276..>46304243)
FT                   /locus_tag="mCG_145568"
FT                   /note="gene_id=mCG145568.0"
FT   mRNA            complement(join(46280276..46280716,46298988..46299126,
FT                   46303103..46303154,46304153..>46304243))
FT                   /locus_tag="mCG_145568"
FT                   /product="mCG145568"
FT                   /note="gene_id=mCG145568.0 transcript_id=mCT184992.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(46280481..46280716,46298988..>46299039))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145568"
FT                   /product="mCG145568"
FT                   /note="gene_id=mCG145568.0 transcript_id=mCT184992.0
FT                   protein_id=mCP105148.0"
FT                   /protein_id="EDL36562.1"
FT                   /translation="RILTGDVEKETQKNKKTEALLKPCCIVQESTLVTRMKRWLSEEEQ
FT                   VLPITNYERCQRVDFQQELQRLFQQQTLDCTILKLFKGITFTFQCNMVLN"
FT   gene            <46304638..46383129
FT                   /locus_tag="mCG_115181"
FT                   /note="gene_id=mCG115181.0"
FT   mRNA            join(<46304638..46304807,46305860..46305917,
FT                   46308147..46308257,46310968..46311033,46312275..46312365,
FT                   46328593..46328768,46333821..46333900,46334911..46334987,
FT                   46335991..46336157,46348780..46348852,46350223..46350346,
FT                   46351799..46352030,46355754..46356013,46358666..46358863,
FT                   46360610..46360694,46361392..46361581,46363738..46364871,
FT                   46365245..46365349,46370921..46371127,46371927..46372073,
FT                   46381982..46383129)
FT                   /locus_tag="mCG_115181"
FT                   /product="mCG115181"
FT                   /note="gene_id=mCG115181.0 transcript_id=mCT116281.0
FT                   created on 04-SEP-2002"
FT   CDS             join(<46304677..46304807,46305860..46305917,
FT                   46308147..46308257,46310968..46311033,46312275..46312365,
FT                   46328593..46328768,46333821..46333900,46334911..46334987,
FT                   46335991..46336157,46348780..46348852,46350223..46350346,
FT                   46351799..46352030,46355754..46356013,46358666..46358863,
FT                   46360610..46360694,46361392..46361581,46363738..46364871,
FT                   46365245..46365349,46370921..46371127,46371927..46372073,
FT                   46381982..46382004)
FT                   /codon_start=1
FT                   /locus_tag="mCG_115181"
FT                   /product="mCG115181"
FT                   /note="gene_id=mCG115181.0 transcript_id=mCT116281.0
FT                   protein_id=mCP78625.0"
FT                   /protein_id="EDL36561.1"
FT                   /translation="IGASGGTRRRNCRCGRERCCPDGDPRRSVGRQTGELTALCTRSSA
FT                   REENSRKLEPHRSPVKMKAADEPAYLTVGTDVSAKYRGAFCEAKIKTVKRLVKVKVLLK
FT                   QDNTTQLVQDDQVKGPLRVGAIVETRTSDGSIQEAIISKLTDASWYTVGYGHLDNDQVL
FT                   LTLSTEDEKEEESSEEEDEDKRRLNDELLGKVVSVASTAESTGWYPALVVSPSCNDDVT
FT                   VKKDQCLVRSFIDSKFYSIARKDIKELDILTLPESELCARPGLRRASVFLKGRIVPDNW
FT                   KMDISEILESSSSDDEECPAEEHEEEKEKEAKKEEEELPEEELDPEERDNFLQQLYKFM
FT                   EDRVVNKILIFQIDSGAVWKQIYMDLGIPILNSAASYNVKTAYRKYLYGFEEYCRSANI
FT                   QFRTIHHHEPKVKEEKKDFEDSMDEALKEAPEMPLLDVKSEPEENTDSNSESDREDTEL
FT                   KSPRGRRKIVRDANCIKKEIEEEKIEDKFLRDDLENKDAGDDDDDGDPAAKREHELLFG
FT                   RKSTPKNKEKKIKKPEDSERDSDEEEEKSQEREETESRCDSEGEDEEDDTEPCLTGTKV
FT                   KVKYGRGKTQKIYEASIKSTEMDDGEILYLVHYYGWNVRYDEWVKADRIIWPLDKGGPK
FT                   KKQKKKVKNKEDSEKDEKRDEERQKSKRGRPPLKSTFSPNMPYSLSKTSNSEGKSGTRN
FT                   AHGNVTGSIPLSDSCSSDSEADDQLEKSSGGEDLSPDVKEELEKNENAHDDKLDEENPK
FT                   IVHISKENDRTQAQPSDTLTVEAGDSDQIVHIFGDKVDQVEEFKKQVEKSPKGKGRRSK
FT                   TKDLSLELIKISPFGQEEAGSEAHGDVHSLEFSSLECKNFSSTEDDIDPYEKEKKLKRK
FT                   ILGQQSPEKKLRLDNGMEMTTGVSQERSDDGAGAEGMKGAHVEQHFETEGEGMPSLTAE
FT                   PDQGLQELTSEKSDSPAEEEPVHTPLKEEEDAMPLIGPETLVCHEVDLDDLDEKDKTSI
FT                   EDVVVEGSESNSLASVPPALPPVAQHNFSVASPLTLSQDESRSIKSESDITIEVDSIAE
FT                   ESQEGLCERESANGFEASVASGACSIIAHERESREKGQKRPSDGNSGLIAKKQKRTPKR
FT                   TSAAAKTEKNGAGQSSDSEDLPAMDSSSNCTPVKRLSLPKPQKLPRSPARTSPHIKDAE
FT                   KEKHREKHPNSSPRTYKWSFQLNELDNMNSTERISFLQEKLQEIRKYYMSLKSEVATID
FT                   RRRKRLKKKDREENKLINN"
FT   gene            <46396567..46408347
FT                   /locus_tag="mCG_5755"
FT                   /note="gene_id=mCG5755.2"
FT   mRNA            join(<46396567..46396719,46402663..46402744,
FT                   46406988..46407130,46408173..46408345)
FT                   /locus_tag="mCG_5755"
FT                   /product="mCG5755, transcript variant mCT193441"
FT                   /note="gene_id=mCG5755.2 transcript_id=mCT193441.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<46396567..46396719,46402663..46402744,
FT                   46406988..46407130,46408173..46408226)
FT                   /codon_start=1
FT                   /locus_tag="mCG_5755"
FT                   /product="mCG5755, isoform CRA_a"
FT                   /note="gene_id=mCG5755.2 transcript_id=mCT193441.0
FT                   protein_id=mCP114433.0 isoform=CRA_a"
FT                   /protein_id="EDL36559.1"
FT                   /translation="ARRATQCPASVLASVSWRAWQRAARSSYSATASTWTGGGTETPHS
FT                   AAACRTLWDPVKKEELQEYFFREVQMGKLCLIRGERGMGFEHLTNALLVCEQPKELLMF
FT                   FKKTLPPEVFQMLLDKIPLICQQLEETCRSTEHLKDDPD"
FT   mRNA            join(46396583..46396719,46396845..46396888,
FT                   46402663..46402744,46406988..46407130,46408173..46408347)
FT                   /locus_tag="mCG_5755"
FT                   /product="mCG5755, transcript variant mCT4929"
FT                   /note="gene_id=mCG5755.2 transcript_id=mCT4929.1 created on
FT                   04-SEP-2002"
FT   CDS             join(46396584..46396719,46396845..46396888,
FT                   46402663..46402744,46406988..46407130,46408173..46408226)
FT                   /codon_start=1
FT                   /locus_tag="mCG_5755"
FT                   /product="mCG5755, isoform CRA_b"
FT                   /note="gene_id=mCG5755.2 transcript_id=mCT4929.1
FT                   protein_id=mCP3120.1 isoform=CRA_b"
FT                   /protein_id="EDL36560.1"
FT                   /translation="MPSVRLGVGLLAGLAAGGAVVLLSYCVYLDWRRHRDPAFRRRLQD
FT                   KRRAGQPKAQAPARQLWDPVKKEELQEYFFREVQMGKLCLIRGERGMGFEHLTNALLVC
FT                   EQPKELLMFFKKTLPPEVFQMLLDKIPLICQQLEETCRSTEHLKDDPD"
FT   gene            complement(46408298..>46421788)
FT                   /gene="Timm9"
FT                   /locus_tag="mCG_5750"
FT                   /note="gene_id=mCG5750.2"
FT   mRNA            complement(join(46408298..46408810,46410586..46410681,
FT                   46411457..46411521,46417125..46417210,46417631..46417766,
FT                   46419024..46419121,46421679..>46421788))
FT                   /gene="Timm9"
FT                   /locus_tag="mCG_5750"
FT                   /product="translocase of inner mitochondrial membrane 9
FT                   homolog (yeast), transcript variant mCT172870"
FT                   /note="gene_id=mCG5750.2 transcript_id=mCT172870.0 created
FT                   on 29-AUG-2002"
FT   CDS             complement(46408376..>46408675)
FT                   /codon_start=1
FT                   /gene="Timm9"
FT                   /locus_tag="mCG_5750"
FT                   /product="translocase of inner mitochondrial membrane 9
FT                   homolog (yeast), isoform CRA_b"
FT                   /note="gene_id=mCG5750.2 transcript_id=mCT172870.0
FT                   protein_id=mCP95787.0 isoform=CRA_b"
FT                   /protein_id="EDL36557.1"
FT                   /translation="RGPEAGTCTERLPAAAAVRTRIHMVENPLTQQEPWSTICHDYLTN
FT                   GNHQRKTLFTRKSQNRRPSCAVKMVRCGGVEALRFVCVVTVIAKINHCSFLCDC"
FT   mRNA            complement(join(46408420..46408810,46410586..46410681,
FT                   46411457..46411521,46417125..46417210,46421679..>46421758))
FT                   /gene="Timm9"
FT                   /locus_tag="mCG_5750"
FT                   /product="translocase of inner mitochondrial membrane 9
FT                   homolog (yeast), transcript variant mCT4936"
FT                   /note="gene_id=mCG5750.2 transcript_id=mCT4936.1 created on
FT                   29-AUG-2002"
FT   mRNA            complement(join(46408510..46408810,46410586..46410681,
FT                   46411457..46411521,46417125..46417210,46417631..46417882,
FT                   46421679..>46421721))
FT                   /gene="Timm9"
FT                   /locus_tag="mCG_5750"
FT                   /product="translocase of inner mitochondrial membrane 9
FT                   homolog (yeast), transcript variant mCT172868"
FT                   /note="gene_id=mCG5750.2 transcript_id=mCT172868.0 created
FT                   on 29-AUG-2002"
FT   mRNA            complement(join(46408523..46408810,46410586..46410681,
FT                   46411457..46411521,46417125..46417210,46417631..46417766,
FT                   46421679..>46421771))
FT                   /gene="Timm9"
FT                   /locus_tag="mCG_5750"
FT                   /product="translocase of inner mitochondrial membrane 9
FT                   homolog (yeast), transcript variant mCT172869"
FT                   /note="gene_id=mCG5750.2 transcript_id=mCT172869.0 created
FT                   on 29-AUG-2002"
FT   mRNA            complement(join(46408549..46408810,46410586..46410681,
FT                   46411457..46411521,46417125..46417210,46417631..46417922,
FT                   46421679..>46421734))
FT                   /gene="Timm9"
FT                   /locus_tag="mCG_5750"
FT                   /product="translocase of inner mitochondrial membrane 9
FT                   homolog (yeast), transcript variant mCT172867"
FT                   /note="gene_id=mCG5750.2 transcript_id=mCT172867.0 created
FT                   on 29-AUG-2002"
FT   CDS             complement(join(46408676..46408810,46410586..46410681,
FT                   46411457..>46411501))
FT                   /codon_start=1
FT                   /gene="Timm9"
FT                   /locus_tag="mCG_5750"
FT                   /product="translocase of inner mitochondrial membrane 9
FT                   homolog (yeast), isoform CRA_a"
FT                   /note="gene_id=mCG5750.2 transcript_id=mCT172867.0
FT                   protein_id=mCP95786.0 isoform=CRA_a"
FT                   /protein_id="EDL36554.1"
FT                   /translation="KNMAAQIPESDQIKQFKEFLGTYNKLTETCFLDCVKDFTTREVKP
FT                   EEVTCSEHCLQKYLKMTQRISVRFQEYHIQQNEALAAKAGLLGQPR"
FT   CDS             complement(join(46408676..46408810,46410586..46410681,
FT                   46411457..>46411501))
FT                   /codon_start=1
FT                   /gene="Timm9"
FT                   /locus_tag="mCG_5750"
FT                   /product="translocase of inner mitochondrial membrane 9
FT                   homolog (yeast), isoform CRA_a"
FT                   /note="gene_id=mCG5750.2 transcript_id=mCT172868.0
FT                   protein_id=mCP95788.0 isoform=CRA_a"
FT                   /protein_id="EDL36555.1"
FT                   /translation="KNMAAQIPESDQIKQFKEFLGTYNKLTETCFLDCVKDFTTREVKP
FT                   EEVTCSEHCLQKYLKMTQRISVRFQEYHIQQNEALAAKAGLLGQPR"
FT   CDS             complement(join(46408676..46408810,46410586..46410681,
FT                   46411457..>46411501))
FT                   /codon_start=1
FT                   /gene="Timm9"
FT                   /locus_tag="mCG_5750"
FT                   /product="translocase of inner mitochondrial membrane 9
FT                   homolog (yeast), isoform CRA_a"
FT                   /note="gene_id=mCG5750.2 transcript_id=mCT172869.0
FT                   protein_id=mCP95789.0 isoform=CRA_a"
FT                   /protein_id="EDL36556.1"
FT                   /translation="KNMAAQIPESDQIKQFKEFLGTYNKLTETCFLDCVKDFTTREVKP
FT                   EEVTCSEHCLQKYLKMTQRISVRFQEYHIQQNEALAAKAGLLGQPR"
FT   CDS             complement(join(46408676..46408810,46410586..46410681,
FT                   46411457..>46411501))
FT                   /codon_start=1
FT                   /gene="Timm9"
FT                   /locus_tag="mCG_5750"
FT                   /product="translocase of inner mitochondrial membrane 9
FT                   homolog (yeast), isoform CRA_a"
FT                   /note="gene_id=mCG5750.2 transcript_id=mCT4936.1
FT                   protein_id=mCP3222.0 isoform=CRA_a"
FT                   /protein_id="EDL36558.1"
FT                   /translation="KNMAAQIPESDQIKQFKEFLGTYNKLTETCFLDCVKDFTTREVKP
FT                   EEVTCSEHCLQKYLKMTQRISVRFQEYHIQQNEALAAKAGLLGQPR"
FT   gene            <46421972..46528927
FT                   /locus_tag="mCG_5765"
FT                   /note="gene_id=mCG5765.2"
FT   mRNA            join(<46421972..46423160,46424777..46424850,
FT                   46425987..46426056,46427172..46427241,46433366..46433540,
FT                   46435367..46435588,46437774..46437921,46439882..46440043,
FT                   46442168..46442291,46443949..46444078,46445312..46445529,
FT                   46446242..46446314,46447694..46447918,46449502..46449676,
FT                   46452184..46452378,46455645..46455832,46458255..46458365,
FT                   46461049..46461129,46462953..46463146,46464164..46464282,
FT                   46470664..46470863,46473617..46473773,46474824..46475043,
FT                   46475643..46475890,46477131..46477201,46479503..46479625,
FT                   46480282..46480456,46501652..46501806,46504801..46504909,
FT                   46528570..46528927)
FT                   /locus_tag="mCG_5765"
FT                   /product="mCG5765, transcript variant mCT193457"
FT                   /note="gene_id=mCG5765.2 transcript_id=mCT193457.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(<46422343..46423160,46427172..46427241,
FT                   46433366..46433540,46435367..46435588,46437774..46437921,
FT                   46439882..46440043,46442168..46442291,46443949..46444078,
FT                   46445312..46445529,46446242..46446314,46447694..46447876,
FT                   46449502..46449676,46452184..46452378,46455645..46455832,
FT                   46458255..46458365,46461049..46461129,46462953..46463146,
FT                   46464164..46464282,46470670..46470863,46473617..46473773,
FT                   46474824..46475043,46475643..46475890,46477131..46477201,
FT                   46479503..46479625,46480282..46480456,46501652..46501806,
FT                   46504801..46504909,46528570..46528924)
FT                   /locus_tag="mCG_5765"
FT                   /product="mCG5765, transcript variant mCT4920"
FT                   /note="gene_id=mCG5765.2 transcript_id=mCT4920.1 created on
FT                   04-SEP-2002"
FT   CDS             join(<46422947..46423160,46424777..46424850,
FT                   46425987..46426056,46427172..46427241,46433366..46433540,
FT                   46435367..46435588,46437774..46437921,46439882..46440043,
FT                   46442168..46442291,46443949..46444078,46445312..46445529,
FT                   46446242..46446314,46447694..46447918,46449502..46449676,
FT                   46452184..46452378,46455645..46455832,46458255..46458365,
FT                   46461049..46461129,46462953..46463146,46464164..46464282,
FT                   46470664..46470863,46473617..46473773,46474824..46475043,
FT                   46475643..46475890,46477131..46477201,46479503..46479625,
FT                   46480282..46480456,46501652..46501806,46504801..46504909,
FT                   46528570..46528721)
FT                   /codon_start=1
FT                   /locus_tag="mCG_5765"
FT                   /product="mCG5765, isoform CRA_a"
FT                   /note="gene_id=mCG5765.2 transcript_id=mCT193457.0
FT                   protein_id=mCP114436.0 isoform=CRA_a"
FT                   /protein_id="EDL36552.1"
FT                   /translation="FVTNQMKNVEFSLERGQRLKMPARKLREIVSPNQGNKLAVVEDEL
FT                   PRVPPALAANKRLAVETRTSSNGTLCGSLDLTSARLYHQPLLESPPASKKSDFSKDAVV
FT                   RQLPLNKTEENNAPKANDIFISQYTMGQKDALRTVLKQKAQSMPVFKAVKVHLFEDTST
FT                   EKNTVAQETETPPNRIDSATTVAAATAAAIATAAPLIKVQSDLEAKVNCVGELLTKLQE
FT                   TDKQLQRVTEHQASVQSKQEKVHCHDHDKQMNAFMEQHIRHLEKLQQQQIDIQTHFIDA
FT                   ALKASSLQLGMSTSRAVGKYSGKLGSPSVGSSVFSHNTFVSKRVPLSEDTDFDGQKSPL
FT                   ETPAPRRFAPVPVSRDGKITKRESPTEEKENMEMNSPKGNVRLLEQVLNSNECLTRKTE
FT                   SSDITSLTQPKMGWNLEKRDSTETLHSQIFPSSEERGTAQVPVPKYNDVVHDLGQKKQA
FT                   SDMLQIKQSPVTLRLSDHPHNPALLQTTNTRSVLKDAAKILRGVQNNKKVLEENLEAIV
FT                   RAKDGAAMYSFINALATNREMSEKIRIRKQVDEWIKIISAEIQDELMRKDYEQKRFDPK
FT                   NQRNKKALTMSRDIKANNQEKTVNRSVIPRSHYQKQTQEQFTSPPVRNLPASGPQKERS
FT                   GLLKSATTLQDEDYMLQIYGKPVYQGHRSTLKKGPYLRFSSPSPKAKPQRPRVIELVKG
FT                   TKVKSAKTQTDFHAASRMKMDSKIQHPITALPHADQQYMVSPSREMPTVSGTLEGHLIP
FT                   MAILLGQTQSNSDSMPPAGVTVNKPRPVTVTTSIPPASRKGNAGVKKPNVAIVEMKSEK
FT                   KDPPQLSVQILPSVDIDSVSYSSTDGASSPPSPKEASLPPLHTWIQTPDFMKVDEEEVP
FT                   LPGTNFDEVIDVIQEEEKRDEIPECSAPMLEFNRSVKVVPTKYNGPSFPPVVSAYHPTT
FT                   DILDKVIERKETLENSLIQWVEQEIMSRIISGLFPLQQQARLDASVSVSEASEPSASDI
FT                   VAGTSSGALQRMVDARVPVNSDMVSHFVNEALTETIAVMLADREAERQRAAATSVPGDL
FT                   SGTETNLLARVCAPVATPQPTPPCSPSPVREHVRVKTPDSSPCESDPDAASSIKEIRVE
FT                   KGSDMPAVMLVSTPTRTPVATPPPAAALTPTLSETSIDKLKLSSPELPKPWDSGDLPLD
FT                   EENPNSLQELPHPRAVVMSVANEEPESVDFSAQPAPPEPAPSAPLPEGTKAPSLQRVPS
FT                   SGSSTLENTLSTVTETETLDRHISEGEILFSCGQNLATKRPGDLFLMNINDSLSSTLQD
FT                   ALEMEDDPPSEGQVIRRPHKKRHEDAIVALLTKQQRELLVSQQEEDLDNSVGELSEGQR
FT                   LVLKAAEDISAGPSGQMLPPTSPAEPSYQHADPRLVLQQSDMASGNICEDLCASHGPMS
FT                   LRELELQPDSNLILPITHTTTAVSDGNLPEAAEDFSQYQQKQDSDIKQVEHKPIQRHLT
FT                   SVRNKPDSTLSQHQGGPADLLLIAHVSPARMSVTLPSANLEDCSQSLSTSSMHGGTESS
FT                   GTDTF"
FT   CDS             join(<46422947..46423160,46427172..46427241,
FT                   46433366..46433540,46435367..46435588,46437774..46437921,
FT                   46439882..46440043,46442168..46442291,46443949..46444078,
FT                   46445312..46445529,46446242..46446314,46447694..46447876,
FT                   46449502..46449676,46452184..46452378,46455645..46455832,
FT                   46458255..46458365,46461049..46461129,46462953..46463146,
FT                   46464164..46464282,46470670..46470863,46473617..46473773,
FT                   46474824..46475043,46475643..46475890,46477131..46477201,
FT                   46479503..46479625,46480282..46480456,46501652..46501806,
FT                   46504801..46504909,46528570..46528721)
FT                   /codon_start=1
FT                   /locus_tag="mCG_5765"
FT                   /product="mCG5765, isoform CRA_b"
FT                   /note="gene_id=mCG5765.2 transcript_id=mCT4920.1
FT                   protein_id=mCP3250.1 isoform=CRA_b"
FT                   /protein_id="EDL36553.1"
FT                   /translation="FVTNQMKNVEFSLERGQRLKMPARKLREIVSPNQGNKLAVVEDEL
FT                   PRVPPALAANKRLAVETRTSSNGTLCANDIFISQYTMGQKDALRTVLKQKAQSMPVFKA
FT                   VKVHLFEDTSTEKNTVAQETETPPNRIDSATTVAAATAAAIATAAPLIKVQSDLEAKVN
FT                   CVGELLTKLQETDKQLQRVTEHQASVQSKQEKVHCHDHDKQMNAFMEQHIRHLEKLQQQ
FT                   QIDIQTHFIDAALKASSLQLGMSTSRAVGKYSGKLGSPSVGSSVFSHNTFVSKRVPLSE
FT                   DTDFDGQKSPLETPAPRRFAPVPVSRDGKITKRESPTEEKENMEMNSPKGNVRLLEQVL
FT                   NSNECLTRKTESSDITSLTQPKMGWNLEKRDSTETLHSQIFPSSEERGTAQVPVPKYND
FT                   VVHDLGQKKQASDMLQIKQSPVTLRLSDHPHNPALLQTTNTRSVLKDAAKILRGVQNNK
FT                   KVLEENLEAIVRAKDGAAMYSFINALATNREMSEKIRIRKQVDEWIKIISAEIQDELMR
FT                   KDYEQKRFDPKNQRNKKALTMSRDIKANNQEKTVNRSVIPRSHYQKQTQEQFTSPPGLL
FT                   KSATTLQDEDYMLQIYGKPVYQGHRSTLKKGPYLRFSSPSPKAKPQRPRVIELVKGTKV
FT                   KSAKTQTDFHAASRMKMDSKIQHPITALPHADQQYMVSPSREMPTVSGTLEGHLIPMAI
FT                   LLGQTQSNSDSMPPAGVTVNKPRPVTVTTSIPPASRKGNAGVKKPNVAIVEMKSEKKDP
FT                   PQLSVQILPSVDIDSVSYSSTDGASSPPSPKEASLPPLHTWIQTPDFMKVDEEEVPLPG
FT                   TNFDEVIDVIQEEEKRDEIPECSAPMLEFNRSVKVVPTKYNGPSFPPVVSAYHPTTDIL
FT                   DKVIERKETLENSLIQWVEQEIMSRIISGLFPLQQQARLDASVSVSEASEPSASDIGTS
FT                   SGALQRMVDARVPVNSDMVSHFVNEALTETIAVMLADREAERQRAAATSVPGDLSGTET
FT                   NLLARVCAPVATPQPTPPCSPSPVREHVRVKTPDSSPCESDPDAASSIKEIRVEKGSDM
FT                   PAVMLVSTPTRTPVATPPPAAALTPTLSETSIDKLKLSSPELPKPWDSGDLPLDEENPN
FT                   SLQELPHPRAVVMSVANEEPESVDFSAQPAPPEPAPSAPLPEGTKAPSLQRVPSSGSST
FT                   LENTLSTVTETETLDRHISEGEILFSCGQNLATKRPGDLFLMNINDSLSSTLQDALEME
FT                   DDPPSEGQVIRRPHKKRHEDAIVALLTKQQRELLVSQQEEDLDNSVGELSEGQRLVLKA
FT                   AEDISAGPSGQMLPPTSPAEPSYQHADPRLVLQQSDMASGNICEDLCASHGPMSLRELE
FT                   LQPDSNLILPITHTTTAVSDGNLPEAAEDFSQYQQKQDSDIKQVEHKPIQRHLTSVRNK
FT                   PDSTLSQHQGGPADLLLIAHVSPARMSVTLPSANLEDCSQSLSTSSMHGGTESSGTDTF
FT                   "
FT   gene            complement(<46554578..>46556001)
FT                   /locus_tag="mCG_5762"
FT                   /note="gene_id=mCG5762.0"
FT   mRNA            complement(join(<46554578..46554783,46555319..46555690,
FT                   46555731..>46556001))
FT                   /locus_tag="mCG_5762"
FT                   /product="mCG5762"
FT                   /note="gene_id=mCG5762.0 transcript_id=mCT4922.0 created on
FT                   04-SEP-2002"
FT   CDS             complement(join(46554578..46554783,46555319..46555690,
FT                   46555731..46556001))
FT                   /codon_start=1
FT                   /locus_tag="mCG_5762"
FT                   /product="mCG5762"
FT                   /note="gene_id=mCG5762.0 transcript_id=mCT4922.0
FT                   protein_id=mCP3184.0"
FT                   /protein_id="EDL36551.1"
FT                   /translation="MNGNQKLDVYNQEKQNFIQHFSQIIKVLTEDELGHPETGDAITRL
FT                   KEVLEYSAVGGKYNRGFDVVQAFQELVKPRKKDAESLQPALTVGWYDIMDSSLTCGGEG
FT                   EGADLLVSEAGIGLDAINDALLLEASIYRLLKFYCREQPYYLNLLELFLQSSFQTEMGQ
FT                   TLDLITASQGHVDLGRYTEKRYKSIVKYKTAFCSFYLPIAVAMYIDGGEGPAGACQCPE
FT                   DPTGDGQILQVRDNYLDLFGDLSVIGKVGIGIQDNKCSLADVLVSAKSHSLTAPDLRGE
FT                   L"
FT   gene            <46595747..46605833
FT                   /gene="Dact1"
FT                   /locus_tag="mCG_5763"
FT                   /note="gene_id=mCG5763.2"
FT   mRNA            join(<46595747..46596013,46598391..46598523,
FT                   46599490..46599645,46602913..46605833)
FT                   /gene="Dact1"
FT                   /locus_tag="mCG_5763"
FT                   /product="dapper homolog 1, antagonist of beta-catenin
FT                   (xenopus)"
FT                   /note="gene_id=mCG5763.2 transcript_id=mCT4918.2 created on
FT                   29-AUG-2002"
FT   CDS             join(<46599597..46599645,46602913..46604636)
FT                   /codon_start=1
FT                   /gene="Dact1"
FT                   /locus_tag="mCG_5763"
FT                   /product="dapper homolog 1, antagonist of beta-catenin
FT                   (xenopus)"
FT                   /note="gene_id=mCG5763.2 transcript_id=mCT4918.2
FT                   protein_id=mCP3218.1"
FT                   /protein_id="EDL36550.1"
FT                   /translation="PLEAALTISDGCPKSADVNPKYQCDLVSKNGNDVYRYPSPLHAVA
FT                   VQSPMFLLCLTGNTLREEEGLGSHASDICIGSELNATKTDNSLPSPSSLWSASHPASSK
FT                   KMDGYILSLVQKKTHPVRTNKPRTSVNADPTKGLLRNGSVCVRAPSGVPPGSSVNFKNT
FT                   KQMCLPAGGITSLENGPFSPPKQRSKDSKTDQLESKRLALPESCSAGAAMEPQSKHVPK
FT                   AAKAASQELTRCQAGLGESMKESNQASAVSPKTSPGRGPVAPAESKALQLPKKMSQKNS
FT                   LQAVPALDRPALDFKSEGSSQSLEEGHLVKAQFIPGQQAAARPHRAHRNPGVARSATLK
FT                   ARGQAAMEHGLPTVREKPRAAGKKCRFPDDSDTNKKFRKTSAKGRRSGGLQDAGLPGRA
FT                   LGTGGHRAGSRAHAHGREPVVAKPKHKRTDYRRWKSSAEVSYEEALRRARRARREHGAA
FT                   YRVAVALPYASPYAYVPSDSEYSAECESLFHSTVVDTSEDEQSNYTTNCFGDSESSVSE
FT                   GDFVGESTTTSDSEESGGLIWSQFVQTLPIQTVTAPDLHTRPTKTFVKIKASHNLKKKI
FT                   LRFRSGSLKLMTTV"
FT   gene            complement(46603363..46610981)
FT                   /locus_tag="mCG_1051102"
FT                   /note="gene_id=mCG1051102.0"
FT   mRNA            complement(join(46603363..46604675,46608614..46608691,
FT                   46610783..46610981))
FT                   /locus_tag="mCG_1051102"
FT                   /product="mCG1051102"
FT                   /note="gene_id=mCG1051102.0 transcript_id=mCT194891.0
FT                   created on 27-JAN-2005"
FT   CDS             complement(46603761..46604105)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1051102"
FT                   /product="mCG1051102"
FT                   /note="gene_id=mCG1051102.0 transcript_id=mCT194891.0
FT                   protein_id=mCP115920.0"
FT                   /protein_id="EDL36549.1"
FT                   /translation="MRVRPATRPMAAGAQGPTGKASVLQPATAPALGGGLPEFLICIRV
FT                   VWETALLACCPRFLPDGGQAVFHGCLAAGLQGGAPCDTRVPVCTVRPGGRLLPRNELSF
FT                   HQMPFLEALR"
FT   gene            <46720658..>46763820
FT                   /locus_tag="mCG_1041561"
FT                   /note="gene_id=mCG1041561.0"
FT   mRNA            join(<46720658..46720727,46721053..46721153,
FT                   46724046..46724147,46724418..46724442,46725604..46725744,
FT                   46728622..46728728,46731036..46731122,46737089..46737202,
FT                   46750301..46750578,46753852..46753948,46755049..46755184,
FT                   46763546..>46763820)
FT                   /locus_tag="mCG_1041561"
FT                   /product="mCG1041561"
FT                   /note="gene_id=mCG1041561.0 transcript_id=mCT159265.0
FT                   created on 12-SEP-2002"
FT   CDS             join(46720658..46720727,46721053..46721153,
FT                   46724046..46724147,46724418..46724442,46725604..46725744,
FT                   46728622..46728728,46731036..46731122,46737089..46737202,
FT                   46750301..46750578,46753852..46753948,46755049..46755184,
FT                   46763546..46763820)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041561"
FT                   /product="mCG1041561"
FT                   /note="gene_id=mCG1041561.0 transcript_id=mCT159265.0
FT                   protein_id=mCP78795.0"
FT                   /protein_id="EDL36548.1"
FT                   /translation="MQLTQGEKPLEQREGHQRVKGKKGRYFINDALSNCFLFTYKMVTN
FT                   KTAIALQAEQAESLEERADNDFGHQLVPHPSLPVTLLQLCCEIKLQGVHKPGQARLNRV
FT                   SQCLVQHICSQWGSRANRRRGLIRSKKSGRCVSLSGAAHVAPGSAVQAAVHSDIAMCIC
FT                   KACVIETLGFSSGLKQSQQNRYSWKPRKVTQPLRIMTQTGLALDVSCKMQKWPLERKLW
FT                   SLTTRTFDTNYLEESKQPMERLRKNEPGNRDHTTYLTLSASISLMEISVTPGGQRIIMA
FT                   WGRRLSALHLTVVNNYMTFNPFIMYFQLMSTSSSQIPQKAGVVVPSLQVEILTLRVVHW
FT                   LVNGNSELQKLARVREKLASDSVTGSRGFKDITERIDSGALWLPCQLLFVDGFSGVCVH
FT                   VSGLQVLVVIHLQMSPVWPDEFKVQFRLNQGVDGGPDAFDKPLEVAEWSTERCFQHCEH
FT                   AQVKADGSKAESDAKRKGKKTKPLQGKLCVDLPPCAGDHLKTLSSIVPLDLV"
FT   gene            46835807..46851306
FT                   /locus_tag="mCG_1041734"
FT                   /note="gene_id=mCG1041734.0"
FT   mRNA            join(46835807..46835956,46837310..46837439,
FT                   46850820..46851306)
FT                   /locus_tag="mCG_1041734"
FT                   /product="mCG1041734"
FT                   /note="gene_id=mCG1041734.0 transcript_id=mCT159438.0
FT                   created on 18-SEP-2002"
FT   CDS             join(46835837..46835956,46837310..46837435)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041734"
FT                   /product="mCG1041734"
FT                   /note="gene_id=mCG1041734.0 transcript_id=mCT159438.0
FT                   protein_id=mCP78990.1"
FT                   /protein_id="EDL36547.1"
FT                   /translation="MDVCGDKLYSSLSQIFAVSSSETHMNPAFNYHLHENATSHASFFL
FT                   AVLMVRSSWHLSCCGTPKLKHSLLGQGRGAQEDSRS"
FT   gene            46873126..46881981
FT                   /locus_tag="mCG_148272"
FT                   /note="gene_id=mCG148272.0"
FT   mRNA            join(46873126..46873308,46879819..46881981)
FT                   /locus_tag="mCG_148272"
FT                   /product="mCG148272"
FT                   /note="gene_id=mCG148272.0 transcript_id=mCT188535.0
FT                   created on 13-JAN-2004"
FT   CDS             46881482..46881745
FT                   /codon_start=1
FT                   /locus_tag="mCG_148272"
FT                   /product="mCG148272"
FT                   /note="gene_id=mCG148272.0 transcript_id=mCT188535.0
FT                   protein_id=mCP108107.0"
FT                   /protein_id="EDL36546.1"
FT                   /translation="MIPSILVFFLRTTCLFRVLMALVIFFNLFPVCVEKAIVTLTELSL
FT                   TLHVSLVRMAMLTILAFCFTARDVVQFTCVVNVFIDVSITDL"
FT   gene            complement(47144764..47146009)
FT                   /pseudo
FT                   /locus_tag="mCG_16448"
FT                   /note="gene_id=mCG16448.2"
FT   mRNA            complement(47144764..47146009)
FT                   /pseudo
FT                   /locus_tag="mCG_16448"
FT                   /note="gene_id=mCG16448.2 transcript_id=mCT17761.2 created
FT                   on 26-JUN-2003"
FT   gene            47188256..47287321
FT                   /gene="Daam1"
FT                   /locus_tag="mCG_16444"
FT                   /note="gene_id=mCG16444.2"
FT   mRNA            join(47188256..47188553,47194439..47194658,
FT                   47214406..47214495,47235451..47235522,47241067..47241161,
FT                   47242950..47243283,47244080..47244190,47244294..47244397,
FT                   47245124..47245190,47245411..47245528,47245895..47246033,
FT                   47246289..47246347,47250089..47250276,47251367..47251474,
FT                   47258715..47258821,47265290..47265374,47269382..47269488,
FT                   47270988..47271076,47271835..47272003,47274946..47275053,
FT                   47277638..47277698,47280628..47280759,47283831..47284001,
FT                   47284623..47287321)
FT                   /gene="Daam1"
FT                   /locus_tag="mCG_16444"
FT                   /product="dishevelled associated activator of morphogenesis
FT                   1"
FT                   /note="gene_id=mCG16444.2 transcript_id=mCT171385.0 created
FT                   on 19-JUN-2003"
FT   CDS             join(47194476..47194658,47214406..47214495,
FT                   47235451..47235522,47241067..47241161,47242950..47243283,
FT                   47244080..47244190,47244294..47244397,47245124..47245190,
FT                   47245411..47245528,47245895..47246033,47246289..47246347,
FT                   47250089..47250276,47251367..47251474,47258715..47258821,
FT                   47265290..47265374,47269382..47269488,47270988..47271076,
FT                   47271835..47272003,47274946..47275053,47277638..47277698,
FT                   47280628..47280759,47283831..47284001,47284623..47284832)
FT                   /codon_start=1
FT                   /gene="Daam1"
FT                   /locus_tag="mCG_16444"
FT                   /product="dishevelled associated activator of morphogenesis
FT                   1"
FT                   /note="gene_id=mCG16444.2 transcript_id=mCT171385.0
FT                   protein_id=mCP94304.0"
FT                   /protein_id="EDL36545.1"
FT                   /translation="MAPRKRGGRGISFIFCCFRNNDHPEITYRLRNDSNFALQTMEPAL
FT                   PMPPVEELDVMFSELVDELDLTDKHREAMFALPAEKKWQIYCSKKKDQEENKGATSWPE
FT                   FYIDQLNSMAARKSLLALEKEEEEERSKTIESLKTALRTKPMRFVTRFIDLDGLSCILN
FT                   FLKTMDYETSESRIHTSLIGCIKALMNNSQGRAHVLAHSESINVIAQSLSTENIKTKVA
FT                   VLEILGAVCLVPGGHKKVLQAMLHYQKYASERTRFQTLINDLDKSTGRYRDEVSLKTAI
FT                   MSFINAVLSQGAGVESLDFRLHLRYEFLMLGIQPVIDKLREHENSTLDRHLDFFEMLRN
FT                   EDELEFAKRFELVHIDTKSATQMFELTRRRLTHSEAYPHFMSILHHCLQMPYKRSGNTV
FT                   QYWLLLDRIIQQIVIQNDKGQDPDSTPLENFNIKNVVRMLVNENEVKQWKEQAEKMRKE
FT                   HNELQQKLEKKERECDAKTQEKEEMMQTLNKMKEKLEKETTEHKQVKQQVADLTAQLHE
FT                   LNRNKLDGTVWTEIDDTKVFKILDLEDLERTFSAYQRQQKEADAIDDTLSSKLKVKELS
FT                   VIDGRRAQNCNILLSRLKLSNDEIKRAILTMDEQEDLPKDMLEQLLKFVPEKSDIDLLE
FT                   EHKHELDRMAKADRFLFEMSRINHYQQRLQSLYFKKKFAERVAEVKPKVEAIRSGSEEV
FT                   FRSRALKQLLEVVLAFGNYMNKGQRGNAYGFKISSLNKIADTKSSIDKNITLLHYLITI
FT                   VENKYPKVLNLSEELRDIPQAAKVNMTELDKEISTLRSGLKAVETELEYQKSQPPQPGD
FT                   KFVSVVSQFITLASFSFSDVEDLLAEAKELFTKAVKHFGEEAGKIQPDEFFGIFDQFLQ
FT                   AVAEAKQENENMRKRKEEEERRARLEAQLKEQRERERKVRKAKESSEESGEFDDLVSAL
FT                   RSGEVFDKDLSKLKRNRKRISNQVTDSSRERPITKLNF"
FT   gene            complement(47365516..47367233)
FT                   /gene="Gpr135"
FT                   /locus_tag="mCG_49112"
FT                   /note="gene_id=mCG49112.2"
FT   mRNA            complement(47365516..47367233)
FT                   /gene="Gpr135"
FT                   /locus_tag="mCG_49112"
FT                   /product="G protein-coupled receptor 135"
FT                   /note="gene_id=mCG49112.2 transcript_id=mCT49295.2 created
FT                   on 12-SEP-2002"
FT   CDS             complement(47365725..47367098)
FT                   /codon_start=1
FT                   /gene="Gpr135"
FT                   /locus_tag="mCG_49112"
FT                   /product="G protein-coupled receptor 135"
FT                   /note="gene_id=mCG49112.2 transcript_id=mCT49295.2
FT                   protein_id=mCP26319.2"
FT                   /db_xref="GOA:A7E1Z8"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:2676315"
FT                   /db_xref="UniProtKB/TrEMBL:A7E1Z8"
FT                   /protein_id="EDL36544.1"
FT                   /translation="MEEQARPPGRPAASATLQGSAHPGGAASTATAAALSFSSVATVTL
FT                   GNQSDAGRPEAAGSRGPAPLLWHGAAVAAQALVLLLIFLLSSLGNCAVMGVIVKHRQLR
FT                   TVTNAFILSLSLSDLLTALLCLPAAFLDLFAPPGDSGPWRSFCAASRFFSSCFGIVSTF
FT                   SVALISLDRYCAIVRPPRDKLGRRRALQLLAGAWLAALGFSLPWDLLRAPREPPAPQSF
FT                   HRCLYRTSPDPAQLGVAYSVGLVVACYLLPFLLMCFCRYHICKTVRLSDVRVRPMTTYA
FT                   RVLRFFSEVRTATTVLIMIIFVMCCWGPYCFLVLLAATRQGQATQAPSLLNVAAVWLTW
FT                   ANGAINPVIYAIRNPNISMLLGRNREEGYRTRNMDAFLPSQGLGFQARSRNRLRNGCAN
FT                   RLGACSRMPSSNPASGSGGEVVMWARKNPVVLFFREGPPDSVMEVGKLHNSETRDSSI"
FT   gene            complement(47369538..>47381547)
FT                   /gene="2810055F11Rik"
FT                   /locus_tag="mCG_16445"
FT                   /note="gene_id=mCG16445.1"
FT   mRNA            complement(join(47369538..47370143,47373251..47373388,
FT                   47373471..47373593,47375594..47375763,47380755..>47381547))
FT                   /gene="2810055F11Rik"
FT                   /locus_tag="mCG_16445"
FT                   /product="RIKEN cDNA 2810055F11"
FT                   /note="gene_id=mCG16445.1 transcript_id=mCT17758.1 created
FT                   on 04-SEP-2002"
FT   CDS             complement(join(47370018..47370143,47373251..47373388,
FT                   47373471..47373593,47375594..47375763,47380755..>47381433))
FT                   /codon_start=1
FT                   /gene="2810055F11Rik"
FT                   /locus_tag="mCG_16445"
FT                   /product="RIKEN cDNA 2810055F11"
FT                   /note="gene_id=mCG16445.1 transcript_id=mCT17758.1
FT                   protein_id=mCP3270.0"
FT                   /protein_id="EDL36543.1"
FT                   /translation="LGRAQSKIPDAGRWVISARRLGPEIATGSARSPVGFGAFSLLGES
FT                   TTALCGSPWTQTMEAALAVTRLPPNDPRTPALSVVDMHTGGEPLRIVHAGCPEVAGPTL
FT                   LAKRRYMRQHLDYIRRRLVFEPRGHRDMYGAILVPSELPDAHLGVLFLHNEGYSSMCGH
FT                   AVLALGRFALDFGLVPAPPKGAREAQVNIHCPCGLVTAFVECEGGRSCGPVRFHSVPAF
FT                   VLASDLTVDVPGHGKVLVDIAYGGAFYAFVSAEKLGLDVCSAKTRDLVDAASALTGAVK
FT                   AQFKINHPESEDLGFLYGSILTDGKDAYSEEATTNICVFADEQVDRSPTGSGVTARIAL
FT                   QYHKGLLQLNQTRAFKSSATGSVFTGCAVREAKCGDFKAVIVEVAGQAHYTGTANLTVE
FT                   DGDPLRDGFLLK"
FT   gene            <47381974..47396928
FT                   /gene="1200003C05Rik"
FT                   /locus_tag="mCG_16450"
FT                   /note="gene_id=mCG16450.2"
FT   mRNA            join(<47381974..47382271,47385421..47385494,
FT                   47386044..47386198,47390025..47390231,47390774..47390955,
FT                   47396135..47396211,47396698..47396928)
FT                   /gene="1200003C05Rik"
FT                   /locus_tag="mCG_16450"
FT                   /product="RIKEN cDNA 1200003C05, transcript variant
FT                   mCT17763"
FT                   /note="gene_id=mCG16450.2 transcript_id=mCT17763.2 created
FT                   on 04-SEP-2002"
FT   mRNA            join(<47382211..47382271,47385403..47385494,
FT                   47386044..47386198,47390025..47390231,47390774..47390955,
FT                   47396135..47396211,47396698..47396928)
FT                   /gene="1200003C05Rik"
FT                   /locus_tag="mCG_16450"
FT                   /product="RIKEN cDNA 1200003C05, transcript variant
FT                   mCT193478"
FT                   /note="gene_id=mCG16450.2 transcript_id=mCT193478.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<47382235..47382271,47385403..47385494,
FT                   47386044..47386198,47390025..47390231,47390774..47390955,
FT                   47396135..47396211,47396698..47396916)
FT                   /codon_start=1
FT                   /gene="1200003C05Rik"
FT                   /locus_tag="mCG_16450"
FT                   /product="RIKEN cDNA 1200003C05, isoform CRA_b"
FT                   /note="gene_id=mCG16450.2 transcript_id=mCT193478.0
FT                   protein_id=mCP114459.0 isoform=CRA_b"
FT                   /protein_id="EDL36542.1"
FT                   /translation="SPASQGNLVWPMAVDIQPACLGLYCGKTLLFKNGSSEIYGECGVC
FT                   PRGQRTNAQKYCQPCTESPELYDWLYLGFMAMLPLVLHWFFIEWYSGKKSSSALFQHIT
FT                   ALFECTMAAIITLLVSDPVGVLYIRSCRVLMLSDWYTMLYNPSPDYVTTVHCTHEAVYP
FT                   LYTIVFVYYAFCLVLMMLLRPLLVKKIACGLGKSDRFKSIYAALYFFPILTVLQAVGGG
FT                   LLYYAFPYIILVLSLVTLAVYMSASEIENCYDLLVRKKRLIVLFSHWLLHAYGIVSISR
FT                   VDRLEHDLPLLALVPTPALFYLFTAKFTEPSRILSEGANGH"
FT   CDS             join(<47382235..47382271,47385421..47385494,
FT                   47386044..47386198,47390025..47390231,47390774..47390955,
FT                   47396135..47396211,47396698..47396916)
FT                   /codon_start=1
FT                   /gene="1200003C05Rik"
FT                   /locus_tag="mCG_16450"
FT                   /product="RIKEN cDNA 1200003C05, isoform CRA_a"
FT                   /note="gene_id=mCG16450.2 transcript_id=mCT17763.2
FT                   protein_id=mCP3146.2 isoform=CRA_a"
FT                   /protein_id="EDL36541.1"
FT                   /translation="SPASQGNLVWPMACLGLYCGKTLLFKNGSSEIYGECGVCPRGQRT
FT                   NAQKYCQPCTESPELYDWLYLGFMAMLPLVLHWFFIEWYSGKKSSSALFQHITALFECT
FT                   MAAIITLLVSDPVGVLYIRSCRVLMLSDWYTMLYNPSPDYVTTVHCTHEAVYPLYTIVF
FT                   VYYAFCLVLMMLLRPLLVKKIACGLGKSDRFKSIYAALYFFPILTVLQAVGGGLLYYAF
FT                   PYIILVLSLVTLAVYMSASEIENCYDLLVRKKRLIVLFSHWLLHAYGIVSISRVDRLEH
FT                   DLPLLALVPTPALFYLFTAKFTEPSRILSEGANGH"
FT   gene            complement(47396917..47405303)
FT                   /locus_tag="mCG_50922"
FT                   /note="gene_id=mCG50922.2"
FT   mRNA            complement(join(47396917..47397508,47398016..47398144,
FT                   47401892..47402075,47402742..47402785,47405162..47405303))
FT                   /locus_tag="mCG_50922"
FT                   /product="mCG50922"
FT                   /note="gene_id=mCG50922.2 transcript_id=mCT51105.2 created
FT                   on 04-SEP-2002"
FT   CDS             complement(join(47397495..47397508,47398016..47398144,
FT                   47401892..47402048))
FT                   /codon_start=1
FT                   /locus_tag="mCG_50922"
FT                   /product="mCG50922"
FT                   /note="gene_id=mCG50922.2 transcript_id=mCT51105.2
FT                   protein_id=mCP26352.2"
FT                   /protein_id="EDL36540.1"
FT                   /translation="MQEIKSLVAKLQYRDEKIESISTWLVGGFERLRRLMEEDSPASLS
FT                   KEDLQKLGKKQKNQEILRFSPSSHARRLTLSRICKMLKKQSRSRKKKHRPRTII"
FT   gene            complement(<47412498..>47413824)
FT                   /locus_tag="mCG_1041560"
FT                   /note="gene_id=mCG1041560.0"
FT   mRNA            complement(join(<47412498..47412590,47412652..47412973,
FT                   47413744..>47413824))
FT                   /locus_tag="mCG_1041560"
FT                   /product="mCG1041560"
FT                   /note="gene_id=mCG1041560.0 transcript_id=mCT159264.0
FT                   created on 12-SEP-2002"
FT   CDS             complement(join(47412498..47412590,47412652..47412973,
FT                   47413744..>47413823))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041560"
FT                   /product="mCG1041560"
FT                   /note="gene_id=mCG1041560.0 transcript_id=mCT159264.0
FT                   protein_id=mCP78786.0"
FT                   /protein_id="EDL36539.1"
FT                   /translation="TKKRMKATLSELNKQQFLYSESLTKERICVLLQQCLDRTDGGLPL
FT                   SFQLPYKSLQSPQPPGPSPCRLQLLGPVSSVSSPLAPYPKAAMTSQICQNYFTEVEAAV
FT                   SCLVSLHLRASYTYFSRGFYFDRNDLTLQGLQNNRGRGRALFRDVQKPSQDGGREGERR
FT                   G"
FT   gene            complement(<47418229..>47483302)
FT                   /locus_tag="mCG_16446"
FT                   /note="gene_id=mCG16446.1"
FT   mRNA            complement(join(<47418229..47418474,47458036..47458264,
FT                   47473341..47473476,47476812..47476923,47479050..47479135,
FT                   47483110..>47483302))
FT                   /locus_tag="mCG_16446"
FT                   /product="mCG16446"
FT                   /note="gene_id=mCG16446.1 transcript_id=mCT17759.1 created
FT                   on 04-SEP-2002"
FT   CDS             complement(join(47418229..47418474,47458036..47458264,
FT                   47473341..47473476,47476812..47476923,47479050..47479135,
FT                   47483110..>47483302))
FT                   /codon_start=1
FT                   /locus_tag="mCG_16446"
FT                   /product="mCG16446"
FT                   /note="gene_id=mCG16446.1 transcript_id=mCT17759.1
FT                   protein_id=mCP3276.1"
FT                   /protein_id="EDL36538.1"
FT                   /translation="SLRLVLTASTNKMAIRSWTPEGFVNKKLVRPASVSTNLSLELCTF
FT                   PTTLGSSVAANALEQLFVVEKSLQGDYFTCSEEVKTFLKDITVAVKKLEEMRKNTVELL
FT                   EIESMELSRLYFLLETVPNSIHRELEECIADARKLNIIEISQIKRKIETMNNEVKFLTN
FT                   KISELKSMNEVLGAKQAELAKRHEQYVLLLNQTLEEKAAATIYINDTYTRMNFEREEIE
FT                   LQKQCMQETTQLIEKQKQDYLEKKEYLAIRVCGKLFRHKSNLTEHKHFHSREKPSECNE
FT                   CGKAFSRTQYILKNQNTHTGEKLFECNDCGKSFSQKENLLTHQRIHTGEKTF"
FT   gene            complement(47510146..>47709356)
FT                   /gene="Rtn1"
FT                   /locus_tag="mCG_121605"
FT                   /note="gene_id=mCG121605.0"
FT   mRNA            complement(join(47510146..47510970,47515164..47515222,
FT                   47515308..47515354,47515812..47515881,47517650..47517788,
FT                   47521725..47521932,47604441..47605187,47608938..47609711,
FT                   47708966..>47709356))
FT                   /gene="Rtn1"
FT                   /locus_tag="mCG_121605"
FT                   /product="reticulon 1, transcript variant mCT122816"
FT                   /note="gene_id=mCG121605.0 transcript_id=mCT122816.0
FT                   created on 04-SEP-2002"
FT   mRNA            complement(join(47510672..47510970,47515164..47515222,
FT                   47515308..47515354,47515812..47515881,47517650..47517788,
FT                   47521725..47521932,47604441..47605202,47608938..47609711,
FT                   47708966..>47709206))
FT                   /gene="Rtn1"
FT                   /locus_tag="mCG_121605"
FT                   /product="reticulon 1, transcript variant mCT193463"
FT                   /note="gene_id=mCG121605.0 transcript_id=mCT193463.0
FT                   created on 09-MAR-2004"
FT   CDS             complement(join(47510928..47510970,47515164..47515222,
FT                   47515308..47515354,47515812..47515881,47517650..47517788,
FT                   47521725..47521932,47604441..47605187,47608938..47609711,
FT                   47708966..>47709293))
FT                   /codon_start=1
FT                   /gene="Rtn1"
FT                   /locus_tag="mCG_121605"
FT                   /product="reticulon 1, isoform CRA_b"
FT                   /note="gene_id=mCG121605.0 transcript_id=mCT122816.0
FT                   protein_id=mCP78733.0 isoform=CRA_b"
FT                   /protein_id="EDL36536.1"
FT                   /translation="GQQQGASASLASAPRPCQATVAQPGAQPAMAAPPDLQDEPLSLGS
FT                   PGSQWFGGRGDGEDEATAVMGARPAQQDGEPAWGSGAGAGVTSSRELCSGPARSPPVAM
FT                   ETASTGMAAVPDALDHSPSSTLKDGEGACYTSLISDVCYPPREDSAYFTGILQKENGHI
FT                   TTSESPEEPETPGPSLPEVPGMEPQGLLSSDSGIEMTPAESTEVNKILADPLDQMKAEA
FT                   YKYIDITRPQEAKGQEEQHPGLEDKDLDFKDKDTEVSTKAEGVRAPNQPAPVEGKLIKD
FT                   HLFEESTFAPYIDELSDEQHRVSLVTAPVKITLTEIEPPLMTATQETIPEKQDLCLKPS
FT                   PDTVPTVTVSEPEDDSPGSVTPPSSGTESQGKGSVSEDELIAAIKEAKGLSYETTESPR
FT                   PVGQVADKPKTKTRSGLPTIPSPLDQEASSAESGDSEIELVSEDPMASEDALPSGYVSF
FT                   GHVSGPPPSPASPSIQYSILREEREAELDSELIIESCDASSASEESPKREQDSPPMKPG
FT                   ALDAIREETGSRATEERAPSHQGPVEPDPMLSFAPAAALQSRPEPSSGDGASVPEPPRS
FT                   QQQKPEEEAVSSSQSPTATEIPGPLGSGLMPPLPFFNKQKAIDLLYWRDIKQTGIVFGS
FT                   FLLLLFSLTQFSVVSVVAYLALAALSATISFRIYKSVLQAVQKTDEGHPFKAYLELEIT
FT                   LSQEQIQKYTDCLQLYVNSTLKELRRLFLVQDLVDSLKFAVLMWLLTYVGALFNGLTLL
FT                   LMAVVSMFTLPVVYVKHQAQVDQYLGLVRTHINTVVAKIQAKIPGAKRHAE"
FT   CDS             complement(join(47510928..47510970,47515164..47515222,
FT                   47515308..47515354,47515812..47515881,47517650..47517788,
FT                   47521725..47521932,47604441..47605202,47608938..47609711,
FT                   47708966..47709206))
FT                   /codon_start=1
FT                   /gene="Rtn1"
FT                   /locus_tag="mCG_121605"
FT                   /product="reticulon 1, isoform CRA_a"
FT                   /note="gene_id=mCG121605.0 transcript_id=mCT193463.0
FT                   protein_id=mCP114398.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q4FJL2"
FT                   /db_xref="InterPro:IPR003388"
FT                   /db_xref="MGI:MGI:1933947"
FT                   /db_xref="UniProtKB/TrEMBL:Q4FJL2"
FT                   /protein_id="EDL36535.1"
FT                   /translation="MAAPPDLQDEPLSLGSPGSQWFGGRGDGEDEATAVMGARPAQQDG
FT                   EPAWGSGAGAGVTSSRELCSGPARSPPVAMETASTGMAAVPDALDHSPSSTLKDGEGAC
FT                   YTSLISDVCYPPREDSAYFTGILQKENGHITTSESPEEPETPGPSLPEVPGMEPQGLLS
FT                   SDSGIEMTPAESTEVNKILADPLDQMKAEAYKYIDITRPQEAKGQEEQHPGLEDKDLDF
FT                   KDKDTEVSTKAEGVRAPNQPAPVEGKLIKDHLFEESTFAPYIDELSDEQHRVSLVTAPV
FT                   KITLTEIEPPLMTATQETIPEKQDLCLKPSPDTVPTVTVSEPEDDSPGSVTPPSSGTEP
FT                   SAAESQGKGSVSEDELIAAIKEAKGLSYETTESPRPVGQVADKPKTKTRSGLPTIPSPL
FT                   DQEASSAESGDSEIELVSEDPMASEDALPSGYVSFGHVSGPPPSPASPSIQYSILREER
FT                   EAELDSELIIESCDASSASEESPKREQDSPPMKPGALDAIREETGSRATEERAPSHQGP
FT                   VEPDPMLSFAPAAALQSRPEPSSGDGASVPEPPRSQQQKPEEEAVSSSQSPTATEIPGP
FT                   LGSGLMPPLPFFNKQKAIDLLYWRDIKQTGIVFGSFLLLLFSLTQFSVVSVVAYLALAA
FT                   LSATISFRIYKSVLQAVQKTDEGHPFKAYLELEITLSQEQIQKYTDCLQLYVNSTLKEL
FT                   RRLFLVQDLVDSLKFAVLMWLLTYVGALFNGLTLLLMAVVSMFTLPVVYVKHQAQVDQY
FT                   LGLVRTHINTVVAKIQAKIPGAKRHAE"
FT   gene            47563839..47564623
FT                   /locus_tag="mCG_1041730"
FT                   /note="gene_id=mCG1041730.1"
FT   mRNA            join(47563839..47564358,47564414..47564623)
FT                   /locus_tag="mCG_1041730"
FT                   /product="mCG1041730"
FT                   /note="gene_id=mCG1041730.1 transcript_id=mCT159434.1
FT                   created on 18-SEP-2002"
FT   CDS             join(47564225..47564358,47564414..47564486)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041730"
FT                   /product="mCG1041730"
FT                   /note="gene_id=mCG1041730.1 transcript_id=mCT159434.1
FT                   protein_id=mCP78953.1"
FT                   /protein_id="EDL36537.1"
FT                   /translation="MYLNLPQSLGSMVNSKKHLTHVGSLSLGRERLDHKDNICMHGVDV
FT                   VHATVCIWRCECRSVHAIACIRR"
FT   gene            47742372..47811066
FT                   /gene="Lrrc9"
FT                   /locus_tag="mCG_16412"
FT                   /note="gene_id=mCG16412.2"
FT   mRNA            join(47742372..47742675,47749831..47749911,
FT                   47750198..47750416,47751227..47751367,47751775..47751838,
FT                   47752485..47752555,47754553..47754735,47756485..47756640,
FT                   47760335..47760516,47761293..47761424,47763827..47764003,
FT                   47764338..47764452,47767360..47767492,47769683..47769805,
FT                   47770737..47770840,47774311..47774523,47776557..47776676,
FT                   47777717..47777908,47779170..47779295,47781938..47782072,
FT                   47783404..47783581,47786681..47786901,47787505..47787627,
FT                   47796069..47796199,47797553..47797661,47798291..47798430,
FT                   47800083..47800219,47801230..47801447,47803961..47804029,
FT                   47806790..47806930,47809475..47809546,47810840..47811066)
FT                   /gene="Lrrc9"
FT                   /locus_tag="mCG_16412"
FT                   /product="leucine rich repeat containing 9, transcript
FT                   variant mCT17849"
FT                   /note="gene_id=mCG16412.2 transcript_id=mCT17849.3 created
FT                   on 13-JUN-2003"
FT   mRNA            join(47742455..47742675,47749831..47749911,
FT                   47750198..47750416,47751227..47751367,47751775..47751838,
FT                   47752485..47752555,47754553..47754735,47756485..47756640,
FT                   47760335..47760516,47761293..47761424,47763827..47764003,
FT                   47764335..47764452,47767360..47768028)
FT                   /gene="Lrrc9"
FT                   /locus_tag="mCG_16412"
FT                   /product="leucine rich repeat containing 9, transcript
FT                   variant mCT185361"
FT                   /note="gene_id=mCG16412.2 transcript_id=mCT185361.0 created
FT                   on 13-JUN-2003"
FT   mRNA            join(47742748..47742977,47749831..47749911,
FT                   47750198..47750416,47751227..47751367,47751775..47751838,
FT                   47752485..47752555,47754553..47755274)
FT                   /gene="Lrrc9"
FT                   /locus_tag="mCG_16412"
FT                   /product="leucine rich repeat containing 9, transcript
FT                   variant mCT185362"
FT                   /note="gene_id=mCG16412.2 transcript_id=mCT185362.0 created
FT                   on 13-JUN-2003"
FT   mRNA            join(47742756..47742977,47749831..47749911,
FT                   47750198..47750416,47751227..47751367,47751775..47751838,
FT                   47752485..47752555,47754553..47754735,47756485..47756640,
FT                   47760335..47760516,47761293..47761424,47763827..47764003,
FT                   47764335..47764452,47767360..47767492,47769683..47769805,
FT                   47770737..47770840,47774311..47774724)
FT                   /gene="Lrrc9"
FT                   /locus_tag="mCG_16412"
FT                   /product="leucine rich repeat containing 9, transcript
FT                   variant mCT185363"
FT                   /note="gene_id=mCG16412.2 transcript_id=mCT185363.0 created
FT                   on 13-JUN-2003"
FT   CDS             join(47749864..47749911,47750198..47750416,
FT                   47751227..47751367,47751775..47751838,47752485..47752555,
FT                   47754553..47754735,47756485..47756640,47760335..47760516,
FT                   47761293..47761424,47763827..47764003,47764338..47764452,
FT                   47767360..47767492,47769683..47769805,47770737..47770840,
FT                   47774311..47774523,47776557..47776676,47777717..47777908,
FT                   47779170..47779295,47781938..47782072,47783404..47783581,
FT                   47786681..47786901,47787505..47787627,47796069..47796199,
FT                   47797553..47797661,47798291..47798430,47800083..47800219,
FT                   47801230..47801447,47803961..47804029,47806790..47806930,
FT                   47809475..47809546,47810840..47811037)
FT                   /codon_start=1
FT                   /gene="Lrrc9"
FT                   /locus_tag="mCG_16412"
FT                   /product="leucine rich repeat containing 9, isoform CRA_b"
FT                   /note="gene_id=mCG16412.2 transcript_id=mCT17849.3
FT                   protein_id=mCP3260.3 isoform=CRA_b"
FT                   /protein_id="EDL36532.1"
FT                   /translation="MIESENLNRGEIIKELCLCNGLTYEIVGQEGSDTSKLEMFFSGYP
FT                   RIVGLSLFHNLSSLTIVAQDIREISGLETCLQLKELWIAECCIEKIEGLQGCRNLEKLY
FT                   LYYNKISKIENLEKLIKLEVLWLNHNMIKNIEGLQTLKNLKDLNLAGNLVSSIGRCLDP
FT                   NEQLEKLNLSGNQITSFKDLTNLTKLTHLKDLCLNDPQYKSNPVCQLCNYSTHVLYHLP
FT                   SLQRLDTFDVSAKQIKELADSTAMKKIMYYNMRIKTVQRHLNEELEKLNDRKCKLQKLP
FT                   EERIKLFNFAKKTLERELAELKISSKGQSDTTPEAEKPRNSEVVTQESVLQQKILTKLS
FT                   ALDDRVTFWNKKLHEIEAIYRTEVKQKKKTHGLLTPFLLTELETVGNIHFEEGTQADDW
FT                   FNSCCELILSRFCTWDFRAYGITGVKVKRVIKVNNRILRLKFEEKFQKCLDLEDTQDPD
FT                   YRKMLECLFYVFDPEVTVKKKHLLQILERGFKDSDTSKPSLKKEAVTLVNSLSMCECPR
FT                   IEFLQQKYKEEKKGPSESELYRHGTILIAKVFLGQSIQARDQEPINKANYPMVNSVFVP
FT                   QRHVLRQRTCDCGYRQYKWFVFDHDLVLPEYIVEFEYTTVVKVHSLFSTSNNVILEEGK
FT                   KYSEGLVFSQDLKFDDEVLKMEPRIKPRPKLISLDEKTIISLAKTNIYSHIVNLNLHGN
FT                   SLSKLRDLAKLTGLRKLNISFNEFTCLDDVYHLYNLEYLDASHNHVITLEGFRGLMKLK
FT                   HLDLSWNQLKKTGEEINVLCKHTTSLLTLDIQHNPWQKPATLRLSVIGRLKTLTHLDGL
FT                   VISEEETRAALKFISGTKITQLTLLQHSSSKEERPRMLSTWPSAKILTQISKLGPHFHL
FT                   TGNWYSKITALNLDGQHLFEITNLEKLENLKWASFSNNNLSKMEGLESCVNLEELTLDG
FT                   NCISKIEGITRLTKLSRLSMNNNLLTGLEKHTFDNLLHLHSLSLENNRITSLSALQKTF
FT                   TLIELYISNNYIAVNQEIYNLKGLCNLVILDMYGNIIIWNQENYRFFVIFHLPELKALD
FT                   GVSIETSETETAKDLFGGRLTSDMIAERQGHSNFIQMQELNWTSSAIRTVDLIPVDHFR
FT                   NVSNVNLQNNNLTSFSGLIYLPNVKVLCLNYNHIESIMPRLKPQTHLSSRQLLYQKVPS
FT                   SGYGQQGTSKLNRDSVGSENLPPIMQSLEVLHLGYNGICNLVQLQLNRLRNLKFLFLQG
FT                   NEISQVEGLDNLIVLQELVVDHNRIRAFNDTAFSKPSSLLMLHLEENRLRELSKLQSLV
FT                   KLEKLFLGYNKIQDITELEKLDVIPSLRELTVYGNPICRKMVHRHVLIFRLPNLQMLDG
FT                   IPINSDDRAKAEFHFSELQAKKSSIIQNNLPTSKSSLPSHLQTPLPCKFVPVTNSTDGG
FT                   SFCHVKASPIKITNVLLPAGFSRFLGPDFTLTPEVEGIFTKSFRENEKTNKQQQ"
FT   CDS             join(47749864..47749911,47750198..47750416,
FT                   47751227..47751367,47751775..47751838,47752485..47752555,
FT                   47754553..47754735,47756485..47756640,47760335..47760516,
FT                   47761293..47761424,47763827..47764003,47764335..47764452,
FT                   47767360..47767492,47769683..47769805,47770737..47770840,
FT                   47774311..47774574)
FT                   /codon_start=1
FT                   /gene="Lrrc9"
FT                   /locus_tag="mCG_16412"
FT                   /product="leucine rich repeat containing 9, isoform CRA_d"
FT                   /note="gene_id=mCG16412.2 transcript_id=mCT185363.0
FT                   protein_id=mCP106620.0 isoform=CRA_d"
FT                   /protein_id="EDL36534.1"
FT                   /translation="MIESENLNRGEIIKELCLCNGLTYEIVGQEGSDTSKLEMFFSGYP
FT                   RIVGLSLFHNLSSLTIVAQDIREISGLETCLQLKELWIAECCIEKIEGLQGCRNLEKLY
FT                   LYYNKISKIENLEKLIKLEVLWLNHNMIKNIEGLQTLKNLKDLNLAGNLVSSIGRCLDP
FT                   NEQLEKLNLSGNQITSFKDLTNLTKLTHLKDLCLNDPQYKSNPVCQLCNYSTHVLYHLP
FT                   SLQRLDTFDVSAKQIKELADSTAMKKIMYYNMRIKTVQRHLNEELEKLNDRKCKLQKLP
FT                   EERIKLFNFAKKTLERELAELKISSKGQSDTTPEAEKPRNSEVVTQESVLQQKILTKLS
FT                   ALDDRVTFWNKKLHEIEAIYRTEVKQKKKTHGLLTPFLLTELETVGNIHFEEGTQADDW
FT                   FNSCCELILSRFCTWDFRAYGITGVKVKRVIKVNNRILRLKFEEKFQKCLDLEDTQDPE
FT                   SYRKMLECLFYVFDPEVTVKKKHLLQILERGFKDSDTSKPSLKKEAVTLVNSLSMCECP
FT                   RIEFLQQKYKEEKKGPSESELYRHGTILIAKVFLGQSIQARDQEPINKANYPMVNSVFV
FT                   PQRHVLRQRTCDCGYRQYKWFVFDHDLVLPEYIVEFEYTTVVKVHSLFSTSNNVILEEG
FT                   KKYSEGLVFSQDLKFDDEVLKMEPRIKPRPKLISLDEKTIISLAKTNIYSHIVVSIIRK
FT                   NLEGNPEFGI"
FT   CDS             join(47749864..47749911,47750198..47750416,
FT                   47751227..47751367,47751775..47751838,47752485..47752555,
FT                   47754553..47754735,47756485..47756640,47760335..47760516,
FT                   47761293..47761424,47763827..47764003,47764335..47764452,
FT                   47767360..47767512)
FT                   /codon_start=1
FT                   /gene="Lrrc9"
FT                   /locus_tag="mCG_16412"
FT                   /product="leucine rich repeat containing 9, isoform CRA_c"
FT                   /note="gene_id=mCG16412.2 transcript_id=mCT185361.0
FT                   protein_id=mCP106621.0 isoform=CRA_c"
FT                   /protein_id="EDL36533.1"
FT                   /translation="MIESENLNRGEIIKELCLCNGLTYEIVGQEGSDTSKLEMFFSGYP
FT                   RIVGLSLFHNLSSLTIVAQDIREISGLETCLQLKELWIAECCIEKIEGLQGCRNLEKLY
FT                   LYYNKISKIENLEKLIKLEVLWLNHNMIKNIEGLQTLKNLKDLNLAGNLVSSIGRCLDP
FT                   NEQLEKLNLSGNQITSFKDLTNLTKLTHLKDLCLNDPQYKSNPVCQLCNYSTHVLYHLP
FT                   SLQRLDTFDVSAKQIKELADSTAMKKIMYYNMRIKTVQRHLNEELEKLNDRKCKLQKLP
FT                   EERIKLFNFAKKTLERELAELKISSKGQSDTTPEAEKPRNSEVVTQESVLQQKILTKLS
FT                   ALDDRVTFWNKKLHEIEAIYRTEVKQKKKTHGLLTPFLLTELETVGNIHFEEGTQADDW
FT                   FNSCCELILSRFCTWDFRAYGITGVKVKRVIKVNNRILRLKFEEKFQKCLDLEDTQDPE
FT                   SYRKMLECLFYVFDPEVTVKKKHLLQILERGFKDSDTSKPSLKKEAVTLVNSLSMCECP
FT                   RIEFLQQKYKEEKKGPSESELYRHGNRQCF"
FT   CDS             join(47749864..47749911,47750198..47750416,
FT                   47751227..47751367,47751775..47751838,47752485..47752555,
FT                   47754553..47754765)
FT                   /codon_start=1
FT                   /gene="Lrrc9"
FT                   /locus_tag="mCG_16412"
FT                   /product="leucine rich repeat containing 9, isoform CRA_a"
FT                   /note="gene_id=mCG16412.2 transcript_id=mCT185362.0
FT                   protein_id=mCP106619.0 isoform=CRA_a"
FT                   /protein_id="EDL36531.1"
FT                   /translation="MIESENLNRGEIIKELCLCNGLTYEIVGQEGSDTSKLEMFFSGYP
FT                   RIVGLSLFHNLSSLTIVAQDIREISGLETCLQLKELWIAECCIEKIEGLQGCRNLEKLY
FT                   LYYNKISKIENLEKLIKLEVLWLNHNMIKNIEGLQTLKNLKDLNLAGNLVSSIGRCLDP
FT                   NEQLEKLNLSGNQITSFKDLTNLTKLTHLKDLCLNDPQYKSNPVCQLCNYSTHVLYHLP
FT                   SLQRLDTFDVSAKQIKELADVSAVAVRYL"
FT   gene            47836847..47842716
FT                   /gene="1810048J11Rik"
FT                   /locus_tag="mCG_1041559"
FT                   /note="gene_id=mCG1041559.1"
FT   mRNA            join(47836847..47837011,47841847..47842716)
FT                   /gene="1810048J11Rik"
FT                   /locus_tag="mCG_1041559"
FT                   /product="RIKEN cDNA 1810048J11"
FT                   /note="gene_id=mCG1041559.1 transcript_id=mCT159263.1
FT                   created on 12-SEP-2002"
FT   CDS             47841892..47842593
FT                   /codon_start=1
FT                   /gene="1810048J11Rik"
FT                   /locus_tag="mCG_1041559"
FT                   /product="RIKEN cDNA 1810048J11"
FT                   /note="gene_id=mCG1041559.1 transcript_id=mCT159263.1
FT                   protein_id=mCP78773.0"
FT                   /protein_id="EDL36530.1"
FT                   /translation="MGSMSSDVPLLNDYKQDFLLKRFPQTVLGGPRLKLGYCAPPYIYV
FT                   NQIVLFLMPWALGGTGTLLYQLDILRDYTAAALSGGLMVFTAAVIQLISVYARSKSVVV
FT                   RRMRTRDILAEEDQHEFTSCAGAETVKFLIPGKKYVANTVFHSVLAGLVCGLGTWYLLP
FT                   NRVTLLYGSPGATAVLFVFGWITLCIGEYSLIVNTATETATFQTQDTYEITPLMRPLYI
FT                   FFFVSVDLAHR"
FT   gene            47848311..47849958
FT                   /locus_tag="mCG_148246"
FT                   /note="gene_id=mCG148246.0"
FT   mRNA            47848311..47849958
FT                   /locus_tag="mCG_148246"
FT                   /product="mCG148246"
FT                   /note="gene_id=mCG148246.0 transcript_id=mCT188509.0
FT                   created on 13-JAN-2004"
FT   CDS             47848509..47848898
FT                   /codon_start=1
FT                   /locus_tag="mCG_148246"
FT                   /product="mCG148246"
FT                   /note="gene_id=mCG148246.0 transcript_id=mCT188509.0
FT                   protein_id=mCP108080.0"
FT                   /protein_id="EDL36529.1"
FT                   /translation="MFSMVSSAPEILSSISCILLLILVSVVPVLFPRFPISGVASICLF
FT                   FITSISIFRSWTDLFISFLFFFLFPFFIRYLAHLHFQCYTKSLPYLPTPIPLPTHSPFL
FT                   ALAFPCTGAYKVCLSDGPLFPVMAD"
FT   gene            47855599..47881103
FT                   /locus_tag="mCG_16410"
FT                   /note="gene_id=mCG16410.1"
FT   mRNA            join(47855599..47856092,47856320..47856834,
FT                   47857059..47857159,47857277..47857396,47867828..47868191,
FT                   47870649..47870752,47874421..47875433,47876285..47876471,
FT                   47880235..47881103)
FT                   /locus_tag="mCG_16410"
FT                   /product="mCG16410"
FT                   /note="gene_id=mCG16410.1 transcript_id=mCT17847.1 created
FT                   on 04-SEP-2002"
FT   CDS             join(47855944..47856092,47856320..47856834,
FT                   47857059..47857159,47857277..47857396,47867828..47868191,
FT                   47870649..47870752,47874421..47875433,47876285..47876471,
FT                   47880235..47880486)
FT                   /codon_start=1
FT                   /locus_tag="mCG_16410"
FT                   /product="mCG16410"
FT                   /note="gene_id=mCG16410.1 transcript_id=mCT17847.1
FT                   protein_id=mCP3234.2"
FT                   /protein_id="EDL36528.1"
FT                   /translation="MNQILHILFVLLPFLWALGTLPPPDALLFWAVEQVLEFGLGGSSM
FT                   STHLRLLVMFIVSAGAAVVSYFIPSTVGVVLFMTGLGFLLSLNPSDVSMVFRYGVTRHR
FT                   VGSSHEARPGNSGHWFPWKECFLFIAVLGMALLEAGLLHHYVSVPQVSRSGAQAVVGYV
FT                   LMVLLSIVWILRETQSIYIFGIFRNPFYPKDIHAVSVFYDKQNKLLKIGAVRWILLTLV
FT                   SPLAMVAFLALDSSLHGLHSVSVSIGFTRAFRMVWQNTETALLETVVVSAVHMVSSTDC
FT                   WWNRSLDTGIRLLLIGIMRDRLIQFITKLQFAVTVLLALWTEKKQHRKTTTTLCVLNTV
FT                   FAPFVLGIIVLSTLLSSPLLPLFTLPVFLVGFPRPVQSWPGAVGTAACVCTDSVFYHQM
FT                   VPRLTAALQTAMAAGSLGLLLPGSHYLGRFEDRLIWIMILECGYTYCCINVKGLELQET
FT                   SCHTAEAQRVDEVFESAFQREHPQVCSLNEHLENVLTPCTVLPVKLYSDARNVLTGIID
FT                   SPDNLKEFKDDLIKVLVWVLIQHCSKRPSTQENKTENTGEASPALPPAANSSPCPESLE
FT                   DSESANSDWSDGSIFDDEPAIKNRKEKLQSKDLPCTKLPIPGSVDSQNPDDHSAGTGPK
FT                   NDLYRTVILGLPAVDKGQREDVAYIPLVEFSCSQSRLLSLPEEWRSNSTPRSKILEMSA
FT                   LFPEDWYQFVLRQLECFHSEEKSRVLEEIAKDKALKDLYVHTVMACYIGLFGIDNGVPS
FT                   PGQLVRVYNGGLPWAGTLDWLSEKPELFHLVRKAFRYTLKLMVDKASLGPIEDFKELTN
FT                   CLREYERDWYIGLVSEEQWKRAILEEKPCLFCLGYESSMGVYTSRVLMLQEMSVHIGKL
FT                   NAEAVRGQWANLSWELLYATNDDEERYSIQAHPLLLRNLTVQAADPPLGYPIFSSKPLP
FT                   IHLC"
FT   gene            complement(47912657..47950371)
FT                   /locus_tag="mCG_121613"
FT                   /note="gene_id=mCG121613.1"
FT   mRNA            complement(join(47912657..47912882,47913491..47913613,
FT                   47920381..47920620,47922810..47922916,47950265..47950371))
FT                   /locus_tag="mCG_121613"
FT                   /product="mCG121613"
FT                   /note="gene_id=mCG121613.1 transcript_id=mCT122827.1
FT                   created on 04-SEP-2002"
FT   CDS             complement(join(47912661..47912882,47913491..47913613,
FT                   47920381..47920620,47922810..47922905))
FT                   /codon_start=1
FT                   /locus_tag="mCG_121613"
FT                   /product="mCG121613"
FT                   /note="gene_id=mCG121613.1 transcript_id=mCT122827.1
FT                   protein_id=mCP79127.1"
FT                   /protein_id="EDL36527.1"
FT                   /translation="MRENDILVLPLDLADTSSHDIATKAVLQEFGRIDILVNNGGETNY
FT                   CFAVDANLDVFKVLMEVNYLGTVSLTKSVLPHMMERKQGKIVIMNSLAGIVPSPLCCGY
FT                   IASKHALRGFANALRTELLDHPGITLSTICPGPVHSNIYQNYLTREAIKARWPKPQEFP
FT                   KMATSRCVQLILVSMANDLEEVWIANQPALFRTYVWQYVPIRDWIISRTQWKKRIEIFR
FT                   ITMV"
FT   gene            complement(47951066..>47966110)
FT                   /gene="Dhrs7"
FT                   /locus_tag="mCG_121612"
FT                   /note="gene_id=mCG121612.0"
FT   mRNA            complement(join(47951066..47951326,47952944..47953159,
FT                   47953810..47953932,47957343..47957582,47958477..47958583,
FT                   47960667..47960819,47965953..>47966110))
FT                   /gene="Dhrs7"
FT                   /locus_tag="mCG_121612"
FT                   /product="dehydrogenase/reductase (SDR family) member 7"
FT                   /note="gene_id=mCG121612.0 transcript_id=mCT122826.0
FT                   created on 04-SEP-2002"
FT   CDS             complement(join(47951282..47951326,47952944..47953159,
FT                   47953810..47953932,47957343..47957582,47958477..47958583,
FT                   47960667..47960819,47965953..>47966109))
FT                   /codon_start=1
FT                   /gene="Dhrs7"
FT                   /locus_tag="mCG_121612"
FT                   /product="dehydrogenase/reductase (SDR family) member 7"
FT                   /note="gene_id=mCG121612.0 transcript_id=mCT122826.0
FT                   protein_id=mCP79120.0"
FT                   /protein_id="EDL36526.1"
FT                   /translation="ESGRQGTAMSWELLLWLLALCALILPLVQLLRFLRADADLTLLWA
FT                   EWQGRRPEWELTDMVVWVTGASSGIGEELAFQLSKLGVSLVLSARRAQELERVKRRCLE
FT                   NGNLKEKDILVLPLDLTDTSSHEAATKAVLQEFGKIDILVNNGGRSQRSLVLETNLDVF
FT                   KELINLNYIGTVSLTKCVLPHMIERKQGKIVTVNSIAGIASVSLSSGYCASKHALRGFF
FT                   NALHSELGQYPGITFCNVYPGPVQSDIVKNAFTEEVTKSMRNNIDQSYKMPTSRCVRLM
FT                   LISMANDLKEVWISDHPVLLGAYIWQYMPTWAAWLNCKLGKERIQNFKNNLDPDLPYKF
FT                   LKAKKD"
FT   gene            <48037424..48096321
FT                   /gene="Ppm1a"
FT                   /locus_tag="mCG_16407"
FT                   /note="gene_id=mCG16407.2"
FT   mRNA            join(<48037424..48037528,48085448..48086301,
FT                   48088437..48088554,48092398..48092506,48094548..48094605,
FT                   48095482..48096321)
FT                   /gene="Ppm1a"
FT                   /locus_tag="mCG_16407"
FT                   /product="protein phosphatase 1A, magnesium dependent,
FT                   alpha isoform, transcript variant mCT172856"
FT                   /note="gene_id=mCG16407.2 transcript_id=mCT172856.0 created
FT                   on 29-AUG-2002"
FT   CDS             join(<48037426..48037528,48085448..48086301,
FT                   48088437..48088554,48092398..48092506,48094548..48094605,
FT                   48095482..48095511)
FT                   /codon_start=1
FT                   /gene="Ppm1a"
FT                   /locus_tag="mCG_16407"
FT                   /product="protein phosphatase 1A, magnesium dependent,
FT                   alpha isoform, isoform CRA_a"
FT                   /note="gene_id=mCG16407.2 transcript_id=mCT172856.0
FT                   protein_id=mCP95776.0 isoform=CRA_a"
FT                   /protein_id="EDL36523.1"
FT                   /translation="VGADFYRRPAETTSLVGLSNDWIPFTGAVGLVADYLEDQVIMGAF
FT                   LDKPKMEKHNAQGQGNGLRYGLSSMQGWRVEMEDAHTAVIGLPSGLETWSFFAVYDGHA
FT                   GSQVAKYCCEHLLDHITNNQDFRGSAGAPSVENVKNGIRTGFLEIDEHMRVMSEKKHGA
FT                   DRSGSTAVGVLISPQHTYFINCGDSRGLLCRNRKVHFFTQDHKPSNPLEKERIQNAGGS
FT                   VMIQRVNGSLAVSRALGDFDYKCVHGKGPTEQLVSPEPEVHDIERSEEDDQFIILACDG
FT                   IWDVMGNEELCDFVRSRLEVTDDLEKVCNEVVDTCLYKGSRDNMSVILICFPSAPKVSA
FT                   EAVKKEAELDKYLESRVEEIIKKQVEGVPDLVHVMRTLASENIPSLPPGGELASKRNVI
FT                   EAVYNRLNPYKNDDTDSASTDDMW"
FT   mRNA            join(<48062846..48062942,48085448..48086301,
FT                   48088437..48088554,48092398..48092506,48094548..48094605,
FT                   48095482..48095632)
FT                   /gene="Ppm1a"
FT                   /locus_tag="mCG_16407"
FT                   /product="protein phosphatase 1A, magnesium dependent,
FT                   alpha isoform, transcript variant mCT17844"
FT                   /note="gene_id=mCG16407.2 transcript_id=mCT17844.1 created
FT                   on 29-AUG-2002"
FT   CDS             join(<48062846..48062942,48085448..48086301,
FT                   48088437..48088554,48092398..48092506,48094548..48094605,
FT                   48095482..48095511)
FT                   /codon_start=1
FT                   /gene="Ppm1a"
FT                   /locus_tag="mCG_16407"
FT                   /product="protein phosphatase 1A, magnesium dependent,
FT                   alpha isoform, isoform CRA_c"
FT                   /note="gene_id=mCG16407.2 transcript_id=mCT17844.1
FT                   protein_id=mCP3199.1 isoform=CRA_c"
FT                   /protein_id="EDL36525.1"
FT                   /translation="PGPGRRRGTPCPAAVATAAPADRGTRPPAAVPDLEDQVIMGAFLD
FT                   KPKMEKHNAQGQGNGLRYGLSSMQGWRVEMEDAHTAVIGLPSGLETWSFFAVYDGHAGS
FT                   QVAKYCCEHLLDHITNNQDFRGSAGAPSVENVKNGIRTGFLEIDEHMRVMSEKKHGADR
FT                   SGSTAVGVLISPQHTYFINCGDSRGLLCRNRKVHFFTQDHKPSNPLEKERIQNAGGSVM
FT                   IQRVNGSLAVSRALGDFDYKCVHGKGPTEQLVSPEPEVHDIERSEEDDQFIILACDGIW
FT                   DVMGNEELCDFVRSRLEVTDDLEKVCNEVVDTCLYKGSRDNMSVILICFPSAPKVSAEA
FT                   VKKEAELDKYLESRVEEIIKKQVEGVPDLVHVMRTLASENIPSLPPGGELASKRNVIEA
FT                   VYNRLNPYKNDDTDSASTDDMW"
FT   mRNA            join(<48063208..48063265,48085448..48086301,
FT                   48088437..48088554,48092398..48092506,48094548..48094605,
FT                   48095482..48096321)
FT                   /gene="Ppm1a"
FT                   /locus_tag="mCG_16407"
FT                   /product="protein phosphatase 1A, magnesium dependent,
FT                   alpha isoform, transcript variant mCT172857"
FT                   /note="gene_id=mCG16407.2 transcript_id=mCT172857.0 created
FT                   on 29-AUG-2002"
FT   CDS             join(<48063253..48063265,48085448..48086301,
FT                   48088437..48088554,48092398..48092506,48094548..48094605,
FT                   48095482..48095511)
FT                   /codon_start=1
FT                   /gene="Ppm1a"
FT                   /locus_tag="mCG_16407"
FT                   /product="protein phosphatase 1A, magnesium dependent,
FT                   alpha isoform, isoform CRA_b"
FT                   /note="gene_id=mCG16407.2 transcript_id=mCT172857.0
FT                   protein_id=mCP95775.0 isoform=CRA_b"
FT                   /protein_id="EDL36524.1"
FT                   /translation="SRSAHLEDQVIMGAFLDKPKMEKHNAQGQGNGLRYGLSSMQGWRV
FT                   EMEDAHTAVIGLPSGLETWSFFAVYDGHAGSQVAKYCCEHLLDHITNNQDFRGSAGAPS
FT                   VENVKNGIRTGFLEIDEHMRVMSEKKHGADRSGSTAVGVLISPQHTYFINCGDSRGLLC
FT                   RNRKVHFFTQDHKPSNPLEKERIQNAGGSVMIQRVNGSLAVSRALGDFDYKCVHGKGPT
FT                   EQLVSPEPEVHDIERSEEDDQFIILACDGIWDVMGNEELCDFVRSRLEVTDDLEKVCNE
FT                   VVDTCLYKGSRDNMSVILICFPSAPKVSAEAVKKEAELDKYLESRVEEIIKKQVEGVPD
FT                   LVHVMRTLASENIPSLPPGGELASKRNVIEAVYNRLNPYKNDDTDSASTDDMW"
FT   gene            48100774..48101584
FT                   /locus_tag="mCG_1041615"
FT                   /note="gene_id=mCG1041615.1"
FT   mRNA            48100774..48101584
FT                   /locus_tag="mCG_1041615"
FT                   /product="mCG1041615"
FT                   /note="gene_id=mCG1041615.1 transcript_id=mCT159319.1
FT                   created on 12-SEP-2002"
FT   CDS             48101089..48101244
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041615"
FT                   /product="mCG1041615"
FT                   /note="gene_id=mCG1041615.1 transcript_id=mCT159319.1
FT                   protein_id=mCP78528.1"
FT                   /protein_id="EDL36522.1"
FT                   /translation="MFVGVKTEFIVLPDQPIANSIAHAREDTVARRCSAVITSFLSVLS
FT                   GEQSTC"
FT   gene            complement(48182746..48242351)
FT                   /gene="Six6os1"
FT                   /locus_tag="mCG_16411"
FT                   /note="gene_id=mCG16411.3"
FT   mRNA            complement(join(48182746..48183069,48186868..48186925,
FT                   48191357..48191495,48194457..48194632,48196647..48196708,
FT                   48200150..48200196,48200373..48200458,48204076..48204152,
FT                   48204879..48204997,48207854..48207942,48209484..48209604,
FT                   48211458..48211500,48211591..48211778,48214872..48214961,
FT                   48217044..48217170,48218362..48218418,48218511..48218567,
FT                   48240900..48240993,48241287..48241356,48242276..48242351))
FT                   /gene="Six6os1"
FT                   /locus_tag="mCG_16411"
FT                   /product="Six6 opposite strand transcript 1, transcript
FT                   variant mCT194215"
FT                   /note="gene_id=mCG16411.3 transcript_id=mCT194215.0 created
FT                   on 17-MAR-2004"
FT   mRNA            complement(join(48182746..48183069,48186868..48186925,
FT                   48191357..48191495,48194457..48194632,48196647..48196708,
FT                   48200150..48200196,48200373..48200458,48204076..48204152,
FT                   48204879..48204997,48207854..48207942,48209484..48209604,
FT                   48211458..48211500,48211591..48211778,48214872..48214961,
FT                   48217044..48217170,48218362..48218418,48218511..48218567,
FT                   48239361..48239674))
FT                   /gene="Six6os1"
FT                   /locus_tag="mCG_16411"
FT                   /product="Six6 opposite strand transcript 1, transcript
FT                   variant mCT194214"
FT                   /note="gene_id=mCG16411.3 transcript_id=mCT194214.0 created
FT                   on 17-MAR-2004"
FT   mRNA            complement(join(48182746..48183069,48186868..48186925,
FT                   48191357..48191495,48194457..48194632,48196647..48196708,
FT                   48200150..48200196,48200373..48200458,48204076..48204152,
FT                   48204879..48204997,48207854..48207942,48209484..48209604,
FT                   48211458..48211500,48211591..48211778,48214872..48214961,
FT                   48217044..48217170,48218362..48218418,48218511..48218567,
FT                   48219494..48219566))
FT                   /gene="Six6os1"
FT                   /locus_tag="mCG_16411"
FT                   /product="Six6 opposite strand transcript 1, transcript
FT                   variant mCT171131"
FT                   /note="gene_id=mCG16411.3 transcript_id=mCT171131.1 created
FT                   on 17-MAR-2004"
FT   mRNA            complement(join(48182746..48183069,48186868..48186925,
FT                   48191357..48191495,48194457..48194632,48196647..48196708,
FT                   48200150..48200196,48200373..48200458,48204076..48204152,
FT                   48204879..48204997,48207854..48207942,48209484..48209604,
FT                   48211458..48211500,48211591..48211778,48214872..48214961,
FT                   48217044..48217170,48218362..48218418,48218511..48218567,
FT                   48219416..48219473))
FT                   /gene="Six6os1"
FT                   /locus_tag="mCG_16411"
FT                   /product="Six6 opposite strand transcript 1, transcript
FT                   variant mCT17848"
FT                   /note="gene_id=mCG16411.3 transcript_id=mCT17848.2 created
FT                   on 17-MAR-2004"
FT   CDS             complement(join(48182873..48183069,48186868..48186925,
FT                   48191357..48191495,48194457..48194632,48196647..48196708,
FT                   48200150..48200196,48200373..48200458,48204076..48204152,
FT                   48204879..48204997,48207854..48207942,48209484..48209604,
FT                   48211458..48211500,48211591..48211778,48214872..48214961,
FT                   48217044..48217170,48218362..48218418,48218511..48218567,
FT                   48240900..48240993,48241287..48241298))
FT                   /codon_start=1
FT                   /gene="Six6os1"
FT                   /locus_tag="mCG_16411"
FT                   /product="Six6 opposite strand transcript 1, isoform CRA_b"
FT                   /note="gene_id=mCG16411.3 transcript_id=mCT194215.0
FT                   protein_id=mCP115244.0 isoform=CRA_b"
FT                   /protein_id="EDL36520.1"
FT                   /translation="MKKEAPIPACLPLTISSCIGSKPGTEGTEPQICSRVSKMNDNLFV
FT                   SLDRLLLEFVFQYEQDISIKEDTIQRINKCLESIKENKANVSKLREAINKVDEDIAFHY
FT                   KHSKEIKDSCSNWKPTCDVFHKHEDYIKDQLTAYQETNEKDKKMYHDYICQYEDVLKQY
FT                   QLKYSETRFSCKYYEKKKEHEEIKNRVLACTEQLQLNETILMKFLVPAPFPSLTKWTLY
FT                   VVNLRYRTQDILKRANNFTKRSFELEKEADDMEIEINSLNKMARLFESKTFSEALDEKN
FT                   KNTEKRKEFEERIFEKDEQVSNRSSQNSQLLLPCESQKFVRNMNSSEARVTDKKEESSA
FT                   NQSKFVRSDVRQKENNPQIFNDSGMDSNSKSSHIPAVKSSQGFMQFRLNQPNYNQRIEK
FT                   EHIDAECGDKETVRQVRESKCSTQALYIEHFGKSIENNSVEEERDENFPQTPETPSFLR
FT                   TPEALKTPESMEKMQFPKSPFFEITKNATSEGHKQKDSPGFSFLMSYTSRSPGLNLFDS
FT                   SVSDSEISSDQFNEHYSAVNLNPSSSQQGIGNLFGKSEGEDAFTFSFSSDSSHTFGAGK
FT                   DDFSFPFSFEQDPSTMTSSSSKDFSSSQNKTQFMFF"
FT   CDS             complement(join(48182873..48183069,48186868..48186925,
FT                   48191357..48191495,48194457..48194632,48196647..48196708,
FT                   48200150..48200196,48200373..48200458,48204076..48204152,
FT                   48204879..48204997,48207854..48207942,48209484..48209604,
FT                   48211458..48211500,48211591..48211778,48214872..48214961,
FT                   48217044..48217170,48218362..48218418,48218511..48218559))
FT                   /codon_start=1
FT                   /gene="Six6os1"
FT                   /locus_tag="mCG_16411"
FT                   /product="Six6 opposite strand transcript 1, isoform CRA_a"
FT                   /note="gene_id=mCG16411.3 transcript_id=mCT17848.2
FT                   protein_id=mCP3305.2 isoform=CRA_a"
FT                   /protein_id="EDL36518.1"
FT                   /translation="MNDNLFVSLDRLLLEFVFQYEQDISIKEDTIQRINKCLESIKENK
FT                   ANVSKLREAINKVDEDIAFHYKHSKEIKDSCSNWKPTCDVFHKHEDYIKDQLTAYQETN
FT                   EKDKKMYHDYICQYEDVLKQYQLKYSETRFSCKYYEKKKEHEEIKNRVLACTEQLQLNE
FT                   TILMKFLVPAPFPSLTKWTLYVVNLRYRTQDILKRANNFTKRSFELEKEADDMEIEINS
FT                   LNKMARLFESKTFSEALDEKNKNTEKRKEFEERIFEKDEQVSNRSSQNSQLLLPCESQK
FT                   FVRNMNSSEARVTDKKEESSANQSKFVRSDVRQKENNPQIFNDSGMDSNSKSSHIPAVK
FT                   SSQGFMQFRLNQPNYNQRIEKEHIDAECGDKETVRQVRESKCSTQALYIEHFGKSIENN
FT                   SVEEERDENFPQTPETPSFLRTPEALKTPESMEKMQFPKSPFFEITKNATSEGHKQKDS
FT                   PGFSFLMSYTSRSPGLNLFDSSVSDSEISSDQFNEHYSAVNLNPSSSQQGIGNLFGKSE
FT                   GEDAFTFSFSSDSSHTFGAGKDDFSFPFSFEQDPSTMTSSSSKDFSSSQNKTQFMFF"
FT   CDS             complement(join(48182873..48183069,48186868..48186925,
FT                   48191357..48191495,48194457..48194632,48196647..48196708,
FT                   48200150..48200196,48200373..48200458,48204076..48204152,
FT                   48204879..48204997,48207854..48207942,48209484..48209604,
FT                   48211458..48211500,48211591..48211778,48214872..48214961,
FT                   48217044..48217170,48218362..48218418,48218511..48218559))
FT                   /codon_start=1
FT                   /gene="Six6os1"
FT                   /locus_tag="mCG_16411"
FT                   /product="Six6 opposite strand transcript 1, isoform CRA_a"
FT                   /note="gene_id=mCG16411.3 transcript_id=mCT194214.0
FT                   protein_id=mCP115243.0 isoform=CRA_a"
FT                   /protein_id="EDL36519.1"
FT                   /translation="MNDNLFVSLDRLLLEFVFQYEQDISIKEDTIQRINKCLESIKENK
FT                   ANVSKLREAINKVDEDIAFHYKHSKEIKDSCSNWKPTCDVFHKHEDYIKDQLTAYQETN
FT                   EKDKKMYHDYICQYEDVLKQYQLKYSETRFSCKYYEKKKEHEEIKNRVLACTEQLQLNE
FT                   TILMKFLVPAPFPSLTKWTLYVVNLRYRTQDILKRANNFTKRSFELEKEADDMEIEINS
FT                   LNKMARLFESKTFSEALDEKNKNTEKRKEFEERIFEKDEQVSNRSSQNSQLLLPCESQK
FT                   FVRNMNSSEARVTDKKEESSANQSKFVRSDVRQKENNPQIFNDSGMDSNSKSSHIPAVK
FT                   SSQGFMQFRLNQPNYNQRIEKEHIDAECGDKETVRQVRESKCSTQALYIEHFGKSIENN
FT                   SVEEERDENFPQTPETPSFLRTPEALKTPESMEKMQFPKSPFFEITKNATSEGHKQKDS
FT                   PGFSFLMSYTSRSPGLNLFDSSVSDSEISSDQFNEHYSAVNLNPSSSQQGIGNLFGKSE
FT                   GEDAFTFSFSSDSSHTFGAGKDDFSFPFSFEQDPSTMTSSSSKDFSSSQNKTQFMFF"
FT   CDS             complement(join(48182873..48183069,48186868..48186925,
FT                   48191357..48191495,48194457..48194632,48196647..48196708,
FT                   48200150..48200196,48200373..48200458,48204076..48204152,
FT                   48204879..48204997,48207854..48207942,48209484..48209604,
FT                   48211458..48211500,48211591..48211778,48214872..48214961,
FT                   48217044..48217170,48218362..48218418,48218511..48218559))
FT                   /codon_start=1
FT                   /gene="Six6os1"
FT                   /locus_tag="mCG_16411"
FT                   /product="Six6 opposite strand transcript 1, isoform CRA_a"
FT                   /note="gene_id=mCG16411.3 transcript_id=mCT171131.1
FT                   protein_id=mCP94049.1 isoform=CRA_a"
FT                   /protein_id="EDL36521.1"
FT                   /translation="MNDNLFVSLDRLLLEFVFQYEQDISIKEDTIQRINKCLESIKENK
FT                   ANVSKLREAINKVDEDIAFHYKHSKEIKDSCSNWKPTCDVFHKHEDYIKDQLTAYQETN
FT                   EKDKKMYHDYICQYEDVLKQYQLKYSETRFSCKYYEKKKEHEEIKNRVLACTEQLQLNE
FT                   TILMKFLVPAPFPSLTKWTLYVVNLRYRTQDILKRANNFTKRSFELEKEADDMEIEINS
FT                   LNKMARLFESKTFSEALDEKNKNTEKRKEFEERIFEKDEQVSNRSSQNSQLLLPCESQK
FT                   FVRNMNSSEARVTDKKEESSANQSKFVRSDVRQKENNPQIFNDSGMDSNSKSSHIPAVK
FT                   SSQGFMQFRLNQPNYNQRIEKEHIDAECGDKETVRQVRESKCSTQALYIEHFGKSIENN
FT                   SVEEERDENFPQTPETPSFLRTPEALKTPESMEKMQFPKSPFFEITKNATSEGHKQKDS
FT                   PGFSFLMSYTSRSPGLNLFDSSVSDSEISSDQFNEHYSAVNLNPSSSQQGIGNLFGKSE
FT                   GEDAFTFSFSSDSSHTFGAGKDDFSFPFSFEQDPSTMTSSSSKDFSSSQNKTQFMFF"
FT   gene            48241301..48246476
FT                   /gene="Six6"
FT                   /locus_tag="mCG_16408"
FT                   /note="gene_id=mCG16408.2"
FT   mRNA            join(48241301..48242204,48243204..48246476)
FT                   /gene="Six6"
FT                   /locus_tag="mCG_16408"
FT                   /product="sine oculis-related homeobox 6 homolog
FT                   (Drosophila)"
FT                   /note="gene_id=mCG16408.2 transcript_id=mCT17845.2 created
FT                   on 17-MAR-2004"
FT   CDS             join(48241633..48242204,48243204..48243372)
FT                   /codon_start=1
FT                   /gene="Six6"
FT                   /locus_tag="mCG_16408"
FT                   /product="sine oculis-related homeobox 6 homolog
FT                   (Drosophila)"
FT                   /note="gene_id=mCG16408.2 transcript_id=mCT17845.2
FT                   protein_id=mCP3229.2"
FT                   /db_xref="GOA:B2RSE8"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="MGI:MGI:1341840"
FT                   /db_xref="UniProtKB/TrEMBL:B2RSE8"
FT                   /protein_id="EDL36517.1"
FT                   /translation="MFQLPILNFSPQQVAGVCETLEESGDVERLGRFLWSLPVAPAACE
FT                   ALNKNESVLRARAIVAFHGGNYRELYHILENHKFTKESHAKLQALWLEAHYQEAEKLRG
FT                   RPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRHLLREWYLQDPYPNPSKKRELAQ
FT                   ATGLTPTQVGNWFKNRRQRDRAAAAKNRLQQQVLSQGPGRVLRSEGEGTPEVLGVASSP
FT                   AASLSSKAATSAISITSSDSECDI"
FT   gene            complement(<48312524..48312890)
FT                   /locus_tag="mCG_64467"
FT                   /note="gene_id=mCG64467.2"
FT   mRNA            complement(join(<48312524..48312771,48312785..48312890))
FT                   /locus_tag="mCG_64467"
FT                   /product="mCG64467"
FT                   /note="gene_id=mCG64467.2 transcript_id=mCT64650.2 created
FT                   on 12-SEP-2002"
FT   CDS             complement(48312524..48312649)
FT                   /codon_start=1
FT                   /locus_tag="mCG_64467"
FT                   /product="mCG64467"
FT                   /note="gene_id=mCG64467.2 transcript_id=mCT64650.2
FT                   protein_id=mCP26282.2"
FT                   /protein_id="EDL36516.1"
FT                   /translation="MFLTPPHPNVCVCVCVCVCVCVCRCVDMSAIALGVQRHWRS"
FT   gene            complement(48343501..>48348370)
FT                   /gene="Six1"
FT                   /locus_tag="mCG_16404"
FT                   /note="gene_id=mCG16404.1"
FT   mRNA            complement(join(48343501..48345499,48347537..>48348370))
FT                   /gene="Six1"
FT                   /locus_tag="mCG_16404"
FT                   /product="sine oculis-related homeobox 1 homolog
FT                   (Drosophila)"
FT                   /note="gene_id=mCG16404.1 transcript_id=mCT17841.1 created
FT                   on 04-SEP-2002"
FT   CDS             complement(join(48345205..48345499,48347537..>48348288))
FT                   /codon_start=1
FT                   /gene="Six1"
FT                   /locus_tag="mCG_16404"
FT                   /product="sine oculis-related homeobox 1 homolog
FT                   (Drosophila)"
FT                   /note="gene_id=mCG16404.1 transcript_id=mCT17841.1
FT                   protein_id=mCP3219.0"
FT                   /protein_id="EDL36515.1"
FT                   /translation="LTPTSLRLPWPPTRRGSTGLFARAKAREGVRSSRAPLPAAAAPCS
FT                   PSSAHCRVRPGPCAPAAPAMSMLPSFGFTQEQVACVCEVLQQGGNLERLGRFLWSLPAC
FT                   DHLHKNESVLKAKAVVAFHRGNFRELYKILESHQFSPHNHPKLQQLWLKAHYVEAEKLR
FT                   GRPLGAVGKYRVRRKFPLPRTIWDGEETSYCFKEKSRGVLREWYAHNPYPSPREKRELA
FT                   EATGLTTTQVSNWFKNRRQRDRAAEAKERENTENNNSSSNKQNQLSPLEGGKPLMSSSE
FT                   EEFSPPQSPDQNSVLLLQSNMGHARSSNYSLPGLTASQPSHGLQAHQHQLQDSLLGPLT
FT                   SSLVDLGS"
FT   gene            complement(48396238..>48410007)
FT                   /gene="Six4"
FT                   /locus_tag="mCG_16406"
FT                   /note="gene_id=mCG16406.1"
FT   mRNA            complement(join(48396238..48400867,48405290..48405978,
FT                   48408920..48409461,48409668..48409747,48409954..>48410007))
FT                   /gene="Six4"
FT                   /locus_tag="mCG_16406"
FT                   /product="sine oculis-related homeobox 4 homolog
FT                   (Drosophila)"
FT                   /note="gene_id=mCG16406.1 transcript_id=mCT17843.1 created
FT                   on 04-SEP-2002"
FT   CDS             complement(join(48400071..48400867,48405290..48405978,
FT                   48408920..48409461,48409668..48409747,48409954..>48410005))
FT                   /codon_start=1
FT                   /gene="Six4"
FT                   /locus_tag="mCG_16406"
FT                   /product="sine oculis-related homeobox 4 homolog
FT                   (Drosophila)"
FT                   /note="gene_id=mCG16406.1 transcript_id=mCT17843.1
FT                   protein_id=mCP3225.1"
FT                   /protein_id="EDL36514.1"
FT                   /translation="AESSYPFTLLCSSSYLNDCKCGGHQAGEWDGKRLGRTGGAPRSGF
FT                   SPDHVACVCEALQQGGNLDRLARFLWSLPQSDLLRGNESLLKARALVAFHQGIYPELYS
FT                   ILESHSFESANHPLLQQLWYKARYTEAERARGRPLGAVDKYRLRRKFPLPRTIWDGEET
FT                   VYCFKEKSRNALKELYKQNRYPSPAEKRHLAKITGLSLTQVSNWFKNRRQRDRNPSETQ
FT                   SKSESDGNPSTEDESSKGHEDLSPHPLSGASDGVTNLSLSSHVEPVYMQQIGNAKISLS
FT                   SSGVLLNGSLVPASTSPVFLNGNSFIQGHNGVILNGLNVGNTQTVSLNPPKMSSNIVGN
FT                   GIAMTDILGSTSQDVKEFKVLQSSAVNSAATTSYSPSAPVSFPGLIPCTEVKREGIQTV
FT                   ASQDGGSVVTFTTPVQINQYGIVQIPNSGANGQFLNGSIGFSPLQLPPVSVAASQGNLS
FT                   VTPSTSDGSTFTSEPATVQHGKLFLSPLTPSAVVYTVPNSGQTVGAVKQEGLERGLVFS
FT                   QLMPVNHSAQVNASLSSENLSGSGLHPLTSSLVNVSAAHGFSLTPPTLLNPTELNPDLA
FT                   ESQPVSAPVASKCTVSSVSNTNYATLQNCSLIPGQDLLSGPMTQAALGEIVPTAEEQVS
FT                   HASTAVHQDFVREQRLVLQSVPNIKENFLQNSENKATNNLMMLDSKSKYVLDGMVEAGC
FT                   EDLGTDKKELAKLQTVQLDEDMQDL"
FT   gene            <48408809..48569260
FT                   /gene="Mnat1"
FT                   /locus_tag="mCG_16405"
FT                   /note="gene_id=mCG16405.2"
FT   mRNA            join(<48408809..48408831,48420301..48420448,
FT                   48464951..48465103,48467544..48467617,48475937..48476040,
FT                   48478467..48478607,48484876..48485001,48515740..48515861,
FT                   48568822..48569260)
FT                   /gene="Mnat1"
FT                   /locus_tag="mCG_16405"
FT                   /product="menage a trois 1"
FT                   /note="gene_id=mCG16405.2 transcript_id=mCT17842.2 created
FT                   on 29-AUG-2002"
FT   CDS             join(<48420315..48420448,48464951..48465103,
FT                   48467544..48467617,48475937..48476040,48478467..48478607,
FT                   48484876..48485001,48515740..48515861,48568822..48568942)
FT                   /codon_start=1
FT                   /gene="Mnat1"
FT                   /locus_tag="mCG_16405"
FT                   /product="menage a trois 1"
FT                   /note="gene_id=mCG16405.2 transcript_id=mCT17842.2
FT                   protein_id=mCP3195.1"
FT                   /protein_id="EDL36513.1"
FT                   /translation="NPCGGKKKIQSRGDAMDDQGCPRCKTTKYRNPSLKLMVNVCGHTL
FT                   CESCVDLLFVRGAGNCPECGTPLRKSNFRVQLFEDPTVDKEVEIRKKVLKIYNKREEDF
FT                   PSLREYNDFLEEVEEIVFNLTNNVDLENTKKKMEIYQKENKDVIQKNKLKLTREQEELE
FT                   EALEVERQEHEQRRLFIQKEEELQQALKRKNKQAFLDELESSDLPVALLLAQHKDRSTQ
FT                   LEMQLEKPRSMKPVTFSTGIKMGQQISLAPIQKLEEALYEYQPLQIETCGPQVPEQELL
FT                   GRLGYLNHVRAASPQDLAGGYTSSLACHRALQDAFSGLFWQPR"
FT   gene            complement(48499349..48500029)
FT                   /pseudo
FT                   /locus_tag="mCG_50169"
FT                   /note="gene_id=mCG50169.1"
FT   mRNA            complement(48499349..48500029)
FT                   /pseudo
FT                   /locus_tag="mCG_50169"
FT                   /note="gene_id=mCG50169.1 transcript_id=mCT50352.1 created
FT                   on 08-APR-2003"
FT   gene            complement(48576422..>48583138)
FT                   /gene="Trmt5"
FT                   /locus_tag="mCG_16401"
FT                   /note="gene_id=mCG16401.2"
FT   mRNA            complement(join(48576422..48577039,48577388..48578039,
FT                   48578995..48579119,48581060..48581700,48582329..48582400,
FT                   48583109..48583135))
FT                   /gene="Trmt5"
FT                   /locus_tag="mCG_16401"
FT                   /product="TRM5 tRNA methyltransferase 5 homolog (S.
FT                   cerevisiae), transcript variant mCT172855"
FT                   /note="gene_id=mCG16401.2 transcript_id=mCT172855.0 created
FT                   on 04-SEP-2002"
FT   mRNA            complement(join(48576423..48577039,48577388..48578039,
FT                   48578995..48579119,48581060..48581700,48583109..>48583138))
FT                   /gene="Trmt5"
FT                   /locus_tag="mCG_16401"
FT                   /product="TRM5 tRNA methyltransferase 5 homolog (S.
FT                   cerevisiae), transcript variant mCT17724"
FT                   /note="gene_id=mCG16401.2 transcript_id=mCT17724.1 created
FT                   on 04-SEP-2002"
FT   CDS             complement(join(48576957..48577039,48577388..48578039,
FT                   48578995..48579119,48581060..48581700,48583109..>48583137))
FT                   /codon_start=1
FT                   /gene="Trmt5"
FT                   /locus_tag="mCG_16401"
FT                   /product="TRM5 tRNA methyltransferase 5 homolog (S.
FT                   cerevisiae), isoform CRA_b"
FT                   /note="gene_id=mCG16401.2 transcript_id=mCT17724.1
FT                   protein_id=mCP3126.1 isoform=CRA_b"
FT                   /protein_id="EDL36512.1"
FT                   /translation="PISELHQSMRIVWKLFGFSRRLLQVEWCHPSESILLFTLVPRLRK
FT                   APSVFLLGQRQGLSTMPEIEASVRDSELFSPPSDVRGMRELDRTAFKKTVSIPVLKARK
FT                   EVVNRLMRALRRVALQRPGIKRVIEDPKDEDSRLIMLDPYRMLTADSFDKAELGVLKEL
FT                   DVSPQLSQYNLELTYENFKSEEILKAVLPEGQDVTSGFSRVGHIAHLNLRDHQLPFKHL
FT                   IGQVMVDKNPGITSAVNKTSNIDNTYRNFQMEVLCGEENMLTKVRENNYTYEFDFSKVY
FT                   WNPRLSTEHGRITELLNPGDVLFDVFAGVGPFAIPAARKNCTVFANDLNPESHKWLLHN
FT                   CKLNKVDQKVKVFNMDGKDFIQGPVREELMLRLGLSAEAKPSVHIVMNLPAKAIEFLSV
FT                   FRSLLDGQPCSTELLPTVHCYCFSKDSDPAKDVRQQAEAVLGVSLETSSSVHLVRNVAP
FT                   NKEMLCITFQIPTATLYRNQSLSLQNDQEPPLKRQKTGDPFSGEPQIASDS"
FT   CDS             complement(join(48576957..48577039,48577388..48578039,
FT                   48578995..48579119,48581060..48581549))
FT                   /codon_start=1
FT                   /gene="Trmt5"
FT                   /locus_tag="mCG_16401"
FT                   /product="TRM5 tRNA methyltransferase 5 homolog (S.
FT                   cerevisiae), isoform CRA_a"
FT                   /note="gene_id=mCG16401.2 transcript_id=mCT172855.0
FT                   protein_id=mCP95774.0 isoform=CRA_a"
FT                   /protein_id="EDL36511.1"
FT                   /translation="MPEIEASVRDSELFSPPSDVRGMRELDRTAFKKTVSIPVLKARKE
FT                   VVNRLMRALRRVALQRPGIKRVIEDPKDEDSRLIMLDPYRMLTADSFDKAELGVLKELD
FT                   VSPQLSQYNLELTYENFKSEEILKAVLPEGQDVTSGFSRVGHIAHLNLRDHQLPFKHLI
FT                   GQVMVDKNPGITSAVNKTSNIDNTYRNFQMEVLCGEENMLTKVRENNYTYEFDFSKVYW
FT                   NPRLSTEHGRITELLNPGDVLFDVFAGVGPFAIPAARKNCTVFANDLNPESHKWLLHNC
FT                   KLNKVDQKVKVFNMDGKDFIQGPVREELMLRLGLSAEAKPSVHIVMNLPAKAIEFLSVF
FT                   RSLLDGQPCSTELLPTVHCYCFSKDSDPAKDVRQQAEAVLGVSLETSSSVHLVRNVAPN
FT                   KEMLCITFQIPTATLYRNQSLSLQNDQEPPLKRQKTGDPFSGEPQIASDS"
FT   gene            48583205..48645211
FT                   /locus_tag="mCG_16402"
FT                   /note="gene_id=mCG16402.2"
FT   mRNA            join(48583205..48583457,48584818..48584948,
FT                   48588584..48588657,48607843..48607895,48611845..48611884,
FT                   48622771..48622849,48629793..48629875,48630281..48630339,
FT                   48634180..48634245,48634479..48634532,48636441..48636520,
FT                   48637565..48637665,48642952..48643076,48644189..48644333,
FT                   48644517..48644611,48644895..48645211)
FT                   /locus_tag="mCG_16402"
FT                   /product="mCG16402"
FT                   /note="gene_id=mCG16402.2 transcript_id=mCT17725.2 created
FT                   on 04-SEP-2002"
FT   CDS             join(48583350..48583457,48584818..48584948,
FT                   48588584..48588657,48607843..48607895,48611845..48611884,
FT                   48622771..48622849,48629793..48629875,48630281..48630339,
FT                   48634180..48634245,48634479..48634532,48636441..48636520,
FT                   48637565..48637665,48642952..48643076,48644189..48644333,
FT                   48644517..48644611,48644895..48644975)
FT                   /codon_start=1
FT                   /locus_tag="mCG_16402"
FT                   /product="mCG16402"
FT                   /note="gene_id=mCG16402.2 transcript_id=mCT17725.2
FT                   protein_id=mCP3168.2"
FT                   /db_xref="GOA:G3UVW3"
FT                   /db_xref="InterPro:IPR013057"
FT                   /db_xref="MGI:MGI:3648156"
FT                   /db_xref="UniProtKB/TrEMBL:G3UVW3"
FT                   /protein_id="EDL36510.1"
FT                   /translation="MQASRHSIQAEPGWYVSAQQPEEAVAADEWSPLLSNEPHRQGSSG
FT                   ASFGLSVFNVMNAIMGSGILGLAYVMANTGILGFSFLLLFVALLASYSVHLLLAMCIHT
FT                   AVTSYEDLGLFAFGLPGKVVVAGTIIIQNIGAMSSYLLIIKTELPAAISEFLPSDHSGS
FT                   WYLDGQMLLIIICVGIVFPLSLLPKIGFLGYTSSLSFFFMVFFALVVVIKKWAVPCPVT
FT                   LDCINEVFQISNATDDCKPKLFHFSKESVYAIPTMAFSFLCHTSVLPIYCELQSPSKKR
FT                   MQNVTNTAIALSFLVYFVSALFGYLTFYDKVESELLQGYSKYLPHDVIVMAVKLCILFA
FT                   VLLTAPLIHFPARKALMMILFSNYPFSWIRHSLTTAALNAIIVVLAIYVPDIRNVFGVV
FT                   GASTSTCLIFVFPGLFYLKLSREDFLSWKKLGALFLLLTGAVVGSFSLVLIIFDWVNK"
FT   gene            complement(48645745..48646450)
FT                   /locus_tag="mCG_1041728"
FT                   /note="gene_id=mCG1041728.1"
FT   mRNA            complement(48645745..48646450)
FT                   /locus_tag="mCG_1041728"
FT                   /product="mCG1041728"
FT                   /note="gene_id=mCG1041728.1 transcript_id=mCT159432.1
FT                   created on 18-SEP-2002"
FT   CDS             complement(48645883..48646254)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041728"
FT                   /product="mCG1041728"
FT                   /note="gene_id=mCG1041728.1 transcript_id=mCT159432.1
FT                   protein_id=mCP78938.1"
FT                   /protein_id="EDL36509.1"
FT                   /translation="MSTLDFSIPGCNTCYTDTRHSFIAGKLQSWSKKSHRIFQFICSIR
FT                   MEMHNYSKKNKGYFFFFKSQMPGMCQDGGRVPNPSTWQEQQQAVCSGDWLTRFGSWQVP
FT                   LKLRLPRSYLDSQMSLHSS"
FT   gene            complement(48656463..48701960)
FT                   /locus_tag="mCG_1041725"
FT                   /note="gene_id=mCG1041725.1"
FT   mRNA            complement(join(48656463..48656723,48663792..48663906,
FT                   48688753..48688903,48701800..48701960))
FT                   /locus_tag="mCG_1041725"
FT                   /product="mCG1041725"
FT                   /note="gene_id=mCG1041725.1 transcript_id=mCT159429.1
FT                   created on 18-SEP-2002"
FT   CDS             complement(join(48688827..48688903,48701800..48701887))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041725"
FT                   /product="mCG1041725"
FT                   /note="gene_id=mCG1041725.1 transcript_id=mCT159429.1
FT                   protein_id=mCP78901.1"
FT                   /protein_id="EDL36508.1"
FT                   /translation="MGSGSWWIVIDLLLWRETPTSWSLLPRHQGFQGTAGPEQGRQGCG
FT                   SPSLVLRRL"
FT   gene            complement(48783187..48801160)
FT                   /locus_tag="mCG_1041723"
FT                   /note="gene_id=mCG1041723.0"
FT   mRNA            complement(join(48783187..48783360,48786257..48786340,
FT                   48799525..48799621,48800948..48801160))
FT                   /locus_tag="mCG_1041723"
FT                   /product="mCG1041723"
FT                   /note="gene_id=mCG1041723.0 transcript_id=mCT159427.0
FT                   created on 18-SEP-2002"
FT   CDS             complement(join(48799546..48799621,48800948..48801057))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041723"
FT                   /product="mCG1041723"
FT                   /note="gene_id=mCG1041723.0 transcript_id=mCT159427.0
FT                   protein_id=mCP78598.1"
FT                   /protein_id="EDL36507.1"
FT                   /translation="MLYFFLSLGKEKLLLNEVSSGSYRGYGRREETALHLGTKLFRISI
FT                   YQQARDLCKQRPAHTS"
FT   gene            complement(48835268..>48836219)
FT                   /locus_tag="mCG_1041611"
FT                   /note="gene_id=mCG1041611.1"
FT   mRNA            complement(48835268..>48836219)
FT                   /locus_tag="mCG_1041611"
FT                   /product="mCG1041611"
FT                   /note="gene_id=mCG1041611.1 transcript_id=mCT159315.1
FT                   created on 12-SEP-2002"
FT   CDS             complement(48835391..>48835600)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041611"
FT                   /product="mCG1041611"
FT                   /note="gene_id=mCG1041611.1 transcript_id=mCT159315.1
FT                   protein_id=mCP78496.0"
FT                   /protein_id="EDL36506.1"
FT                   /translation="LLNVIKFNIRSHFVIFDYEKQNVACTLECFIYYKCLVDQPSPVSG
FT                   KGICFLFFPIQLRVTIFYYHFVEQ"
FT   gene            complement(48836631..48838268)
FT                   /locus_tag="mCG_64446"
FT                   /note="gene_id=mCG64446.2"
FT   mRNA            complement(48836631..48838268)
FT                   /locus_tag="mCG_64446"
FT                   /product="mCG64446"
FT                   /note="gene_id=mCG64446.2 transcript_id=mCT64629.2 created
FT                   on 12-SEP-2002"
FT   CDS             complement(48837144..48838205)
FT                   /codon_start=1
FT                   /locus_tag="mCG_64446"
FT                   /product="mCG64446"
FT                   /note="gene_id=mCG64446.2 transcript_id=mCT64629.2
FT                   protein_id=mCP26304.1"
FT                   /db_xref="GOA:Q0VEI2"
FT                   /db_xref="InterPro:IPR005045"
FT                   /db_xref="MGI:MGI:2442082"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VEI2"
FT                   /protein_id="EDL36505.1"
FT                   /translation="MTWSATARGAHQPDNTAFTQQRLPAWQPLLSAGIALPLFFCAGLA
FT                   FIGLGLGLFYSSNGIKELEYDYTGNPGTGDCSVCAAKGQGRAPPPGCACSWSFTLPELF
FT                   PGPVYLYYELSNFYQNNRRYGVSRDDAQLSGLASALRHPANECAPYQFRSDGLPIAPCG
FT                   AIANSLFNDSFSLWHQRQPSDPFVEVPLDRTAIAWWTDYHVKFRNPPLVNGSLALAFRG
FT                   TAPPPNWHRPVYELSPDPNNTGFINQDFVVWMRTAALPTFRKLYARIRQGNYSAGLPRG
FT                   TYRVNITYNYPVRAFGGHKLIILSNISWMGGKNPFLGIAYLVVGSLCIVMGFVMLVVYI
FT                   RYQDQDDDDNDDE"
FT   gene            48840239..48843749
FT                   /locus_tag="mCG_19201"
FT                   /note="gene_id=mCG19201.1"
FT   mRNA            join(48840239..48840334,48840832..48840904,
FT                   48841959..48842004,48842919..48843749)
FT                   /locus_tag="mCG_19201"
FT                   /product="mCG19201"
FT                   /note="gene_id=mCG19201.1 transcript_id=mCT17282.1 created
FT                   on 18-SEP-2002"
FT   CDS             join(48841964..48842004,48842919..48843141)
FT                   /codon_start=1
FT                   /locus_tag="mCG_19201"
FT                   /product="mCG19201"
FT                   /note="gene_id=mCG19201.1 transcript_id=mCT17282.1
FT                   protein_id=mCP3094.2"
FT                   /protein_id="EDL36504.1"
FT                   /translation="MWLSSILANNLNKRRHPDDNSCYHNTLPISAPQISRLWSAISCPS
FT                   SRIRKTWGLMYTCVPRNRLHDSVLVSGLSVAAASSSQHERFD"
FT   gene            <48877855..49072980
FT                   /gene="Prkch"
FT                   /locus_tag="mCG_19202"
FT                   /note="gene_id=mCG19202.1"
FT   mRNA            join(<48877855..48878276,48944768..48944831,
FT                   48986978..48987128,48988291..48988325,48991654..48991742,
FT                   48993387..48993516,48995651..48995778,48997909..48998052,
FT                   48998210..48998383,49017208..49017362,49054442..49054580,
FT                   49055109..49055297,49071248..49071391,49072769..49072980)
FT                   /gene="Prkch"
FT                   /locus_tag="mCG_19202"
FT                   /product="protein kinase C, eta"
FT                   /note="gene_id=mCG19202.1 transcript_id=mCT17753.1 created
FT                   on 29-AUG-2002"
FT   CDS             join(<48877857..48878276,48944768..48944831,
FT                   48986978..48987128,48988291..48988325,48991654..48991742,
FT                   48993387..48993516,48995651..48995778,48997909..48998052,
FT                   48998210..48998383,49017208..49017362,49054442..49054580,
FT                   49055109..49055297,49071248..49071391,49072769..49072915)
FT                   /codon_start=1
FT                   /gene="Prkch"
FT                   /locus_tag="mCG_19202"
FT                   /product="protein kinase C, eta"
FT                   /note="gene_id=mCG19202.1 transcript_id=mCT17753.1
FT                   protein_id=mCP3256.1"
FT                   /protein_id="EDL36503.1"
FT                   /translation="RVPQCQPARPPRGSGSSAGMSSGTMKFNGYLRVRIGEAVGLQPTR
FT                   WSLRHSLFKKGHQLLDPYLTVSVDQVRVGQTSTKQKTNKPTYNEEFCANVTDGGHLELA
FT                   VFHETPLGYDHFVANCTLQFQELLRTAGTSDTFEGWVDLEPEGKVFVVITLTGSFTEAT
FT                   LQRDRIFKHFTRKRQRAMRRRVHQVNGHKFMATYLRQPTYCSHCREFIWGVFGKQGYQC
FT                   QVCTCVVHKRCHHLIVTACTCQNNINKVDAKIAEQRFGINIPHKFNVHNYKVPTFCDHC
FT                   GSLLWGIMRQGLQCKICKMNVHIRCQANVAPNCGVNAVELAKTLAGMGLQPGNISPTSK
FT                   LISRSTLRRQGKEGSKEGNGIGVNSSSRFGIDNFEFIRVLGKGSFGKVMLARIKETGEL
FT                   YAVKVLKKDVILQDDDVECTMTEKRILSLARNHPFLTQLFCCFQTPDRLFFVMEFVNGG
FT                   DLMFHIQKSRRFDEARARFYAAEIISALMFLHEKGIIYRDLKLDNVLLDHEGHCKLADF
FT                   GMCKEGICNGVTTATFCGTPDYIAPEILQEMLYGPAVDWWAMGVLLYEMLCGHAPFEAE
FT                   NEDDLFEAILNDEVVYPTWLHEDATGILKSFMTKNPTMRLGSLTQGGEHEILRHPFFKE
FT                   IDWAQLNHRQLEPPFRPRIKSREDVSNFDPDFIKEEPVLTPIDEGHLPMINQDEFRNFS
FT                   YVSPELQL"
FT   gene            complement(49141457..49167954)
FT                   /locus_tag="mCG_59525"
FT                   /note="gene_id=mCG59525.1"
FT   mRNA            complement(join(49141457..49141706,49161791..49161936,
FT                   49167854..49167954))
FT                   /locus_tag="mCG_59525"
FT                   /product="mCG59525"
FT                   /note="gene_id=mCG59525.1 transcript_id=mCT59708.1 created
FT                   on 04-SEP-2002"
FT   CDS             complement(join(49141593..49141706,49161791..49161925))
FT                   /codon_start=1
FT                   /locus_tag="mCG_59525"
FT                   /product="mCG59525"
FT                   /note="gene_id=mCG59525.1 transcript_id=mCT59708.1
FT                   protein_id=mCP26338.2"
FT                   /protein_id="EDL36502.1"
FT                   /translation="MPLIPPGGCDTGFHGMDLRIEDMMVGFTRSWRGKEIFSSQRGERK
FT                   VCLCTVYVPGAFGDQKTTLEPLELELQLVNCPVGPGN"
FT   gene            <49206741..49246176
FT                   /gene="Hif1a"
FT                   /locus_tag="mCG_120775"
FT                   /note="gene_id=mCG120775.2"
FT   mRNA            join(<49206741..49207161,49225353..49225546,
FT                   49226786..49226931,49227014..49227098,49229455..49229567,
FT                   49231102..49231304,49235018..49235124,49236472..49236619,
FT                   49238347..49238567,49239158..49239441,49240305..49240469,
FT                   49240578..49241002,49242697..49242805,49243532..49243658,
FT                   49244174..49246176)
FT                   /gene="Hif1a"
FT                   /locus_tag="mCG_120775"
FT                   /product="hypoxia inducible factor 1, alpha subunit,
FT                   transcript variant mCT193474"
FT                   /note="gene_id=mCG120775.2 transcript_id=mCT193474.0
FT                   created on 09-MAR-2004"
FT   mRNA            join(49206784..49207161,49225356..49225546,
FT                   49226786..49226931,49227014..49227098,49229455..49229567,
FT                   49231102..49231304,49235018..49235124,49236472..49236619,
FT                   49238347..49238567,49239158..49239441,49240305..49240469,
FT                   49240578..49241002,49242697..49242805,49243532..49243658,
FT                   49244174..49245513)
FT                   /gene="Hif1a"
FT                   /locus_tag="mCG_120775"
FT                   /product="hypoxia inducible factor 1, alpha subunit,
FT                   transcript variant mCT121967"
FT                   /note="gene_id=mCG120775.2 transcript_id=mCT121967.1
FT                   created on 31-DEC-2002"
FT   CDS             join(<49206926..49207161,49225353..49225546,
FT                   49226786..49226931,49227014..49227098,49229455..49229567,
FT                   49231102..49231304,49235018..49235124,49236472..49236619,
FT                   49238347..49238567,49239158..49239441,49240305..49240469,
FT                   49240578..49241002,49242697..49242805,49243532..49243658,
FT                   49244174..49244325)
FT                   /codon_start=1
FT                   /gene="Hif1a"
FT                   /locus_tag="mCG_120775"
FT                   /product="hypoxia inducible factor 1, alpha subunit,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG120775.2 transcript_id=mCT193474.0
FT                   protein_id=mCP114448.0 isoform=CRA_b"
FT                   /protein_id="EDL36501.1"
FT                   /translation="PEERLGTRAGAQRAQPAAPASPSRGASRLPPRLWTCLFLRARGQS
FT                   RRLGPSEPGGRRPGRQRGHRFAMEGAGGENEKKNRMSSERRKEKSRDAARSRRSKESEV
FT                   FYELAHQLPLPHNVSSHLDKASVMRLTISYLRVRKLLDAGGLDSEDEMKAQMDCFYLKA
FT                   LDGFVMVLTDDGDMVYISDNVNKYMGLTQFELTGHSVFDFTHPCDHEEMREMLTHRNGP
FT                   VRKGKELNTQRSFFLRMKCTLTSRGRTMNIKSATWKVLHCTGHIHVYDTNSNQPQCGYK
FT                   KPPMTCLVLICEPIPHPSNIEIPLDSKTFLSRHSLDMKFSYCDERITELMGYEPEELLG
FT                   RSIYEYYHALDSDHLTKTHHDMFTKGQVTTGQYRMLAKRGGYVWVETQATVIYNTKNSQ
FT                   PQCIVCVNYVVSGIIQHDLIFSLQQTESVLKPVESSDMKMTQLFTKVESEDTSCLFDKL
FT                   KKEPDALTLLAPAAGDTIISLDFGSDDTETEDQQLEDVPLYNDVMFPSSNEKLNINLAM
FT                   SPLPSSETPKPLRSSADPALNQEVALKLESSPESLGLSFTMPQIQDQPASPSDGSTRQS
FT                   SPERLLQENVNTPNFSQPNSPSEYCFDVDSDMVNVFKLELVEKLFAEDTEAKNPFSTQD
FT                   TDLDLEMLAPYIPMDDDFQLRSFDQLSPLESNSPSPPSMSTVTGFQQTQLQKPTITATA
FT                   TTTATTDESKTETKDNKEDIKILIASPSSTQVPQETTTAKASAYSGTHSRTASPDRAGK
FT                   RVIEQTDKAHPRSLNLSATLNQRNTVPEEELNPKTIASQNAQRKRKMEHDGSLFQAAGI
FT                   GTLLQQPGDCAPTMSLSWKRVKGFISSEQNGTEQKTIILIPSDLACRLLGQSMDESGLP
FT                   QLTSYDCEVNAPIQGSRNLLQGEELLRALDQVN"
FT   CDS             join(49207127..49207161,49225356..49225546,
FT                   49226786..49226931,49227014..49227098,49229455..49229567,
FT                   49231102..49231304,49235018..49235124,49236472..49236619,
FT                   49238347..49238567,49239158..49239441,49240305..49240469,
FT                   49240578..49241002,49242697..49242805,49243532..49243658,
FT                   49244174..49244325)
FT                   /codon_start=1
FT                   /gene="Hif1a"
FT                   /locus_tag="mCG_120775"
FT                   /product="hypoxia inducible factor 1, alpha subunit,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG120775.2 transcript_id=mCT121967.1
FT                   protein_id=mCP78620.1 isoform=CRA_a"
FT                   /protein_id="EDL36500.1"
FT                   /translation="MEGAGGENEKKKMSSERRKEKSRDAARSRRSKESEVFYELAHQLP
FT                   LPHNVSSHLDKASVMRLTISYLRVRKLLDAGGLDSEDEMKAQMDCFYLKALDGFVMVLT
FT                   DDGDMVYISDNVNKYMGLTQFELTGHSVFDFTHPCDHEEMREMLTHRNGPVRKGKELNT
FT                   QRSFFLRMKCTLTSRGRTMNIKSATWKVLHCTGHIHVYDTNSNQPQCGYKKPPMTCLVL
FT                   ICEPIPHPSNIEIPLDSKTFLSRHSLDMKFSYCDERITELMGYEPEELLGRSIYEYYHA
FT                   LDSDHLTKTHHDMFTKGQVTTGQYRMLAKRGGYVWVETQATVIYNTKNSQPQCIVCVNY
FT                   VVSGIIQHDLIFSLQQTESVLKPVESSDMKMTQLFTKVESEDTSCLFDKLKKEPDALTL
FT                   LAPAAGDTIISLDFGSDDTETEDQQLEDVPLYNDVMFPSSNEKLNINLAMSPLPSSETP
FT                   KPLRSSADPALNQEVALKLESSPESLGLSFTMPQIQDQPASPSDGSTRQSSPERLLQEN
FT                   VNTPNFSQPNSPSEYCFDVDSDMVNVFKLELVEKLFAEDTEAKNPFSTQDTDLDLEMLA
FT                   PYIPMDDDFQLRSFDQLSPLESNSPSPPSMSTVTGFQQTQLQKPTITATATTTATTDES
FT                   KTETKDNKEDIKILIASPSSTQVPQETTTAKASAYSGTHSRTASPDRAGKRVIEQTDKA
FT                   HPRSLNLSATLNQRNTVPEEELNPKTIASQNAQRKRKMEHDGSLFQAAGIGTLLQQPGD
FT                   CAPTMSLSWKRVKGFISSEQNGTEQKTIILIPSDLACRLLGQSMDESGLPQLTSYDCEV
FT                   NAPIQGSRNLLQGEELLRALDQVN"
FT   gene            complement(49225280..49248418)
FT                   /locus_tag="mCG_1041720"
FT                   /note="gene_id=mCG1041720.2"
FT   mRNA            complement(join(49225280..49225553,49227623..49227901,
FT                   49229214..49229328,49231154..49231292,49232331..49232429,
FT                   49233457..49233840,49248256..49248418))
FT                   /locus_tag="mCG_1041720"
FT                   /product="mCG1041720"
FT                   /note="gene_id=mCG1041720.2 transcript_id=mCT159424.2
FT                   created on 16-JUN-2003"
FT   CDS             complement(join(49227857..49227901,49229214..49229328,
FT                   49231154..49231218))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041720"
FT                   /product="mCG1041720"
FT                   /note="gene_id=mCG1041720.2 transcript_id=mCT159424.2
FT                   protein_id=mCP78564.2"
FT                   /protein_id="EDL36499.1"
FT                   /translation="MRNGFTNQHQARHGWFLVPTLSMSVGLTAPSRESVCKTAVTPWTV
FT                   GGESTLHRINYSSVLYFACMSMGVCQILE"
FT   gene            49259793..49260054
FT                   /locus_tag="mCG_50500"
FT                   /note="gene_id=mCG50500.1"
FT   mRNA            49259793..49260054
FT                   /locus_tag="mCG_50500"
FT                   /product="mCG50500"
FT                   /note="gene_id=mCG50500.1 transcript_id=mCT50683.1 created
FT                   on 12-SEP-2002"
FT   CDS             49259822..49260040
FT                   /codon_start=1
FT                   /locus_tag="mCG_50500"
FT                   /product="mCG50500"
FT                   /note="gene_id=mCG50500.1 transcript_id=mCT50683.1
FT                   protein_id=mCP26286.0"
FT                   /protein_id="EDL36498.1"
FT                   /translation="MPTETERCIESLIAVLQKYSGKDGNGSQLSKTEFLSFMNTELAAF
FT                   TKNQKDPGVLDHMMKKLDLNCDGQLDF"
FT   gene            49263196..49282966
FT                   /gene="Snapc1"
FT                   /locus_tag="mCG_19204"
FT                   /note="gene_id=mCG19204.1"
FT   mRNA            join(49263196..49263381,49266530..49266689,
FT                   49266861..49267001,49268149..49268253,49268803..49268961,
FT                   49270471..49270539,49271123..49271185,49273596..49273746,
FT                   49281053..49281154,49282438..49282966)
FT                   /gene="Snapc1"
FT                   /locus_tag="mCG_19204"
FT                   /product="small nuclear RNA activating complex, polypeptide
FT                   1"
FT                   /note="gene_id=mCG19204.1 transcript_id=mCT17756.1 created
FT                   on 04-SEP-2002"
FT   CDS             join(49263197..49263381,49266530..49266689,
FT                   49266861..49267001,49268149..49268253,49268803..49268961,
FT                   49270471..49270539,49271123..49271185,49273596..49273746,
FT                   49281053..49281154,49282438..49282472)
FT                   /codon_start=1
FT                   /gene="Snapc1"
FT                   /locus_tag="mCG_19204"
FT                   /product="small nuclear RNA activating complex, polypeptide
FT                   1"
FT                   /note="gene_id=mCG19204.1 transcript_id=mCT17756.1
FT                   protein_id=mCP3143.1"
FT                   /protein_id="EDL36497.1"
FT                   /translation="MGTPAGAGTRPTGAGTVEGVGIPPGLQTDYETLLSRFQEMDSVRF
FT                   EDFTELWRSMKFATIFCGKMRNLKKNMFTKEALALAWRYFLPPHTFQIRVGALYLLYGL
FT                   YNTQLCQPKQKIRVALKDWDEVIRFQQDLMNAQHFDAAFVFRKLRLDRAFHFTAMPKLL
FT                   SCRMKKKVQQTEVTQKFKDPNDRVMKLITSDVLEEMLNVHDHYQNMKHAISADKSMPDR
FT                   ALSLVKEDFFENIKNIVLEHQEWHKERKNPSLKPKLKDGEENGEGPSEEPERCERAVSL
FT                   AKIKAKAFSAVVPVSKSRRHRQSKLDSSDSDSGSGQVQGRAAKRKRTREPAGPAGRKRS
FT                   SRSKGNAPNERKEEKSLHLSMPIITEEEEEDMGGVRKAEFTAPKRKRKC"
FT   gene            complement(49332590..49334056)
FT                   /locus_tag="mCG_148251"
FT                   /note="gene_id=mCG148251.0"
FT   mRNA            complement(join(49332590..49333042,49333354..49334056))
FT                   /locus_tag="mCG_148251"
FT                   /product="mCG148251"
FT                   /note="gene_id=mCG148251.0 transcript_id=mCT188514.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(49333380..49333508)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148251"
FT                   /product="mCG148251"
FT                   /note="gene_id=mCG148251.0 transcript_id=mCT188514.0
FT                   protein_id=mCP108085.0"
FT                   /protein_id="EDL36496.1"
FT                   /translation="MAHHQKERDLQGKRGSCNLSTPHFINLESSTREKKHASLLVF"
FT   gene            49427429..49527645
FT                   /locus_tag="mCG_19205"
FT                   /note="gene_id=mCG19205.1"
FT   mRNA            join(49427429..49427611,49520800..49521012,
FT                   49527434..49527645)
FT                   /locus_tag="mCG_19205"
FT                   /product="mCG19205"
FT                   /note="gene_id=mCG19205.1 transcript_id=mCT17755.0 created
FT                   on 04-SEP-2002"
FT   CDS             49527479..49527631
FT                   /codon_start=1
FT                   /locus_tag="mCG_19205"
FT                   /product="mCG19205"
FT                   /note="gene_id=mCG19205.1 transcript_id=mCT17755.0
FT                   protein_id=mCP3162.1"
FT                   /protein_id="EDL36495.1"
FT                   /translation="MKTAPFPFSHNPPSRAGTSGTMALAVRRWAWSEASVVLVQMASWR
FT                   RRQLL"
FT   gene            <49533020..49566155
FT                   /locus_tag="mCG_53849"
FT                   /note="gene_id=mCG53849.1"
FT   mRNA            join(<49533020..49533460,49536392..49536581,
FT                   49564878..49566155)
FT                   /locus_tag="mCG_53849"
FT                   /product="mCG53849"
FT                   /note="gene_id=mCG53849.1 transcript_id=mCT54032.1 created
FT                   on 04-SEP-2002"
FT   CDS             join(<49533020..49533460,49536392..49536581,
FT                   49564878..49565191)
FT                   /codon_start=1
FT                   /locus_tag="mCG_53849"
FT                   /product="mCG53849"
FT                   /note="gene_id=mCG53849.1 transcript_id=mCT54032.1
FT                   protein_id=mCP26264.1"
FT                   /protein_id="EDL36494.1"
FT                   /translation="EQDGTSLQVPHRLLEPISKCGDLDVIFEYRAVTQKLTVTIVRAQG
FT                   LPDKDRSGVNSWQVHIVLLPSKKQRGKTNIQRGPNPVFKEKVTFTKLEPRDVASCAVRF
FT                   RLYAARKMTRERMMGEKLFCLSHLHPEGEMKVTLVLEPRSNLSSGESPLSPSVVSHSDS
FT                   ASSTQSLSHGGVPELLVGLSYNATTGRLSVEMIKGSHFRNLAANRAPDTYGKLFLLNCV
FT                   GQEMSRCKTSIRRGQPNPVYKETFVFQVALFQLSDVTLMISIYSRRTMKRKEMIGWVAL
FT                   GQNSSGEEEQEHWEEMKESKGQQTCRWHTLLES"
FT   gene            <49582520..49594181
FT                   /locus_tag="mCG_146312"
FT                   /note="gene_id=mCG146312.0"
FT   mRNA            join(<49582520..49582696,49583755..49583878,
FT                   49593573..49593688,49593803..49594181)
FT                   /locus_tag="mCG_146312"
FT                   /product="mCG146312"
FT                   /note="gene_id=mCG146312.0 transcript_id=mCT186415.0
FT                   created on 14-JUL-2003"
FT   CDS             join(<49583845..49583878,49593573..49593688,
FT                   49593803..49594177)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146312"
FT                   /product="mCG146312"
FT                   /note="gene_id=mCG146312.0 transcript_id=mCT186415.0
FT                   protein_id=mCP107277.0"
FT                   /protein_id="EDL36493.1"
FT                   /translation="TYTLRSESALPAYPREVLSYSSTTSKVAYFKRKYAEEEDLHQDSH
FT                   GYFPKHLILPEDRTCILKLSLEKLRFLEDPETYLRRSVLINNLLRKIHLETEKESYEYF
FT                   KEAPCYKTAYSDTRKRLKFMVQECCSQSLYYEELHSYHIVPYTSESTIYGMGYTGDHLE
FT                   QNSQLLIYKMN"
FT   gene            complement(50173668..>50181069)
FT                   /locus_tag="mCG_1041556"
FT                   /note="gene_id=mCG1041556.0"
FT   mRNA            complement(join(50173668..50174618,50180980..>50181069))
FT                   /locus_tag="mCG_1041556"
FT                   /product="mCG1041556"
FT                   /note="gene_id=mCG1041556.0 transcript_id=mCT159260.0
FT                   created on 12-SEP-2002"
FT   CDS             complement(join(50173671..50174618,50180980..50181069))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041556"
FT                   /product="mCG1041556"
FT                   /note="gene_id=mCG1041556.0 transcript_id=mCT159260.0
FT                   protein_id=mCP78741.0"
FT                   /protein_id="EDL36492.1"
FT                   /translation="MGSDMNQSQSSRVPGESARPGPPTAGLHRAIIFRKISDVKKEEEE
FT                   RLRQKNEVTLSIPVDHPVRKLFQKFKQQKELRIQGSAQSDPERSQLQVESRPLQNGASI
FT                   TGTSVVTVSQITPIQTSLAYVKTSESLKQNNRDAMELKPNGGAEPKCLKVNSPIRMKNG
FT                   NGKGWLRLKNNMGAQEEKKEDWNNVTKAESMGLLSEDPKGSDSENSVTKNPLRKTDSCD
FT                   SGITKSDLRLDKAGEARSPLEHSPSQADVKHSFYPIPEQALQTTLQEVKHELKEDIQLL
FT                   SCRMTALEKQVAEILKLLSEKSVPQTSSPKPQIPLQVPPQIPCQDIFSVSRPESPESDK
FT                   DEINF"
FT   gene            complement(50240727..>50430500)
FT                   /gene="Kcnh5"
FT                   /locus_tag="mCG_113439"
FT                   /note="gene_id=mCG113439.1"
FT   mRNA            complement(join(50240727..50241085,50252347..50252599,
FT                   50283558..50283757,50363980..50364406,50390733..50391125,
FT                   50396315..50396430,50407292..50407420,50413838..50413944,
FT                   50430377..>50430500))
FT                   /gene="Kcnh5"
FT                   /locus_tag="mCG_113439"
FT                   /product="potassium voltage-gated channel, subfamily H
FT                   (eag-related), member 5"
FT                   /note="gene_id=mCG113439.1 transcript_id=mCT114518.1
FT                   created on 04-SEP-2002"
FT   CDS             complement(join(50240862..50241085,50252347..50252599,
FT                   50283558..50283757,50363980..50364406,50390733..50391125,
FT                   50396315..50396430,50407292..50407420,50413838..50413944,
FT                   50430377..>50430498))
FT                   /codon_start=1
FT                   /gene="Kcnh5"
FT                   /locus_tag="mCG_113439"
FT                   /product="potassium voltage-gated channel, subfamily H
FT                   (eag-related), member 5"
FT                   /note="gene_id=mCG113439.1 transcript_id=mCT114518.1
FT                   protein_id=mCP78745.1"
FT                   /protein_id="EDL36491.1"
FT                   /translation="SSFLLGNAQIVDWPVVYSNDGFCKLSGYHRADVMQKSSTCSFMYG
FT                   ELTDKKTIEKVRQTFDNYESNCFEVLLYKKNRTPVWFYMQIAPIRNEHEKVVLFLCTFK
FT                   DITLFKQPIEDDSTKGWTKFARLTRALTNSRSVLQQLTPMNKTETVHKHSRLAEVLQLG
FT                   SDILPQYKQEAPKTPPHIILHYCAFKTTWDWVILILTFYTAIMVPYNVSFKTKQNNIAW
FT                   LVLDSVVDVIFLVDIVLNFHTTFVGPGGEVISDPKLIRMNYLKTWFVIDLLSCLPYDII
FT                   NAFENVDEGISSLFSSLKVVRLLRLGRVARKLDHYLEYGAAVLVLLVCVFGLVAHWLAC
FT                   IWYSIGDYEVIDEVTNTIQIDSWLYQLALSIGTPYRYNTSAGIWEGGPSKDSLYVSSLY
FT                   FTMTSLTTIGFGNIAPTTDVEKMFSVAMMMVGSLLYATIFGNVTTIFQQMYANTNRYHE
FT                   MLNNVRDFLKLYQVPKGLSERVMDYIVSTWSMSKGIDTEKVLSICPKDMRADICVHLNR
FT                   KVFNEHPAFRLASDGCLRALAVEFQTIHCAPGDLIYHAGESVDALCFVVSGSLEVIQDE
FT                   EVVAILGKGDVFGDIFWKETTLAHACANVRALTYCDLHIIKREALLKVLDFYTAFANSF
FT                   SRNLTLTCNLRKRVCCIFFLL"
FT   gene            <50584607..50670719
FT                   /gene="Rhoj"
FT                   /locus_tag="mCG_48636"
FT                   /note="gene_id=mCG48636.1"
FT   mRNA            join(<50584607..50585183,50651520..50651578,
FT                   50660942..50661106,50663233..50663328,50669371..50670719)
FT                   /gene="Rhoj"
FT                   /locus_tag="mCG_48636"
FT                   /product="ras homolog gene family, member J, transcript
FT                   variant mCT48819"
FT                   /note="gene_id=mCG48636.1 transcript_id=mCT48819.1 created
FT                   on 28-AUG-2002"
FT   mRNA            join(<50584617..50585183,50651520..50651578,
FT                   50660942..50661106,50663233..50667216)
FT                   /gene="Rhoj"
FT                   /locus_tag="mCG_48636"
FT                   /product="ras homolog gene family, member J, transcript
FT                   variant mCT193458"
FT                   /note="gene_id=mCG48636.1 transcript_id=mCT193458.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<50584865..50585183,50651520..50651578,
FT                   50660942..50661106,50663233..50663328,50669371..50669517)
FT                   /codon_start=1
FT                   /gene="Rhoj"
FT                   /locus_tag="mCG_48636"
FT                   /product="ras homolog gene family, member J, isoform CRA_b"
FT                   /note="gene_id=mCG48636.1 transcript_id=mCT48819.1
FT                   protein_id=mCP26336.1 isoform=CRA_b"
FT                   /protein_id="EDL36490.1"
FT                   /translation="AAGLECVWAVPGRARPARVRPPELQPGAGATAPCTAEAPAAAAGA
FT                   ANMSCRERTDSSCGCNGHEENRILKCVVVGDGAVGKTCLLMSYANDAFPEEYVPTVFDH
FT                   YAVTVTVGGKQHLLGLYDTAGQEDYNQLRPLSYPNTDVFLICFSVVNPASYHNVQEEWV
FT                   PELKDCMPHVPYVLIGTQIDLRDDPKTLARLLYMKEKPLTYEHGVKLAKAIGAQCYLEC
FT                   SALTQKGLKAVFDEAILTIFHPKKKKKGCLGCHGCCAII"
FT   CDS             join(<50584865..50585183,50651520..50651578,
FT                   50660942..50661106,50663233..50663334)
FT                   /codon_start=1
FT                   /gene="Rhoj"
FT                   /locus_tag="mCG_48636"
FT                   /product="ras homolog gene family, member J, isoform CRA_a"
FT                   /note="gene_id=mCG48636.1 transcript_id=mCT193458.0
FT                   protein_id=mCP114423.0 isoform=CRA_a"
FT                   /protein_id="EDL36489.1"
FT                   /translation="AAGLECVWAVPGRARPARVRPPELQPGAGATAPCTAEAPAAAAGA
FT                   ANMSCRERTDSSCGCNGHEENRILKCVVVGDGAVGKTCLLMSYANDAFPEEYVPTVFDH
FT                   YAVTVTVGGKQHLLGLYDTAGQEDYNQLRPLSYPNTDVFLICFSVVNPASYHNVQEEWV
FT                   PELKDCMPHVPYVLIGTQIDLRDDPKTLARLLYMKEKPLTYEHGVKLAKAV"
FT   gene            complement(50681974..50686050)
FT                   /gene="Gphb5"
FT                   /locus_tag="mCG_52905"
FT                   /note="gene_id=mCG52905.1"
FT   mRNA            complement(join(50681974..50682285,50684878..50685082,
FT                   50685937..50686050))
FT                   /gene="Gphb5"
FT                   /locus_tag="mCG_52905"
FT                   /product="glycoprotein hormone beta 5"
FT                   /note="gene_id=mCG52905.1 transcript_id=mCT53088.1 created
FT                   on 18-SEP-2002"
FT   CDS             complement(join(50682097..50682285,50684878..50685081))
FT                   /codon_start=1
FT                   /gene="Gphb5"
FT                   /locus_tag="mCG_52905"
FT                   /product="glycoprotein hormone beta 5"
FT                   /note="gene_id=mCG52905.1 transcript_id=mCT53088.1
FT                   protein_id=mCP26292.0"
FT                   /db_xref="GOA:B2RTN6"
FT                   /db_xref="InterPro:IPR001545"
FT                   /db_xref="InterPro:IPR006208"
FT                   /db_xref="InterPro:IPR029034"
FT                   /db_xref="MGI:MGI:2156540"
FT                   /db_xref="UniProtKB/TrEMBL:B2RTN6"
FT                   /protein_id="EDL36488.1"
FT                   /translation="MKLVYLVLGAVALLLLGGPDSVLSSSSGNLHTFVGCAVREFTFMA
FT                   KKPGCRGLRITTDACWGRCETWEKPILEPPYIEAYHRVCTYNETRQVTVKLPNCAPGVD
FT                   PFYTYPMAVRCDCGACSTATTECETI"
FT   gene            complement(50718854..>50878866)
FT                   /gene="Ppp2r5e"
FT                   /locus_tag="mCG_10056"
FT                   /note="gene_id=mCG10056.1"
FT   mRNA            complement(join(50718854..50723203,50729134..50729235,
FT                   50731726..50731853,50734298..50734417,50736052..50736102,
FT                   50737937..50738045,50739157..50739287,50770561..50770653,
FT                   50778843..50778944,50801046..50801242,50878693..>50878866))
FT                   /gene="Ppp2r5e"
FT                   /locus_tag="mCG_10056"
FT                   /product="protein phosphatase 2, regulatory subunit B
FT                   (B56), epsilon isoform"
FT                   /note="gene_id=mCG10056.1 transcript_id=mCT10565.1 created
FT                   on 04-SEP-2002"
FT   CDS             complement(join(50723104..50723203,50729134..50729235,
FT                   50731726..50731853,50734298..50734417,50736052..50736102,
FT                   50737937..50738045,50739157..50739287,50770561..50770653,
FT                   50778843..50778944,50801046..50801242,50878693..>50878864))
FT                   /codon_start=1
FT                   /gene="Ppp2r5e"
FT                   /locus_tag="mCG_10056"
FT                   /product="protein phosphatase 2, regulatory subunit B
FT                   (B56), epsilon isoform"
FT                   /note="gene_id=mCG10056.1 transcript_id=mCT10565.1
FT                   protein_id=mCP3152.0"
FT                   /protein_id="EDL36487.1"
FT                   /translation="RDMSSAPTTPPSVDKVDGFSRKSVRKARQKRSQSSSQFRSQGKPI
FT                   ELTPLPLLKGETHVPTSEQPELFLKKLQQCCVIFDFMDTLSDLKMKEYKRSTLNELVDY
FT                   ITISRGCLTEQTYPEVVRMVSCNIFRTLPPSDSNEFDPEEDEPTLEASWPHLQLVYEFF
FT                   IRFLESQEFQPSIAKKYIDQKFVLQLLELFDSEDPRERDYLKTVLHRIYGKFLGLRAFI
FT                   RKQINNIFLSIINGFALPLKAEHKQFLVKVLIPLHTVRSLSLFHAQVIRGLMKFWPKTC
FT                   SQKEVMFLGELEEILDVIEPSQFVKIQEPLFKQIAKCVSSPHFQVAERALYYWNNEYIM
FT                   SLIEENSNVILPIMFSSLYRISKEHWNPAIVALVYNVLKAFMEMNSTMFDELTATYKSD
FT                   RQREKKKEKEREELWKKLEDLELKRGLRRDGIIPT"
FT   gene            complement(50916361..50916804)
FT                   /locus_tag="mCG_10050"
FT                   /note="gene_id=mCG10050.0"
FT   mRNA            complement(50916361..50916804)
FT                   /locus_tag="mCG_10050"
FT                   /product="mCG10050"
FT                   /note="gene_id=mCG10050.0 transcript_id=mCT10559.0 created
FT                   on 01-APR-2003"
FT   CDS             complement(50916403..50916750)
FT                   /codon_start=1
FT                   /locus_tag="mCG_10050"
FT                   /product="mCG10050"
FT                   /note="gene_id=mCG10050.0 transcript_id=mCT10559.0
FT                   protein_id=mCP3106.1"
FT                   /protein_id="EDL36486.1"
FT                   /translation="MRYVASYLLAALGGNSSPSAKDIKKILGSVGIEADDDRLNKVISE
FT                   LNGKNIEDVIAQGVGKLASVPAGGAVAVSAAPGSAAPAAGSAPAAAEEKKDEKKEESEE
FT                   SDDDMGFGLFD"
FT   gene            complement(50916829..>50954994)
FT                   /locus_tag="mCG_144956"
FT                   /note="gene_id=mCG144956.0"
FT   mRNA            complement(join(50916829..50918940,50926238..50926450,
FT                   50954939..>50954994))
FT                   /locus_tag="mCG_144956"
FT                   /product="mCG144956"
FT                   /note="gene_id=mCG144956.0 transcript_id=mCT184380.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(50917750..50918940,50926238..>50926243))
FT                   /codon_start=1
FT                   /locus_tag="mCG_144956"
FT                   /product="mCG144956"
FT                   /note="gene_id=mCG144956.0 transcript_id=mCT184380.0
FT                   protein_id=mCP105136.0"
FT                   /protein_id="EDL36484.1"
FT                   /translation="IESFIPLDASTDMEKIEDQFASLHIVRRSSEPKEPTYLLGIDTSK
FT                   TVQADKGGLVAVLCSNGSIRIYDKETLHLLREFGGSPGLLSGVSFANSCDSVYSASTDG
FT                   TVKCWDARGASEKPVQLFKGYPSCSFISFDVNCKDHVICAGAEKVDEDALLVFWDARFT
FT                   SQDLSTRDPLGAYSETHSDDITQVRFHPSNPNLVVSGSTDGLVNVFDLSADKEEDALVA
FT                   TCNSVSSVSCIGWCGKDYKQIYCMTHDEGFCWWDLNHLDTDEPITCLNIQDVREITDVK
FT                   DGHLDYLIGGLYHEKMDRLFVIGGTNTGKIHLLSCTSAGLTHVTSLHGGHAATVRSFCW
FT                   NVSEDSLLTGGEDAQLLLWKPGAMEKTFTKKDSLKIASSVQQRVRVHSSDSYKKRKQQ"
FT   gene            50921688..50923182
FT                   /locus_tag="mCG_1041712"
FT                   /note="gene_id=mCG1041712.0"
FT   mRNA            join(50921688..50922244,50923050..50923182)
FT                   /locus_tag="mCG_1041712"
FT                   /product="mCG1041712"
FT                   /note="gene_id=mCG1041712.0 transcript_id=mCT159416.0
FT                   created on 18-SEP-2002"
FT   CDS             50922088..50922192
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041712"
FT                   /product="mCG1041712"
FT                   /note="gene_id=mCG1041712.0 transcript_id=mCT159416.0
FT                   protein_id=mCP78493.1"
FT                   /protein_id="EDL36485.1"
FT                   /translation="MLLGLNDVRITWALLTILSFMIKLKQSSCITLFL"
FT   gene            complement(51004287..51025370)
FT                   /gene="Sgpp1"
FT                   /locus_tag="mCG_10048"
FT                   /note="gene_id=mCG10048.2"
FT   mRNA            complement(join(51004287..51006737,51012488..51012577,
FT                   51024553..51025370))
FT                   /gene="Sgpp1"
FT                   /locus_tag="mCG_10048"
FT                   /product="sphingosine-1-phosphate phosphatase 1, transcript
FT                   variant mCT10557"
FT                   /note="gene_id=mCG10048.2 transcript_id=mCT10557.2 created
FT                   on 13-JUN-2003"
FT   CDS             complement(join(51006186..51006737,51012488..51012577,
FT                   51024553..51025203))
FT                   /codon_start=1
FT                   /gene="Sgpp1"
FT                   /locus_tag="mCG_10048"
FT                   /product="sphingosine-1-phosphate phosphatase 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG10048.2 transcript_id=mCT10557.2
FT                   protein_id=mCP3294.2 isoform=CRA_a partial"
FT                   /db_xref="GOA:Q3UDY2"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="MGI:MGI:2135760"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UDY2"
FT                   /protein_id="EDL36482.1"
FT                   /translation="MSLGQRLALLASRLQEPQRVASFQRLCGVEVPLSSPAADEDAETE
FT                   VRGAPGEPRRRGRQPGAEDSPAKADCCGAPNGVRNGLAAEPGPTGPRRAGSQRRNSLTG
FT                   EEGELVKVSNLPLYYLFCLGTELGNELFYILFFPFWIWNLDPFVGRRLVIIWVLVMYLG
FT                   QCTKDIIRWPRPASPPVIKLEVFYNSEYSMPSTHAMSGTAIPIAMFLLTYGRWQYPLIY
FT                   GLILIPCWSSLVCLSRIYMGMHSILDVIAGFLYTILILIIFYPLVDLIDNFNQTYKYAP
FT                   LIIIGLHLILGIFSFTLDTWSTSRGDTAEILGSGAGIACGSHAAYTLGLSLEPSLHMLP
FT                   LAIPPLTVTLFGKAILRIVLGMLLVLFVRDIMKKITIPLACKLSSIPCHDIRQARQHME
FT                   VELPYRYITYGMVGFSITFLVPYVFSFIGIS"
FT   mRNA            complement(join(51008039..51012577,51024553..51025370))
FT                   /gene="Sgpp1"
FT                   /locus_tag="mCG_10048"
FT                   /product="sphingosine-1-phosphate phosphatase 1, transcript
FT                   variant mCT185332"
FT                   /note="gene_id=mCG10048.2 transcript_id=mCT185332.0 created
FT                   on 13-JUN-2003"
FT   CDS             complement(join(51012422..51012577,51024553..51025203))
FT                   /codon_start=1
FT                   /gene="Sgpp1"
FT                   /locus_tag="mCG_10048"
FT                   /product="sphingosine-1-phosphate phosphatase 1, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG10048.2 transcript_id=mCT185332.0
FT                   protein_id=mCP106590.0 isoform=CRA_b"
FT                   /protein_id="EDL36483.1"
FT                   /translation="MSLGQRLALLASRLQEPQRVASFQRLCGVEVPLSSPAADEDAETE
FT                   VRGAPGEPRRRGRQPGAEDSPAKADCCGAPNGVRNGLAAEPGPTGPRRAGSQRRNSLTG
FT                   EEGELVKVSNLPLYYLFCLGTELGNELFYILFFPFWIWNLDPFVGRRLVIIWVLVMYLG
FT                   QCTKDIIRWPRPASPPVIKLEVFYNSEYSMPSTHAMSGTAIPIAMFLLTYGRWQYPLIY
FT                   GLILIPCWSSLVCLSRIYMGMHSILVRRLCVCVCVCVCVCIHTYKI"
FT   gene            <51108101..>51212630
FT                   /locus_tag="mCG_146314"
FT                   /note="gene_id=mCG146314.0"
FT   mRNA            join(<51108101..51108262,51143845..51143971,
FT                   51167932..51167993,51169719..51169814,51169925..51170002,
FT                   51170091..51170183,51177758..51177945,51179830..51180026,
FT                   51182687..51182787,51186199..51186300,51188748..51188885,
FT                   51193793..51193957,51194841..51194953,51196291..51196453,
FT                   51198449..51198527,51198754..51198941,51200592..51200756,
FT                   51201879..51202001,51204801..51204974,51208126..51208284,
FT                   51208578..51208751,51210727..51210861,51212537..>51212630)
FT                   /locus_tag="mCG_146314"
FT                   /product="mCG146314, transcript variant mCT186417"
FT                   /note="gene_id=mCG146314.0 transcript_id=mCT186417.0
FT                   created on 14-JUL-2003"
FT   mRNA            join(<51108113..51108262,51117388..51117578,
FT                   51143845..51143971,51167932..51167993,51169719..51169814,
FT                   51169925..51170002,51170091..51170183,51177758..51177945,
FT                   51179830..51180026,51182687..51182787,51186199..51186300,
FT                   51188748..51188885,51193793..51193957,51194841..51194953,
FT                   51196291..>51196453)
FT                   /locus_tag="mCG_146314"
FT                   /product="mCG146314, transcript variant mCT193446"
FT                   /note="gene_id=mCG146314.0 transcript_id=mCT193446.0
FT                   created on 09-MAR-2004"
FT   mRNA            join(<51108132..51108262,51143845..51143971,
FT                   51167932..51167993,51169719..51169814,51169925..51170002,
FT                   51170091..51170183,51177758..51177945,51179830..51180026,
FT                   51182687..51182787,51186199..51186300,51188748..51188885,
FT                   51193793..51193957,51194841..51195485)
FT                   /locus_tag="mCG_146314"
FT                   /product="mCG146314, transcript variant mCT193447"
FT                   /note="gene_id=mCG146314.0 transcript_id=mCT193447.0
FT                   created on 09-MAR-2004"
FT   CDS             join(<51143875..51143971,51167932..51167993,
FT                   51169719..51169814,51169925..51170002,51170091..51170183,
FT                   51177758..51177945,51179830..51180026,51182687..51182787,
FT                   51186199..51186300,51188748..51188885,51193793..51193957,
FT                   51194841..51194953,51196291..51196453,51198449..51198527,
FT                   51198754..51198941,51200592..51200756,51201879..51202001,
FT                   51204801..51204974,51208126..51208284,51208578..51208751,
FT                   51210727..51210861,51212537..>51212630)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146314"
FT                   /product="mCG146314, isoform CRA_a"
FT                   /note="gene_id=mCG146314.0 transcript_id=mCT186417.0
FT                   protein_id=mCP107279.0 isoform=CRA_a"
FT                   /protein_id="EDL36478.1"
FT                   /translation="SPLSQSMAASPVLPTEDGEGFLGIDDLHFSLQAEQEDTQKKTFTC
FT                   WINSQLAKHTPPSVVSDLFADIKKGHVLLDLLEVLSGQQLPRDKGSNTFQCRINIEHAL
FT                   TFLKNRSIKLINIHVADIVEGNPSIILGLIWTIILHFHIEKLAQTLSCDYNQPSPEVVS
FT                   VAASSPTSSPPTKKCSKAQAQARWQWSAKKALLQWAQEQCARSESVNVTDFKSSWRNGM
FT                   AFLAVIHALRPDLIDMDSMRHRSNKDNLKEAFRIAEHELKIPKLLEPEDVDVVNPDEKS
FT                   IMTYVAQFLKYSKDAPGPGDSTQAKVRDALVWLTLQEKRFQKMLKDSASETYCNKYHSL
FT                   LSFMESLNEEKESFIDVLSLKGRMGELNEDESRLRQGWTSLMHQVAAWRAQLDDALPSP
FT                   LKETEAWLKDIEGVVQEGVPTSQSYSEARTLIQGKLSSFKSLMGSFDYHSDVLMAFQSN
FT                   AEKSLPAVPPVKLEEMTRRINNVLGKNFIPLLEFHDSKCSVLALLDEAKAKLDVWNGTY
FT                   ESKESVEVLLEDWHKFTGEKKFLIQLDASFQKCEEMYKNSARECESIREEYMMLEKNVH
FT                   SCRQYIHNTKATLQRALMSWATFEEDLALLKASFDLTKKEQIKEVPVETLLQWNTKHTS
FT                   LNEVGSFLIGVSSREVAASISKELRRLNKRWRKFITKTPLELKLPLVKIQDQPPGNSSG
FT                   TSLSKESAMAAEPGGSRGEDVKAAEKQEVEDEESAGQLKVNEEVEGLIKQVTIWESQTK
FT                   SILDLLQHGDHADGSSADTLQHLIAKGSVYEELLARTEDTLQMDVQSPSNLEPFQNVLR
FT                   AGLQAKIQEAKQGVQITMVELSAVLKNLSDEPLELDLGLKVEEAQKELEVSILRAEQLL
FT                   GQRERPGGFLLKYKEALEILNTNSLAKYLRAVEELKRTVPGGAKLQLEEQSRVASAKWE
FT                   PLRHEISLYLQQLKIAIEEEKLRDNIARLEK"
FT   CDS             join(<51143875..51143971,51167932..51167993,
FT                   51169719..51169814,51169925..51170002,51170091..51170183,
FT                   51177758..51177945,51179830..51180026,51182687..51182787,
FT                   51186199..51186300,51188748..51188885,51193793..51193957,
FT                   51194841..51194953,51196291..>51196453)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146314"
FT                   /product="mCG146314, isoform CRA_b"
FT                   /note="gene_id=mCG146314.0 transcript_id=mCT193446.0
FT                   protein_id=mCP114406.0 isoform=CRA_b"
FT                   /protein_id="EDL36479.1"
FT                   /translation="SPLSQSMAASPVLPTEDGEGFLGIDDLHFSLQAEQEDTQKKTFTC
FT                   WINSQLAKHTPPSVVSDLFADIKKGHVLLDLLEVLSGQQLPRDKGSNTFQCRINIEHAL
FT                   TFLKNRSIKLINIHVADIVEGNPSIILGLIWTIILHFHIEKLAQTLSCDYNQPSPEVVS
FT                   VAASSPTSSPPTKKCSKAQAQARWQWSAKKALLQWAQEQCARSESVNVTDFKSSWRNGM
FT                   AFLAVIHALRPDLIDMDSMRHRSNKDNLKEAFRIAEHELKIPKLLEPEDVDVVNPDEKS
FT                   IMTYVAQFLKYSKDAPGPGDSTQAKVRDALVWLTLQEKRFQKMLKDSASETYCNKYHSL
FT                   LSFMESLNEEKESFIDVLSLKGRMGELNEDESRLRQGWTSLMHQVAAWRAQLDDALPSP
FT                   LKETEAWLKDIEGVVQEGVPTSQSYSEARTLIQGKLSSFKSLMGSFDYHSDVLMAFQSN
FT                   AEKSLPAVPPVKLEEMTRRINNVLGKNFIPLLEFHDSKCSVLALLDEAKAKLDVWNGTY
FT                   ESKESVEVLLEDWH"
FT   CDS             join(<51143875..51143971,51167932..51167993,
FT                   51169719..51169814,51169925..51170002,51170091..51170183,
FT                   51177758..51177945,51179830..51180026,51182687..51182787,
FT                   51186199..51186300,51188748..51188885,51193793..51193957,
FT                   51194841..51194990)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146314"
FT                   /product="mCG146314, isoform CRA_c"
FT                   /note="gene_id=mCG146314.0 transcript_id=mCT193447.0
FT                   protein_id=mCP114407.0 isoform=CRA_c"
FT                   /protein_id="EDL36480.1"
FT                   /translation="SPLSQSMAASPVLPTEDGEGFLGIDDLHFSLQAEQEDTQKKTFTC
FT                   WINSQLAKHTPPSVVSDLFADIKKGHVLLDLLEVLSGQQLPRDKGSNTFQCRINIEHAL
FT                   TFLKNRSIKLINIHVADIVEGNPSIILGLIWTIILHFHIEKLAQTLSCDYNQPSPEVVS
FT                   VAASSPTSSPPTKKCSKAQAQARWQWSAKKALLQWAQEQCARSESVNVTDFKSSWRNGM
FT                   AFLAVIHALRPDLIDMDSMRHRSNKDNLKEAFRIAEHELKIPKLLEPEDVDVVNPDEKS
FT                   IMTYVAQFLKYSKDAPGPGDSTQAKVRDALVWLTLQEKRFQKMLKDSASETYCNKYHSL
FT                   LSFMESLNEEKESFIDVLSLKGRMGELNEDESRLRQGWTSLMHQVAAWRAQLDDALPSP
FT                   LKETEAWLKDIEGVVQEGVPTSQSYSEARTLIQGKLSSFKSLMGSFDYHSDVLMAFQSN
FT                   AEKSLPAVPPVKLEEMTRRFVIVPVHKLCE"
FT   gene            51202782..51203469
FT                   /locus_tag="mCG_1041709"
FT                   /note="gene_id=mCG1041709.0"
FT   mRNA            join(51202782..51203367,51203404..51203469)
FT                   /locus_tag="mCG_1041709"
FT                   /product="mCG1041709"
FT                   /note="gene_id=mCG1041709.0 transcript_id=mCT159413.0
FT                   created on 18-SEP-2002"
FT   CDS             51202987..51203250
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041709"
FT                   /product="mCG1041709"
FT                   /note="gene_id=mCG1041709.0 transcript_id=mCT159413.0
FT                   protein_id=mCP78950.0"
FT                   /protein_id="EDL36481.1"
FT                   /translation="MPRPSPRLLPRLAHNSIILYYVYILLCLPHRWLPFPSFIHSIYCK
FT                   SGWQISLLSISQSSLFLLMPHLLVLSQLIGHQFFILTDQKVP"
FT   gene            <51215045..51220917
FT                   /locus_tag="mCG_113442"
FT                   /note="gene_id=mCG113442.1"
FT   mRNA            join(<51215045..51215102,51215254..51215344,
FT                   51216078..51216196,51217005..51217131,51218880..51219037,
FT                   51219323..51219470,51220188..51220917)
FT                   /locus_tag="mCG_113442"
FT                   /product="mCG113442"
FT                   /note="gene_id=mCG113442.1 transcript_id=mCT114524.1
FT                   created on 04-SEP-2002"
FT   CDS             join(<51215255..51215344,51216078..51216196,
FT                   51217005..51217131,51218880..51219037,51219323..51219470,
FT                   51220188..51220775)
FT                   /codon_start=1
FT                   /locus_tag="mCG_113442"
FT                   /product="mCG113442"
FT                   /note="gene_id=mCG113442.1 transcript_id=mCT114524.1
FT                   protein_id=mCP78790.1"
FT                   /protein_id="EDL36477.1"
FT                   /translation="SALITTENGRRDADGEVPLEIPDNQLSTEKAMEPIKNFSQTSELK
FT                   PQQEESIMEKEGKDCSASLSDLQERYDTQRGLLEQHLQDSKSRVTSDFASEQERSSACL
FT                   QSKLAELQVLLADTDAHWEKFEITSLNLRRLMSDAEKPVLNQERDLLKGNEQVLHGLLN
FT                   TRMESLEMALQIVLPLEKECSLLCASDLPLCTVAVQDLHPVEIDGVYQNLRDIRDSIAK
FT                   QIRVCTSLEEPSNSVPRELHTLDQCAIQDIVLKCRLQLETMNQKVEMREDALDALEGFL
FT                   ASLRAAKLSAELPADRPAPKAPEVLSEDILLMKEKAGPLDERLRTLGINIKDAEGGENT
FT                   TCERLVGALSVNLVAMDGQSKEEGPPEDKKLLEACSSKNLELFKNIQDLQNQISKIGLK
FT                   DPTAPAVKHR"
FT   gene            <51223460..>51229730
FT                   /locus_tag="mCG_1041610"
FT                   /note="gene_id=mCG1041610.0"
FT   mRNA            join(<51223460..51223639,51224095..51224284,
FT                   51226950..51227108,51228262..51228423,51229533..>51229730)
FT                   /locus_tag="mCG_1041610"
FT                   /product="mCG1041610"
FT                   /note="gene_id=mCG1041610.0 transcript_id=mCT159314.0
FT                   created on 12-SEP-2002"
FT   CDS             join(<51223461..51223639,51224095..51224284,
FT                   51226950..51227108,51228262..51228423,51229533..51229730)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041610"
FT                   /product="mCG1041610"
FT                   /note="gene_id=mCG1041610.0 transcript_id=mCT159314.0
FT                   protein_id=mCP78488.0"
FT                   /protein_id="EDL36476.1"
FT                   /translation="KKSLLRLDKDLDGLEEEKVRIQKIAGSLPRFKDGSEKNVIQQCED
FT                   TAALWESTKASVTESLEQCGSALELLRQYQNIKNNLTALIQKEEGIISQQASYMGKDNL
FT                   KKKIAEVSLPFKRAVRCGDIETVKEEFSDHLEVVDKINQICKNLQYHLNKMKTFEDPPF
FT                   EKEANAIVDRWLDINEKTEEYGENLGRALALWDKLFIIKNNIDEWTEQILGKAESHELT
FT                   EEDRGRLKEELKVLEEQSAEFSRRVADIQSLLQSNEKPLELQVWEVGFRSQWKILCPFE
FT                   NGSHSPHILNLNRK"
FT   gene            <51239104..51257871
FT                   /locus_tag="mCG_10046"
FT                   /note="gene_id=mCG10046.2"
FT   mRNA            join(<51239104..51239135,51240893..51241057,
FT                   51242640..51242981,51252474..51252629,51253624..51253889,
FT                   51255606..51257871)
FT                   /locus_tag="mCG_10046"
FT                   /product="mCG10046"
FT                   /note="gene_id=mCG10046.2 transcript_id=mCT10555.2 created
FT                   on 04-SEP-2002"
FT   CDS             join(<51239106..51239135,51240893..51241057,
FT                   51242640..51242981,51252474..51252629,51253624..51253889,
FT                   51255606..51257724)
FT                   /codon_start=1
FT                   /locus_tag="mCG_10046"
FT                   /product="mCG10046"
FT                   /note="gene_id=mCG10046.2 transcript_id=mCT10555.2
FT                   protein_id=mCP3174.2"
FT                   /protein_id="EDL36475.1"
FT                   /translation="LHESLLQQLQDSVQKLEGHVQEHSSYQVCLTDLSSTLDDISKEYF
FT                   SLCDGSKDQIMAKERMQKLQELESRLRFQGGALKKASALAKSIKQNTSSVGQKIIKDDI
FT                   RSLKYKQKDLENRIESAKQETENGLNSILKSKSSTEKHVKFSLPVEEMPATSEVPKPTR
FT                   ESAAVGESGGARETNTNSAVEMILSKQLSLNVQESMQNAQDEREVNELQNQPLELDIML
FT                   RNEQLKGMEELSTHLEARRAAIELLEQSQHLNQTEEQALVLPAARPSVCHLGSLQQELH
FT                   TLKKTKERQYGLLSGFQDQLVMAEASLNTSLAEVESLKIGSLDSATYLGKIKKFLGSVE
FT                   NQQGSLSKLRTEWAHLSSLLAAADQKLVESQMKHLEHGWELVEQLAHRKCFQQATEHSE
FT                   LTCLLEKLQDLKVSLHQQQQRLTLSLNSPGQQAAIVDMVTPAAELQAIKCEFSGLKWQA
FT                   ELHMKRLWGEKDKKTLEDAINNLNKQMEALEPLNREVENRIKKCELQNRIKETLSWVKN
FT                   TMAELVVPIALLPDNILSQIRKCKLIHDGILGNQQAVELLVEEVRGITPSLAPCEGDGL
FT                   NALLEDLQSQHQALLLKSTERSQQLELKLEEKSKLFAIIGKVQLTLEESETLMSPTGDR
FT                   ASTEAELERRLAILKASQQQLQDTESALSAHLQELTNAYKDANVFERLFLDDQLKNLKA
FT                   RTNRTQRFLQNNGSELKQKMESYREFHDKAAVLQKEAECILHGGLLPLRQELEQDAKEQ
FT                   LGNLRDKLAAIRGSLSQVLTSEEVFDTIGLSWDGSLLARLQTQVLEREREVEGKIKQLD
FT                   TFLIARDRHQASISKIRAVDLQIKKGAESLLKVPSMSPESTLLNAQTLIQKIEKSKRLR
FT                   DEIIRKLSKNEAFDDSFKESEMQRLKLCAEENSRLQEALQNMLLELQPREMGEKEFREK
FT                   LENALHVLKQIQSRLQQPLCVNLGVQHIQHEKETWEAFGEQVEAEMCGLRAVRITEEQR
FT                   EENDSGTGGMEAKLRDIEGLHMELSKSISLRAVSCL"
FT   gene            <51294507..>51313136
FT                   /locus_tag="mCG_1041608"
FT                   /note="gene_id=mCG1041608.0"
FT   mRNA            join(<51294507..51294729,51295365..51295405,
FT                   51298783..51298899,51305441..51305671,51310295..51310477,
FT                   51313011..>51313136)
FT                   /locus_tag="mCG_1041608"
FT                   /product="mCG1041608"
FT                   /note="gene_id=mCG1041608.0 transcript_id=mCT159312.0
FT                   created on 12-SEP-2002"
FT   CDS             join(51294507..51294729,51295365..51295405,
FT                   51298783..51298899,51305441..51305671,51310295..51310477,
FT                   51313011..51313136)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041608"
FT                   /product="mCG1041608"
FT                   /note="gene_id=mCG1041608.0 transcript_id=mCT159312.0
FT                   protein_id=mCP78955.0"
FT                   /protein_id="EDL36474.1"
FT                   /translation="MMPTTLSEQGEMERLEKQILNLNQKKEDLLVDLKTAVLNLHEHLK
FT                   QEQQEVGDKPSAGASECTVAERDASERKVVVKEEAEESSVKSEDADGRISTCDSSMVHI
FT                   IAPDSGSTEEGPAPSPRLSQTDEGATPPIEAALLDFPREQGAFESTVERSRPRPADILR
FT                   VCKTQVAKLELWLQQANVAFEPETVDADMQQVVEEELAGCQAMLTEIEYKVASLLETCK
FT                   DQGLGDCGTTQQEAEALSWKLKTVKCNLEKVQMVLQEKFSEDQILELKPSEQKDLIKFT
FT                   ELNAKKTWLQGHQENEDANRQSASR"
FT   gene            <51334322..51390728
FT                   /locus_tag="mCG_10044"
FT                   /note="gene_id=mCG10044.2"
FT   mRNA            join(<51334322..51334528,51336319..51336498,
FT                   51337033..51337161,51338999..51339153,51339249..51339393,
FT                   51339718..51339812,51341155..51341389,51343618..51343812,
FT                   51346040..51346165,51351692..51351847,51354006..51354164,
FT                   51355310..51355476,51367255..51367417,51373798..51373985,
FT                   51374559..51374709,51375009..51375191,51376387..51376524,
FT                   51377401..51377595,51378747..51379029,51379545..51379613,
FT                   51380546..51380685,51382522..51382624,51383574..51383776,
FT                   51384792..51384992,51385816..51385944,51387311..51387502,
FT                   51387971..51388042,51388694..51388737,51389650..51390728)
FT                   /locus_tag="mCG_10044"
FT                   /product="mCG10044, transcript variant mCT10553"
FT                   /note="gene_id=mCG10044.2 transcript_id=mCT10553.2 created
FT                   on 28-FEB-2003"
FT   CDS             join(<51334322..51334528,51336319..51336498,
FT                   51337033..51337161,51338999..51339153,51339249..51339393,
FT                   51339718..51339812,51341155..51341389,51343618..51343812,
FT                   51346040..51346165,51351692..51351847,51354006..51354164,
FT                   51355310..51355476,51367255..51367417,51373798..51373985,
FT                   51374559..51374709,51375009..51375191,51376387..51376524,
FT                   51377401..51377595,51378747..51379029,51379545..51379613,
FT                   51380546..51380685,51382522..51382624,51383574..51383776,
FT                   51384792..51384992,51385816..51385944,51387311..51387502,
FT                   51387971..51388042,51388694..51388737,51389650..51389872)
FT                   /codon_start=1
FT                   /locus_tag="mCG_10044"
FT                   /product="mCG10044, isoform CRA_a"
FT                   /note="gene_id=mCG10044.2 transcript_id=mCT10553.2
FT                   protein_id=mCP3103.2 isoform=CRA_a"
FT                   /protein_id="EDL36471.1"
FT                   /translation="RWTQVNQDLADQLQEARGQLQLWKAPHNAHAEAAAWLQQQEAKFQ
FT                   QLANTNLSGDNLADILPRALKDIKGLQSDLQKTKEAFLENSTLSDQLPQPEERSTPGLH
FT                   SGQRHSLQTAAYLEKMLLAKSNEFEIVLAQFKDFTDRLAYSKDLIVHKEENLNKLYHEE
FT                   KEEVPDLFLNHVLALTAQSPDIERLNEESLRLPLSDVTIKTLQSLNRQWIRATATALDH
FT                   YSELQGNGLNEKFLHYCERWIQVLEKIQESLSVEVAHSLPALLEQQKTYEILEAEVSTN
FT                   QAVADAYVTQSLQLLDTAEIEKRPEFVSEFSKLSDQWQRAARGVRQRKCDISRLVTQWR
FT                   FFTTSVEDLLRFLADTSQLLSAVKEQDCYSLCQTRRLVHELKSKEIHLQRWRTTYALAL
FT                   EAGEKLRNTPSPETREFVDGQISRLQESWKDTELSLGEVISRLQSTAETWDQCKKKIKK
FT                   LKKRLQALKAQSEDPLPELHEALHEEKELIKEVEKSLANWTHSLKELQTMKADLSQHIL
FT                   AEDVTVLKEQIQLLHRQWEDLCLRVAIRKQEIEDRLNSWIVFNEKNKELCAWLVQMENK
FT                   VLQTADVSIEEMIEKLQKDCMEEISLFTENKLQLKQMGDQLIKASSKAKAAELEEKLSK
FT                   INDRWQHLFDVIGSRVKKLKETFAFIQQLDKNMSNLRTWLARIESELSKPVVYDVCDNQ
FT                   EIQKRLAEQQDLQRDIEQHSAGVESVFNICDVLLHDSDACANETECDSIQQTTRSLDRR
FT                   WRNICAMSMERRMKIEETWRLWQKFLDDYSRFEDWLKSAERTAACPNSSEVLYTNAKEE
FT                   LKRFEAFQRQIHERLTQLELINKQYRRLARENRTDTASKLKQMVHEGNQRWDNLQKRVT
FT                   AILRRLRYFTNQREEFEGTRESILVWLTEMDLQLTNVEHFSESDAEDKMRQLNGFQQEI
FT                   TLNTNKIDQLIVFGEQLIQKSEPLDAVLIEDELEELHRYCQEVFGRVSRFHRRLTSHTP
FT                   GLDDEKEASENETDIEDPREIQADSWCKRRESEEPTSPQSLCHLVPPALGHERSGCETP
FT                   VSVDSIPLEWDHTGDVGGSSSHEDDEEGPFYSALSDVEIPENPEAYLKMTTKSLQASSG
FT                   KSISEGHPWHVPDSPSHSKHHYKHMEGDRTEAPVPTDASTPFKSDYVKLLLRQGTDDSK
FT                   EGLKEAQQEDEQLATLTGQQPGAFDRWELIQAQELHSKLRLKQTVQQLKSDIGSIAAWL
FT                   GKTEAELEALKLAEPPSDIQEIALRVKRLQEILKAFDTYKALMVSVNVSHKEYLPSQSP
FT                   EATELQNRLHQLSLSWDSVQGVLDNWRGDLRQSLMQCQDFHQLSQDLLLWLATAESRRQ
FT                   KAHVTSPEADRQVLLECQKDLMRLEKELVARQPQVSSLREISSSLLVKGQGEDYIEAEE
FT                   KVHVIEKKLKQLQEQVAQDLMSLQRSLDPDASLTSFDEVDSGEQLPAAFAKFGVEEEEE
FT                   EEETDSRMPHLDSPGSSQPRRSFLSRVIRAALPLQLLLLLLLLLACLLPASEDDYSCTQ
FT                   ANNFARSFYPMLRYTNGPPPT"
FT   mRNA            join(<51341153..51341389,51343618..51343812,
FT                   51346040..51346165,51351692..51351847,51354006..51354164,
FT                   51355310..51355476,51367255..51367417,51373798..51373985,
FT                   51374559..51374709,51375009..51375191,51376387..51376524,
FT                   51377401..51377595,51378747..51379029,51380546..51380685,
FT                   51382522..51382624,51383574..51383776,51384792..51384992,
FT                   51385816..51385944,51387311..51387502,51387971..51388042,
FT                   51388691..51388737,51389650..51390728)
FT                   /locus_tag="mCG_10044"
FT                   /product="mCG10044, transcript variant mCT193443"
FT                   /note="gene_id=mCG10044.2 transcript_id=mCT193443.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<51341153..51341389,51343618..51343812,
FT                   51346040..51346165,51351692..51351847,51354006..51354164,
FT                   51355310..51355476,51367255..51367417,51373798..51373985,
FT                   51374559..51374709,51375009..51375191,51376387..51376524,
FT                   51377401..51377595,51378747..51379029,51380546..51380685,
FT                   51382522..51382624,51383574..51383776,51384792..51384992,
FT                   51385816..51385944,51387311..51387502,51387971..51388042,
FT                   51388691..51388737,51389650..51389872)
FT                   /codon_start=1
FT                   /locus_tag="mCG_10044"
FT                   /product="mCG10044, isoform CRA_c"
FT                   /note="gene_id=mCG10044.2 transcript_id=mCT193443.0
FT                   protein_id=mCP114395.0 isoform=CRA_c"
FT                   /protein_id="EDL36473.1"
FT                   /translation="RPEFVSEFSKLSDQWQRAARGVRQRKCDISRLVTQWRFFTTSVED
FT                   LLRFLADTSQLLSAVKEQDCYSLCQTRRLVHELKSKEIHLQRWRTTYALALEAGEKLRN
FT                   TPSPETREFVDGQISRLQESWKDTELSLGEVISRLQSTAETWDQCKKKIKKLKKRLQAL
FT                   KAQSEDPLPELHEALHEEKELIKEVEKSLANWTHSLKELQTMKADLSQHILAEDVTVLK
FT                   EQIQLLHRQWEDLCLRVAIRKQEIEDRLNSWIVFNEKNKELCAWLVQMENKVLQTADVS
FT                   IEEMIEKLQKDCMEEISLFTENKLQLKQMGDQLIKASSKAKAAELEEKLSKINDRWQHL
FT                   FDVIGSRVKKLKETFAFIQQLDKNMSNLRTWLARIESELSKPVVYDVCDNQEIQKRLAE
FT                   QQDLQRDIEQHSAGVESVFNICDVLLHDSDACANETECDSIQQTTRSLDRRWRNICAMS
FT                   MERRMKIEETWRLWQKFLDDYSRFEDWLKSAERTAACPNSSEVLYTNAKEELKRFEAFQ
FT                   RQIHERLTQLELINKQYRRLARENRTDTASKLKQMVHEGNQRWDNLQKRVTAILRRLRY
FT                   FTNQREEFEGTRESILVWLTEMDLQLTNVEHFSESDAEDKMRQLNGFQQEITLNTNKID
FT                   QLIVFGEQLIQKSEPLDAVLIEDELEELHRYCQEVFGRVSRFHRRLTSHTPGLDDEKEA
FT                   SENETDIEDPREIQADSWCKRRESEEPTSPQSLCHLVPPALGHERSGCETPVSVDSIPL
FT                   EWDHTGDVGGSSSHEDDEEGPFYSALSGKSISEGHPWHVPDSPSHSKHHYKHMEGDRTE
FT                   APVPTDASTPFKSDYVKLLLRQGTDDSKEGLKEAQQEDEQLATLTGQQPGAFDRWELIQ
FT                   AQELHSKLRLKQTVQQLKSDIGSIAAWLGKTEAELEALKLAEPPSDIQEIALRVKRLQE
FT                   ILKAFDTYKALMVSVNVSHKEYLPSQSPEATELQNRLHQLSLSWDSVQGVLDNWRGDLR
FT                   QSLMQCQDFHQLSQDLLLWLATAESRRQKAHVTSPEADRQVLLECQKDLMRLEKELVAR
FT                   QPQVSSLREISSSLLVKGQGEDYIEAEEKVHVIEKKLKQLQEQVAQDLMSLQRSLDPDA
FT                   SLTSFDEVDSGEQLPAAFAKQFGVEEEEEEEETDSRMPHLDSPGSSQPRRSFLSRVIRA
FT                   ALPLQLLLLLLLLLACLLPASEDDYSCTQANNFARSFYPMLRYTNGPPPT"
FT   mRNA            join(<51355438..51355476,51367255..51367417,
FT                   51373798..51373985,51374559..51374709,51375009..51375191,
FT                   51376387..51376524,51377401..51377595,51378747..51379029,
FT                   51380546..51380685,51382522..51382624,51383574..51383776,
FT                   51384792..51384992,51385816..51385944,51387311..51387502,
FT                   51387971..51388042,51388694..51388737,51389650..51390728)
FT                   /locus_tag="mCG_10044"
FT                   /product="mCG10044, transcript variant mCT180771"
FT                   /note="gene_id=mCG10044.2 transcript_id=mCT180771.0 created
FT                   on 28-FEB-2003"
FT   CDS             join(<51355439..51355476,51367255..51367417,
FT                   51373798..51373985,51374559..51374709,51375009..51375191,
FT                   51376387..51376524,51377401..51377595,51378747..51379029,
FT                   51380546..51380685,51382522..51382624,51383574..51383776,
FT                   51384792..51384992,51385816..51385944,51387311..51387502,
FT                   51387971..51388042,51388694..51388737,51389650..51389872)
FT                   /codon_start=1
FT                   /locus_tag="mCG_10044"
FT                   /product="mCG10044, isoform CRA_b"
FT                   /note="gene_id=mCG10044.2 transcript_id=mCT180771.0
FT                   protein_id=mCP103693.0 isoform=CRA_b"
FT                   /protein_id="EDL36472.1"
FT                   /translation="DRWQHLFDVIGSRVKKLKETFAFIQQLDKNMSNLRTWLARIESEL
FT                   SKPVVYDVCDNQEIQKRLAEQQDLQRDIEQHSAGVESVFNICDVLLHDSDACANETECD
FT                   SIQQTTRSLDRRWRNICAMSMERRMKIEETWRLWQKFLDDYSRFEDWLKSAERTAACPN
FT                   SSEVLYTNAKEELKRFEAFQRQIHERLTQLELINKQYRRLARENRTDTASKLKQMVHEG
FT                   NQRWDNLQKRVTAILRRLRYFTNQREEFEGTRESILVWLTEMDLQLTNVEHFSESDAED
FT                   KMRQLNGFQQEITLNTNKIDQLIVFGEQLIQKSEPLDAVLIEDELEELHRYCQEVFGRV
FT                   SRFHRRLTSHTPGLDDEKEASENETDIEDPREIQADSWCKRRESEEPTSPQSLCHLVPP
FT                   ALGHERSGCETPVSVDSIPLEWDHTGDVGGSSSHEDDEEGPFYSALSGKSISEGHPWHV
FT                   PDSPSHSKHHYKHMEGDRTEAPVPTDASTPFKSDYVKLLLRQGTDDSKEGLKEAQQEDE
FT                   QLATLTGQQPGAFDRWELIQAQELHSKLRLKQTVQQLKSDIGSIAAWLGKTEAELEALK
FT                   LAEPPSDIQEIALRVKRLQEILKAFDTYKALMVSVNVSHKEYLPSQSPEATELQNRLHQ
FT                   LSLSWDSVQGVLDNWRGDLRQSLMQCQDFHQLSQDLLLWLATAESRRQKAHVTSPEADR
FT                   QVLLECQKDLMRLEKELVARQPQVSSLREISSSLLVKGQGEDYIEAEEKVHVIEKKLKQ
FT                   LQEQVAQDLMSLQRSLDPDASLTSFDEVDSGEQLPAAFAKFGVEEEEEEEETDSRMPHL
FT                   DSPGSSQPRRSFLSRVIRAALPLQLLLLLLLLLACLLPASEDDYSCTQANNFARSFYPM
FT                   LRYTNGPPPT"
FT   gene            complement(51400281..51456433)
FT                   /gene="Esr2"
FT                   /locus_tag="mCG_10047"
FT                   /note="gene_id=mCG10047.2"
FT   mRNA            complement(join(51400281..51401778,51403009..51403189,
FT                   51413563..51413696,51421099..51421237,51425004..51425303,
FT                   51445120..51445292,51446928..51447380,51456120..51456433))
FT                   /gene="Esr2"
FT                   /locus_tag="mCG_10047"
FT                   /product="estrogen receptor 2 (beta), transcript variant
FT                   mCT10556"
FT                   /note="gene_id=mCG10047.2 transcript_id=mCT10556.2 created
FT                   on 28-SEP-2004"
FT   mRNA            complement(join(51400281..51401778,51403009..51403189,
FT                   51413563..51413696,51419963..51420016,51421099..51421237,
FT                   51425004..51425303,51445120..51445292,51446928..51447380,
FT                   51456120..51456433))
FT                   /gene="Esr2"
FT                   /locus_tag="mCG_10047"
FT                   /product="estrogen receptor 2 (beta), transcript variant
FT                   mCT194528"
FT                   /note="gene_id=mCG10047.2 transcript_id=mCT194528.0 created
FT                   on 28-SEP-2004"
FT   CDS             complement(join(51401592..51401778,51403009..51403189,
FT                   51413563..51413696,51421099..51421237,51425004..51425303,
FT                   51445120..51445292,51446928..51447346))
FT                   /codon_start=1
FT                   /gene="Esr2"
FT                   /locus_tag="mCG_10047"
FT                   /product="estrogen receptor 2 (beta), isoform CRA_a"
FT                   /note="gene_id=mCG10047.2 transcript_id=mCT10556.2
FT                   protein_id=mCP3289.2 isoform=CRA_a"
FT                   /protein_id="EDL36469.1"
FT                   /translation="MSICASSHKDFSQLRPTQDMEIKNSPSSLTSPASYNCSQSILPLE
FT                   HGPIYIPSSYVESRHEYSAMTFYSPAVMNYSVPSSTGNLEGGPVRQTASPNVLWPTSGH
FT                   LSPLATHCQSSLLYAEPQKSPWCEARSLEHTLPVNRETLKRKLGGSGCASPVTSPSAKR
FT                   DAHFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQGSRRERCGYRIVRRQRSASEQVHCL
FT                   NKAKRTSGHTPRVKELLLNSLSPEQLVLTLLEAEPPNVLVSRPSMPFTEASMMMSLTKL
FT                   ADKELVHMIGWAKKIPGFVELSLLDQVRLLESCWMEVLMVGLMWRSIDHPGKLIFAPDL
FT                   VLDRDEGKCVEGILEIFDMLLATTARFRELKLQHKEYLCVKAMILLNSSMYPLATASQE
FT                   AESSRKLTHLLNAVTDALVWVISKSGISSQQQSVRLANLLMLLSHVRHISNKGMEHLLS
FT                   MKCKNVVPVYDLLLEMLNAHTLRGYKSSISGSECCSTEDSKSKEGSQNLQSQ"
FT   CDS             complement(join(51401592..51401778,51403009..51403189,
FT                   51413563..51413696,51419963..51420016,51421099..51421237,
FT                   51425004..51425303,51445120..51445292,51446928..51447346))
FT                   /codon_start=1
FT                   /gene="Esr2"
FT                   /locus_tag="mCG_10047"
FT                   /product="estrogen receptor 2 (beta), isoform CRA_b"
FT                   /note="gene_id=mCG10047.2 transcript_id=mCT194528.0
FT                   protein_id=mCP115557.0 isoform=CRA_b"
FT                   /protein_id="EDL36470.1"
FT                   /translation="MSICASSHKDFSQLRPTQDMEIKNSPSSLTSPASYNCSQSILPLE
FT                   HGPIYIPSSYVESRHEYSAMTFYSPAVMNYSVPSSTGNLEGGPVRQTASPNVLWPTSGH
FT                   LSPLATHCQSSLLYAEPQKSPWCEARSLEHTLPVNRETLKRKLGGSGCASPVTSPSAKR
FT                   DAHFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQGSRRERCGYRIVRRQRSASEQVHCL
FT                   NKAKRTSGHTPRVKELLLNSLSPEQLVLTLLEAEPPNVLVSRPSMPFTEASMMMSLTKL
FT                   ADKELVHMIGWAKKIPGFVELSLLDQVRLLESCWMEVLMVGLMWRSIDHPGKLIFAPDL
FT                   VLDRSSEDPHWHVAQTKSAVPRDEGKCVEGILEIFDMLLATTARFRELKLQHKEYLCVK
FT                   AMILLNSSMYPLATASQEAESSRKLTHLLNAVTDALVWVISKSGISSQQQSVRLANLLM
FT                   LLSHVRHISNKGMEHLLSMKCKNVVPVYDLLLEMLNAHTLRGYKSSISGSECCSTEDSK
FT                   SKEGSQNLQSQ"
FT   gene            complement(51477971..>51522570)
FT                   /gene="Tex21"
FT                   /locus_tag="mCG_123932"
FT                   /note="gene_id=mCG123932.0"
FT   mRNA            complement(join(51477971..51478230,51483381..51483599,
FT                   51486077..51486283,51491708..51491890,51493737..51494042,
FT                   51496303..51496434,51515262..51515390,51520844..51521194,
FT                   51522491..>51522570))
FT                   /gene="Tex21"
FT                   /locus_tag="mCG_123932"
FT                   /product="testis expressed gene 21"
FT                   /note="gene_id=mCG123932.0 transcript_id=mCT125167.0
FT                   created on 28-AUG-2002"
FT   CDS             complement(join(51478072..51478230,51483381..51483599,
FT                   51486077..51486283,51491708..51491890,51493737..51494042,
FT                   51496303..51496434,51515262..51515390,51520844..>51521035))
FT                   /codon_start=1
FT                   /gene="Tex21"
FT                   /locus_tag="mCG_123932"
FT                   /product="testis expressed gene 21"
FT                   /note="gene_id=mCG123932.0 transcript_id=mCT125167.0
FT                   protein_id=mCP79069.0"
FT                   /protein_id="EDL36468.1"
FT                   /translation="RHCGSPLVDLLYASCASNMSRPLQPVSHSDPGRLANSQTKEACEA
FT                   KPPEARHLSHLSARENVPVACFDPPLEMDPTGNPIIHNKKAADPVHPDLASMLVKNKTL
FT                   LAEREHLVGREEIKAELLEKRRSCPSSFSPYMNLKGPEDSLDIFPVKDNDEVYNLKRGS
FT                   VVYSEGPIDGQTTGDKCQQDLIHQEKLTSELDRAPFSCGWETTPEQSHHQDFLGQLATL
FT                   LSDSIGPILATEEAVKERIQEMGANEQSWKCKAEALQQEIQTLTKRLEQLYRLYEEAQT
FT                   EENYTEQERPLGPLEGKVAVSCSLRNLDVGRKKENSRTRTAHIDKHSKFKKLEMLLDIE
FT                   QNSKMAAAPRMEEKIQRLQKQLSDLKLSNKNMKTQLTRINVLKDKTIERLRQSVTKVET
FT                   LKEKTAAKTDNLKTPSDPAEQGARPEKERAHQTPAQSLPDPSTVRAVLKGLSGREQELA
FT                   DFREAIMKMLGFNMKTADKDVINRLKLVVQIYEISKRSKMASHCEPGQAK"
FT   gene            51531263..51595845
FT                   /gene="Mthfd1"
FT                   /locus_tag="mCG_10057"
FT                   /note="gene_id=mCG10057.1"
FT   mRNA            join(51531263..51531507,51546312..51546340,
FT                   51546379..51546463,51555348..51555407,51556101..51556154,
FT                   51556324..51556460,51556573..51556673,51558832..51558968,
FT                   51559876..51559987,51564946..51565073,51565496..51565593,
FT                   51565750..51565923,51567046..51567182,51569456..51569502,
FT                   51570205..51570312,51570422..51570496,51573549..51573651,
FT                   51576455..51576531,51577325..51577465,51579026..51579094,
FT                   51579701..51579812,51579909..51580048,51583258..51583299,
FT                   51586933..51587033,51587830..51588007,51590426..51590533,
FT                   51590974..51591126,51593632..51593725,51595618..51595845)
FT                   /gene="Mthfd1"
FT                   /locus_tag="mCG_10057"
FT                   /product="methylenetetrahydrofolate dehydrogenase (NADP+
FT                   dependent), methenyltetrahydrofolate cyclohydrolase,
FT                   formyltetrahydrofolate synthase, transcript variant
FT                   mCT10566"
FT                   /note="gene_id=mCG10057.1 transcript_id=mCT10566.2 created
FT                   on 26-MAR-2003"
FT   mRNA            join(<51531398..51531507,51546379..51546463,
FT                   51555348..51555407,51556101..51556154,51556324..51556460,
FT                   51556573..51556673,51558832..51558968,51559876..51559987,
FT                   51564946..51565073,51565496..51565593,51565750..51565923,
FT                   51567046..51567182,51569456..51569502,51570205..51570312,
FT                   51570422..51570496,51573549..51573651,51576455..51576531,
FT                   51577325..51577465,51579026..51579094,51579701..51579812,
FT                   51579909..51580048,51583258..51583299,51586933..51587033,
FT                   51587830..51588007,51590426..51590533,51590974..51591126,
FT                   51593632..51593725,51595618..51595839)
FT                   /gene="Mthfd1"
FT                   /locus_tag="mCG_10057"
FT                   /product="methylenetetrahydrofolate dehydrogenase (NADP+
FT                   dependent), methenyltetrahydrofolate cyclohydrolase,
FT                   formyltetrahydrofolate synthase, transcript variant
FT                   mCT193459"
FT                   /note="gene_id=mCG10057.1 transcript_id=mCT193459.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<51531425..51531507,51546379..51546463,
FT                   51555348..51555407,51556101..51556154,51556324..51556460,
FT                   51556573..51556673,51558832..51558968,51559876..51559987,
FT                   51564946..51565073,51565496..51565593,51565750..51565923,
FT                   51567046..51567182,51569456..51569502,51570205..51570312,
FT                   51570422..51570496,51573549..51573651,51576455..51576531,
FT                   51577325..51577465,51579026..51579094,51579701..51579812,
FT                   51579909..51580048,51583258..51583299,51586933..51587033,
FT                   51587830..51588007,51590426..51590533,51590974..51591126,
FT                   51593632..51593721)
FT                   /codon_start=1
FT                   /gene="Mthfd1"
FT                   /locus_tag="mCG_10057"
FT                   /product="methylenetetrahydrofolate dehydrogenase (NADP+
FT                   dependent), methenyltetrahydrofolate cyclohydrolase,
FT                   formyltetrahydrofolate synthase, isoform CRA_b"
FT                   /note="gene_id=mCG10057.1 transcript_id=mCT193459.0
FT                   protein_id=mCP114396.0 isoform=CRA_b"
FT                   /protein_id="EDL36467.1"
FT                   /translation="FLLVFTVGGRLAKAMAPAGILNGKLVSAQIRDRLKNQVTRMQEQV
FT                   PGFTPGLAILQVGDRDDSNLYINVKLKAAEEIGIKATHIKLPRTSTESEVLKYVISLNE
FT                   DASVHGFIVQLPLDSENSINTEAVINAIAPEKDVDGLTSVSAGKLARGDLNDCFIPCTP
FT                   KGCLELIKEAGVQIAGRHAVVVGRSKIVGAPMHDLLLWNNATVTTCHSKTANLDKEVNK
FT                   GDILVVATGQPEMVKGEWIKPGAVVIDCGINYVPDDTKPNGRKVVGDVAYDEAKERASF
FT                   ITPVPGGVGPMTVAMLMQSTVESAQRFLQKFKPGKWTIQYNKLNLKTPVPSDIAISRSC
FT                   KPKLIGNLAREIGLLTEEVELYGETKAKVLLSALDRLKHQPDGKYVVVTGITPTPLGEG
FT                   KSTTTIGLVQALGAHLRQNVFACVRQPSQGPTFGIKGGAAGGGYSQVIPMEEFNLHLTG
FT                   DIHAITAANNLVAAAIDARIFHELTQTDKALFNRLVPSVNGIRKFSDIQIRRLRRLGIE
FT                   KTDPTTLTDDEINRFARLDIDPETITWQRVLDTNDRFLRKITIGQSPTEKGHTRTAQFD
FT                   ISVASEIMAVLALTSSLEDMRERLGRMVVASSKKGEPISCEDLGVSGALTVLMKDAIKP
FT                   NLMQTLEGTPVFVHAGPFANIAHGNSSIIADRIALKLVGPEGFVVTEAGFGADIGMEKF
FT                   FNIKCRYSGLQPHVVVLVATVRALKMHGGGPTVTAGLPLPKAYTEEDLDLVEKGFSNLR
FT                   KQIENARMFGVPVVVAVNVFKTDTDAELDLVSRLSREHGAFDAVKCTHWAEGGQGALAL
FT                   AQAVQRASQAPSSFQLLYDLKLSIEDKIRIIAQRIYGADDIELLPEAQNKAEIYTKQGF
FT                   GNLPICMAKTHLSLSHNPEQKGVPTGFVLPIRDIRASVGAGFLYPLVGTMSTMPGLPTR
FT                   PCFYDIDLDPETEQVNGLF"
FT   CDS             join(51546336..51546340,51546379..51546463,
FT                   51555348..51555407,51556101..51556154,51556324..51556460,
FT                   51556573..51556673,51558832..51558968,51559876..51559987,
FT                   51564946..51565073,51565496..51565593,51565750..51565923,
FT                   51567046..51567182,51569456..51569502,51570205..51570312,
FT                   51570422..51570496,51573549..51573651,51576455..51576531,
FT                   51577325..51577465,51579026..51579094,51579701..51579812,
FT                   51579909..51580048,51583258..51583299,51586933..51587033,
FT                   51587830..51588007,51590426..51590533,51590974..51591126,
FT                   51593632..51593721)
FT                   /codon_start=1
FT                   /gene="Mthfd1"
FT                   /locus_tag="mCG_10057"
FT                   /product="methylenetetrahydrofolate dehydrogenase (NADP+
FT                   dependent), methenyltetrahydrofolate cyclohydrolase,
FT                   formyltetrahydrofolate synthase, isoform CRA_a"
FT                   /note="gene_id=mCG10057.1 transcript_id=mCT10566.2
FT                   protein_id=mCP3177.2 isoform=CRA_a"
FT                   /protein_id="EDL36466.1"
FT                   /translation="MKQIRDRLKNQVTRMQEQVPGFTPGLAILQVGDRDDSNLYINVKL
FT                   KAAEEIGIKATHIKLPRTSTESEVLKYVISLNEDASVHGFIVQLPLDSENSINTEAVIN
FT                   AIAPEKDVDGLTSVSAGKLARGDLNDCFIPCTPKGCLELIKEAGVQIAGRHAVVVGRSK
FT                   IVGAPMHDLLLWNNATVTTCHSKTANLDKEVNKGDILVVATGQPEMVKGEWIKPGAVVI
FT                   DCGINYVPDDTKPNGRKVVGDVAYDEAKERASFITPVPGGVGPMTVAMLMQSTVESAQR
FT                   FLQKFKPGKWTIQYNKLNLKTPVPSDIAISRSCKPKLIGNLAREIGLLTEEVELYGETK
FT                   AKVLLSALDRLKHQPDGKYVVVTGITPTPLGEGKSTTTIGLVQALGAHLRQNVFACVRQ
FT                   PSQGPTFGIKGGAAGGGYSQVIPMEEFNLHLTGDIHAITAANNLVAAAIDARIFHELTQ
FT                   TDKALFNRLVPSVNGIRKFSDIQIRRLRRLGIEKTDPTTLTDDEINRFARLDIDPETIT
FT                   WQRVLDTNDRFLRKITIGQSPTEKGHTRTAQFDISVASEIMAVLALTSSLEDMRERLGR
FT                   MVVASSKKGEPISCEDLGVSGALTVLMKDAIKPNLMQTLEGTPVFVHAGPFANIAHGNS
FT                   SIIADRIALKLVGPEGFVVTEAGFGADIGMEKFFNIKCRYSGLQPHVVVLVATVRALKM
FT                   HGGGPTVTAGLPLPKAYTEEDLDLVEKGFSNLRKQIENARMFGVPVVVAVNVFKTDTDA
FT                   ELDLVSRLSREHGAFDAVKCTHWAEGGQGALALAQAVQRASQAPSSFQLLYDLKLSIED
FT                   KIRIIAQRIYGADDIELLPEAQNKAEIYTKQGFGNLPICMAKTHLSLSHNPEQKGVPTG
FT                   FVLPIRDIRASVGAGFLYPLVGTMSTMPGLPTRPCFYDIDLDPETEQVNGLF"
FT   gene            <51603852..>51606017
FT                   /locus_tag="mCG_52906"
FT                   /note="gene_id=mCG52906.1"
FT   mRNA            <51603852..>51606017
FT                   /locus_tag="mCG_52906"
FT                   /product="mCG52906"
FT                   /note="gene_id=mCG52906.1 transcript_id=mCT53089.1 created
FT                   on 12-SEP-2002"
FT   CDS             51603852..51606017
FT                   /codon_start=1
FT                   /locus_tag="mCG_52906"
FT                   /product="mCG52906"
FT                   /note="gene_id=mCG52906.1 transcript_id=mCT53089.1
FT                   protein_id=mCP26321.1"
FT                   /protein_id="EDL36465.1"
FT                   /translation="METSVSEIQVETKDEKGPVAASPQKERQERKTATLCFKRRKKANK
FT                   TKPKAGSRTAEETKKHTPEAGGSGQRQPAGAWASIKGLVTHRKRSEPAKKQKPPEAEVQ
FT                   PEDGALPKKKAKSRLKFPCLRFSRGAKRSRHSKLTEDSGYVRVQGEADDLEIKAQTQPD
FT                   DQAIQAGSTQGLQEGVLVRDGKKSQESHISNSVTSGENVIAIELELENKSSAIQMGTPE
FT                   LEKETKVITEKPSVQTQRASLLESSAAGSPRSVTSAAPPSPATTHQHSLEEPSNGIRES
FT                   APSGKDDRRKTAAEEKKSGETALGQAEEAAVGQADKRALSQAGEATAGHPEEATVIQAE
FT                   SQAKEGKLSQAEETTVAQAKETVLSQAKEGELSQAKKATVGQAEEATIDHTEKVTVDQA
FT                   EETTVGQAEEATVGQAGEAILSQAKEATVVGQAEEATVDRAEEATVGQAEEATVGHTEK
FT                   VTVDQAEEATVGQAEEATVGQAEEATVDRAEKPTVGQAEEATVGQAEEATVGHTEKVTV
FT                   DQAEEATVGQAEEATVGHTEKVTVDHAEEATVGQAEEATVGQAEKVTVDHAEEATVGQA
FT                   EEATVGQAEKVTVDQAEEPTVDQAEEAISSHAPDLKENGIDTEKPRSEESKRMEPIAII
FT                   ITDTEISEFDVKKSKNVPKQFLISMENEQVGVFANDSDFEGRTSEQYETLLIETASSLV
FT                   KNAIELSVEQLVNEMVSEDNQINTLFQ"
FT   gene            complement(51619868..51622958)
FT                   /locus_tag="mCG_1041707"
FT                   /note="gene_id=mCG1041707.0"
FT   mRNA            complement(join(51619868..51620093,51622475..51622958))
FT                   /locus_tag="mCG_1041707"
FT                   /product="mCG1041707"
FT                   /note="gene_id=mCG1041707.0 transcript_id=mCT159411.0
FT                   created on 18-SEP-2002"
FT   CDS             complement(join(51620062..51620093,51622475..51622694))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041707"
FT                   /product="mCG1041707"
FT                   /note="gene_id=mCG1041707.0 transcript_id=mCT159411.0
FT                   protein_id=mCP78924.1 partial"
FT                   /protein_id="EDL36464.1"
FT                   /translation="MQNEQLQAHSVRLSLKNLRHQNLENSCGCWNQTRSSAGAASTLKH
FT                   RISLSCSFCLFEVMSYYMAHNGLGLETTPPAGRGGAHL"
FT   gene            complement(51624787..51645719)
FT                   /locus_tag="mCG_10049"
FT                   /note="gene_id=mCG10049.1"
FT   mRNA            complement(join(51624787..51626478,51632093..51632272,
FT                   51645645..51645719))
FT                   /locus_tag="mCG_10049"
FT                   /product="mCG10049"
FT                   /note="gene_id=mCG10049.1 transcript_id=mCT10558.1 created
FT                   on 25-MAR-2003"
FT   CDS             complement(join(51625332..51626478,51632093..51632265))
FT                   /codon_start=1
FT                   /locus_tag="mCG_10049"
FT                   /product="mCG10049"
FT                   /note="gene_id=mCG10049.1 transcript_id=mCT10558.1
FT                   protein_id=mCP3178.1"
FT                   /db_xref="GOA:G3UW50"
FT                   /db_xref="InterPro:IPR000210"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="InterPro:IPR013069"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="MGI:MGI:99197"
FT                   /db_xref="UniProtKB/TrEMBL:G3UW50"
FT                   /protein_id="EDL36463.1"
FT                   /translation="MDTASHSLVLLQQLNMQREFGFLCDCTVAIGDVYFKAHRAVLAAF
FT                   SNYFKMIFIHQTSECIKIQPADIQPDIFSYLLHIMYTGKGPKQIVDHSRLEEGIRFLHA
FT                   DYLSHIATEMNQVFSPETVQTSNLYGIQISTTQKTAVKQGLEIKETPPSSSGNRAAVPG
FT                   DHPQLQLSLAIGLDDGSGAEQQRTHPAAQAVEEHQKPPVSIKQERCDPESVISQSHSSS
FT                   SSEVTGPSFTENSIKVHLCHYCGERFESRSNLRQHLHTHVSRSLPFGVPASILESNDLG
FT                   EVHPLSDSSEALECRRLSSFIVKENEQQQPSPEHSSRGTSEPLQISQVSLISKDTEPVE
FT                   LNCNFSFSRKRKISCTICGHKFLRKSQLLEHMYTHKGKSYRYNRCQRFGNSLAQRFQQY
FT                   CDSWPDVPLKSSRLSQEHLDLPCALESELTQAGVDTILVE"
FT   gene            <51646696..51664946
FT                   /gene="Zbtb1"
FT                   /locus_tag="mCG_10058"
FT                   /note="gene_id=mCG10058.2"
FT   mRNA            join(<51646696..51646854,51661344..51664946)
FT                   /gene="Zbtb1"
FT                   /locus_tag="mCG_10058"
FT                   /product="zinc finger and BTB domain containing 1"
FT                   /note="gene_id=mCG10058.2 transcript_id=mCT10567.2 created
FT                   on 04-SEP-2002"
FT   CDS             join(<51646823..51646854,51661344..51663501)
FT                   /codon_start=1
FT                   /gene="Zbtb1"
FT                   /locus_tag="mCG_10058"
FT                   /product="zinc finger and BTB domain containing 1"
FT                   /note="gene_id=mCG10058.2 transcript_id=mCT10567.2
FT                   protein_id=mCP3284.0"
FT                   /protein_id="EDL36462.1"
FT                   /translation="NLRSRASHRARSSQQKMAKPSHSSYVLQQLNNQREWGFLCDCCIA
FT                   IDDIYFQAHKAVLAACSSYFRMFFMNHQHSTAQLNLSNMKISAECFDLILQFMYLGKIM
FT                   TAPSSFEQFKVAMNYLQLYNVPDCLEDIQDADCSSSKCSSSASSRQSSKMIFGVRMYED
FT                   TVARNGNEANRWCAEPSSTVNTPHHREPEEESLQLANFPEPLFDVCKKSSVSKLSTPKE
FT                   RVSRRFGRSFTCDSCGFGFSCEKLLDEHVLTCTNRHSYQNTTRAYHRIVDIRDGKDSNI
FT                   KAELAEKDSSKTFSAQPDKYREDANQAPDDSASTTGSRKSTVEAGIAGEEKSRATETKR
FT                   IIIKMEPEDIPADDMKDFNIIKVTEKDCNESTDNDELEDEPEEPFYRYYVEEDVGIKKS
FT                   GRKTLKPRMSISVDERGGLENMRPPNNTSPIQEDAENASCELCGLTITEEDLSSHYLAK
FT                   HIENICACGKCGQILVKGRQLQEHAQRCGEPQDLTMNGLGNADEKMDMEENPDEQSEIR
FT                   DMFVEMLDDFRDNHYQINSIQKKQLFKHSACPFRCPNCGQRFETENLVVEHMSSCLDQD
FT                   MFKGAIMEENERDHRRKHFCNLCGKGFYQRCHLREHYTVHTKEKQFVCQTCGKQFLRER
FT                   QLRLHNDMHKGMARYVCSICDQGNFRKHDHVRHMISHLSGGETICQVCFQIFPNNEQLE
FT                   QHMDVHLYTCGICGAKFNLRKDMRSHYNAKHLKRT"
FT   gene            complement(51678875..51679773)
FT                   /locus_tag="mCG_148247"
FT                   /note="gene_id=mCG148247.0"
FT   mRNA            complement(join(51678875..51679013,51679275..51679773))
FT                   /locus_tag="mCG_148247"
FT                   /product="mCG148247"
FT                   /note="gene_id=mCG148247.0 transcript_id=mCT188510.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(51679433..51679531)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148247"
FT                   /product="mCG148247"
FT                   /note="gene_id=mCG148247.0 transcript_id=mCT188510.0
FT                   protein_id=mCP108081.0"
FT                   /protein_id="EDL36461.1"
FT                   /translation="MKKSLWHLFSRNLRIILESILWNKGVGRSWLL"
FT   gene            51680300..>51682553
FT                   /gene="Hspa2"
FT                   /locus_tag="mCG_7922"
FT                   /note="gene_id=mCG7922.1"
FT   mRNA            join(51680300..51680407,51680647..>51682553)
FT                   /gene="Hspa2"
FT                   /locus_tag="mCG_7922"
FT                   /product="heat shock protein 2"
FT                   /note="gene_id=mCG7922.1 transcript_id=mCT6737.1 created on
FT                   09-APR-2003"
FT   CDS             51680652..51682553
FT                   /codon_start=1
FT                   /gene="Hspa2"
FT                   /locus_tag="mCG_7922"
FT                   /product="heat shock protein 2"
FT                   /note="gene_id=mCG7922.1 transcript_id=mCT6737.1
FT                   protein_id=mCP3097.0"
FT                   /db_xref="GOA:P17156"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="MGI:MGI:96243"
FT                   /db_xref="UniProtKB/Swiss-Prot:P17156"
FT                   /protein_id="EDL36460.1"
FT                   /translation="MSARGPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAF
FT                   TDTERLIGDAAKNQVAMNPTNTIFDAKRLIGRKFEDATVQSDMKHWPFRVVSEGGKPKV
FT                   QVEYKGEMKTFFPEEISSMVLTKMKEIAEAYLGGKVQSAVITVPAYFNDSQRQATKDAG
FT                   TITGLNVLRIINEPTAAAIAYGLDKKGCAGGEKNVLIFDLGGGTFDVSILTIEDGIFEV
FT                   KSTAGDTHLGGEDFDNRMVSHLAEEFKRKHKKDIGPNKRAVRRLRTACERAKRTLSSST
FT                   QASIEIDSLYEGVDFYTSITRARFEELNADLFRGTLEPVEKALRDAKLDKGQIQEIVLV
FT                   GGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILIGDKSENVQDLLLLDV
FT                   TPLSLGIETAGGVMTPLIKRNTTIPTKQTQTFTTYSDNQSSVLVQVYEGERAMTKDNNL
FT                   LGKFDLTGIPPAPRGVPQIEVTFDIDANGILNVTAADKSTGKENKITITNDKGRLSKDD
FT                   IDRMVQEAERYKSEDEANRDRVAAKNAVESYTYNIKQTVEDEKLRGKISEQDKNKILDK
FT                   CQEVINWLDRNQMAEKDEYEHKQKELERVCNPIISKLYQGGPGGGGSSGGPTIEEVD"
FT   gene            <51694684..51716422
FT                   /locus_tag="mCG_7918"
FT                   /note="gene_id=mCG7918.1"
FT   mRNA            join(<51694684..51694777,51695990..51696054,
FT                   51703781..51703867,51704826..51704923,51705021..51705087,
FT                   51705776..51705874,51713084..51713171,51714897..51715075,
FT                   51715306..51715494,51716060..51716422)
FT                   /locus_tag="mCG_7918"
FT                   /product="mCG7918, transcript variant mCT6739"
FT                   /note="gene_id=mCG7918.1 transcript_id=mCT6739.1 created on
FT                   04-SEP-2002"
FT   mRNA            join(<51694684..51694777,51695990..51696054,
FT                   51703781..51703867,51704826..51704923,51705021..51705087,
FT                   51705776..51705874,51713084..>51713245)
FT                   /locus_tag="mCG_7918"
FT                   /product="mCG7918, transcript variant mCT193482"
FT                   /note="gene_id=mCG7918.1 transcript_id=mCT193482.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<51694685..51694777,51695990..51696054,
FT                   51703781..51703867,51704826..51704923,51705021..51705087,
FT                   51705776..51705874,51713084..51713171,51714897..51715075,
FT                   51715306..51715494,51716060..51716246)
FT                   /codon_start=1
FT                   /locus_tag="mCG_7918"
FT                   /product="mCG7918, isoform CRA_c"
FT                   /note="gene_id=mCG7918.1 transcript_id=mCT6739.1
FT                   protein_id=mCP3113.1 isoform=CRA_c"
FT                   /protein_id="EDL36459.1"
FT                   /translation="GVMVKSEAMFTVPEFYSRRKQFVGQSSTRLDQCGLRLGMWYWKDE
FT                   TKTLEFKSFTPAIELKEKGKKGKAVHFAEMDSGASERLTDKRFASRDEKAAKALEKRSQ
FT                   QGNVTLDDVKFVALLSLQDTEMQRICSFTTFLRNKNLDSFLMALLYYLSYYLQRLSMEK
FT                   NPQSRVVGLIEKKEVELVVNKLEDAQKYLAQKYCILSFYTFCTCIAWIVFRRQYLTEIE
FT                   EEVGRLFRTNMFNIPRRKHEDEASGGEKKRMTLVQFRRMMAKRPAIKKAVDMRSPVLST
FT                   LLPSLREKAQHITEKKYVAGIKLQPREENIITDLESVAMPIVGILGEPRNLFNPNTLLP
FT                   LELEENTKPSGRSSSIVETNNTKIQNTLSLVMSKLASPSTCPK"
FT   CDS             join(<51694685..51694777,51695990..51696054,
FT                   51703781..51703867,51704826..51704923,51705021..51705087,
FT                   51705776..51705874,51713084..>51713245)
FT                   /codon_start=1
FT                   /locus_tag="mCG_7918"
FT                   /product="mCG7918, isoform CRA_a"
FT                   /note="gene_id=mCG7918.1 transcript_id=mCT193482.0
FT                   protein_id=mCP114480.0 isoform=CRA_a"
FT                   /protein_id="EDL36457.1"
FT                   /translation="GVMVKSEAMFTVPEFYSRRKQFVGQSSTRLDQCGLRLGMWYWKDE
FT                   TKTLEFKSFTPAIELKEKGKKGKAVHFAEMDSGASERLTDKRFASRDEKAAKALEKRSQ
FT                   QGNVTLDDVKFVALLSLQDTEMQRICSFTTFLRNKNLDSFLMALLYYLSYYLQRLSMEK
FT                   NPQSRVVGLIEKKEVELVVNKLEDAQKYLAQKYCILVLGLGMADKHHLSCGKYACASAA
FT                   LR"
FT   mRNA            join(<51695990..51696054,51703781..51703867,
FT                   51704826..51704923,51705021..51705087,51705776..51705874,
FT                   51713084..51713218,51714537..51714579,51714897..>51715076)
FT                   /locus_tag="mCG_7918"
FT                   /product="mCG7918, transcript variant mCT193483"
FT                   /note="gene_id=mCG7918.1 transcript_id=mCT193483.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<51695990..51696054,51703781..51703867,
FT                   51704826..51704923,51705021..51705087,51705776..51705874,
FT                   51713084..51713218,51714537..51714579,51714897..>51715076)
FT                   /codon_start=1
FT                   /locus_tag="mCG_7918"
FT                   /product="mCG7918, isoform CRA_b"
FT                   /note="gene_id=mCG7918.1 transcript_id=mCT193483.0
FT                   protein_id=mCP114481.0 isoform=CRA_b"
FT                   /protein_id="EDL36458.1"
FT                   /translation="QCGLRLGMWYWKDETKTLEFKSFTPAIELKEKGKKGKAVHFAEMD
FT                   SGASERLTDKRFASRDEKAAKALEKRSQQGNVTLDDVKFVALLSLQDTEMQRICSFTTF
FT                   LRNKNLDSFLMALLYYLSYYLQRLSMEKNPQSRVVGLIEKKEVELVVNKLEDAQKYLAQ
FT                   KYCILVLGLGMADKHHLSCGKEKISDTQKDWKFFESFYTFCTCIAWIVFRRQYLTEIEE
FT                   EVGRLFRTNMFNIPRRKHEDEASGGEKKRMTLVQFR"
FT   gene            51721431..51726707
FT                   /locus_tag="mCG_7921"
FT                   /note="gene_id=mCG7921.1"
FT   mRNA            join(51721431..51721555,51724865..51725043,
FT                   51726601..51726707)
FT                   /locus_tag="mCG_7921"
FT                   /product="mCG7921"
FT                   /note="gene_id=mCG7921.1 transcript_id=mCT6736.1 created on
FT                   18-SEP-2002"
FT   CDS             join(51721474..51721555,51724865..51724971)
FT                   /codon_start=1
FT                   /locus_tag="mCG_7921"
FT                   /product="mCG7921"
FT                   /note="gene_id=mCG7921.1 transcript_id=mCT6736.1
FT                   protein_id=mCP3166.2"
FT                   /protein_id="EDL36456.1"
FT                   /translation="MATEKGPSDVRSCSQLCRLAGLEPSDTGAALWPNIPVSSGLGTNR
FT                   DCFLPEKQTLQITSGSS"
FT   gene            51810802..51845402
FT                   /locus_tag="mCG_7917"
FT                   /note="gene_id=mCG7917.2"
FT   mRNA            join(51810802..51811037,51837473..51837862,
FT                   51839551..51839648,51841100..51841169,51841442..51841488,
FT                   51841602..51841752,51841847..51841978,51842143..51842325,
FT                   51842504..51842596,51842837..51842923,51843129..51843162,
FT                   51843513..51845402)
FT                   /locus_tag="mCG_7917"
FT                   /product="mCG7917, transcript variant mCT125178"
FT                   /note="gene_id=mCG7917.2 transcript_id=mCT125178.1 created
FT                   on 02-APR-2003"
FT   CDS             join(51837512..51837862,51839551..51839648,
FT                   51841100..51841169,51841442..51841488,51841602..51841752,
FT                   51841847..51841978,51842143..51842325,51842504..51842596,
FT                   51842837..51842923,51843129..51843162,51843513..51844150)
FT                   /codon_start=1
FT                   /locus_tag="mCG_7917"
FT                   /product="mCG7917, isoform CRA_a"
FT                   /note="gene_id=mCG7917.2 transcript_id=mCT125178.1
FT                   protein_id=mCP79091.1 isoform=CRA_a"
FT                   /protein_id="EDL36454.1"
FT                   /translation="MPVSTALHQDGSQERPRSLVSTTSSSGSSRDSHSAMEEPTGSEAS
FT                   AQNGTGSPWDRHVPNSNNNSSGWLNMKGPLSPFNGRAGTSPAYHKLSYLGRVVREIVET
FT                   ERMYVQDLRSIVEDYLLKIIDTPGLLKPEQVSALFGNIESIYALNSQLLRDLDSCNSDP
FT                   VAVASCFVERSQEFDIYTQYCNNYPNSVAALTECMQDKQQAKFFRDRQELLQHSLPLGS
FT                   YLLKPVQRVLKYHLLLQEIAKHFDEEEDGFEVVEDAIDTMTCVAWYINDMKRRHEHAVR
FT                   LQEIQSLLINWKGPDLTTYGELVLEATFRVHRVRNDRTFFLFDKILLITKKRGDHFVYK
FT                   GHIPCSSLMLIESTRDSLCFTVTHYKHSKQQYSIQAKTVEEKRSWTHHIKRLILENHHA
FT                   TIPQKAKEAILEMDSYYPSRYRCSPERMKKAWSSQDEVSSHVRQGRRQSGEGRAVWTRT
FT                   FFLGSLAQAGIICSDIVGRWSLQKAGEDSRVGWWMSVDRFLFMPGFPSNNHLLCLLLTR
FT                   AVHLLKGLGMFVIQDLASLLSHLNLLALLLSQSSTWKSWDSFSVQVSSDSRGWVGGKTL
FT                   RPSGTKSRQEIFILGHAIFLSWVFFHDGICLCARGVIRMKRLLREDKNLAL"
FT   mRNA            join(51839592..51839648,51840845..51840866,
FT                   51841100..51841169,51841442..51841488,51841602..51841752,
FT                   51841847..51841978,51842143..51842325,51842504..51842596,
FT                   51842837..51842923,51843129..51845402)
FT                   /locus_tag="mCG_7917"
FT                   /product="mCG7917, transcript variant mCT181737"
FT                   /note="gene_id=mCG7917.2 transcript_id=mCT181737.0 created
FT                   on 02-APR-2003"
FT   CDS             51843374..51844150
FT                   /codon_start=1
FT                   /locus_tag="mCG_7917"
FT                   /product="mCG7917, isoform CRA_b"
FT                   /note="gene_id=mCG7917.2 transcript_id=mCT181737.0
FT                   protein_id=mCP104659.0 isoform=CRA_b"
FT                   /protein_id="EDL36455.1"
FT                   /translation="MEDGGPPKRHLAPSGAGVGEEYAIRYGQLLLGRWGIRDLIISLLA
FT                   TDPSRYRCSPERMKKAWSSQDEVSSHVRQGRRQSGEGRAVWTRTFFLGSLAQAGIICSD
FT                   IVGRWSLQKAGEDSRVGWWMSVDRFLFMPGFPSNNHLLCLLLTRAVHLLKGLGMFVIQD
FT                   LASLLSHLNLLALLLSQSSTWKSWDSFSVQVSSDSRGWVGGKTLRPSGTKSRQEIFILG
FT                   HAIFLSWVFFHDGICLCARGVIRMKRLLREDKNLAL"
FT   gene            <51850499..51856369
FT                   /locus_tag="mCG_145565"
FT                   /note="gene_id=mCG145565.0"
FT   mRNA            join(<51850499..51850689,51853186..51854605,
FT                   51855004..51856369)
FT                   /locus_tag="mCG_145565"
FT                   /product="mCG145565"
FT                   /note="gene_id=mCG145565.0 transcript_id=mCT184989.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<51850555..51850689,51853186..51854605,
FT                   51855004..51855737)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145565"
FT                   /product="mCG145565"
FT                   /note="gene_id=mCG145565.0 transcript_id=mCT184989.0
FT                   protein_id=mCP105150.0"
FT                   /protein_id="EDL36453.1"
FT                   /translation="ADFCLLQGKRHRESEGSKGCRRPSNRSPTSAEKRMSFESVSSLPE
FT                   VETDPEPGAEQEAFAALEGPSTEEMPSDPEFPEALETQLHAPKGLLGVDNPAAVVDFVE
FT                   PEGSEDLKPLSSEEEEEEEMEAAQEPESLLPPSVLDQASVIAERFASSFSRRSSLAIED
FT                   GKSSGLGTPRLISRSSSVLSLEGSDKGLARWSSIGDSLSNPPTPEVIIGADMVTDNGPS
FT                   VNGTESPSAGSGCPTEQDRSSCKKKESALSTRDRQLLDKIKNYYENAEHHDAGFSIRRR
FT                   ESLSYIPKGLVRSSVSRFNSLPKPDSEPAAPVGYKRPGSSRPASWTLFDLPGPRTDKGD
FT                   PAPITDAEFCPSSEIAKIWERMESSERSPRTGSGQSQANGFELQEPLFILEEHELGAIT
FT                   EESAVASPESASPTEQPSPAHLARELKELVKELSSSVQGELVTPLHPRIVQLSHVMDSH
FT                   VSERVKNKVYQLARQYSLRIKNIKAARPPLQWEKVTPDQEEQVPSISGLPEEAGELSGG
FT                   KARRKPVLSLLSYEQLVAQEHGTSKSSAAVETSPRRFSFSPSAVSPRTTSPGARSSARS
FT                   PLSPFDTETFNWPDVRELCSKYTSHDKTAQVESSWPRSLLVNRSRSLPENIVEPPMSGK
FT                   ADRCCGLNTHRRLGDGEASQPPLPESPPQSQLNGGDALYVTADLTLENNQRVIIMEKGP
FT                   HPSSTVGLEEDSGKESSSPVALKGQGQGFQASAEYQPKEHGPRDSADTNKQGRVRNLRE
FT                   KFQALNSVG"
FT   gene            complement(51857819..51927290)
FT                   /gene="Spnb1"
FT                   /locus_tag="mCG_123942"
FT                   /note="gene_id=mCG123942.2"
FT   mRNA            complement(join(51857819..51860721,51860890..51860932,
FT                   51861089..51861262,51864664..51864923,51875044..51875119,
FT                   51875603..51875652,51875912..51876108,51877143..51877227,
FT                   51877641..51877779,51879176..51879420,51880705..51881079,
FT                   51881338..51881542,51882805..51882935,51883562..51883840,
FT                   51885298..51885387,51885807..51886013,51886357..51886620,
FT                   51888060..51888206,51889129..51889219,51889312..51889514,
FT                   51889880..51890636,51896387..51896524,51898004..51898874,
FT                   51899491..51899641,51900257..51900559,51901575..51901733,
FT                   51902344..51902461,51904296..51904483,51905230..51905342,
FT                   51905824..51905939,51906243..51906323,51906961..51907052,
FT                   51907933..51908106,51909727..51909878,51927082..51927290))
FT                   /gene="Spnb1"
FT                   /locus_tag="mCG_123942"
FT                   /product="spectrin beta 1, transcript variant mCT125179"
FT                   /note="gene_id=mCG123942.2 transcript_id=mCT125179.1
FT                   created on 29-SEP-2004"
FT   CDS             complement(join(51860554..51860721,51860890..51860932,
FT                   51861089..51861262,51864664..51864923,51875044..51875119,
FT                   51875603..51875652,51875912..51876108,51877143..51877227,
FT                   51877641..51877779,51879176..51879420,51880705..51881079,
FT                   51881338..51881542,51882805..51882935,51883562..51883840,
FT                   51885298..51885387,51885807..51886013,51886357..51886620,
FT                   51888060..51888206,51889129..51889219,51889312..51889514,
FT                   51889880..51890636,51896387..51896524,51898004..51898874,
FT                   51899491..51899641,51900257..51900559,51901575..51901733,
FT                   51902344..51902461,51904296..51904483,51905230..51905342,
FT                   51905824..51905939,51906243..51906323,51906961..51907052,
FT                   51907933..51908106,51909727..51909878,51927082..51927229))
FT                   /codon_start=1
FT                   /gene="Spnb1"
FT                   /locus_tag="mCG_123942"
FT                   /product="spectrin beta 1, isoform CRA_b"
FT                   /note="gene_id=mCG123942.2 transcript_id=mCT125179.1
FT                   protein_id=mCP79101.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q3UGX2"
FT                   /db_xref="InterPro:IPR001589"
FT                   /db_xref="InterPro:IPR001605"
FT                   /db_xref="InterPro:IPR001715"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR002017"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR016343"
FT                   /db_xref="InterPro:IPR018159"
FT                   /db_xref="MGI:MGI:98387"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UGX2"
FT                   /protein_id="EDL36452.1"
FT                   /translation="MTSATEFENVGNQPPFSRINARWDAPDDELDNDNSSARLFERSRI
FT                   KALADEREVVQKKTFTKWVNSHLARVSCRISDLYKDLRDGRMLIKLLEVLSGEMLPRPT
FT                   KGKMRIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLVLGLIWTIILRFQIQDIV
FT                   VQTQEGRETRSAKDALLLWCQMKTAGYPHVNVTNFTSSWKDGLAFNALIHKHRPDLIDF
FT                   DKLKDSNARHNLEHAFDVAERQLGIIPLLDPEDVFTENPDEKSIITYVVAFYHYFSKMK
FT                   VLAVEGKRVGKVIDHAIETEKMIEKYSGLASDLLTWIEQTISVLNSRKFANSLSGVQQQ
FT                   LQAFSTYRTVEKPPKFQEKGNLEVLLFTIQSRMRANNQKVYTPHDGKLVSDINRAWESL
FT                   EEAEYQRELALRSELIRQEKLEQLARRFDRKAAMRETWLNENQRLVTQDNFGYDLAAVE
FT                   AAKKKHEAIETDTAAYEERVKALEDLAQELEKENYHDQKRIIARKDNILRLWSYLQELL
FT                   RSRRQRLEATLALQKLFQDMLHSIDWMDEIKAHILSAEFGKHLLEVEDLLQKHKLMEAD
FT                   IAIQGDKVKAITAATLQFAEGKGYQPCDPQVIQDRVSHLEQCFSELSNMAAGRKAQLEQ
FT                   SKRLWKFFWEMDEAESWIKEKEQIYSSLDYGKDLTSVLILQRKHKAFEDELRGLDAHLK
FT                   QIFQEADDMVAQKQFGHPQIETRVKEVSAQWDHLKELAAFRKKDLQDAENFFQFQGDAD
FT                   DLKAWLQDAHRLLSGEDVGQDEGATRALGKKHKEFLEELEESRGVMEHLEHQAQGFPEE
FT                   FRDSPDVTNRLQALRKLYQQVLTQAELRGHKLQEALDLYTVFGESDACELWMTEKGKWL
FT                   DQMDIPNTLEDLEVVQHRFDILDQEMKTLMAQIDGVNLAANNLVESGHPRSGEVKQYQD
FT                   RLNKRWQAFQAVVSEQREAVDSALRVNNYCVDCEETSKWIMDKTKVVESTKDLGQDLAG
FT                   VIAIQRKLSGLERDVLAIRDRVSALERESQYLMESHPEQKEDIGQRQADVEKLWKGLQD
FT                   ALQGQELSLGEASKLQAFLQDLDDFKAWLSMAQKAVASEDMPESLPEAEQLLQQHAAIK
FT                   EEIDAHRDDYHRVKASGEKVIEGQTDPDYQLLGQRLEGLDTDWDALRRMWESRGNTLTQ
FT                   CLGFQEFQKDAKQAEAILSNQEYTLAHLEPPDSLAAAEAGIRKFEDFLVSMENNRDKIL
FT                   SPVDSGNKLVAEGNLYSNKIMEKVQLIEDRHKKNNEKAQEATVLLKDNLELQNFLQNCK
FT                   ELTLWINDKLLTSPDVSYDEARNLHNKWMKHQAFMAELASHQGWLENIDAEGRQLMAEK
FT                   PQFKDVVSERLEALHKLWEELQSTAKAKAEQLSAARSSDLRLQTHADLNKWIGAMEDQL
FT                   RSDDLGKDLTTVNRMLAKLKRVEEQVNLRKEELEELFADAPSLGAEAGDTDMSIEKRFL
FT                   DLLEPLGRRKKQLELSKAKLQISRDLEDETLWVEERLPLAQSADYGTNLQTVQLFMKKN
FT                   QTLQNEILGHAPRVEDVLRRGQELVKAAEIDCQDIEERLGHLQSSWDTLREAAAGRLQR
FT                   LRDAHEAQQYYLDAGEAEAWISEQELYVFSDEPPKDEEGAIVMLKRHLRQQRTVEEYGR
FT                   NIKQLAGRAQSLLSAGHPEGEQIIRLQGQVDKQYAGLKDMAEERRRRLENMYHLFQLKR
FT                   EADDLEQWITEKEMVASSQEMGQDFDHVTMLRDKFRDFARETGAIGQERVDNVNTIIER
FT                   LIDAGHSEAATIAEWKDGLNDMWADLLELIDTRMQLLAASYDLHRYFYTGTEILGLIDE
FT                   KHRELPEDVGLDASTAESFHRVHTAFERELHLLGVQVQQFQDVATRLQTAYAGEKADAI
FT                   QSKEQEVSAAWQALLDACAGRRAQLVDTADKFRFFSMVRDLLSWMESIIRQIETQERPR
FT                   DVSSVELLLKYHQGIKAEINTRAKNFSTCLELGESLLQRQHQASDEIREKLQQVISRRQ
FT                   EMNDKWEARSDRLHMLLEVCQFSRDASVAEAWLIAQEPYLASRDFGHTVDSVEKLIKRH
FT                   EAFEKSTASWAERFAALEKPTTLELKERQTPERPTEEPGPQEEEGETAGEAPQVHHAAT
FT                   ERTSPGEERGPWPQDLQPPPLPGHHKDEQEKSVGDERPATEPLFKVLDTPLSEGDEPTT
FT                   LPAQRDLGHTVQMEGYLGRKHDLEGPNKKASNRSWNNLYCVLRNSQLTFYKDAKNLALG
FT                   VPYHGEEPLALRHAICEIAVNYKKKKHVFKLRLSNGSEWLFHGKDEEEMLMWLQSMSTA
FT                   INESQSIRVKAQSLPLPSLAGPDASVGKKEKEKRFSFFPKKK"
FT   mRNA            complement(join(51873451..51875119,51875603..51875652,
FT                   51875912..51876108,51877143..51877227,51877641..51877779,
FT                   51879176..51879420,51880705..51881079,51881338..51881542,
FT                   51882805..51882935,51883562..51883840,51885298..51885387,
FT                   51885807..51886013,51886357..51886620,51888060..51888206,
FT                   51889129..51889219,51889312..51889514,51889880..51890636,
FT                   51896387..51896524,51898004..51898874,51899491..51899641,
FT                   51900257..51900559,51901575..51901733,51902344..51902461,
FT                   51904296..51904483,51905230..51905342,51905824..51905939,
FT                   51906243..51906323,51906961..51907052,51907933..51908106,
FT                   51909727..51909878,51927082..51927290))
FT                   /gene="Spnb1"
FT                   /locus_tag="mCG_123942"
FT                   /product="spectrin beta 1, transcript variant mCT193422"
FT                   /note="gene_id=mCG123942.2 transcript_id=mCT193422.1
FT                   created on 29-SEP-2004"
FT   CDS             complement(join(51874975..51875119,51875603..51875652,
FT                   51875912..51876108,51877143..51877227,51877641..51877779,
FT                   51879176..51879420,51880705..51881079,51881338..51881542,
FT                   51882805..51882935,51883562..51883840,51885298..51885387,
FT                   51885807..51886013,51886357..51886620,51888060..51888206,
FT                   51889129..51889219,51889312..51889514,51889880..51890636,
FT                   51896387..51896524,51898004..51898874,51899491..51899641,
FT                   51900257..51900559,51901575..51901733,51902344..51902461,
FT                   51904296..51904483,51905230..51905342,51905824..51905939,
FT                   51906243..51906323,51906961..51907052,51907933..51908106,
FT                   51909727..51909878,51927082..51927229))
FT                   /codon_start=1
FT                   /gene="Spnb1"
FT                   /locus_tag="mCG_123942"
FT                   /product="spectrin beta 1, isoform CRA_a"
FT                   /note="gene_id=mCG123942.2 transcript_id=mCT193422.1
FT                   protein_id=mCP114400.1 isoform=CRA_a"
FT                   /protein_id="EDL36451.1"
FT                   /translation="MTSATEFENVGNQPPFSRINARWDAPDDELDNDNSSARLFERSRI
FT                   KALADEREVVQKKTFTKWVNSHLARVSCRISDLYKDLRDGRMLIKLLEVLSGEMLPRPT
FT                   KGKMRIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLVLGLIWTIILRFQIQDIV
FT                   VQTQEGRETRSAKDALLLWCQMKTAGYPHVNVTNFTSSWKDGLAFNALIHKHRPDLIDF
FT                   DKLKDSNARHNLEHAFDVAERQLGIIPLLDPEDVFTENPDEKSIITYVVAFYHYFSKMK
FT                   VLAVEGKRVGKVIDHAIETEKMIEKYSGLASDLLTWIEQTISVLNSRKFANSLSGVQQQ
FT                   LQAFSTYRTVEKPPKFQEKGNLEVLLFTIQSRMRANNQKVYTPHDGKLVSDINRAWESL
FT                   EEAEYQRELALRSELIRQEKLEQLARRFDRKAAMRETWLNENQRLVTQDNFGYDLAAVE
FT                   AAKKKHEAIETDTAAYEERVKALEDLAQELEKENYHDQKRIIARKDNILRLWSYLQELL
FT                   RSRRQRLEATLALQKLFQDMLHSIDWMDEIKAHILSAEFGKHLLEVEDLLQKHKLMEAD
FT                   IAIQGDKVKAITAATLQFAEGKGYQPCDPQVIQDRVSHLEQCFSELSNMAAGRKAQLEQ
FT                   SKRLWKFFWEMDEAESWIKEKEQIYSSLDYGKDLTSVLILQRKHKAFEDELRGLDAHLK
FT                   QIFQEADDMVAQKQFGHPQIETRVKEVSAQWDHLKELAAFRKKDLQDAENFFQFQGDAD
FT                   DLKAWLQDAHRLLSGEDVGQDEGATRALGKKHKEFLEELEESRGVMEHLEHQAQGFPEE
FT                   FRDSPDVTNRLQALRKLYQQVLTQAELRGHKLQEALDLYTVFGESDACELWMTEKGKWL
FT                   DQMDIPNTLEDLEVVQHRFDILDQEMKTLMAQIDGVNLAANNLVESGHPRSGEVKQYQD
FT                   RLNKRWQAFQAVVSEQREAVDSALRVNNYCVDCEETSKWIMDKTKVVESTKDLGQDLAG
FT                   VIAIQRKLSGLERDVLAIRDRVSALERESQYLMESHPEQKEDIGQRQADVEKLWKGLQD
FT                   ALQGQELSLGEASKLQAFLQDLDDFKAWLSMAQKAVASEDMPESLPEAEQLLQQHAAIK
FT                   EEIDAHRDDYHRVKASGEKVIEGQTDPDYQLLGQRLEGLDTDWDALRRMWESRGNTLTQ
FT                   CLGFQEFQKDAKQAEAILSNQEYTLAHLEPPDSLAAAEAGIRKFEDFLVSMENNRDKIL
FT                   SPVDSGNKLVAEGNLYSNKIMEKVQLIEDRHKKNNEKAQEATVLLKDNLELQNFLQNCK
FT                   ELTLWINDKLLTSPDVSYDEARNLHNKWMKHQAFMAELASHQGWLENIDAEGRQLMAEK
FT                   PQFKDVVSERLEALHKLWEELQSTAKAKAEQLSAARSSDLRLQTHADLNKWIGAMEDQL
FT                   RSDDLGKDLTTVNRMLAKLKRVEEQVNLRKEELEELFADAPSLGAEAGDTDMSIEKRFL
FT                   DLLEPLGRRKKQLELSKAKLQISRDLEDETLWVEERLPLAQSADYGTNLQTVQLFMKKN
FT                   QTLQNEILGHAPRVEDVLRRGQELVKAAEIDCQDIEERLGHLQSSWDTLREAAAGRLQR
FT                   LRDAHEAQQYYLDAGEAEAWISEQELYVFSDEPPKDEEGAIVMLKRHLRQQRTVEEYGR
FT                   NIKQLAGRAQSLLSAGHPEGEQIIRLQGQVDKQYAGLKDMAEERRRRLENMYHLFQLKR
FT                   EADDLEQWITEKEMVASSQEMGQDFDHVTMLRDKFRDFARETGAIGQERVDNVNTIIER
FT                   LIDAGHSEAATIAEWKDGLNDMWADLLELIDTRMQLLAASYDLHRYFYTGTEILGLIDE
FT                   KHRELPEDVGLDASTAESFHRVHTAFERELHLLGVQVQQFQDVATRLQTAYAGEKADAI
FT                   QSKEQEVSAAWQALLDACAGRRAQLVDTADKFRFFSMVRDLLSWMESIIRQIETQERPR
FT                   DVSSVELLLKYHQGIKAEINTRAKNFSTCLELGESLLQRQHQASDEIREKLQQVISRRQ
FT                   EMNDKWEARSDRLHMLLEVCQFSRDASVAEAWLIAQEPYLASRDFGHTVDSVEKLIKRH
FT                   EAFEKSTASWAERFAALEKPTTLELKERQTPERPTEEPGPQEEEGETAGEAPQVHHAAT
FT                   ERTSPVSFMSRLSSSWESLLPEPAHPF"
FT   gene            <52032738..52188432
FT                   /locus_tag="mCG_7924"
FT                   /note="gene_id=mCG7924.1"
FT   mRNA            join(<52032738..52033045,52040665..52040800,
FT                   52043001..52043071,52104960..52105184,52130213..52130277,
FT                   52141268..52141340,52142926..52143017,52155090..52155236,
FT                   52155330..52155413,52164684..52164770,52174280..52174409,
FT                   52177525..52177657,52182149..52182260,52183434..52183548,
FT                   52187095..52188432)
FT                   /locus_tag="mCG_7924"
FT                   /product="mCG7924"
FT                   /note="gene_id=mCG7924.1 transcript_id=mCT6733.1 created on
FT                   04-SEP-2002"
FT   CDS             join(<52032794..52033045,52040665..52040800,
FT                   52043001..52043071,52104960..52105184,52130213..52130277,
FT                   52141268..52141340,52142926..52143017,52155090..52155236,
FT                   52155330..52155413,52164684..52164770,52174280..52174409,
FT                   52177525..52177657,52182149..52182260,52183434..52183548,
FT                   52187095..52187226)
FT                   /codon_start=1
FT                   /locus_tag="mCG_7924"
FT                   /product="mCG7924"
FT                   /note="gene_id=mCG7924.1 transcript_id=mCT6733.1
FT                   protein_id=mCP3127.0"
FT                   /protein_id="EDL36446.1"
FT                   /translation="VLRSFQYLKIFESSPRCTLLTRRPPNNRCYGRRLLASCGVLRSCA
FT                   TKSISQLSRGFAFRVSLGSFSENCVTMCGDCVEKEYPNRGTTCLENGSFLLNFAGCAVC
FT                   SKRDFMLITNRSLKEEDGEEIVTYDHLCKNCHHVVARHEYTFSIMDEFQRLSPLEFQCA
FT                   LLLDEAESYTALAALPIMASSSSFTYYCPPSSSPVWSEPLYSLRPEHVRERLQDDSVET
FT                   VTSIEQAKVEEKIQEVFSSYKFNHLVPRLILQREKHFHYLKRGLRQLTDAYECLDASRP
FT                   WLCYWILHSLELLDEPIPQIVATDVCQFLELCQSPDGGFGGGPGQYPHLAPTYAAVNAL
FT                   CIIGTEEAYNVINREKLLQYLYSLKQPDGSFLMHVGGEVDVRSAYCAASVASLTNIITP
FT                   DLFEGTAEWIARCQNWEGGIGGVPGMEAHGGYTFCGLAALVILKKERSLNLKSLLQWVT
FT                   SRQMRFEGGFQGRCNKLVDGCYSFWQAGLLPLLHRALHAQGDPALSMSHWMFHQQALQE
FT                   YILMCCQCPAGGLLDKPGKSRDFYHTCYCLSGLSIAQHFGSGAMLHDMVMGVPENVLQP
FT                   THPVYNIGPEKVIQATTHFLQKPVPGFEECEDEVTSDPATD"
FT   gene            complement(52059780..52062952)
FT                   /gene="Gpx2"
FT                   /locus_tag="mCG_1041532"
FT                   /note="gene_id=mCG1041532.1"
FT   mRNA            complement(join(52059780..52060441,52062600..52062952))
FT                   /gene="Gpx2"
FT                   /locus_tag="mCG_1041532"
FT                   /product="glutathione peroxidase 2"
FT                   /note="gene_id=mCG1041532.1 transcript_id=mCT159236.1
FT                   created on 28-AUG-2002"
FT   CDS             complement(52060091..52060264)
FT                   /codon_start=1
FT                   /gene="Gpx2"
FT                   /locus_tag="mCG_1041532"
FT                   /product="glutathione peroxidase 2"
FT                   /note="gene_id=mCG1041532.1 transcript_id=mCT159236.1
FT                   protein_id=mCP78743.1"
FT                   /protein_id="EDL36450.1"
FT                   /translation="MTDPKLIIWSPVRRSDVSWNFEKFLIGPEGEPFRRYSRSFQTINI
FT                   EPDIKRLLKVAI"
FT   gene            complement(52065406..>52090393)
FT                   /gene="Rab15"
FT                   /locus_tag="mCG_7919"
FT                   /note="gene_id=mCG7919.2"
FT   mRNA            complement(join(52065406..52067847,52068012..52068077,
FT                   52069362..52069427,52070514..52070591,52071014..52071074,
FT                   52071889..52071949,52089679..>52090131))
FT                   /gene="Rab15"
FT                   /locus_tag="mCG_7919"
FT                   /product="RAB15, member RAS oncogene family, transcript
FT                   variant mCT6734"
FT                   /note="gene_id=mCG7919.2 transcript_id=mCT6734.1 created on
FT                   28-AUG-2002"
FT   mRNA            complement(join(52065409..52067847,52068012..52068077,
FT                   52069338..52069427,52070514..52070591,52071014..52071074,
FT                   52071889..52071949,52089679..>52090001))
FT                   /gene="Rab15"
FT                   /locus_tag="mCG_7919"
FT                   /product="RAB15, member RAS oncogene family, transcript
FT                   variant mCT193485"
FT                   /note="gene_id=mCG7919.2 transcript_id=mCT193485.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(52067689..52067847,52068012..52068077,
FT                   52069362..52069427,52070514..52070591,52071014..52071074,
FT                   52071889..52071949,52089679..>52089811))
FT                   /codon_start=1
FT                   /gene="Rab15"
FT                   /locus_tag="mCG_7919"
FT                   /product="RAB15, member RAS oncogene family, isoform CRA_c"
FT                   /note="gene_id=mCG7919.2 transcript_id=mCT6734.1
FT                   protein_id=mCP3147.1 isoform=CRA_c"
FT                   /protein_id="EDL36449.1"
FT                   /translation="VPAMAKQYDVLFRLLLIGDSGVGKTCLLCRFTDNEFHSSHISTIG
FT                   VDFKMKTIEVDGIKVRIQIWDTAGQERYQTITKQYYRRAQGIFLVYDISSERSYQHIMK
FT                   WVSDVDEYAPEGVQKILIGNKADEEQKRQLAKEYGMDFYETSACTNLNIKESFTRLTEL
FT                   VLQAHRKELDGLRTRASNELALAELEEDEGKPEGPANSSKTCWC"
FT   CDS             complement(join(52067689..52067847,52068012..52068077,
FT                   52069338..52069427,52070514..52070591,52071014..52071074,
FT                   52071889..52071949,52089679..>52089811))
FT                   /codon_start=1
FT                   /gene="Rab15"
FT                   /locus_tag="mCG_7919"
FT                   /product="RAB15, member RAS oncogene family, isoform CRA_b"
FT                   /note="gene_id=mCG7919.2 transcript_id=mCT193485.0
FT                   protein_id=mCP114483.0 isoform=CRA_b"
FT                   /protein_id="EDL36448.1"
FT                   /translation="VPAMAKQYDVLFRLLLIGDSGVGKTCLLCRFTDNEFHSSHISTIG
FT                   VDFKMKTIEVDGIKVRIQIWDTAGQERYQTITKQYYRRAQGIFLVYDISSERSYQHIMK
FT                   WVSDVDEYAPEGVQKILIGNKADEEQKRQVGREQGQQLAKEYGMDFYETSACTNLNIKE
FT                   SFTRLTELVLQAHRKELDGLRTRASNELALAELEEDEGKPEGPANSSKTCWC"
FT   mRNA            complement(join(<52067776..52067847,52068012..52068077,
FT                   52069338..52069427,52070514..52070591,52071014..52071074,
FT                   52071889..52071949,52090337..>52090393))
FT                   /gene="Rab15"
FT                   /locus_tag="mCG_7919"
FT                   /product="RAB15, member RAS oncogene family, transcript
FT                   variant mCT193484"
FT                   /note="gene_id=mCG7919.2 transcript_id=mCT193484.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(<52067776..52067847,52068012..52068077,
FT                   52069338..52069427,52070514..52070591,52071014..52071074,
FT                   52071889..52071949,52090337..>52090349))
FT                   /codon_start=1
FT                   /gene="Rab15"
FT                   /locus_tag="mCG_7919"
FT                   /product="RAB15, member RAS oncogene family, isoform CRA_a"
FT                   /note="gene_id=mCG7919.2 transcript_id=mCT193484.0
FT                   protein_id=mCP114482.0 isoform=CRA_a"
FT                   /protein_id="EDL36447.1"
FT                   /translation="RGNLGVDFKMKTIEVDGIKVRIQIWDTAGQERYQTITKQYYRRAQ
FT                   GIFLVYDISSERSYQHIMKWVSDVDEYAPEGVQKILIGNKADEEQKRQVGREQGQQLAK
FT                   EYGMDFYETSACTNLNIKESFTRLTELVLQAHRKELDGLRTRA"
FT   gene            complement(52204595..52229550)
FT                   /gene="Max"
FT                   /locus_tag="mCG_7920"
FT                   /note="gene_id=mCG7920.1"
FT   mRNA            complement(join(52204595..52206081,52207293..52207416,
FT                   52220501..52220608,52229467..52229550))
FT                   /gene="Max"
FT                   /locus_tag="mCG_7920"
FT                   /product="Max protein"
FT                   /note="gene_id=mCG7920.1 transcript_id=mCT6735.1 created on
FT                   09-APR-2003"
FT   CDS             complement(join(52205894..52206081,52207293..52207368))
FT                   /codon_start=1
FT                   /gene="Max"
FT                   /locus_tag="mCG_7920"
FT                   /product="Max protein"
FT                   /note="gene_id=mCG7920.1 transcript_id=mCT6735.1
FT                   protein_id=mCP3306.2"
FT                   /protein_id="EDL36445.1"
FT                   /translation="MRRKNHTHQQDIDDLKRQNALLEQQVRALEKARSSAQLQTNYPSS
FT                   DNSLYTNAKGGTISAFDGGSDSSSESEPEEPQSRKKLRMEAS"
FT   gene            complement(<52443021..52443464)
FT                   /locus_tag="mCG_1041704"
FT                   /note="gene_id=mCG1041704.1"
FT   mRNA            complement(<52443021..52443464)
FT                   /locus_tag="mCG_1041704"
FT                   /product="mCG1041704"
FT                   /note="gene_id=mCG1041704.1 transcript_id=mCT159408.1
FT                   created on 17-SEP-2002"
FT   CDS             complement(<52443021..52443112)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041704"
FT                   /product="mCG1041704"
FT                   /note="gene_id=mCG1041704.1 transcript_id=mCT159408.1
FT                   protein_id=mCP78898.1"
FT                   /protein_id="EDL36444.1"
FT                   /translation="MAHLRASVGSGNLSQTKDQFKSLSKRKCCSS"
FT   gene            <52503551..52741467
FT                   /gene="Fut8"
FT                   /locus_tag="mCG_121407"
FT                   /note="gene_id=mCG121407.2"
FT   mRNA            join(<52503551..52503625,52543280..52543374,
FT                   52544863..52544951,52589774..52589866,52597842..52598275,
FT                   52630851..52630966,52631079..52631241,52659603..52659717,
FT                   52678491..52678728,52713952..52714198,52715579..52715755,
FT                   52729539..52729689,52740479..52741445)
FT                   /gene="Fut8"
FT                   /locus_tag="mCG_121407"
FT                   /product="fucosyltransferase 8, transcript variant
FT                   mCT193426"
FT                   /note="gene_id=mCG121407.2 transcript_id=mCT193426.0
FT                   created on 09-MAR-2004"
FT   mRNA            join(52503573..52503625,52543280..52543374,
FT                   52589774..52589866,52597842..52598275,52630851..52630966,
FT                   52631079..52631241,52659603..52659717,52678491..52678728,
FT                   52713952..52714198,52715579..52715755,52729539..52729689,
FT                   52740479..52741362)
FT                   /gene="Fut8"
FT                   /locus_tag="mCG_121407"
FT                   /product="fucosyltransferase 8, transcript variant
FT                   mCT181734"
FT                   /note="gene_id=mCG121407.2 transcript_id=mCT181734.0
FT                   created on 02-APR-2003"
FT   mRNA            join(52504372..52504547,52543280..52543374,
FT                   52589774..52589866,52597842..52598275,52630851..52630966,
FT                   52631079..52631241,52659603..52659717,52678491..52678728,
FT                   52713952..52714198,52715579..52715755,52729539..52729689,
FT                   52740479..52741467)
FT                   /gene="Fut8"
FT                   /locus_tag="mCG_121407"
FT                   /product="fucosyltransferase 8, transcript variant
FT                   mCT122609"
FT                   /note="gene_id=mCG121407.2 transcript_id=mCT122609.1
FT                   created on 02-APR-2003"
FT   CDS             join(<52598001..52598275,52630851..52630966,
FT                   52631079..52631241,52659603..52659717,52678491..52678728,
FT                   52713952..52714198,52715579..52715755,52729539..52729689,
FT                   52740479..52740796)
FT                   /codon_start=1
FT                   /gene="Fut8"
FT                   /locus_tag="mCG_121407"
FT                   /product="fucosyltransferase 8, isoform CRA_b"
FT                   /note="gene_id=mCG121407.2 transcript_id=mCT193426.0
FT                   protein_id=mCP114397.0 isoform=CRA_b"
FT                   /protein_id="EDL36442.1"
FT                   /translation="LEPEYNVSSSLSSRKIEDRVETLKMRAWTGSWRWIMLILFAWGTL
FT                   LFYIGGHLVRDNDHPDHSSRELSKILAKLERLKQQNEDLRRMAESLRIPEGPIDQGTAT
FT                   GRVRVLEEQLVKAKEQIENYKKQARNGLGKDHEILRRRIENGAKELWFFLQSELKKLKH
FT                   LEGNELQRHADEILLDLGHHERSIMTDLYYLSQTDGAGDWREKEAKDLTELVQRRITYL
FT                   QNPKDCSKARKLVCNINKGCGYGCQLHHVVYCFMIAYGTQRTLILESQNWRYATGGWET
FT                   VFRPVSETCTDRSGLSTGHWSGEVNDKNIQVVELPIVDSLHPRPPYLPLAVPEDLADRL
FT                   LRVHGDPAVWWVSQFVKYLIRPQPWLEKEIEEATKKLGFKHPVIGVHVRRTDKVGTEAA
FT                   FHPIEEYMVHVEEHFQLLARRMQVDKKRVYLATDDPTLLKEAKTKYSNYEFISDNSISW
FT                   SAGLHNRYTENSLRGVILDIHFLSQADFLVCTFSSQVCRVAYEIMQTLHPDASANFHSL
FT                   DDIYYFGGQNAHNQIAVYPHKPRTEEEIPMEPGDIIGVAGNHWDGYSKGINRKLGKTGL
FT                   YPSYKVREKIETVKYPTYPEAEK"
FT   CDS             join(52598073..52598275,52630851..52630966,
FT                   52631079..52631241,52659603..52659717,52678491..52678728,
FT                   52713952..52714198,52715579..52715755,52729539..52729689,
FT                   52740479..52740796)
FT                   /codon_start=1
FT                   /gene="Fut8"
FT                   /locus_tag="mCG_121407"
FT                   /product="fucosyltransferase 8, isoform CRA_a"
FT                   /note="gene_id=mCG121407.2 transcript_id=mCT181734.0
FT                   protein_id=mCP104656.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q9WTS2"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR015827"
FT                   /db_xref="InterPro:IPR027350"
FT                   /db_xref="MGI:MGI:1858901"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9WTS2"
FT                   /protein_id="EDL36441.1"
FT                   /translation="MRAWTGSWRWIMLILFAWGTLLFYIGGHLVRDNDHPDHSSRELSK
FT                   ILAKLERLKQQNEDLRRMAESLRIPEGPIDQGTATGRVRVLEEQLVKAKEQIENYKKQA
FT                   RNGLGKDHEILRRRIENGAKELWFFLQSELKKLKHLEGNELQRHADEILLDLGHHERSI
FT                   MTDLYYLSQTDGAGDWREKEAKDLTELVQRRITYLQNPKDCSKARKLVCNINKGCGYGC
FT                   QLHHVVYCFMIAYGTQRTLILESQNWRYATGGWETVFRPVSETCTDRSGLSTGHWSGEV
FT                   NDKNIQVVELPIVDSLHPRPPYLPLAVPEDLADRLLRVHGDPAVWWVSQFVKYLIRPQP
FT                   WLEKEIEEATKKLGFKHPVIGVHVRRTDKVGTEAAFHPIEEYMVHVEEHFQLLARRMQV
FT                   DKKRVYLATDDPTLLKEAKTKYSNYEFISDNSISWSAGLHNRYTENSLRGVILDIHFLS
FT                   QADFLVCTFSSQVCRVAYEIMQTLHPDASANFHSLDDIYYFGGQNAHNQIAVYPHKPRT
FT                   EEEIPMEPGDIIGVAGNHWDGYSKGINRKLGKTGLYPSYKVREKIETVKYPTYPEAEK"
FT   CDS             join(52598073..52598275,52630851..52630966,
FT                   52631079..52631241,52659603..52659717,52678491..52678728,
FT                   52713952..52714198,52715579..52715755,52729539..52729689,
FT                   52740479..52740796)
FT                   /codon_start=1
FT                   /gene="Fut8"
FT                   /locus_tag="mCG_121407"
FT                   /product="fucosyltransferase 8, isoform CRA_a"
FT                   /note="gene_id=mCG121407.2 transcript_id=mCT122609.1
FT                   protein_id=mCP78909.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q9WTS2"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR015827"
FT                   /db_xref="InterPro:IPR027350"
FT                   /db_xref="MGI:MGI:1858901"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9WTS2"
FT                   /protein_id="EDL36443.1"
FT                   /translation="MRAWTGSWRWIMLILFAWGTLLFYIGGHLVRDNDHPDHSSRELSK
FT                   ILAKLERLKQQNEDLRRMAESLRIPEGPIDQGTATGRVRVLEEQLVKAKEQIENYKKQA
FT                   RNGLGKDHEILRRRIENGAKELWFFLQSELKKLKHLEGNELQRHADEILLDLGHHERSI
FT                   MTDLYYLSQTDGAGDWREKEAKDLTELVQRRITYLQNPKDCSKARKLVCNINKGCGYGC
FT                   QLHHVVYCFMIAYGTQRTLILESQNWRYATGGWETVFRPVSETCTDRSGLSTGHWSGEV
FT                   NDKNIQVVELPIVDSLHPRPPYLPLAVPEDLADRLLRVHGDPAVWWVSQFVKYLIRPQP
FT                   WLEKEIEEATKKLGFKHPVIGVHVRRTDKVGTEAAFHPIEEYMVHVEEHFQLLARRMQV
FT                   DKKRVYLATDDPTLLKEAKTKYSNYEFISDNSISWSAGLHNRYTENSLRGVILDIHFLS
FT                   QADFLVCTFSSQVCRVAYEIMQTLHPDASANFHSLDDIYYFGGQNAHNQIAVYPHKPRT
FT                   EEEIPMEPGDIIGVAGNHWDGYSKGINRKLGKTGLYPSYKVREKIETVKYPTYPEAEK"
FT   gene            complement(<52752209..>52809148)
FT                   /locus_tag="mCG_1041703"
FT                   /note="gene_id=mCG1041703.0"
FT   mRNA            complement(join(<52752209..52752322,52755213..52755333,
FT                   52762122..52762213,52764313..52764579,52766291..52766427,
FT                   52770569..52770722,52782535..52782729,52794535..52794694,
FT                   52798228..52798407,52801492..52801618,52806324..52806408,
FT                   52807357..52807438,52808072..52808206,52809105..>52809148))
FT                   /locus_tag="mCG_1041703"
FT                   /product="mCG1041703"
FT                   /note="gene_id=mCG1041703.0 transcript_id=mCT159407.0
FT                   created on 17-SEP-2002"
FT   CDS             complement(join(52752209..52752322,52755213..52755333,
FT                   52762122..52762213,52764313..52764579,52766291..52766427,
FT                   52770569..52770722,52782535..52782729,52794535..52794694,
FT                   52798228..52798407,52801492..52801618,52806324..52806408,
FT                   52807357..52807438,52808072..52808206,52809105..52809148))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041703"
FT                   /product="mCG1041703"
FT                   /note="gene_id=mCG1041703.0 transcript_id=mCT159407.0
FT                   protein_id=mCP78874.0"
FT                   /protein_id="EDL36440.1"
FT                   /translation="MTPASVDTLPALLRGPMYACLQRKFWIPRGQNSLLATVEKENSIS
FT                   RALADQPQLTFVSYRSWALLSEELWLGWGLLQLGFRRAPGFITGESNRDLLPAQQDLMV
FT                   LSCSSITELRTGMGWKQGVREDGGCTSFVLSRLENQNACCSPEVTEDLQAACSCKTKAA
FT                   LQEEEHLEDEGAETEGKMWPSRWRNRYCKSGSFWQEGNRGELELATAWGLRLRKTMTAI
FT                   ELVWGKGSAHSQVTHQAAESHQPQKPDNQDPWCFHSGPQADGGLSLCLLLPLHAYEVLI
FT                   YMINFDITDEGHSYLQICMADPESSYSKVGPFCLIKCTKRRNRRALVALSLDHMEPIMG
FT                   FQTLTEDKPCILSKSSRELHSNVDKCVELSVKSNHHKTLRKRETDLCGKMPTSPVLMTL
FT                   EMMAAIIGQKTPRAAPAPVPDAQKLLLTKQGCSQPSSREKQEGDMDIWVLQRQAPIGLP
FT                   PLALISVNSHELLEQKPKPESSTCNLGSNICYSNDESSCVSRKKKQMDEIHLSLGLLKE
FT                   AHSAGPGVKLSNKPQTLRSSKMKNGMSKNSSKQYIRNISESTVRATLHLGKLQAARSAR
FT                   YYPLMKKGKQGWERRRKTRPMGEKDERWSLKSRGETPTTTTITVVNGLNVGNLS"
FT   gene            complement(52888517..52890449)
FT                   /pseudo
FT                   /locus_tag="mCG_16061"
FT                   /note="gene_id=mCG16061.2"
FT   mRNA            complement(52888517..52890449)
FT                   /pseudo
FT                   /locus_tag="mCG_16061"
FT                   /note="gene_id=mCG16061.2 transcript_id=mCT15533.2 created
FT                   on 04-SEP-2002"
FT   gene            <52947252..52953682
FT                   /locus_tag="mCG_1041701"
FT                   /note="gene_id=mCG1041701.0"
FT   mRNA            join(<52947252..52947984,52953150..52953682)
FT                   /locus_tag="mCG_1041701"
FT                   /product="mCG1041701"
FT                   /note="gene_id=mCG1041701.0 transcript_id=mCT159405.0
FT                   created on 06-SEP-2002"
FT   CDS             <52947466..52947744
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041701"
FT                   /product="mCG1041701"
FT                   /note="gene_id=mCG1041701.0 transcript_id=mCT159405.0
FT                   protein_id=mCP78848.0"
FT                   /protein_id="EDL36439.1"
FT                   /translation="SKNPYSCLNGNFMTFIKATSAESPIDMGPFSLPTCLCLHGFCLSS
FT                   SGSRPVQFGFNLLWPRHWVSGSFFRMDDTQPSFTLTLGQGTSLMPSF"
FT   gene            53083377..53084098
FT                   /locus_tag="mCG_16060"
FT                   /note="gene_id=mCG16060.2"
FT   mRNA            53083377..53084098
FT                   /locus_tag="mCG_16060"
FT                   /product="mCG16060"
FT                   /note="gene_id=mCG16060.2 transcript_id=mCT15531.2 created
FT                   on 04-APR-2003"
FT   CDS             53083417..53083617
FT                   /codon_start=1
FT                   /locus_tag="mCG_16060"
FT                   /product="mCG16060"
FT                   /note="gene_id=mCG16060.2 transcript_id=mCT15531.2
FT                   protein_id=mCP3285.1"
FT                   /protein_id="EDL36438.1"
FT                   /translation="MRNSPEIISWQMTFTLCCYSLTFMRFAYKVQPRNWLLFACHVTNE
FT                   VAQLIQGGRHINYEMSKRPSA"
FT   assembly_gap    3320..3447
FT                   /estimated_length=128
FT                   /gap_type="unknown"
FT   assembly_gap    7028..7288
FT                   /estimated_length=261
FT                   /gap_type="unknown"
FT   assembly_gap    8515..10439
FT                   /estimated_length=1925
FT                   /gap_type="unknown"
FT   assembly_gap    18357..21148
FT                   /estimated_length=2792
FT                   /gap_type="unknown"
FT   assembly_gap    23811..23830
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26919..31473
FT                   /estimated_length=4555
FT                   /gap_type="unknown"
FT   assembly_gap    34544..34646
FT                   /estimated_length=103
FT                   /gap_type="unknown"
FT   assembly_gap    35624..36726
FT                   /estimated_length=1103
FT                   /gap_type="unknown"
FT   assembly_gap    39996..40422
FT                   /estimated_length=427
FT                   /gap_type="unknown"
FT   assembly_gap    45235..45352
FT                   /estimated_length=118
FT                   /gap_type="unknown"
FT   assembly_gap    52258..52277
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    53383..53402
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    91183..91289
FT                   /estimated_length=107
FT                   /gap_type="unknown"
FT   assembly_gap    119437..120498
FT                   /estimated_length=1062
FT                   /gap_type="unknown"
FT   assembly_gap    127294..127823
FT                   /estimated_length=530
FT                   /gap_type="unknown"
FT   assembly_gap    148163..150175
FT                   /estimated_length=2013
FT                   /gap_type="unknown"
FT   assembly_gap    167887..167906
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    169935..169954
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    172528..173284
FT                   /estimated_length=757
FT                   /gap_type="unknown"
FT   assembly_gap    175677..175696
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    177161..177180
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    204628..204647
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    221552..221571
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    231073..231167
FT                   /estimated_length=95
FT                   /gap_type="unknown"
FT   assembly_gap    233858..233877
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    237975..237994
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    267518..267543
FT                   /estimated_length=26
FT                   /gap_type="unknown"
FT   assembly_gap    289358..289377
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    315410..315480
FT                   /estimated_length=71
FT                   /gap_type="unknown"
FT   assembly_gap    328311..328330
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    334700..334927
FT                   /estimated_length=228
FT                   /gap_type="unknown"
FT   assembly_gap    360816..361569
FT                   /estimated_length=754
FT                   /gap_type="unknown"
FT   assembly_gap    374762..374781
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    395001..395020
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    396841..398953
FT                   /estimated_length=2113
FT                   /gap_type="unknown"
FT   assembly_gap    400172..400191
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    402031..402050
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    403300..403319
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    404488..404507
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    405816..406584
FT                   /estimated_length=769
FT                   /gap_type="unknown"
FT   assembly_gap    442027..442177
FT                   /estimated_length=151
FT                   /gap_type="unknown"
FT   assembly_gap    474031..474198
FT                   /estimated_length=168
FT                   /gap_type="unknown"
FT   assembly_gap    477194..477213
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    478719..478738
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    518939..518958
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    530278..530452
FT                   /estimated_length=175
FT                   /gap_type="unknown"
FT   assembly_gap    539278..539297
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    540486..540505
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    546942..546961
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    548218..553210
FT                   /estimated_length=4993
FT                   /gap_type="unknown"
FT   assembly_gap    554222..554241
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    571660..571822
FT                   /estimated_length=163
FT                   /gap_type="unknown"
FT   assembly_gap    575090..576109
FT                   /estimated_length=1020
FT                   /gap_type="unknown"
FT   assembly_gap    580388..580407
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    587727..587885
FT                   /estimated_length=159
FT                   /gap_type="unknown"
FT   assembly_gap    706248..706460
FT                   /estimated_length=213
FT                   /gap_type="unknown"
FT   assembly_gap    722960..724337
FT                   /estimated_length=1378
FT                   /gap_type="unknown"
FT   assembly_gap    729556..730146
FT                   /estimated_length=591
FT                   /gap_type="unknown"
FT   assembly_gap    732748..732767
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    749407..749426
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    757705..757864
FT                   /estimated_length=160
FT                   /gap_type="unknown"
FT   assembly_gap    767031..767050
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    782991..783181
FT                   /estimated_length=191
FT                   /gap_type="unknown"
FT   assembly_gap    787765..787784
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    839383..839652
FT                   /estimated_length=270
FT                   /gap_type="unknown"
FT   assembly_gap    860565..860771
FT                   /estimated_length=207
FT                   /gap_type="unknown"
FT   assembly_gap    862110..862372
FT                   /estimated_length=263
FT                   /gap_type="unknown"
FT   assembly_gap    885091..885466
FT                   /estimated_length=376
FT                   /gap_type="unknown"
FT   assembly_gap    893222..893505
FT                   /estimated_length=284
FT                   /gap_type="unknown"
FT   assembly_gap    908108..908127
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    934534..934625
FT                   /estimated_length=92
FT                   /gap_type="unknown"
FT   assembly_gap    1009081..1009146
FT                   /estimated_length=66
FT                   /gap_type="unknown"
FT   assembly_gap    1012057..1012167
FT                   /estimated_length=111
FT                   /gap_type="unknown"
FT   assembly_gap    1040297..1040631
FT                   /estimated_length=335
FT                   /gap_type="unknown"
FT   assembly_gap    1045850..1046207
FT                   /estimated_length=358
FT                   /gap_type="unknown"
FT   assembly_gap    1056156..1056175
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1057263..1057282
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1065913..1066012
FT                   /estimated_length=100
FT                   /gap_type="unknown"
FT   assembly_gap    1066739..1069397
FT                   /estimated_length=2659
FT                   /gap_type="unknown"
FT   assembly_gap    1071326..1071396
FT                   /estimated_length=71
FT                   /gap_type="unknown"
FT   assembly_gap    1083651..1083670
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1098539..1098558
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1108296..1108315
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1109398..1109417
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1112030..1112049
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1113190..1113552
FT                   /estimated_length=363
FT                   /gap_type="unknown"
FT   assembly_gap    1114676..1115271
FT                   /estimated_length=596
FT                   /gap_type="unknown"
FT   assembly_gap    1116297..1116316
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1117336..1117355
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1128264..1128509
FT                   /estimated_length=246
FT                   /gap_type="unknown"
FT   assembly_gap    1148013..1148056
FT                   /estimated_length=44
FT                   /gap_type="unknown"
FT   assembly_gap    1160219..1160348
FT                   /estimated_length=130
FT                   /gap_type="unknown"
FT   assembly_gap    1161870..1161889
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1165229..1165248
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1166375..1168080
FT                   /estimated_length=1706
FT                   /gap_type="unknown"
FT   assembly_gap    1284519..1284538
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1287475..1287494
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1288657..1288676
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1292239..1293145
FT                   /estimated_length=907
FT                   /gap_type="unknown"
FT   assembly_gap    1294562..1295145
FT                   /estimated_length=584
FT                   /gap_type="unknown"
FT   assembly_gap    1305009..1305028
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1311071..1311090
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1329859..1329878
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1342892..1342911
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1346231..1346925
FT                   /estimated_length=695
FT                   /gap_type="unknown"
FT   assembly_gap    1354048..1357299
FT                   /estimated_length=3252
FT                   /gap_type="unknown"
FT   assembly_gap    1361270..1361289
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1363230..1363249
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1365742..1366447
FT                   /estimated_length=706
FT                   /gap_type="unknown"
FT   assembly_gap    1368495..1371694
FT                   /estimated_length=3200
FT                   /gap_type="unknown"
FT   assembly_gap    1381679..1381698
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1382802..1382821
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1387616..1387770
FT                   /estimated_length=155
FT                   /gap_type="unknown"
FT   assembly_gap    1407921..1408225
FT                   /estimated_length=305
FT                   /gap_type="unknown"
FT   assembly_gap    1419374..1419393
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1421918..1422152
FT                   /estimated_length=235
FT                   /gap_type="unknown"
FT   assembly_gap    1426049..1426068
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1452068..1452766
FT                   /estimated_length=699
FT                   /gap_type="unknown"
FT   assembly_gap    1453613..1454551
FT                   /estimated_length=939
FT                   /gap_type="unknown"
FT   assembly_gap    1455254..1455450
FT                   /estimated_length=197
FT                   /gap_type="unknown"
FT   assembly_gap    1511850..1511869
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1534436..1534455
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1535788..1535807
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1538862..1538952
FT                   /estimated_length=91
FT                   /gap_type="unknown"
FT   assembly_gap    1545389..1546636
FT                   /estimated_length=1248
FT                   /gap_type="unknown"
FT   assembly_gap    1552688..1552954
FT                   /estimated_length=267
FT                   /gap_type="unknown"
FT   assembly_gap    1556920..1558054
FT                   /estimated_length=1135
FT                   /gap_type="unknown"
FT   assembly_gap    1627857..1628036
FT                   /estimated_length=180
FT                   /gap_type="unknown"
FT   assembly_gap    1629135..1629379
FT                   /estimated_length=245
FT                   /gap_type="unknown"
FT   assembly_gap    1646594..1649664
FT                   /estimated_length=3071
FT                   /gap_type="unknown"
FT   assembly_gap    1651176..1651476
FT                   /estimated_length=301
FT                   /gap_type="unknown"
FT   assembly_gap    1655125..1668882
FT                   /estimated_length=13758
FT                   /gap_type="unknown"
FT   assembly_gap    1677356..1678042
FT                   /estimated_length=687
FT                   /gap_type="unknown"
FT   assembly_gap    1685445..1686252
FT                   /estimated_length=808
FT                   /gap_type="unknown"
FT   assembly_gap    1695872..1696529
FT                   /estimated_length=658
FT                   /gap_type="unknown"
FT   assembly_gap    1707368..1707635
FT                   /estimated_length=268
FT                   /gap_type="unknown"
FT   assembly_gap    1709757..1709776
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1737036..1737055
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1832907..1834108
FT                   /estimated_length=1202
FT                   /gap_type="unknown"
FT   assembly_gap    1845584..1845603
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1846858..1846877
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1848846..1848865
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1851384..1852241
FT                   /estimated_length=858
FT                   /gap_type="unknown"
FT   assembly_gap    1852963..1852982
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1901088..1901107
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1934034..1934191
FT                   /estimated_length=158
FT                   /gap_type="unknown"
FT   assembly_gap    1939943..1939989
FT                   /estimated_length=47
FT                   /gap_type="unknown"
FT   assembly_gap    1952565..1952593
FT                   /estimated_length=29
FT                   /gap_type="unknown"
FT   assembly_gap    1959994..1960144
FT                   /estimated_length=151
FT                   /gap_type="unknown"
FT   assembly_gap    1968711..1968754
FT                   /estimated_length=44
FT                   /gap_type="unknown"
FT   assembly_gap    1985483..1985645
FT                   /estimated_length=163
FT                   /gap_type="unknown"
FT   assembly_gap    2000285..2000304
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2003554..2003573
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2036989..2037008
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2048063..2048635
FT                   /estimated_length=573
FT                   /gap_type="unknown"
FT   assembly_gap    2050154..2051696
FT                   /estimated_length=1543
FT                   /gap_type="unknown"
FT   assembly_gap    2069304..2069323
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2098218..2098334
FT                   /estimated_length=117
FT                   /gap_type="unknown"
FT   assembly_gap    2130010..2130029
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2134204..2134739
FT                   /estimated_length=536
FT                   /gap_type="unknown"
FT   assembly_gap    2174770..2174807
FT                   /estimated_length=38
FT                   /gap_type="unknown"
FT   assembly_gap    2177716..2177735
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2181600..2181619
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2182751..2182770
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2188332..2188653
FT                   /estimated_length=322
FT                   /gap_type="unknown"
FT   assembly_gap    2190147..2190166
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2193753..2194605
FT                   /estimated_length=853
FT                   /gap_type="unknown"
FT   assembly_gap    2203762..2203959
FT                   /estimated_length=198
FT                   /gap_type="unknown"
FT   assembly_gap    2212279..2212662
FT                   /estimated_length=384
FT                   /gap_type="unknown"
FT   assembly_gap    2214094..2214748
FT                   /estimated_length=655
FT                   /gap_type="unknown"
FT   assembly_gap    2223020..2223050
FT                   /estimated_length=31
FT                   /gap_type="unknown"
FT   assembly_gap    2225416..2225435
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2238838..2238857
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2244711..2244823
FT                   /estimated_length=113
FT                   /gap_type="unknown"
FT   assembly_gap    2251531..2256365
FT                   /estimated_length=4835
FT                   /gap_type="unknown"
FT   assembly_gap    2262704..2262844
FT                   /estimated_length=141
FT