
ID   CH466526; SV 2; linear; genomic DNA; CON; MUS; 53230554 BP.
AC   CH466526;
PR   Project:PRJNA11785;
DT   04-AUG-2005 (Rel. 84, Created)
DT   10-JUN-2007 (Rel. 92, Last updated, Version 8)
DE   Mus musculus 232000009830310 genomic scaffold, whole genome shotgun
DE   sequence.
KW   .
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
RN   [1]
RP   1-53230554
RX   DOI; 10.1126/science.1069193.
RX   PUBMED; 12040188.
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Miklos G.L., Wides R.,
RA   Halpern A., Li P.W., Sutton G.G., Nadeau J., Salzberg S.L., Holt R.A.,
RA   Kodira C.D., Lu F., Chen L., Deng Z., Evangelista C.C., Gan W.,
RA   Heiman T.J., Li J., Li Z., Merkulov G.V., Milshina N.V., Naik A.K., Qi R.,
RA   Shue B.C., Wang A., Wang J., Wang X., Yan X., Ye J., Yooseph S., Zhao Q.,
RA   Zheng L., Zhu S.C., Biddick K., Bolanos R., Delcher A.L., Dew I.M.,
RA   Fasulo D., Flanigan M.J., Huson D.H., Kravitz S.A., Miller J.R.,
RA   Mobarry C.M., Reinert K., Remington K.A., Zhang Q., Zheng X.H.,
RA   Nusskern D.R., Lai Z., Lei Y., Zhong W., Yao A., Guan P., Ji R.R., Gu Z.,
RA   Wang Z.Y., Zhong F., Xiao C., Chiang C.C., Yandell M., Wortman J.R.,
RA   Amanatides P.G., Hladun S.L., Pratts E.C., Johnson J.E., Dodson K.L.,
RA   Woodford K.J., Evans C.A., Gropman B., Rusch D.B., Venter E., Wang M.,
RA   Smith T.J., Houck J.T., Tompkins D.E., Haynes C., Jacob D., Chin S.H.,
RA   Allen D.R., Dahlke C.E., Sanders R., Li K., Liu X., Levitsky A.A.,
RA   Majoros W.H., Chen Q., Xia A.C., Lopez J.R., Donnelly M.T., Newman M.H.,
RA   Glodek A., Kraft C.L., Nodell M., Ali F., An H.J., Baldwin-Pitts D.,
RA   Beeson K.Y., Cai S., Carnes M., Carver A., Caulk P.M., Center A.,
RA   Chen Y.H., Cheng M.L., Coyne M.D., Crowder M., Danaher S., Davenport L.B.,
RA   Desilets R., Dietz S.M., Doup L., Dullaghan P., Ferriera S., Fosler C.R.,
RA   Gire H.C., Gluecksmann A., Gocayne J.D., Gray J., Hart B., Haynes J.,
RA   Hoover J., Howland T., Ibegwam C., Jalali M., Johns D., Kline L., Ma D.S.,
RA   MacCawley S., Magoon A., Mann F., May D., McIntosh T.C., Mehta S., Moy L.,
RA   Moy M.C., Murphy B.J., Murphy S.D., Nelson K.A., Nuri Z., Parker K.A.,
RA   Prudhomme A.C., Puri V.N., Qureshi H., Raley J.C., Reardon M.S.,
RA   Regier M.A., Rogers Y.H., Romblad D.L., Schutz J., Scott J.L., Scott R.,
RA   Sitter C.D., Smallwood M., Sprague A.C., Stewart E., Strong R.V., Suh E.,
RA   Sylvester K., Thomas R., Tint N.N., Tsonis C., Wang G., Wang G.,
RA   Williams M.S., Williams S.M., Windsor S.M., Wolfe K., Wu M.M., Zaveri J.,
RA   Chaturvedi K., Gabrielian A.E., Ke Z., Sun J., Subramanian G., Venter J.C.,
RA   Pfannkoch C.M., Barnstead M., Stephenson L.D.;
RT   "A comparison of whole-genome shotgun-derived mouse chromosome 16 and the
RT   human genome";
RL   Science, e1252229 296(5573):1661-1671(2002).
RN   [2]
RP   1-53230554
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (05-JUL-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
RN   [3]
RP   1-53230554
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (02-SEP-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
DR   MD5; a34d4e3ea5bbc2ab4f6709a7cce32130.
DR   ENA; AAHY01000000; SET.
DR   ENA; AAHY00000000; SET.
DR   ENA-CON; CM000220.
DR   BioSample; SAMN03004379.
DR   Ensembl-Gn; ENSMUSG00000001627; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000004698; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020545; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020561; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020644; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020990; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000021023; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000021054; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000021061; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000021065; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000021087; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000021099; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000034435; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000035105; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000035431; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000043398; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000044067; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000044573; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000044712; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000047022; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000047446; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000048982; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000054204; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000056459; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000058669; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000059970; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000062198; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000071342; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000092305; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000109482; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019635; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019653; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019654; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019666; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019676; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019680; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019682; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019691; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019699; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019701; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019702; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019735; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019742; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019747; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019756; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019763; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019773; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019801; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019804; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019820; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019831; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019836; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019838; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019847; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019850; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019856; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019858; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019862; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019868; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0019602; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019620; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019621; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019633; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019646; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019648; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019657; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019665; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019667; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019668; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019697; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019704; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019706; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019715; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019722; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019732; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019759; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019762; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019778; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019789; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019794; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019796; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019805; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019808; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019814; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019816; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019820; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019826; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0019573; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019591; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019592; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019604; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019614; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019617; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019619; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019628; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019636; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019638; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019639; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019668; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019690; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019697; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019707; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019735; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019738; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019754; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019764; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019769; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019771; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019780; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019783; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019789; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019791; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019795; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019801; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019579; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019597; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019598; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019610; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019620; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019624; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019626; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019635; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019643; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019645; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019646; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019675; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019682; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019686; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019695; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019702; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019712; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019739; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019742; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019758; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019769; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019774; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019776; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019784; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019787; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019793; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019795; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019799; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019805; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019383; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019401; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019414; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019424; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019428; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019430; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019439; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019447; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019449; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019450; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019478; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019491; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019500; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019507; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019517; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019545; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019548; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019563; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019574; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019579; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019581; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019590; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019593; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019599; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019601; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019605; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019611; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0020027; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0020044; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0020045; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0020057; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0020067; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0020071; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0020073; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0020082; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0020090; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0020092; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0020093; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0020123; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0020130; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0020138; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0020147; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0020154; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0020164; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0020191; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0020194; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0020210; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0020221; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0020226; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0020228; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0020236; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0020239; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0020245; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0020247; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0020251; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0020257; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018938; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018956; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018957; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018969; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018979; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018982; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018984; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018992; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0019000; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0019002; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0019003; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0019031; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0019038; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0019043; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0019052; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0019059; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0019069; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0019096; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0019099; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0019115; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0019126; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0019131; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0019133; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0019141; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0019144; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0019150; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0019152; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0019156; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0019162; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0019354; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019372; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019373; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019386; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019396; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019400; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019402; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019411; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019419; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019421; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019422; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019450; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019469; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019476; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019486; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019514; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019517; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019533; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019544; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019549; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019551; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019560; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019563; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019569; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019571; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019575; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019581; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0019468; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019486; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019487; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019499; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019509; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019513; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019515; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019524; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019532; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019534; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019535; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019564; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019571; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019585; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019592; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019602; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019630; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019633; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019649; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019660; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019665; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019667; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019676; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019679; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019685; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019687; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019691; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019697; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0019459; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019477; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019478; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019490; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019502; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019504; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019513; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019521; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019523; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019524; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019553; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019560; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019564; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019573; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019580; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019590; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019617; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019620; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019636; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019647; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019652; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019654; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019663; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019666; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019672; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019674; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019678; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019684; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0019538; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019556; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019557; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019569; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019579; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019583; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019585; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019594; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019602; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019604; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019605; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019636; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019643; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019657; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019664; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019674; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019702; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019705; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019721; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019732; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019737; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019739; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019748; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019751; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019757; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019759; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019763; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019769; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019494; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019512; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019513; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019525; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019535; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019538; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019540; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019549; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019557; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019559; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019560; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019589; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019602; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019611; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019618; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019628; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019656; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019659; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019675; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019686; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019691; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019693; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019702; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019705; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019711; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019713; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019717; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019723; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0020066; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0020084; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0020085; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0020097; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0020107; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0020111; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0020113; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0020122; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0020130; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0020132; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0020133; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0020161; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0020168; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0020181; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0020188; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0020198; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0020226; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0020229; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0020245; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0020256; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0020261; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0020263; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0020272; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0020275; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0020281; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0020283; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0020287; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0020293; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018705; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018723; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018724; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018736; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018746; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018749; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018751; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018759; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018767; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018769; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018770; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018798; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018805; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018810; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018819; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018826; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018835; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018861; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018864; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018880; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018891; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018898; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018907; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018910; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018916; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018918; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018922; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018928; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018989; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0019007; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0019019; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0019032; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0019034; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0019042; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0019050; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0019052; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0019053; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0019082; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0019089; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0019094; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0019103; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0019110; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0019120; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0019147; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0019150; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0019166; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0019177; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0019182; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0019184; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0019193; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0019196; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0019202; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0019204; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0019208; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0019214; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000001672; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020853; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020877; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020974; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000021377; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000021406; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000021411; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000021450; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000021458; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000021519; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000039516; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000042975; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000044299; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000050649; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000051079; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000057783; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000062740; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000062804; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000067087; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000072631; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000074038; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000078505; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000080449; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000095760; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110671; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110819; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000123498; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000130447; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000134550; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000136441; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000140523; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000144910; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000167011; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000171770; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000176102; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000176278; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000177595; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000184766; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000184980; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000208307; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000209667; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000219555; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000220285; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000221761; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0034564; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0034607; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0034608; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0034642; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0034685; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0034689; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0034692; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0034708; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0034736; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0034743; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0034744; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0034817; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0034834; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0034843; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0034861; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0034884; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0034930; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0034989; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0035001; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0035049; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0035087; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0035100; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0035106; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0035124; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0035128; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0035155; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0035162; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0035167; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0035189; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0034495; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0034537; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0034538; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0034571; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0034617; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0034620; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0034636; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0034663; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0034670; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0034671; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0034741; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0034759; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0034763; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0034782; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0034805; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0034849; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0034910; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0034922; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0034972; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0035011; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0035024; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0035030; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0035048; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0035052; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0035079; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0035086; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0035091; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0035113; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0034479; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0034521; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0034522; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0034555; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0034597; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0034601; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0034604; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0034620; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0034647; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0034654; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0034655; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0034724; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0034769; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0034792; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0034838; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0034896; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0034908; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0034956; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0034993; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0035005; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0035012; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0035030; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0035034; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0035060; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0035067; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0035072; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0035094; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0034493; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0034534; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0034535; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0034568; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0034610; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0034615; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0034618; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0034634; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0034661; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0034668; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0034669; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0034740; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0034757; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0034763; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0034782; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0034805; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0034848; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0034906; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0034918; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0034967; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0035005; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0035017; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0035023; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0035040; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0035044; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0035071; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0035078; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0035083; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0035105; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0034273; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0034314; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0034348; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0034390; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0034395; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0034398; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0034414; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0034441; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0034448; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0034449; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0034518; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0034544; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0034563; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0034586; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0034632; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0034691; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0034703; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0034749; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0034788; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0034800; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0034807; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0034825; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0034829; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0034856; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0034863; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0034868; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0034890; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0034993; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0035033; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0035034; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0035066; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0035108; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0035113; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0035116; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0035132; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0035159; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0035166; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0035167; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0035240; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0035255; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0035267; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0035286; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0035309; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0035354; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0035410; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0035421; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0035469; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0035507; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0035519; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0035525; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0035542; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0035546; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0035573; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0035580; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0035586; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0035608; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0034188; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0034232; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0034233; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0034268; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0034312; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0034316; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0034319; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0034336; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0034362; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0034369; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0034370; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0034441; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0034461; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0034468; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0034490; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0034512; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0034558; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0034621; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0034633; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0034682; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0034720; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0034731; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0034737; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0034758; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0034761; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0034787; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0034794; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0034799; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0034822; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0034184; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0034226; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0034227; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0034261; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0034304; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0034309; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0034312; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0034328; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0034355; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0034362; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0034363; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0034432; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0034469; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0034492; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0034538; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0034598; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0034611; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0034660; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0034699; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0034711; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0034718; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0034736; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0034740; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0034767; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0034774; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0034779; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0034801; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0034328; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0034369; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0034370; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0034403; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0034445; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0034451; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0034454; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0034470; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0034497; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0034504; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0034505; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0034576; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0034593; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0034620; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0034643; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0034688; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0034746; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0034758; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0034806; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0034844; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0034856; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0034863; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0034881; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0034885; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0034912; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0034919; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0034924; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0034946; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0034322; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0034364; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0034365; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0034397; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0034443; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0034446; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0034462; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0034489; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0034496; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0034497; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0034565; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0034581; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0034587; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0034606; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0034629; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0034674; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0034730; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0034742; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0034790; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0034829; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0034841; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0034847; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0034865; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0034868; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0034895; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0034902; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0034907; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0034929; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0034467; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0034510; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0034511; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0034544; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0034586; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0034591; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0034594; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0034610; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0034637; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0034644; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0034645; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0034716; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0034733; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0034758; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0034781; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0034826; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0034885; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0034897; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0034944; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0034980; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0034992; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0034998; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0035016; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0035020; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0035047; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0035054; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0035059; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0035081; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0034330; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0034374; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0034375; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0034407; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0034448; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0034452; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0034455; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0034471; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0034499; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0034506; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0034507; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0034576; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0034601; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0034619; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0034641; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0034683; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0034741; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0034754; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0034801; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0034836; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0034849; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0034855; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0034872; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0034876; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0034903; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0034910; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0034915; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0034939; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0035039; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0035081; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0035082; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0035115; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0035157; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0035162; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0035165; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0035181; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0035208; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0035215; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0035216; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0035283; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0035300; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0035326; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0035350; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0035395; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0035455; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0035467; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0035516; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0035554; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0035566; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0035572; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0035590; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0035594; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0035621; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0035628; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0035633; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0035656; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0033870; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0033915; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0033916; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0033950; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0033994; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0033998; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0034001; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0034018; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0034044; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0034051; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0034052; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0034125; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0034142; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0034149; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0034172; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0034196; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0034241; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0034300; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0034312; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0034361; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0034401; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0034421; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0034443; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0034446; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0034473; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0034480; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0034485; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0034511; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0033742; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0033783; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0033816; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0033861; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0033864; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0033879; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0033905; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0033912; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0033913; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0033982; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0034000; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0034007; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0034027; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0034050; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0034093; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0034150; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0034162; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0034211; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0034247; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0034258; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0034264; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0034281; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0034285; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0034312; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0034319; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0034324; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0034345; mus_musculus_wsbeij.
DR   PubMed; 12040188.
CC   On Sep 6, 2005 this sequence version replaced gi:70980454.
CC   This is the July 2001 combined whole genome shotgun assembly of Mus
CC   musculus. It contains 27 million Celera reads on four Mus musculus
CC   strains (129X1/SvJ, 129S1/SvImJ, DBA/2J and A/J), 13 million reads
CC   on C57BL/6J from the NCBI Trace Archive, 0.4 million BAC end
CC   sequences from TIGR, and unfinished and finished BACs pulled from
CC   NCBI (Nature 2002. 420:520-562). The assembly process relied on
CC   Celera's paired reads and BAC end reads for long range order and
CC   orientation. Its scaffolds were mapped to chromosomes using STS
CC   maps. For more detailed information about whole genome sequencing
CC   and Celera's assembly process, please refer to Venter, J.C. et al.
CC   Science 2001. 291:1304-1351.
CC   This version of genes, transcripts, and proteins was
CC   computationally created in November 2001 from the whole-genome
CC   mapping of transcript and protein sequences on the Celera mouse
CC   genome assembly by Celera Chromosome Team and Content Systems.  The
CC   data sets used by this annotation process were collected in 2001
CC   and include RefSeq (NM_ from mouse and human) sequences, GenBank
CC   mRNA and dbEST sequences, mammalian SwissProt sequences,  and NRAA
CC   sequences (all mouse unless noted otherwise).  The initial gene set
CC   was manually curated between 2002 and 2003. Subsequently, automated
CC   annotation updates were performed.  The CDS of each transcript was
CC   manually or computationally defined by either the longest
CC   ATG-to-Stop or the longest open reading frame. All CDSs
CC   corresponding to the longest open reading frames with no starting
CC   ATG were flagged as partial.
FH   Key             Location/Qualifiers
FT   source          1..53230554
FT                   /organism="Mus musculus"
FT                   /chromosome="12"
FT                   /strain="mixed"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   assembly_gap    3320..3447
FT                   /estimated_length=128
FT                   /gap_type="unknown"
FT   gene            complement(<6327..6727)
FT                   /locus_tag="mCG_1041697"
FT                   /note="gene_id=mCG1041697.1"
FT   mRNA            complement(<6327..6727)
FT                   /locus_tag="mCG_1041697"
FT                   /product="mCG1041697"
FT                   /note="gene_id=mCG1041697.1 transcript_id=mCT159401.1
FT                   created on 18-SEP-2002"
FT   CDS             complement(<6327..6457)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041697"
FT                   /product="mCG1041697"
FT                   /note="gene_id=mCG1041697.1 transcript_id=mCT159401.1
FT                   protein_id=mCP78816.1"
FT                   /protein_id="EDL37002.1"
FT   assembly_gap    7028..7288
FT                   /estimated_length=261
FT                   /gap_type="unknown"
FT   assembly_gap    8515..10439
FT                   /estimated_length=1925
FT                   /gap_type="unknown"
FT   assembly_gap    18357..21148
FT                   /estimated_length=2792
FT                   /gap_type="unknown"
FT   assembly_gap    23811..23830
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26919..31473
FT                   /estimated_length=4555
FT                   /gap_type="unknown"
FT   gene            complement(32095..33894)
FT                   /pseudo
FT                   /locus_tag="mCG_126897"
FT                   /note="gene_id=mCG126897.0"
FT   mRNA            complement(join(32095..33802,33863..33894))
FT                   /pseudo
FT                   /locus_tag="mCG_126897"
FT                   /note="gene_id=mCG126897.0 transcript_id=mCT128174.0
FT                   created on 10-SEP-2002"
FT   assembly_gap    34544..34646
FT                   /estimated_length=103
FT                   /gap_type="unknown"
FT   assembly_gap    35624..36726
FT                   /estimated_length=1103
FT                   /gap_type="unknown"
FT   assembly_gap    39996..40422
FT                   /estimated_length=427
FT                   /gap_type="unknown"
FT   assembly_gap    45235..45352
FT                   /estimated_length=118
FT                   /gap_type="unknown"
FT   assembly_gap    52258..52277
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    53383..53402
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            70465..73749
FT                   /locus_tag="mCG_1041985"
FT                   /note="gene_id=mCG1041985.1"
FT   mRNA            join(70465..70664,72226..73749)
FT                   /locus_tag="mCG_1041985"
FT                   /product="mCG1041985"
FT                   /note="gene_id=mCG1041985.1 transcript_id=mCT159689.1
FT                   created on 18-SEP-2002"
FT   CDS             72385..72633
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041985"
FT                   /product="mCG1041985"
FT                   /note="gene_id=mCG1041985.1 transcript_id=mCT159689.1
FT                   protein_id=mCP79105.1"
FT                   /protein_id="EDL37001.1"
FT   assembly_gap    91183..91289
FT                   /estimated_length=107
FT                   /gap_type="unknown"
FT   assembly_gap    119437..120498
FT                   /estimated_length=1062
FT                   /gap_type="unknown"
FT   assembly_gap    127294..127823
FT                   /estimated_length=530
FT                   /gap_type="unknown"
FT   gene            complement(137897..>140025)
FT                   /locus_tag="mCG_18894"
FT                   /note="gene_id=mCG18894.1"
FT   mRNA            complement(join(137897..137952,138129..138394,
FT                   138556..>140025))
FT                   /locus_tag="mCG_18894"
FT                   /product="mCG18894"
FT                   /note="gene_id=mCG18894.1 transcript_id=mCT16269.1 created
FT                   on 10-SEP-2002"
FT   CDS             complement(139400..>139999)
FT                   /codon_start=1
FT                   /locus_tag="mCG_18894"
FT                   /product="mCG18894"
FT                   /note="gene_id=mCG18894.1 transcript_id=mCT16269.1
FT                   protein_id=mCP12115.1"
FT                   /protein_id="EDL37000.1"
FT   gene            144663..>205555
FT                   /gene="Taf1b"
FT                   /locus_tag="mCG_126896"
FT                   /note="gene_id=mCG126896.1"
FT   mRNA            join(144663..144942,146716..146814,151665..151763,
FT                   152036..152131,157399..157549,159420..159570,
FT                   165636..165735,191432..191579,194166..194343,
FT                   194723..194769,196576..196666,203170..203240,
FT                   203699..203921,205354..>205555)
FT                   /gene="Taf1b"
FT                   /locus_tag="mCG_126896"
FT                   /product="TATA box binding protein (Tbp)-associated factor,
FT                   RNA polymerase I, B, transcript variant mCT128171"
FT                   /note="gene_id=mCG126896.1 transcript_id=mCT128171.1
FT                   created on 03-SEP-2002"
FT   CDS             join(144925..144942,146716..146814,151665..151763,
FT                   152036..152131,157399..157549,159420..159570,
FT                   165636..165735,191432..191579,194166..194343,
FT                   194723..194769,196576..196666,203170..203240,
FT                   203699..203921,205354..205555)
FT                   /codon_start=1
FT                   /gene="Taf1b"
FT                   /locus_tag="mCG_126896"
FT                   /product="TATA box binding protein (Tbp)-associated factor,
FT                   RNA polymerase I, B, isoform CRA_a"
FT                   /note="gene_id=mCG126896.1 transcript_id=mCT128171.1
FT                   protein_id=mCP78686.0 isoform=CRA_a"
FT                   /protein_id="EDL36998.1"
FT   mRNA            join(<145103..145338,146716..146814,151665..151763,
FT                   152036..152131,157399..157549,159420..159570,
FT                   165636..165735,191432..191579,194166..194343,
FT                   194723..194769,196576..196666,203170..203240,
FT                   203699..203921,205354..>205555)
FT                   /gene="Taf1b"
FT                   /locus_tag="mCG_126896"
FT                   /product="TATA box binding protein (Tbp)-associated factor,
FT                   RNA polymerase I, B, transcript variant mCT172852"
FT                   /note="gene_id=mCG126896.1 transcript_id=mCT172852.0
FT                   created on 03-SEP-2002"
FT   CDS             join(<145264..145338,146716..146814,151665..151763,
FT                   152036..152131,157399..157549,159420..159570,
FT                   165636..165735,191432..191579,194166..194343,
FT                   194723..194769,196576..196666,203170..203240,
FT                   203699..203921,205354..205555)
FT                   /codon_start=1
FT                   /gene="Taf1b"
FT                   /locus_tag="mCG_126896"
FT                   /product="TATA box binding protein (Tbp)-associated factor,
FT                   RNA polymerase I, B, isoform CRA_b"
FT                   /note="gene_id=mCG126896.1 transcript_id=mCT172852.0
FT                   protein_id=mCP95771.0 isoform=CRA_b"
FT                   /protein_id="EDL36999.1"
FT                   "
FT   assembly_gap    148163..150175
FT                   /estimated_length=2013
FT                   /gap_type="unknown"
FT   assembly_gap    167887..167906
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    169935..169954
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    172528..173284
FT                   /estimated_length=757
FT                   /gap_type="unknown"
FT   assembly_gap    175677..175696
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    177161..177180
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    204628..204647
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <219323..>229937
FT                   /locus_tag="mCG_18897"
FT                   /note="gene_id=mCG18897.1"
FT   mRNA            join(<219323..219484,222869..223055,224985..225055,
FT                   228317..228707,229857..>229937)
FT                   /locus_tag="mCG_18897"
FT                   /product="mCG18897"
FT                   /note="gene_id=mCG18897.1 transcript_id=mCT16273.1 created
FT                   on 10-SEP-2002"
FT   CDS             join(<219324..219484,222869..223055,224985..225055,
FT                   228317..228707,229857..229937)
FT                   /codon_start=1
FT                   /locus_tag="mCG_18897"
FT                   /product="mCG18897"
FT                   /note="gene_id=mCG18897.1 transcript_id=mCT16273.1
FT                   protein_id=mCP12105.1"
FT                   /protein_id="EDL36997.1"
FT                   PGMNSEDYVFDNVSG"
FT   assembly_gap    221552..221571
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    231073..231167
FT                   /estimated_length=95
FT                   /gap_type="unknown"
FT   gene            <231282..264398
FT                   /locus_tag="mCG_127794"
FT                   /note="gene_id=mCG127794.0"
FT   mRNA            join(<231282..231442,231796..231907,233017..233111,
FT                   249952..250110,255076..255166,255480..255619,
FT                   256756..256793,258875..258966,259207..259292,
FT                   261461..261525,262834..264398)
FT                   /locus_tag="mCG_127794"
FT                   /product="mCG127794, transcript variant mCT129086"
FT                   /note="gene_id=mCG127794.0 transcript_id=mCT129086.0
FT                   created on 10-SEP-2002"
FT   CDS             join(<231284..231442,231796..231907,233017..233111,
FT                   249952..250110,255076..255166,255480..255619,
FT                   256756..256793,258875..258966,259207..259292,
FT                   261461..261525,262834..262948)
FT                   /codon_start=1
FT                   /locus_tag="mCG_127794"
FT                   /product="mCG127794, isoform CRA_a"
FT                   /note="gene_id=mCG127794.0 transcript_id=mCT129086.0
FT                   protein_id=mCP78427.0 isoform=CRA_a"
FT                   /protein_id="EDL36995.1"
FT   mRNA            join(<233072..233111,249952..250110,255076..255127,
FT                   255480..255619,256756..256793,258875..258966,
FT                   259207..259292,261461..>261507)
FT                   /locus_tag="mCG_127794"
FT                   /product="mCG127794, transcript variant mCT193503"
FT                   /note="gene_id=mCG127794.0 transcript_id=mCT193503.0
FT                   created on 09-MAR-2004"
FT   CDS             join(<233073..233111,249952..250110,255076..255127,
FT                   255480..255619,256756..256793,258875..258966,
FT                   259207..259292,261461..>261507)
FT                   /codon_start=1
FT                   /locus_tag="mCG_127794"
FT                   /product="mCG127794, isoform CRA_b"
FT                   /note="gene_id=mCG127794.0 transcript_id=mCT193503.0
FT                   protein_id=mCP114450.0 isoform=CRA_b"
FT                   /protein_id="EDL36996.1"
FT   assembly_gap    233858..233877
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    237975..237994
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(264870..265562)
FT                   /locus_tag="mCG_1041984"
FT                   /note="gene_id=mCG1041984.0"
FT   mRNA            complement(join(264870..265366,265380..265562))
FT                   /locus_tag="mCG_1041984"
FT                   /product="mCG1041984"
FT                   /note="gene_id=mCG1041984.0 transcript_id=mCT159688.0
FT                   created on 18-SEP-2002"
FT   CDS             complement(265094..265306)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041984"
FT                   /product="mCG1041984"
FT                   /note="gene_id=mCG1041984.0 transcript_id=mCT159688.0
FT                   protein_id=mCP79095.1"
FT                   /protein_id="EDL36994.1"
FT   assembly_gap    267518..267543
FT                   /estimated_length=26
FT                   /gap_type="unknown"
FT   assembly_gap    289358..289377
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <297236..308779
FT                   /gene="Tieg3"
FT                   /locus_tag="mCG_18898"
FT                   /note="gene_id=mCG18898.2"
FT   mRNA            join(<297236..297530,299520..299771,300801..301734,
FT                   306186..308679)
FT                   /gene="Tieg3"
FT                   /locus_tag="mCG_18898"
FT                   /product="TGFB inducible early growth response 3,
FT                   transcript variant mCT193514"
FT                   /note="gene_id=mCG18898.2 transcript_id=mCT193514.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<297237..297530,299520..299771,300801..301734,
FT                   306186..306466)
FT                   /codon_start=1
FT                   /gene="Tieg3"
FT                   /locus_tag="mCG_18898"
FT                   /product="TGFB inducible early growth response 3, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG18898.2 transcript_id=mCT193514.0
FT                   protein_id=mCP114460.0 isoform=CRA_a"
FT                   /protein_id="EDL36992.1"
FT                   SILEPLPASG"
FT   mRNA            join(<297489..297530,299520..299771,300819..301734,
FT                   306186..308779)
FT                   /gene="Tieg3"
FT                   /locus_tag="mCG_18898"
FT                   /product="TGFB inducible early growth response 3,
FT                   transcript variant mCT16271"
FT                   /note="gene_id=mCG18898.2 transcript_id=mCT16271.1 created
FT                   on 10-SEP-2002"
FT   CDS             join(297489..297530,299520..299771,300819..301734,
FT                   306186..306466)
FT                   /codon_start=1
FT                   /gene="Tieg3"
FT                   /locus_tag="mCG_18898"
FT                   /product="TGFB inducible early growth response 3, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG18898.2 transcript_id=mCT16271.1
FT                   protein_id=mCP12110.1 isoform=CRA_b"
FT                   /protein_id="EDL36993.1"
FT   gene            complement(311865..>327241)
FT                   /gene="Cys1"
FT                   /locus_tag="mCG_18901"
FT                   /note="gene_id=mCG18901.1"
FT   mRNA            complement(join(311865..312279,312786..312846,
FT                   313109..313251,315695..315747,326074..>327241))
FT                   /gene="Cys1"
FT                   /locus_tag="mCG_18901"
FT                   /product="cystin 1"
FT                   /note="gene_id=mCG18901.1 transcript_id=mCT16276.1 created
FT                   on 03-SEP-2002"
FT   CDS             complement(join(313146..313251,315695..315747,
FT                   326074..>326502))
FT                   /codon_start=1
FT                   /gene="Cys1"
FT                   /locus_tag="mCG_18901"
FT                   /product="cystin 1"
FT                   /note="gene_id=mCG18901.1 transcript_id=mCT16276.1
FT                   protein_id=mCP12119.0"
FT                   /protein_id="EDL36991.1"
FT   assembly_gap    315410..315480
FT                   /estimated_length=71
FT                   /gap_type="unknown"
FT   assembly_gap    328311..328330
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    334700..334927
FT                   /estimated_length=228
FT                   /gap_type="unknown"
FT   gene            <349044..355234
FT                   /gene="Rrm2"
FT                   /locus_tag="mCG_18902"
FT                   /note="gene_id=mCG18902.2"
FT   mRNA            join(<349044..349557,349672..349746,350051..350197,
FT                   350437..350553,351471..351604,352569..352663,
FT                   352791..352924,353783..353887,353983..354096,
FT                   354206..355234)
FT                   /gene="Rrm2"
FT                   /locus_tag="mCG_18902"
FT                   /product="ribonucleotide reductase M2"
FT                   /note="gene_id=mCG18902.2 transcript_id=mCT16277.2 created
FT                   on 03-SEP-2002"
FT   CDS             join(<349396..349557,349672..349746,350051..350197,
FT                   350437..350553,351471..351604,352569..352663,
FT                   352791..352924,353783..353887,353983..354096,
FT                   354206..354358)
FT                   /codon_start=1
FT                   /gene="Rrm2"
FT                   /locus_tag="mCG_18902"
FT                   /product="ribonucleotide reductase M2"
FT                   /note="gene_id=mCG18902.2 transcript_id=mCT16277.2
FT                   protein_id=mCP12107.0"
FT                   /protein_id="EDL36990.1"
FT                   STENSFTLDADF"
FT   assembly_gap    360816..361569
FT                   /estimated_length=754
FT                   /gap_type="unknown"
FT   assembly_gap    374762..374781
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <381188..381702
FT                   /locus_tag="mCG_18900"
FT                   /note="gene_id=mCG18900.0"
FT   mRNA            <381188..381702
FT                   /locus_tag="mCG_18900"
FT                   /product="mCG18900"
FT                   /note="gene_id=mCG18900.0 transcript_id=mCT16275.0 created
FT                   on 10-SEP-2002"
FT   CDS             <381189..381626
FT                   /codon_start=1
FT                   /locus_tag="mCG_18900"
FT                   /product="mCG18900"
FT                   /note="gene_id=mCG18900.0 transcript_id=mCT16275.0
FT                   protein_id=mCP12106.0"
FT                   /protein_id="EDL36989.1"
FT   assembly_gap    395001..395020
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    396841..398953
FT                   /estimated_length=2113
FT                   /gap_type="unknown"
FT   assembly_gap    400172..400191
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            400596..401403
FT                   /locus_tag="mCG_1041603"
FT                   /note="gene_id=mCG1041603.0"
FT   mRNA            join(400596..400653,401109..401403)
FT                   /locus_tag="mCG_1041603"
FT                   /product="mCG1041603"
FT                   /note="gene_id=mCG1041603.0 transcript_id=mCT159307.0
FT                   created on 18-SEP-2002"
FT   CDS             401249..401362
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041603"
FT                   /product="mCG1041603"
FT                   /note="gene_id=mCG1041603.0 transcript_id=mCT159307.0
FT                   protein_id=mCP78890.1"
FT                   /protein_id="EDL36988.1"
FT   assembly_gap    402031..402050
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    403300..403319
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    404488..404507
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            405244..407785
FT                   /locus_tag="mCG_148249"
FT                   /note="gene_id=mCG148249.0"
FT   mRNA            join(405244..405354,407584..407785)
FT                   /locus_tag="mCG_148249"
FT                   /product="mCG148249"
FT                   /note="gene_id=mCG148249.0 transcript_id=mCT188512.0
FT                   created on 13-JAN-2004"
FT   assembly_gap    405816..406584
FT                   /estimated_length=769
FT                   /gap_type="unknown"
FT   CDS             407602..407700
FT                   /codon_start=1
FT                   /locus_tag="mCG_148249"
FT                   /product="mCG148249"
FT                   /note="gene_id=mCG148249.0 transcript_id=mCT188512.0
FT                   protein_id=mCP108083.0"
FT                   /protein_id="EDL36987.1"
FT                   /translation="MSSDAGMDHPSLPQIEVEMSGPYLKTVSSDMN"
FT   assembly_gap    442027..442177
FT                   /estimated_length=151
FT                   /gap_type="unknown"
FT   assembly_gap    474031..474198
FT                   /estimated_length=168
FT                   /gap_type="unknown"
FT   gene            <474200..599495
FT                   /gene="Mboat2"
FT                   /locus_tag="mCG_127795"
FT                   /note="gene_id=mCG127795.0"
FT   mRNA            join(<474200..474411,562773..562868,573223..573278,
FT                   578880..578934,585456..585636,587192..587384,
FT                   590527..590630,593344..593408,594441..594573,
FT                   596763..596914,598122..599495)
FT                   /gene="Mboat2"
FT                   /locus_tag="mCG_127795"
FT                   /product="membrane bound O-acyltransferase domain
FT                   containing 2, transcript variant mCT129087"
FT                   /note="gene_id=mCG127795.0 transcript_id=mCT129087.0
FT                   created on 10-SEP-2002"
FT   mRNA            join(474204..474364,521537..521682,525961..526038,
FT                   573223..573278,578880..578934,585456..585636,
FT                   587192..587384,590527..590630,593344..593408,
FT                   594441..594573,596763..596914,598122..598880)
FT                   /gene="Mboat2"
FT                   /locus_tag="mCG_127795"
FT                   /product="membrane bound O-acyltransferase domain
FT                   containing 2, transcript variant mCT173189"
FT                   /note="gene_id=mCG127795.0 transcript_id=mCT173189.0
FT                   created on 10-SEP-2002"
FT   mRNA            join(<474207..474364,573223..573278,578880..578934,
FT                   585456..585636,587192..587384,590527..590630,
FT                   593344..593408,594441..594573,596763..596914,
FT                   598122..599494)
FT                   /gene="Mboat2"
FT                   /locus_tag="mCG_127795"
FT                   /product="membrane bound O-acyltransferase domain
FT                   containing 2, transcript variant mCT193504"
FT                   /note="gene_id=mCG127795.0 transcript_id=mCT193504.0
FT                   created on 09-MAR-2004"
FT   CDS             join(<474207..474364,573223..573278,578880..578934,
FT                   585456..585636,587192..587384,590527..590630,
FT                   593344..593408,594441..594573,596763..596914,
FT                   598122..598347)
FT                   /codon_start=1
FT                   /gene="Mboat2"
FT                   /locus_tag="mCG_127795"
FT                   /product="membrane bound O-acyltransferase domain
FT                   containing 2, isoform CRA_c"
FT                   /note="gene_id=mCG127795.0 transcript_id=mCT193504.0
FT                   protein_id=mCP114451.0 isoform=CRA_c"
FT                   /protein_id="EDL36984.1"
FT   mRNA            join(<474213..474364,521537..521682,525961..526038,
FT                   562773..562868,573223..573278,578880..578934,
FT                   585456..585636,587192..587384,590527..590630,
FT                   593344..593408,594441..594573,596763..596914,
FT                   598122..599035)
FT                   /gene="Mboat2"
FT                   /locus_tag="mCG_127795"
FT                   /product="membrane bound O-acyltransferase domain
FT                   containing 2, transcript variant mCT193505"
FT                   /note="gene_id=mCG127795.0 transcript_id=mCT193505.0
FT                   created on 09-MAR-2004"
FT   CDS             join(<474218..474411,562773..562868,573223..573278,
FT                   578880..578934,585456..585636,587192..587384,
FT                   590527..590630,593344..593408,594441..594573,
FT                   596763..596914,598122..598347)
FT                   /codon_start=1
FT                   /gene="Mboat2"
FT                   /locus_tag="mCG_127795"
FT                   /product="membrane bound O-acyltransferase domain
FT                   containing 2, isoform CRA_a"
FT                   /note="gene_id=mCG127795.0 transcript_id=mCT129087.0
FT                   protein_id=mCP78453.0 isoform=CRA_a"
FT                   /protein_id="EDL36982.1"
FT   CDS             join(<474218..474364,521537..521682,525961..526038,
FT                   562773..562868,573223..573278,578880..578934,
FT                   585456..585636,587192..587384,590527..590630,
FT                   593344..593408,594441..594573,596763..596914,
FT                   598122..598347)
FT                   /codon_start=1
FT                   /gene="Mboat2"
FT                   /locus_tag="mCG_127795"
FT                   /product="membrane bound O-acyltransferase domain
FT                   containing 2, isoform CRA_d"
FT                   /note="gene_id=mCG127795.0 transcript_id=mCT193505.0
FT                   protein_id=mCP114452.0 isoform=CRA_d"
FT                   /protein_id="EDL36985.1"
FT   mRNA            join(<474221..474364,562773..562868,578880..578934,
FT                   585456..585636,587192..587384,590527..590630,
FT                   593344..593408,594441..594573,596763..596914,
FT                   598122..599475)
FT                   /gene="Mboat2"
FT                   /locus_tag="mCG_127795"
FT                   /product="membrane bound O-acyltransferase domain
FT                   containing 2, transcript variant mCT193506"
FT                   /note="gene_id=mCG127795.0 transcript_id=mCT193506.0
FT                   created on 09-MAR-2004"
FT   CDS             join(<474223..474364,562773..562868,578880..578934,
FT                   585456..585636,587192..587384,590527..590630,
FT                   593344..593408,594441..594573,596763..596914,
FT                   598122..598347)
FT                   /codon_start=1
FT                   /gene="Mboat2"
FT                   /locus_tag="mCG_127795"
FT                   /product="membrane bound O-acyltransferase domain
FT                   containing 2, isoform CRA_e"
FT                   /note="gene_id=mCG127795.0 transcript_id=mCT193506.0
FT                   protein_id=mCP114453.0 isoform=CRA_e"
FT                   /protein_id="EDL36986.1"
FT   CDS             join(474290..474364,521537..521682,525961..526038,
FT                   573223..573278,578880..578934,585456..585636,
FT                   587192..587384,590527..590630,593344..593408,
FT                   594441..594573,596763..596914,598122..598347)
FT                   /codon_start=1
FT                   /gene="Mboat2"
FT                   /locus_tag="mCG_127795"
FT                   /product="membrane bound O-acyltransferase domain
FT                   containing 2, isoform CRA_b"
FT                   /note="gene_id=mCG127795.0 transcript_id=mCT173189.0
FT                   protein_id=mCP96108.0 isoform=CRA_b"
FT                   /protein_id="EDL36983.1"
FT   assembly_gap    477194..477213
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    478719..478738
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    518939..518958
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    530278..530452
FT                   /estimated_length=175
FT                   /gap_type="unknown"
FT   assembly_gap    539278..539297
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    540486..540505
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    546942..546961
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    548218..553210
FT                   /estimated_length=4993
FT                   /gap_type="unknown"
FT   assembly_gap    554222..554241
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    571660..571822
FT                   /estimated_length=163
FT                   /gap_type="unknown"
FT   assembly_gap    575090..576109
FT                   /estimated_length=1020
FT                   /gap_type="unknown"
FT   assembly_gap    580388..580407
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    587727..587885
FT                   /estimated_length=159
FT                   /gap_type="unknown"
FT   gene            complement(<603065..603587)
FT                   /locus_tag="mCG_1041696"
FT                   /note="gene_id=mCG1041696.1"
FT   mRNA            complement(<603065..603587)
FT                   /locus_tag="mCG_1041696"
FT                   /product="mCG1041696"
FT                   /note="gene_id=mCG1041696.1 transcript_id=mCT159400.1
FT                   created on 27-SEP-2002"
FT   CDS             complement(<603065..603328)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041696"
FT                   /product="mCG1041696"
FT                   /note="gene_id=mCG1041696.1 transcript_id=mCT159400.1
FT                   protein_id=mCP78522.1"
FT                   /protein_id="EDL36981.1"
FT   gene            <614095..698652
FT                   /locus_tag="mCG_18896"
FT                   /note="gene_id=mCG18896.1"
FT   mRNA            join(<614095..614229,621369..621509,626057..626155,
FT                   627686..627784,628896..628994,629868..629969,
FT                   631407..631505,634034..634231,636659..636757,
FT                   638125..638223,638680..638778,640980..641157,
FT                   642399..642563,643355..643534,644465..644630,
FT                   647487..647638,647831..648120,649501..649641,
FT                   650319..650562,650924..651012,652675..652819,
FT                   656170..656332,675763..675941,677737..677837,
FT                   679761..679874,690164..690295,691869..691967,
FT                   692873..693109,695690..698652)
FT                   /locus_tag="mCG_18896"
FT                   /product="mCG18896"
FT                   /note="gene_id=mCG18896.1 transcript_id=mCT16272.1 created
FT                   on 10-SEP-2002"
FT   CDS             join(<621390..621509,626057..626155,627686..627784,
FT                   628896..628994,629868..629969,631407..631505,
FT                   634034..634231,636659..636757,638125..638223,
FT                   638680..638778,640980..641157,642399..642563,
FT                   643355..643534,644465..644630,647487..647638,
FT                   647831..648120,649501..649641,650319..650562,
FT                   650924..651012,652675..652819,656170..656332,
FT                   675763..675941,677737..677837,679761..679874,
FT                   690164..690295,691869..691967,692873..693109,
FT                   695690..696949)
FT                   /codon_start=1
FT                   /locus_tag="mCG_18896"
FT                   /product="mCG18896"
FT                   /note="gene_id=mCG18896.1 transcript_id=mCT16272.1
FT                   protein_id=mCP12118.1"
FT                   /protein_id="EDL36980.1"
FT                   HAASSDSTGFGEERESIL"
FT   assembly_gap    706248..706460
FT                   /estimated_length=213
FT                   /gap_type="unknown"
FT   assembly_gap    722960..724337
FT                   /estimated_length=1378
FT                   /gap_type="unknown"
FT   assembly_gap    729556..730146
FT                   /estimated_length=591
FT                   /gap_type="unknown"
FT   assembly_gap    732748..732767
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(736365..738281)
FT                   /gene="Id2"
FT                   /locus_tag="mCG_3640"
FT                   /note="gene_id=mCG3640.1"
FT   mRNA            complement(join(736365..736779,737513..737576,
FT                   737866..738281))
FT                   /gene="Id2"
FT                   /locus_tag="mCG_3640"
FT                   /product="inhibitor of DNA binding 2"
FT                   /note="gene_id=mCG3640.1 transcript_id=mCT3143.1 created on
FT                   03-SEP-2002"
FT   CDS             complement(join(737520..737576,737866..738213))
FT                   /codon_start=1
FT                   /gene="Id2"
FT                   /locus_tag="mCG_3640"
FT                   /product="inhibitor of DNA binding 2"
FT                   /note="gene_id=mCG3640.1 transcript_id=mCT3143.1
FT                   protein_id=mCP12111.0"
FT                   /db_xref="GOA:Q545T4"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="InterPro:IPR026052"
FT                   /db_xref="InterPro:IPR036638"
FT                   /db_xref="MGI:MGI:96397"
FT                   /db_xref="UniProtKB/TrEMBL:Q545T4"
FT                   /protein_id="EDL36979.1"
FT   assembly_gap    749407..749426
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    757705..757864
FT                   /estimated_length=160
FT                   /gap_type="unknown"
FT   assembly_gap    767031..767050
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            771090..776837
FT                   /locus_tag="mCG_1051104"
FT                   /note="gene_id=mCG1051104.0"
FT   mRNA            join(771090..771201,773043..773155,773279..776837)
FT                   /locus_tag="mCG_1051104"
FT                   /product="mCG1051104"
FT                   /note="gene_id=mCG1051104.0 transcript_id=mCT194893.0
FT                   created on 27-JAN-2005"
FT   CDS             join(771134..771201,773043..773155,773279..773433)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1051104"
FT                   /product="mCG1051104"
FT                   /note="gene_id=mCG1051104.0 transcript_id=mCT194893.0
FT                   protein_id=mCP115922.0"
FT                   /protein_id="EDL36978.1"
FT                   EAQGFDD"
FT   assembly_gap    782991..783181
FT                   /estimated_length=191
FT                   /gap_type="unknown"
FT   assembly_gap    787765..787784
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    839383..839652
FT                   /estimated_length=270
FT                   /gap_type="unknown"
FT   assembly_gap    860565..860771
FT                   /estimated_length=207
FT                   /gap_type="unknown"
FT   assembly_gap    862110..862372
FT                   /estimated_length=263
FT                   /gap_type="unknown"
FT   assembly_gap    885091..885466
FT                   /estimated_length=376
FT                   /gap_type="unknown"
FT   assembly_gap    893222..893505
FT                   /estimated_length=284
FT                   /gap_type="unknown"
FT   assembly_gap    908108..908127
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            924626..924958
FT                   /pseudo
FT                   /locus_tag="mCG_1041601"
FT                   /note="gene_id=mCG1041601.1"
FT   mRNA            924626..924958
FT                   /pseudo
FT                   /locus_tag="mCG_1041601"
FT                   /note="gene_id=mCG1041601.1 transcript_id=mCT159305.1
FT                   created on 27-SEP-2002"
FT   assembly_gap    934534..934625
FT                   /estimated_length=92
FT                   /gap_type="unknown"
FT   gene            960089..1030050
FT                   /locus_tag="mCG_145567"
FT                   /note="gene_id=mCG145567.0"
FT   mRNA            join(960089..960356,963200..963353,1020279..1020371,
FT                   1028532..1030050)
FT                   /locus_tag="mCG_145567"
FT                   /product="mCG145567"
FT                   /note="gene_id=mCG145567.0 transcript_id=mCT184991.0
FT                   created on 05-JUN-2003"
FT   assembly_gap    1009081..1009146
FT                   /estimated_length=66
FT                   /gap_type="unknown"
FT   assembly_gap    1012057..1012167
FT                   /estimated_length=111
FT                   /gap_type="unknown"
FT   CDS             1028680..1028955
FT                   /codon_start=1
FT                   /locus_tag="mCG_145567"
FT                   /product="mCG145567"
FT                   /note="gene_id=mCG145567.0 transcript_id=mCT184991.0
FT                   protein_id=mCP105152.0"
FT                   /protein_id="EDL36977.1"
FT   assembly_gap    1040297..1040631
FT                   /estimated_length=335
FT                   /gap_type="unknown"
FT   assembly_gap    1045850..1046207
FT                   /estimated_length=358
FT                   /gap_type="unknown"
FT   assembly_gap    1056156..1056175
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1057263..1057282
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1065913..1066012
FT                   /estimated_length=100
FT                   /gap_type="unknown"
FT   assembly_gap    1066739..1069397
FT                   /estimated_length=2659
FT                   /gap_type="unknown"
FT   assembly_gap    1071326..1071396
FT                   /estimated_length=71
FT                   /gap_type="unknown"
FT   assembly_gap    1083651..1083670
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1098539..1098558
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1108296..1108315
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1109398..1109417
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1112030..1112049
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1113190..1113552
FT                   /estimated_length=363
FT                   /gap_type="unknown"
FT   assembly_gap    1114676..1115271
FT                   /estimated_length=596
FT                   /gap_type="unknown"
FT   assembly_gap    1116297..1116316
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1117336..1117355
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1128264..1128509
FT                   /estimated_length=246
FT                   /gap_type="unknown"
FT   assembly_gap    1148013..1148056
FT                   /estimated_length=44
FT                   /gap_type="unknown"
FT   assembly_gap    1160219..1160348
FT                   /estimated_length=130
FT                   /gap_type="unknown"
FT   assembly_gap    1161870..1161889
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1165229..1165248
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1166375..1168080
FT                   /estimated_length=1706
FT                   /gap_type="unknown"
FT   assembly_gap    1284519..1284538
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1287475..1287494
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1288657..1288676
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1292239..1293145
FT                   /estimated_length=907
FT                   /gap_type="unknown"
FT   assembly_gap    1294562..1295145
FT                   /estimated_length=584
FT                   /gap_type="unknown"
FT   assembly_gap    1305009..1305028
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1311071..1311090
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1329859..1329878
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1342892..1342911
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1346231..1346925
FT                   /estimated_length=695
FT                   /gap_type="unknown"
FT   assembly_gap    1354048..1357299
FT                   /estimated_length=3252
FT                   /gap_type="unknown"
FT   assembly_gap    1361270..1361289
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1363230..1363249
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1365742..1366447
FT                   /estimated_length=706
FT                   /gap_type="unknown"
FT   assembly_gap    1368495..1371694
FT                   /estimated_length=3200
FT                   /gap_type="unknown"
FT   assembly_gap    1381679..1381698
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1382802..1382821
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1387616..1387770
FT                   /estimated_length=155
FT                   /gap_type="unknown"
FT   assembly_gap    1407921..1408225
FT                   /estimated_length=305
FT                   /gap_type="unknown"
FT   assembly_gap    1419374..1419393
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1421918..1422152
FT                   /estimated_length=235
FT                   /gap_type="unknown"
FT   assembly_gap    1426049..1426068
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1452068..1452766
FT                   /estimated_length=699
FT                   /gap_type="unknown"
FT   assembly_gap    1453613..1454551
FT                   /estimated_length=939
FT                   /gap_type="unknown"
FT   assembly_gap    1455254..1455450
FT                   /estimated_length=197
FT                   /gap_type="unknown"
FT   assembly_gap    1511850..1511869
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1534436..1534455
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1535788..1535807
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1538862..1538952
FT                   /estimated_length=91
FT                   /gap_type="unknown"
FT   assembly_gap    1545389..1546636
FT                   /estimated_length=1248
FT                   /gap_type="unknown"
FT   assembly_gap    1552688..1552954
FT                   /estimated_length=267
FT                   /gap_type="unknown"
FT   assembly_gap    1556920..1558054
FT                   /estimated_length=1135
FT                   /gap_type="unknown"
FT   assembly_gap    1627857..1628036
FT                   /estimated_length=180
FT                   /gap_type="unknown"
FT   assembly_gap    1629135..1629379
FT                   /estimated_length=245
FT                   /gap_type="unknown"
FT   assembly_gap    1646594..1649664
FT                   /estimated_length=3071
FT                   /gap_type="unknown"
FT   assembly_gap    1651176..1651476
FT                   /estimated_length=301
FT                   /gap_type="unknown"
FT   assembly_gap    1655125..1668882
FT                   /estimated_length=13758
FT                   /gap_type="unknown"
FT   assembly_gap    1677356..1678042
FT                   /estimated_length=687
FT                   /gap_type="unknown"
FT   assembly_gap    1685445..1686252
FT                   /estimated_length=808
FT                   /gap_type="unknown"
FT   assembly_gap    1695872..1696529
FT                   /estimated_length=658
FT                   /gap_type="unknown"
FT   assembly_gap    1707368..1707635
FT                   /estimated_length=268
FT                   /gap_type="unknown"
FT   assembly_gap    1709757..1709776
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1737036..1737055
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1832907..1834108
FT                   /estimated_length=1202
FT                   /gap_type="unknown"
FT   assembly_gap    1845584..1845603
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1846858..1846877
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1848846..1848865
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1851384..1852241
FT                   /estimated_length=858
FT                   /gap_type="unknown"
FT   assembly_gap    1852963..1852982
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1874056..1891117)
FT                   /locus_tag="mCG_148248"
FT                   /note="gene_id=mCG148248.0"
FT   mRNA            complement(join(1874056..1874594,1876670..1876919,
FT                   1877440..1877579,1879011..1879099,1889700..1889800,
FT                   1890849..1891117))
FT                   /locus_tag="mCG_148248"
FT                   /product="mCG148248"
FT                   /note="gene_id=mCG148248.0 transcript_id=mCT188511.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(join(1874543..1874594,1876670..1876839))
FT                   /codon_start=1
FT                   /locus_tag="mCG_148248"
FT                   /product="mCG148248"
FT                   /note="gene_id=mCG148248.0 transcript_id=mCT188511.0
FT                   protein_id=mCP108082.0"
FT                   /protein_id="EDL36976.1"
FT   assembly_gap    1901088..1901107
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1934034..1934191
FT                   /estimated_length=158
FT                   /gap_type="unknown"
FT   assembly_gap    1939943..1939989
FT                   /estimated_length=47
FT                   /gap_type="unknown"
FT   gene            complement(1947968..2057569)
FT                   /gene="Rnf144"
FT                   /locus_tag="mCG_17803"
FT                   /note="gene_id=mCG17803.3"
FT   mRNA            complement(join(1947968..1949233,1952333..1952422,
FT                   1956012..1956159,1959320..1959527,1965696..1965756,
FT                   1965921..1966025,1977882..1978027,2029324..2029505,
FT                   2057408..2057569))
FT                   /gene="Rnf144"
FT                   /locus_tag="mCG_17803"
FT                   /product="ring finger protein 144, transcript variant
FT                   mCT16264"
FT                   /note="gene_id=mCG17803.3 transcript_id=mCT16264.3 created
FT                   on 13-JUN-2003"
FT   mRNA            complement(join(1947968..1949233,1952333..1952422,
FT                   1956012..1956159,1959320..1959527,1965696..1965756,
FT                   1965921..1966025,1977882..1978027,2029324..2029505,
FT                   2047657..2047730,2057408..2057569))
FT                   /gene="Rnf144"
FT                   /locus_tag="mCG_17803"
FT                   /product="ring finger protein 144, transcript variant
FT                   mCT175261"
FT                   /note="gene_id=mCG17803.3 transcript_id=mCT175261.1 created
FT                   on 13-JUN-2003"
FT   mRNA            complement(join(1947968..1949233,1952333..1952422,
FT                   1956012..1956159,1959320..1959527,1965696..1965756,
FT                   1965921..1966025,1977882..1978027,2029324..2029505,
FT                   2047657..2047730,2056068..2056135,2057408..2057569))
FT                   /gene="Rnf144"
FT                   /locus_tag="mCG_17803"
FT                   /product="ring finger protein 144, transcript variant
FT                   mCT172858"
FT                   /note="gene_id=mCG17803.3 transcript_id=mCT172858.1 created
FT                   on 13-JUN-2003"
FT   CDS             complement(join(1949102..1949233,1952333..1952422,
FT                   1956012..1956159,1959320..1959527,1965696..1965756,
FT                   1965921..1966025,1977882..1978016))
FT                   /codon_start=1
FT                   /gene="Rnf144"
FT                   /locus_tag="mCG_17803"
FT                   /product="ring finger protein 144, isoform CRA_a"
FT                   /note="gene_id=mCG17803.3 transcript_id=mCT16264.3
FT                   protein_id=mCP12113.2 isoform=CRA_a"
FT                   /protein_id="EDL36973.1"
FT                   CSKGDDDPLPT"
FT   CDS             complement(join(1949102..1949233,1952333..1952422,
FT                   1956012..1956159,1959320..1959527,1965696..1965756,
FT                   1965921..1966025,1977882..1978016))
FT                   /codon_start=1
FT                   /gene="Rnf144"
FT                   /locus_tag="mCG_17803"
FT                   /product="ring finger protein 144, isoform CRA_a"
FT                   /note="gene_id=mCG17803.3 transcript_id=mCT172858.1
FT                   protein_id=mCP95777.0 isoform=CRA_a"
FT                   /protein_id="EDL36974.1"
FT                   CSKGDDDPLPT"
FT   CDS             complement(join(1949102..1949233,1952333..1952422,
FT                   1956012..1956159,1959320..1959527,1965696..1965756,
FT                   1965921..1966025,1977882..1978016))
FT                   /codon_start=1
FT                   /gene="Rnf144"
FT                   /locus_tag="mCG_17803"
FT                   /product="ring finger protein 144, isoform CRA_a"
FT                   /note="gene_id=mCG17803.3 transcript_id=mCT175261.1
FT                   protein_id=mCP98180.0 isoform=CRA_a"
FT                   /protein_id="EDL36975.1"
FT                   CSKGDDDPLPT"
FT   assembly_gap    1952565..1952593
FT                   /estimated_length=29
FT                   /gap_type="unknown"
FT   assembly_gap    1959994..1960144
FT                   /estimated_length=151
FT                   /gap_type="unknown"
FT   assembly_gap    1968711..1968754
FT                   /estimated_length=44
FT                   /gap_type="unknown"
FT   assembly_gap    1985483..1985645
FT                   /estimated_length=163
FT                   /gap_type="unknown"
FT   assembly_gap    2000285..2000304
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2003554..2003573
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2036989..2037008
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2048063..2048635
FT                   /estimated_length=573
FT                   /gap_type="unknown"
FT   assembly_gap    2050154..2051696
FT                   /estimated_length=1543
FT                   /gap_type="unknown"
FT   assembly_gap    2069304..2069323
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(2088856..>2099890)
FT                   /gene="Rsad2"
FT                   /locus_tag="mCG_17799"
FT                   /note="gene_id=mCG17799.1"
FT   mRNA            complement(join(2088856..2089118,2090705..2090737,
FT                   2092136..2092285,2094102..2094331,2097589..2097750,
FT                   2099533..>2099890))
FT                   /gene="Rsad2"
FT                   /locus_tag="mCG_17799"
FT                   /product="radical S-adenosyl methionine domain containing
FT                   2"
FT                   /note="gene_id=mCG17799.1 transcript_id=mCT16260.0 created
FT                   on 03-SEP-2002"
FT   CDS             complement(join(2088954..2089118,2090705..2090737,
FT                   2092136..2092285,2094102..2094331,2097589..2097750,
FT                   2099533..>2099890))
FT                   /codon_start=1
FT                   /gene="Rsad2"
FT                   /locus_tag="mCG_17799"
FT                   /product="radical S-adenosyl methionine domain containing
FT                   2"
FT                   /note="gene_id=mCG17799.1 transcript_id=mCT16260.0
FT                   protein_id=mCP12104.0"
FT                   /protein_id="EDL36972.1"
FT   assembly_gap    2098218..2098334
FT                   /estimated_length=117
FT                   /gap_type="unknown"
FT   gene            <2112660..2123165
FT                   /gene="Tyki"
FT                   /locus_tag="mCG_17802"
FT                   /note="gene_id=mCG17802.2"
FT   mRNA            join(<2112660..2113327,2114728..2114842,2117333..2117534,
FT                   2120339..2120572,2121345..2123165)
FT                   /gene="Tyki"
FT                   /locus_tag="mCG_17802"
FT                   /product="thymidylate kinase family LPS-inducible member,
FT                   transcript variant mCT16263"
FT                   /note="gene_id=mCG17802.2 transcript_id=mCT16263.2 created
FT                   on 03-SEP-2002"
FT   CDS             join(<2112812..2113327,2114728..2114842,2117333..2117534,
FT                   2120339..2120572,2121345..2121462)
FT                   /codon_start=1
FT                   /gene="Tyki"
FT                   /locus_tag="mCG_17802"
FT                   /product="thymidylate kinase family LPS-inducible member,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG17802.2 transcript_id=mCT16263.2
FT                   protein_id=mCP12109.2 isoform=CRA_a"
FT                   /protein_id="EDL36970.1"
FT   mRNA            join(<2113831..2114842,2117333..2117534,2120339..2120572,
FT                   2121345..2123165)
FT                   /gene="Tyki"
FT                   /locus_tag="mCG_17802"
FT                   /product="thymidylate kinase family LPS-inducible member,
FT                   transcript variant mCT193423"
FT                   /note="gene_id=mCG17802.2 transcript_id=mCT193423.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<2114578..2114842,2117333..2117534,2120339..2120572,
FT                   2121345..2121462)
FT                   /codon_start=1
FT                   /gene="Tyki"
FT                   /locus_tag="mCG_17802"
FT                   /product="thymidylate kinase family LPS-inducible member,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG17802.2 transcript_id=mCT193423.0
FT                   protein_id=mCP114411.0 isoform=CRA_b"
FT                   /protein_id="EDL36971.1"
FT   gene            complement(2129247..>2131076)
FT                   /locus_tag="mCG_17801"
FT                   /note="gene_id=mCG17801.1"
FT   mRNA            complement(join(2129247..2129688,2130426..2130545,
FT                   2130865..>2131076))
FT                   /locus_tag="mCG_17801"
FT                   /product="mCG17801"
FT                   /note="gene_id=mCG17801.1 transcript_id=mCT16262.1 created
FT                   on 10-SEP-2002"
FT   CDS             complement(join(2129312..2129688,2130426..2130545,
FT                   2130865..>2131012))
FT                   /codon_start=1
FT                   /locus_tag="mCG_17801"
FT                   /product="mCG17801"
FT                   /note="gene_id=mCG17801.1 transcript_id=mCT16262.1
FT                   protein_id=mCP12108.1"
FT                   /protein_id="EDL36969.1"
FT   assembly_gap    2130010..2130029
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2134204..2134739
FT                   /estimated_length=536
FT                   /gap_type="unknown"
FT   assembly_gap    2174770..2174807
FT                   /estimated_length=38
FT                   /gap_type="unknown"
FT   assembly_gap    2177716..2177735
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2181600..2181619
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2182751..2182770
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2188332..2188653
FT                   /estimated_length=322
FT                   /gap_type="unknown"
FT   assembly_gap    2190147..2190166
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2193753..2194605
FT                   /estimated_length=853
FT                   /gap_type="unknown"
FT   assembly_gap    2203762..2203959
FT                   /estimated_length=198
FT                   /gap_type="unknown"
FT   assembly_gap    2212279..2212662
FT                   /estimated_length=384
FT                   /gap_type="unknown"
FT   assembly_gap    2214094..2214748
FT                   /estimated_length=655
FT                   /gap_type="unknown"
FT   assembly_gap    2223020..2223050
FT                   /estimated_length=31
FT                   /gap_type="unknown"
FT   assembly_gap    2225416..2225435
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2238838..2238857
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2244711..2244823
FT                   /estimated_length=113
FT                   /gap_type="unknown"
FT   assembly_gap    2251531..2256365
FT                   /estimated_length=4835
FT                   /gap_type="unknown"
FT   assembly_gap    2262704..2262844
FT                   /estimated_length=141
FT                   /gap_type="unknown"
FT   assembly_gap    2266178..2266197
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2274038..2274057
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2275070..2275089
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2278334..2278353
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2284125..2284144
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2286208..2286227
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2292621..2293190
FT                   /estimated_length=570
FT                   /gap_type="unknown"
FT   assembly_gap    2305367..2305605
FT                   /estimated_length=239
FT                   /gap_type="unknown"
FT   assembly_gap    2317936..2317955
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2329071..2329090
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2330665..2330684
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2340036..2340055
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2341175..2341194
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2342867..2343341
FT                   /estimated_length=475
FT                   /gap_type="unknown"
FT   assembly_gap    2350915..2350934
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2392116..2392727
FT                   /estimated_length=612
FT                   /gap_type="unknown"
FT   assembly_gap    2395684..2395703
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2400054..2400073
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2401136..2401821
FT                   /estimated_length=686
FT                   /gap_type="unknown"
FT   assembly_gap    2402878..2402897
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2409222..2410433
FT                   /estimated_length=1212
FT                   /gap_type="unknown"
FT   assembly_gap    2411017..2413430
FT                   /estimated_length=2414
FT                   /gap_type="unknown"
FT   assembly_gap    2415465..2415484
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2417737..2418018
FT                   /estimated_length=282
FT                   /gap_type="unknown"
FT   assembly_gap    2421988..2423434
FT                   /estimated_length=1447
FT                   /gap_type="unknown"
FT   assembly_gap    2425231..2425665
FT                   /estimated_length=435
FT                   /gap_type="unknown"
FT   assembly_gap    2426697..2426734
FT                   /estimated_length=38
FT                   /gap_type="unknown"
FT   assembly_gap    2428077..2428096
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2429834..2430147
FT                   /estimated_length=314
FT                   /gap_type="unknown"
FT   assembly_gap    2445834..2445853
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2454120..2454461
FT                   /estimated_length=342
FT                   /gap_type="unknown"
FT   gene            complement(2468458..2490272)
FT                   /locus_tag="mCG_1051105"
FT                   /note="gene_id=mCG1051105.0"
FT   mRNA            complement(join(2468458..2469020,2469151..2469307,
FT                   2470158..2470265,2476182..2476321,2486363..2486515,
FT                   2488683..2488723,2489867..2490272))
FT                   /locus_tag="mCG_1051105"
FT                   /product="mCG1051105"
FT                   /note="gene_id=mCG1051105.0 transcript_id=mCT194894.0
FT                   created on 27-JAN-2005"
FT   CDS             complement(2468607..2468906)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1051105"
FT                   /product="mCG1051105"
FT                   /note="gene_id=mCG1051105.0 transcript_id=mCT194894.0
FT                   protein_id=mCP115923.0"
FT                   /protein_id="EDL36968.1"
FT   assembly_gap    2469322..2469341
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2471682..2474160
FT                   /estimated_length=2479
FT                   /gap_type="unknown"
FT   assembly_gap    2475494..2475513
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2487147..2487166
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2488186..2488205
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2499241..2499260
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2507113..2507544
FT                   /estimated_length=432
FT                   /gap_type="unknown"
FT   assembly_gap    2524028..2524172
FT                   /estimated_length=145
FT                   /gap_type="unknown"
FT   assembly_gap    2534670..2534689
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2561703..2562110
FT                   /estimated_length=408
FT                   /gap_type="unknown"
FT   assembly_gap    2566044..2566063
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2567243..2567262
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2568273..2568292
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2571448..2571467
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2573378..2573397
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2575657..2575676
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2584355..2584450
FT                   /estimated_length=96
FT                   /gap_type="unknown"
FT   assembly_gap    2591150..2591169
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2592603..2597501
FT                   /estimated_length=4899
FT                   /gap_type="unknown"
FT   assembly_gap    2606175..2606194
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2607413..2607432
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2609369..2609388
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2610883..2610902
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2613725..2613744
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2648786..2648820
FT                   /estimated_length=35
FT                   /gap_type="unknown"
FT   assembly_gap    2659776..2659795
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2661271..2661290
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2665471..2665490
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2666761..2666780
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2672800..2672819
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2675065..2675084
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2728204..2728356
FT                   /estimated_length=153
FT                   /gap_type="unknown"
FT   assembly_gap    2731444..2731711
FT                   /estimated_length=268
FT                   /gap_type="unknown"
FT   assembly_gap    2734977..2735225
FT                   /estimated_length=249
FT                   /gap_type="unknown"
FT   assembly_gap    2736284..2736303
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2739935..2740113
FT                   /estimated_length=179
FT                   /gap_type="unknown"
FT   gene            complement(2750604..2775454)
FT                   /locus_tag="mCG_148273"
FT                   /note="gene_id=mCG148273.0"
FT   mRNA            complement(join(2750604..2751880,2757193..2757387,
FT                   2774955..2775454))
FT                   /locus_tag="mCG_148273"
FT                   /product="mCG148273"
FT                   /note="gene_id=mCG148273.0 transcript_id=mCT188536.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(2751302..2751511)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148273"
FT                   /product="mCG148273"
FT                   /note="gene_id=mCG148273.0 transcript_id=mCT188536.0
FT                   protein_id=mCP108108.0"
FT                   /protein_id="EDL36967.1"
FT   assembly_gap    2756231..2756438
FT                   /estimated_length=208
FT                   /gap_type="unknown"
FT   assembly_gap    2760162..2760181
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2793416..2793715
FT                   /estimated_length=300
FT                   /gap_type="unknown"
FT   assembly_gap    2801335..2801403
FT                   /estimated_length=69
FT                   /gap_type="unknown"
FT   gene            complement(2802017..2802677)
FT                   /locus_tag="mCG_1041969"
FT                   /note="gene_id=mCG1041969.1"
FT   mRNA            complement(2802017..2802677)
FT                   /locus_tag="mCG_1041969"
FT                   /product="mCG1041969"
FT                   /note="gene_id=mCG1041969.1 transcript_id=mCT159673.1
FT                   created on 27-SEP-2002"
FT   CDS             complement(2802233..2802298)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041969"
FT                   /product="mCG1041969"
FT                   /note="gene_id=mCG1041969.1 transcript_id=mCT159673.1
FT                   protein_id=mCP79088.1"
FT                   /protein_id="EDL36966.1"
FT                   /translation="MGAKVSGSFQTNKCGCRLSAP"
FT   assembly_gap    2825493..2825858
FT                   /estimated_length=366
FT                   /gap_type="unknown"
FT   assembly_gap    2826454..2826733
FT                   /estimated_length=280
FT                   /gap_type="unknown"
FT   assembly_gap    2868087..2869898
FT                   /estimated_length=1812
FT                   /gap_type="unknown"
FT   assembly_gap    2872122..2872141
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2874059..2874078
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2879736..2879755
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2880994..2898875
FT                   /estimated_length=17882
FT                   /gap_type="unknown"
FT   assembly_gap    2900223..2900242
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2901335..2903897
FT                   /estimated_length=2563
FT                   /gap_type="unknown"
FT   assembly_gap    2904857..2904876
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2920362..2920381
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            2924936..2929007
FT                   /locus_tag="mCG_148278"
FT                   /note="gene_id=mCG148278.0"
FT   mRNA            join(2924936..2927429,2927473..2929007)
FT                   /locus_tag="mCG_148278"
FT                   /product="mCG148278"
FT                   /note="gene_id=mCG148278.0 transcript_id=mCT188541.0
FT                   created on 13-JAN-2004"
FT   assembly_gap    2927449..2927468
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             2928342..2928536
FT                   /codon_start=1
FT                   /locus_tag="mCG_148278"
FT                   /product="mCG148278"
FT                   /note="gene_id=mCG148278.0 transcript_id=mCT188541.0
FT                   protein_id=mCP108112.0"
FT                   /protein_id="EDL36965.1"
FT   assembly_gap    2937594..2937613
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2939935..2940499
FT                   /estimated_length=565
FT                   /gap_type="unknown"
FT   assembly_gap    2943695..2944307
FT                   /estimated_length=613
FT                   /gap_type="unknown"
FT   assembly_gap    2946149..2946551
FT                   /estimated_length=403
FT                   /gap_type="unknown"
FT   assembly_gap    2948246..2948575
FT                   /estimated_length=330
FT                   /gap_type="unknown"
FT   assembly_gap    2949472..2949516
FT                   /estimated_length=45
FT                   /gap_type="unknown"
FT   assembly_gap    2980526..2980545
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2985085..2985104
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(3001319..3004841)
FT                   /locus_tag="mCG_11193"
FT                   /note="gene_id=mCG11193.2"
FT   mRNA            complement(3001319..3004841)
FT                   /locus_tag="mCG_11193"
FT                   /product="mCG11193"
FT                   /note="gene_id=mCG11193.2 transcript_id=mCT11099.2 created
FT                   on 30-NOV-2004"
FT   CDS             complement(3003353..3004540)
FT                   /codon_start=1
FT                   /locus_tag="mCG_11193"
FT                   /product="mCG11193"
FT                   /note="gene_id=mCG11193.2 transcript_id=mCT11099.2
FT                   protein_id=mCP10270.2"
FT                   /protein_id="EDL36964.1"
FT   assembly_gap    3028855..3028874
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3032379..3032461
FT                   /estimated_length=83
FT                   /gap_type="unknown"
FT   assembly_gap    3040313..3040332
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3043854..3044003
FT                   /estimated_length=150
FT                   /gap_type="unknown"
FT   assembly_gap    3062832..3062851
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3091296..3091342
FT                   /estimated_length=47
FT                   /gap_type="unknown"
FT   assembly_gap    3102989..3103008
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3106465..3106595
FT                   /estimated_length=131
FT                   /gap_type="unknown"
FT   assembly_gap    3140167..3140387
FT                   /estimated_length=221
FT                   /gap_type="unknown"
FT   assembly_gap    3145272..3145433
FT                   /estimated_length=162
FT                   /gap_type="unknown"
FT   assembly_gap    3170798..3171012
FT                   /estimated_length=215
FT                   /gap_type="unknown"
FT   assembly_gap    3205127..3205146
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3223585..3224201
FT                   /estimated_length=617
FT                   /gap_type="unknown"
FT   assembly_gap    3231632..3232915
FT                   /estimated_length=1284
FT                   /gap_type="unknown"
FT   assembly_gap    3234248..3234267
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            3251752..3267590
FT                   /locus_tag="mCG_1051106"
FT                   /note="gene_id=mCG1051106.0"
FT   mRNA            join(3251752..3251868,3255797..3255844,3257632..3257773,
FT                   3266278..3267590)
FT                   /locus_tag="mCG_1051106"
FT                   /product="mCG1051106"
FT                   /note="gene_id=mCG1051106.0 transcript_id=mCT194895.0
FT                   created on 27-JAN-2005"
FT   assembly_gap    3254047..3254418
FT                   /estimated_length=372
FT                   /gap_type="unknown"
FT   assembly_gap    3255341..3255360
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             3266926..3267261
FT                   /codon_start=1
FT                   /locus_tag="mCG_1051106"
FT                   /product="mCG1051106"
FT                   /note="gene_id=mCG1051106.0 transcript_id=mCT194895.0
FT                   protein_id=mCP115924.0"
FT                   /protein_id="EDL36963.1"
FT                   SDPGTSF"
FT   assembly_gap    3267591..3267695
FT                   /estimated_length=105
FT                   /gap_type="unknown"
FT   assembly_gap    3269936..3269955
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3329587..3333741
FT                   /estimated_length=4155
FT                   /gap_type="unknown"
FT   assembly_gap    3334509..3336180
FT                   /estimated_length=1672
FT                   /gap_type="unknown"
FT   assembly_gap    3339581..3339700
FT                   /estimated_length=120
FT                   /gap_type="unknown"
FT   assembly_gap    3344875..3345031
FT                   /estimated_length=157
FT                   /gap_type="unknown"
FT   assembly_gap    3368876..3369607
FT                   /estimated_length=732
FT                   /gap_type="unknown"
FT   assembly_gap    3372816..3372835
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3375661..3375680
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3391393..3391610
FT                   /estimated_length=218
FT                   /gap_type="unknown"
FT   assembly_gap    3427114..3427133
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3440640..3440659
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3441749..3443446
FT                   /estimated_length=1698
FT                   /gap_type="unknown"
FT   assembly_gap    3447389..3447688
FT                   /estimated_length=300
FT                   /gap_type="unknown"
FT   assembly_gap    3451276..3451785
FT                   /estimated_length=510
FT                   /gap_type="unknown"
FT   assembly_gap    3469531..3469550
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3477126..3477145
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3481524..3481543
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3482938..3482957
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3492838..3492857
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3501837..3502474
FT                   /estimated_length=638
FT                   /gap_type="unknown"
FT   assembly_gap    3503076..3504476
FT                   /estimated_length=1401
FT                   /gap_type="unknown"
FT   assembly_gap    3505991..3507071
FT                   /estimated_length=1081
FT                   /gap_type="unknown"
FT   assembly_gap    3549401..3549420
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3574652..3574858
FT                   /estimated_length=207
FT                   /gap_type="unknown"
FT   assembly_gap    3576343..3576362
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3577493..3577512
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3578536..3578555
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3608888..3608907
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3627447..3627466
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3629122..3629141
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3630372..3630391
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <3638394..>3675694
FT                   /locus_tag="mCG_1041962"
FT                   /note="gene_id=mCG1041962.0"
FT   mRNA            join(<3638394..3638468,3646624..3646666,3650014..3650223,
FT                   3659781..3659905,3668308..3668437,3669601..3669625,
FT                   3673900..3673997,3675588..>3675694)
FT                   /locus_tag="mCG_1041962"
FT                   /product="mCG1041962"
FT                   /note="gene_id=mCG1041962.0 transcript_id=mCT159666.0
FT                   created on 26-SEP-2002"
FT   CDS             join(3638394..3638468,3646624..3646666,3650014..3650223,
FT                   3659781..3659905,3668308..3668437,3669601..3669625,
FT                   3673900..3673997,3675588..3675694)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041962"
FT                   /product="mCG1041962"
FT                   /note="gene_id=mCG1041962.0 transcript_id=mCT159666.0
FT                   protein_id=mCP79022.0"
FT                   /protein_id="EDL36962.1"
FT   assembly_gap    3678478..3678497
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3680887..3680906
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3682066..3682085
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3687565..3687584
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3696808..3696827
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3700379..3701442
FT                   /estimated_length=1064
FT                   /gap_type="unknown"
FT   assembly_gap    3726403..3726422
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3727978..3727997
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3730057..3730076
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3756149..3756168
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3789755..3789890
FT                   /estimated_length=136
FT                   /gap_type="unknown"
FT   assembly_gap    3823891..3824243
FT                   /estimated_length=353
FT                   /gap_type="unknown"
FT   assembly_gap    3828657..3828676
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3830123..3830142
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3832852..3832871
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3839026..3841567
FT                   /estimated_length=2542
FT                   /gap_type="unknown"
FT   assembly_gap    3911693..3912036
FT                   /estimated_length=344
FT                   /gap_type="unknown"
FT   assembly_gap    3914187..3915708
FT                   /estimated_length=1522
FT                   /gap_type="unknown"
FT   assembly_gap    3917874..3917893
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3920521..3920540
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3925872..3931238
FT                   /estimated_length=5367
FT                   /gap_type="unknown"
FT   assembly_gap    3938458..3938477
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3939936..3941285
FT                   /estimated_length=1350
FT                   /gap_type="unknown"
FT   assembly_gap    3945241..3945260
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3963081..3963158
FT                   /estimated_length=78
FT                   /gap_type="unknown"
FT   assembly_gap    3979419..3980603
FT                   /estimated_length=1185
FT                   /gap_type="unknown"
FT   assembly_gap    3994466..3994519
FT                   /estimated_length=54
FT                   /gap_type="unknown"
FT   assembly_gap    4030255..4030274
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4034853..4034872
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4036482..4036501
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4056027..4056046
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4103936..4103955
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4110137..4110156
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4111198..4111217
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4112271..4112290
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(4112291..4223310)
FT                   /locus_tag="mCG_148245"
FT                   /note="gene_id=mCG148245.0"
FT   mRNA            complement(join(4112291..4112734,4192700..4192768,
FT                   4200593..4200693,4202602..4202725,4204528..4204570,
FT                   4206224..4206361,4210828..4210956,4222181..4222232,
FT                   4223207..4223310))
FT                   /locus_tag="mCG_148245"
FT                   /product="mCG148245"
FT                   /note="gene_id=mCG148245.0 transcript_id=mCT188508.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(join(4112711..4112734,4192700..4192768,
FT                   4200593..4200693,4202602..4202725,4204528..4204570,
FT                   4206224..4206361,4210828..4210868))
FT                   /codon_start=1
FT                   /locus_tag="mCG_148245"
FT                   /product="mCG148245"
FT                   /note="gene_id=mCG148245.0 transcript_id=mCT188508.0
FT                   protein_id=mCP108078.0"
FT                   /protein_id="EDL36961.1"
FT                   SSPGLKSGMHIPASFM"
FT   assembly_gap    4122199..4122218
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4141233..4141376
FT                   /estimated_length=144
FT                   /gap_type="unknown"
FT   assembly_gap    4143653..4144603
FT                   /estimated_length=951
FT                   /gap_type="unknown"
FT   assembly_gap    4157635..4157686
FT                   /estimated_length=52
FT                   /gap_type="unknown"
FT   assembly_gap    4172241..4172260
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4174397..4174416
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4177570..4178713
FT                   /estimated_length=1144
FT                   /gap_type="unknown"
FT   assembly_gap    4179819..4179838
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4181140..4181159
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4182811..4182830
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4186333..4186352
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4187896..4187915
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4189330..4189349
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4209763..4209817
FT                   /estimated_length=55
FT                   /gap_type="unknown"
FT   assembly_gap    4221596..4221615
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(4228659..4257488)
FT                   /gene="Allc"
FT                   /locus_tag="mCG_126922"
FT                   /note="gene_id=mCG126922.1"
FT   mRNA            complement(join(4228659..4228951,4230172..4230296,
FT                   4232256..4232364,4234134..4234207,4234766..4234921,
FT                   4238838..4238970,4239700..4239779,4240862..4240990,
FT                   4243441..4243528,4246047..4246097,4248384..4248586,
FT                   4257428..4257488))
FT                   /gene="Allc"
FT                   /locus_tag="mCG_126922"
FT                   /product="allantoicase, transcript variant mCT127467"
FT                   /note="gene_id=mCG126922.1 transcript_id=mCT127467.1
FT                   created on 03-SEP-2002"
FT   mRNA            complement(join(4228659..4228951,4230172..4230296,
FT                   4232256..4232364,4234134..4234207,4234766..4234921,
FT                   4238838..4238970,4239700..4239779,4240862..4240990,
FT                   4243441..4243528,4246047..4246097,4248384..4248478,
FT                   4257423..4257478))
FT                   /gene="Allc"
FT                   /locus_tag="mCG_126922"
FT                   /product="allantoicase, transcript variant mCT128198"
FT                   /note="gene_id=mCG126922.1 transcript_id=mCT128198.1
FT                   created on 03-SEP-2002"
FT   mRNA            complement(join(4228660..4228951,4230172..4230296,
FT                   4232256..4232364,4234134..4234207,4234766..4234921,
FT                   4238838..4238970,4239700..4239779,4240862..4240990,
FT                   4243441..4243528,4246047..4246097,4248384..4248478,
FT                   4257428..>4257479))
FT                   /gene="Allc"
FT                   /locus_tag="mCG_126922"
FT                   /product="allantoicase, transcript variant mCT193427"
FT                   /note="gene_id=mCG126922.1 transcript_id=mCT193427.0
FT                   created on 09-MAR-2004"
FT   CDS             complement(join(4228742..4228951,4230172..4230296,
FT                   4232256..4232364,4234134..4234207,4234766..4234921,
FT                   4238838..4238970,4239700..4239779,4240862..4240990,
FT                   4243441..4243528,4246047..4246097,4248384..4248478,
FT                   4257428..>4257449))
FT                   /codon_start=1
FT                   /gene="Allc"
FT                   /locus_tag="mCG_126922"
FT                   /product="allantoicase, isoform CRA_b"
FT                   /note="gene_id=mCG126922.1 transcript_id=mCT193427.0
FT                   protein_id=mCP114402.0 isoform=CRA_b"
FT                   /protein_id="EDL36959.1"
FT   CDS             complement(join(4228742..4228951,4230172..4230296,
FT                   4232256..4232364,4234134..4234207,4234766..4234921,
FT                   4238838..4238970,4239700..4239779,4240862..4240990,
FT                   4243441..4243528,4246047..4246097,4248384..4248473))
FT                   /codon_start=1
FT                   /gene="Allc"
FT                   /locus_tag="mCG_126922"
FT                   /product="allantoicase, isoform CRA_a"
FT                   /note="gene_id=mCG126922.1 transcript_id=mCT128198.1
FT                   protein_id=mCP78764.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q32MW4"
FT                   /db_xref="InterPro:IPR005164"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR015908"
FT                   /db_xref="MGI:MGI:2136971"
FT                   /db_xref="UniProtKB/TrEMBL:Q32MW4"
FT                   /protein_id="EDL36958.1"
FT                   PLLRFSLKTGFRANL"
FT   CDS             complement(join(4228742..4228951,4230172..4230296,
FT                   4232256..4232364,4234134..4234207,4234766..4234921,
FT                   4238838..4238970,4239700..4239779,4240862..4240990,
FT                   4243441..4243528,4246047..4246097,4248384..4248473))
FT                   /codon_start=1
FT                   /gene="Allc"
FT                   /locus_tag="mCG_126922"
FT                   /product="allantoicase, isoform CRA_a"
FT                   /note="gene_id=mCG126922.1 transcript_id=mCT127467.1
FT                   protein_id=mCP79084.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q32MW4"
FT                   /db_xref="InterPro:IPR005164"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR015908"
FT                   /db_xref="MGI:MGI:2136971"
FT                   /db_xref="UniProtKB/TrEMBL:Q32MW4"
FT                   /protein_id="EDL36960.1"
FT                   PLLRFSLKTGFRANL"
FT   assembly_gap    4268314..4268333
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(4268998..>4298584)
FT                   /locus_tag="mCG_19121"
FT                   /note="gene_id=mCG19121.1"
FT   mRNA            complement(join(4268998..4269872,4270067..4270162,
FT                   4270762..4270815,4273888..4273959,4287892..4287963,
FT                   4292687..4292842,4298527..>4298584))
FT                   /locus_tag="mCG_19121"
FT                   /product="mCG19121, transcript variant mCT17307"
FT                   /note="gene_id=mCG19121.1 transcript_id=mCT17307.2 created
FT                   on 10-SEP-2002"
FT   CDS             complement(join(4269481..4269872,4270067..4270162,
FT                   4270762..4270815,4273888..4273959,4287892..4287963,
FT                   4292687..4292842,4298527..>4298584))
FT                   /codon_start=1
FT                   /locus_tag="mCG_19121"
FT                   /product="mCG19121, isoform CRA_b"
FT                   /note="gene_id=mCG19121.1 transcript_id=mCT17307.2
FT                   protein_id=mCP10281.2 isoform=CRA_b"
FT                   /protein_id="EDL36957.1"
FT                   VACHITMYFMCEFDKENL"
FT   mRNA            complement(join(<4269848..4269890,4270067..4270162,
FT                   4270762..4270815,4273888..4273959,4287892..4287963,
FT                   4292687..4292842,4298527..>4298583))
FT                   /locus_tag="mCG_19121"
FT                   /product="mCG19121, transcript variant mCT193442"
FT                   /note="gene_id=mCG19121.1 transcript_id=mCT193442.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(<4269848..4269890,4270067..4270162,
FT                   4270762..4270815,4273888..4273959,4287892..4287963,
FT                   4292687..4292842,4298527..>4298581))
FT                   /codon_start=1
FT                   /locus_tag="mCG_19121"
FT                   /product="mCG19121, isoform CRA_a"
FT                   /note="gene_id=mCG19121.1 transcript_id=mCT193442.0
FT                   protein_id=mCP114412.0 isoform=CRA_a"
FT                   /protein_id="EDL36956.1"
FT   assembly_gap    4274050..4274085
FT                   /estimated_length=36
FT                   /gap_type="unknown"
FT   assembly_gap    4284457..4284476
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4291512..4291531
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(4306630..>4311476)
FT                   /locus_tag="mCG_19129"
FT                   /note="gene_id=mCG19129.0"
FT   mRNA            complement(join(4306630..4306725,4307157..4307307,
FT                   4309305..4309369,4309746..4309889,4310967..4311038,
FT                   4311131..4311214,4311407..>4311476))
FT                   /locus_tag="mCG_19129"
FT                   /product="mCG19129"
FT                   /note="gene_id=mCG19129.0 transcript_id=mCT17310.0 created
FT                   on 03-SEP-2002"
FT   CDS             complement(join(4306648..4306725,4307157..4307307,
FT                   4309305..4309369,4309746..4309889,4310967..4311038,
FT                   4311131..4311214,4311407..>4311454))
FT                   /codon_start=1
FT                   /locus_tag="mCG_19129"
FT                   /product="mCG19129"
FT                   /note="gene_id=mCG19129.0 transcript_id=mCT17310.0
FT                   protein_id=mCP10279.0"
FT                   /protein_id="EDL36955.1"
FT   assembly_gap    4314742..4314761
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <4326611..4336566
FT                   /gene="Rnaseh1"
FT                   /locus_tag="mCG_19128"
FT                   /note="gene_id=mCG19128.2"
FT   mRNA            join(<4326611..4326805,4329027..4329142,4330043..4330204,
FT                   4332587..4332686,4334621..4334701,4335149..4335273,
FT                   4335970..4336560)
FT                   /gene="Rnaseh1"
FT                   /locus_tag="mCG_19128"
FT                   /product="ribonuclease H1, transcript variant mCT193445"
FT                   /note="gene_id=mCG19128.2 transcript_id=mCT193445.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(<4326629..4326805,4329027..4329142,4330043..4330204,
FT                   4332587..4332686,4334256..4334310,4334617..4334701,
FT                   4335149..4335273,4335970..4336566)
FT                   /gene="Rnaseh1"
FT                   /locus_tag="mCG_19128"
FT                   /product="ribonuclease H1, transcript variant mCT17596"
FT                   /note="gene_id=mCG19128.2 transcript_id=mCT17596.1 created
FT                   on 03-SEP-2002"
FT   CDS             join(<4326675..4326805,4329027..4329142,4330043..4330204,
FT                   4332587..4332686,4334256..4334310,4334617..4334701,
FT                   4335149..4335273,4335970..4336056)
FT                   /codon_start=1
FT                   /gene="Rnaseh1"
FT                   /locus_tag="mCG_19128"
FT                   /product="ribonuclease H1, isoform CRA_a"
FT                   /note="gene_id=mCG19128.2 transcript_id=mCT17596.1
FT                   protein_id=mCP10276.1 isoform=CRA_a"
FT                   /protein_id="EDL36953.1"
FT                   KQSED"
FT   CDS             join(<4326675..4326805,4329027..4329142,4330043..4330204,
FT                   4332587..4332686,4334621..4334701,4335149..4335158)
FT                   /codon_start=1
FT                   /gene="Rnaseh1"
FT                   /locus_tag="mCG_19128"
FT                   /product="ribonuclease H1, isoform CRA_b"
FT                   /note="gene_id=mCG19128.2 transcript_id=mCT193445.0
FT                   protein_id=mCP114414.0 isoform=CRA_b"
FT                   /protein_id="EDL36954.1"
FT   assembly_gap    4345546..4346046
FT                   /estimated_length=501
FT                   /gap_type="unknown"
FT   assembly_gap    4347252..4347271
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            4351944..4359974
FT                   /gene="Adi1"
FT                   /locus_tag="mCG_19126"
FT                   /note="gene_id=mCG19126.2"
FT   mRNA            join(4351944..4352089,4357546..4357725,4359087..4359974)
FT                   /gene="Adi1"
FT                   /locus_tag="mCG_19126"
FT                   /product="acireductone dioxygenase 1, transcript variant
FT                   mCT17594"
FT                   /note="gene_id=mCG19126.2 transcript_id=mCT17594.2 created
FT                   on 15-JUL-2003"
FT   CDS             join(4351970..4352089,4357546..4357725,4359087..4359206)
FT                   /codon_start=1
FT                   /gene="Adi1"
FT                   /locus_tag="mCG_19126"
FT                   /product="acireductone dioxygenase 1, isoform CRA_b"
FT                   /note="gene_id=mCG19126.2 transcript_id=mCT17594.2
FT                   protein_id=mCP10278.2 isoform=CRA_b"
FT                   /protein_id="EDL36952.1"
FT   mRNA            join(4352197..4352266,4357546..4357725,4359087..4359616)
FT                   /gene="Adi1"
FT                   /locus_tag="mCG_19126"
FT                   /product="acireductone dioxygenase 1, transcript variant
FT                   mCT172859"
FT                   /note="gene_id=mCG19126.2 transcript_id=mCT172859.1 created
FT                   on 15-JUL-2003"
FT   assembly_gap    4353352..4356469
FT                   /estimated_length=3118
FT                   /gap_type="unknown"
FT   CDS             join(4357552..4357725,4359087..4359206)
FT                   /codon_start=1
FT                   /gene="Adi1"
FT                   /locus_tag="mCG_19126"
FT                   /product="acireductone dioxygenase 1, isoform CRA_a"
FT                   /note="gene_id=mCG19126.2 transcript_id=mCT172859.1
FT                   protein_id=mCP95778.1 isoform=CRA_a"
FT                   /protein_id="EDL36951.1"
FT   assembly_gap    4358137..4358156
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4359977..4360057
FT                   /estimated_length=81
FT                   /gap_type="unknown"
FT   assembly_gap    4363631..4363650
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            4367501..4368243
FT                   /locus_tag="mCG_1041957"
FT                   /note="gene_id=mCG1041957.0"
FT   mRNA            4367501..4368243
FT                   /locus_tag="mCG_1041957"
FT                   /product="mCG1041957"
FT                   /note="gene_id=mCG1041957.0 transcript_id=mCT159661.1
FT                   created on 26-SEP-2002"
FT   CDS             4367532..4367654
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041957"
FT                   /product="mCG1041957"
FT                   /note="gene_id=mCG1041957.0 transcript_id=mCT159661.1
FT                   protein_id=mCP78982.1"
FT                   /protein_id="EDL36950.1"
FT   gene            complement(4368745..>4429019)
FT                   /gene="Ttc15"
FT                   /locus_tag="mCG_126920"
FT                   /note="gene_id=mCG126920.0"
FT   mRNA            complement(join(4368745..4369672,4369874..4369961,
FT                   4370596..4370696,4375476..4375574,4379922..4379995,
FT                   4381910..4381982,4390268..4390380,4399365..4399503,
FT                   4400688..4400801,4416577..4416693,4424872..4426109,
FT                   4428744..>4429019))
FT                   /gene="Ttc15"
FT                   /locus_tag="mCG_126920"
FT                   /product="tetratricopeptide repeat domain 15, transcript
FT                   variant mCT128196"
FT                   /note="gene_id=mCG126920.0 transcript_id=mCT128196.0
FT                   created on 10-SEP-2002"
FT   mRNA            complement(join(4369129..4369672,4369874..4369961,
FT                   4370596..4370696,4375476..4375574,4379922..4379995,
FT                   4381910..4381982,4390268..4390380,4399365..4399503,
FT                   4400688..4400801,4416577..4416693,4424872..4426109,
FT                   4428913..>4428972))
FT                   /gene="Ttc15"
FT                   /locus_tag="mCG_126920"
FT                   /product="tetratricopeptide repeat domain 15, transcript
FT                   variant mCT193425"
FT                   /note="gene_id=mCG126920.0 transcript_id=mCT193425.0
FT                   created on 09-MAR-2004"
FT   CDS             complement(join(4369430..4369672,4369874..4369961,
FT                   4370596..4370696,4375476..4375574,4379922..4379995,
FT                   4381910..4381982,4390268..4390380,4399365..4399503,
FT                   4400688..4400801,4416577..4416693,4424872..4426109,
FT                   4428913..>4428970))
FT                   /codon_start=1
FT                   /gene="Ttc15"
FT                   /locus_tag="mCG_126920"
FT                   /product="tetratricopeptide repeat domain 15, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG126920.0 transcript_id=mCT193425.0
FT                   protein_id=mCP114401.0 isoform=CRA_b"
FT                   /protein_id="EDL36949.1"
FT                   QCLKLA"
FT   CDS             complement(join(4369430..4369672,4369874..4369961,
FT                   4370596..4370696,4375476..4375574,4379922..4379995,
FT                   4381910..4381982,4390268..4390380,4399365..4399503,
FT                   4400688..4400801,4416577..4416693,4424872..4426109,
FT                   4428744..>4428777))
FT                   /codon_start=1
FT                   /gene="Ttc15"
FT                   /locus_tag="mCG_126920"
FT                   /product="tetratricopeptide repeat domain 15, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG126920.0 transcript_id=mCT128196.0
FT                   protein_id=mCP78441.0 isoform=CRA_a"
FT                   /protein_id="EDL36948.1"
FT   assembly_gap    4409024..4409043
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <4430404..4546858
FT                   /gene="Tssc1"
FT                   /locus_tag="mCG_19124"
FT                   /note="gene_id=mCG19124.1"
FT   mRNA            join(<4430404..4430607,4436781..4436864,4443669..4443801,
FT                   4508343..4508499,4527705..4527804,4538796..4538932,
FT                   4542334..4542501,4544045..4544209,4546283..4546858)
FT                   /gene="Tssc1"
FT                   /locus_tag="mCG_19124"
FT                   /product="tumor suppressing subtransferable candidate 1,
FT                   transcript variant mCT17592"
FT                   /note="gene_id=mCG19124.1 transcript_id=mCT17592.1 created
FT                   on 10-SEP-2002"
FT   mRNA            join(<4430450..4430589,4436781..4436864,4443669..4443801,
FT                   4508343..4508499,4527705..4527804,4538796..4538932,
FT                   4542334..4542501,4544045..4544209,4546283..4546852)
FT                   /gene="Tssc1"
FT                   /locus_tag="mCG_19124"
FT                   /product="tumor suppressing subtransferable candidate 1,
FT                   transcript variant mCT193444"
FT                   /note="gene_id=mCG19124.1 transcript_id=mCT193444.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<4430530..4430607,4436781..4436864,4443669..4443801,
FT                   4508343..4508499,4527705..4527804,4538796..4538932,
FT                   4542334..4542501,4544045..4544209,4546283..4546457)
FT                   /codon_start=1
FT                   /gene="Tssc1"
FT                   /locus_tag="mCG_19124"
FT                   /product="tumor suppressing subtransferable candidate 1,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG19124.1 transcript_id=mCT17592.1
FT                   protein_id=mCP10269.1 isoform=CRA_b"
FT                   /protein_id="EDL36946.1"
FT   CDS             join(<4430530..4430589,4436781..4436864,4443669..4443801,
FT                   4508343..4508499,4527705..4527804,4538796..4538932,
FT                   4542334..4542501,4544045..4544209,4546283..4546457)
FT                   /codon_start=1
FT                   /gene="Tssc1"
FT                   /locus_tag="mCG_19124"
FT                   /product="tumor suppressing subtransferable candidate 1,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG19124.1 transcript_id=mCT193444.0
FT                   protein_id=mCP114413.0 isoform=CRA_c"
FT                   /protein_id="EDL36947.1"
FT   assembly_gap    4432968..4432987
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4463591..4463614
FT                   /estimated_length=24
FT                   /gap_type="unknown"
FT   assembly_gap    4479377..4479396
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            join(4480367..4480397,4508343..4508499,4527705..4527804,
FT                   4538796..4538932,4542334..4542501,4544045..4544209,
FT                   4546283..4546770)
FT                   /gene="Tssc1"
FT                   /locus_tag="mCG_19124"
FT                   /product="tumor suppressing subtransferable candidate 1,
FT                   transcript variant mCT173190"
FT                   /note="gene_id=mCG19124.1 transcript_id=mCT173190.0 created
FT                   on 10-SEP-2002"
FT   assembly_gap    4490068..4490330
FT                   /estimated_length=263
FT                   /gap_type="unknown"
FT   assembly_gap    4500109..4502385
FT                   /estimated_length=2277
FT                   /gap_type="unknown"
FT   assembly_gap    4504865..4504884
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(4508384..4508499,4527705..4527804,4538796..4538932,
FT                   4542334..4542501,4544045..4544209,4546283..4546457)
FT                   /codon_start=1
FT                   /gene="Tssc1"
FT                   /locus_tag="mCG_19124"
FT                   /product="tumor suppressing subtransferable candidate 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG19124.1 transcript_id=mCT173190.0
FT                   protein_id=mCP96109.0 isoform=CRA_a"
FT                   /protein_id="EDL36945.1"
FT                   YHILL"
FT   assembly_gap    4521249..4521268
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4523289..4523308
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4547399..4547418
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4549485..4550679
FT                   /estimated_length=1195
FT                   /gap_type="unknown"
FT   assembly_gap    4552636..4553019
FT                   /estimated_length=384
FT                   /gap_type="unknown"
FT   assembly_gap    4554351..4559510
FT                   /estimated_length=5160
FT                   /gap_type="unknown"
FT   assembly_gap    4563439..4572333
FT                   /estimated_length=8895
FT                   /gap_type="unknown"
FT   assembly_gap    4576000..4577733
FT                   /estimated_length=1734
FT                   /gap_type="unknown"
FT   assembly_gap    4578694..4578910
FT                   /estimated_length=217
FT                   /gap_type="unknown"
FT   assembly_gap    4580173..4580789
FT                   /estimated_length=617
FT                   /gap_type="unknown"
FT   assembly_gap    4586081..4588456
FT                   /estimated_length=2376
FT                   /gap_type="unknown"
FT   assembly_gap    4599935..4599954
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4603722..4609194
FT                   /estimated_length=5473
FT                   /gap_type="unknown"
FT   assembly_gap    4611296..4611315
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4612490..4612509
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4615857..4627832
FT                   /estimated_length=11976
FT                   /gap_type="unknown"
FT   assembly_gap    4629242..4629261
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4640960..4641123
FT                   /estimated_length=164
FT                   /gap_type="unknown"
FT   assembly_gap    4698590..4698903
FT                   /estimated_length=314
FT                   /gap_type="unknown"
FT   assembly_gap    4709396..4709415
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4714746..4714765
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4716170..4716189
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4717953..4724692
FT                   /estimated_length=6740
FT                   /gap_type="unknown"
FT   assembly_gap    4731340..4733366
FT                   /estimated_length=2027
FT                   /gap_type="unknown"
FT   assembly_gap    4739312..4739331
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4740699..4740718
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4755353..4755372
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4757025..4757044
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4768445..4768464
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4770451..4770470
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4774514..4774533
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4776039..4776058
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4781697..4781994
FT                   /estimated_length=298
FT                   /gap_type="unknown"
FT   assembly_gap    4787809..4787828
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4795456..4795540
FT                   /estimated_length=85
FT                   /gap_type="unknown"
FT   assembly_gap    4798245..4798376
FT                   /estimated_length=132
FT                   /gap_type="unknown"
FT   gene            <4799832..4857629
FT                   /locus_tag="mCG_145560"
FT                   /note="gene_id=mCG145560.0"
FT   mRNA            join(<4799832..4799984,4822632..4822677,4824982..4825106,
FT                   4855732..4857629)
FT                   /locus_tag="mCG_145560"
FT                   /product="mCG145560"
FT                   /note="gene_id=mCG145560.0 transcript_id=mCT184984.0
FT                   created on 05-JUN-2003"
FT   assembly_gap    4804553..4804572
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4828206..4828225
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4829286..4829305
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4837122..4837180
FT                   /estimated_length=59
FT                   /gap_type="unknown"
FT   CDS             <4857271..4857606
FT                   /codon_start=1
FT                   /locus_tag="mCG_145560"
FT                   /product="mCG145560"
FT                   /note="gene_id=mCG145560.0 transcript_id=mCT184984.0
FT                   protein_id=mCP105144.0"
FT                   /protein_id="EDL36944.1"
FT                   GSSQSHH"
FT   assembly_gap    4887605..4887624
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4891976..4892199
FT                   /estimated_length=224
FT                   /gap_type="unknown"
FT   assembly_gap    4917562..4917581
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4927322..4927612
FT                   /estimated_length=291
FT                   /gap_type="unknown"
FT   assembly_gap    4962738..4962980
FT                   /estimated_length=243
FT                   /gap_type="unknown"
FT   assembly_gap    4968499..4968518
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<4968871..>4978093)
FT                   /locus_tag="mCG_48644"
FT                   /note="gene_id=mCG48644.1"
FT   mRNA            complement(join(<4968871..4968983,4972554..4972614,
FT                   4975471..4975516,4977864..>4978093))
FT                   /locus_tag="mCG_48644"
FT                   /product="mCG48644"
FT                   /note="gene_id=mCG48644.1 transcript_id=mCT48827.0 created
FT                   on 26-SEP-2002"
FT   CDS             complement(join(4968871..4968983,4972554..4972614,
FT                   4975471..4975516,4977864..4978093))
FT                   /codon_start=1
FT                   /locus_tag="mCG_48644"
FT                   /product="mCG48644"
FT                   /note="gene_id=mCG48644.1 transcript_id=mCT48827.0
FT                   protein_id=mCP32220.0"
FT                   /protein_id="EDL36943.1"
FT   assembly_gap    4983124..4983401
FT                   /estimated_length=278
FT                   /gap_type="unknown"
FT   assembly_gap    4985032..4985486
FT                   /estimated_length=455
FT                   /gap_type="unknown"
FT   assembly_gap    4987167..4987392
FT                   /estimated_length=226
FT                   /gap_type="unknown"
FT   assembly_gap    4993668..4994010
FT                   /estimated_length=343
FT                   /gap_type="unknown"
FT   assembly_gap    4997164..4997229
FT                   /estimated_length=66
FT                   /gap_type="unknown"
FT   assembly_gap    5008746..5008993
FT                   /estimated_length=248
FT                   /gap_type="unknown"
FT   assembly_gap    5014937..5015141
FT                   /estimated_length=205
FT                   /gap_type="unknown"
FT   assembly_gap    5015530..5015982
FT                   /estimated_length=453
FT                   /gap_type="unknown"
FT   assembly_gap    5028727..5033412
FT                   /estimated_length=4686
FT                   /gap_type="unknown"
FT   assembly_gap    5055995..5056301
FT                   /estimated_length=307
FT                   /gap_type="unknown"
FT   assembly_gap    5088458..5088477
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5109206..5109237
FT                   /estimated_length=32
FT                   /gap_type="unknown"
FT   assembly_gap    5116669..5116688
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5162306..5162483
FT                   /estimated_length=178
FT                   /gap_type="unknown"
FT   assembly_gap    5171100..5171119
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<5172694..5173830)
FT                   /locus_tag="mCG_148254"
FT                   /note="gene_id=mCG148254.0"
FT   mRNA            complement(join(<5172694..5173552,5173769..5173830))
FT                   /locus_tag="mCG_148254"
FT                   /product="mCG148254"
FT                   /note="gene_id=mCG148254.0 transcript_id=mCT188517.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(<5172694..5172959)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148254"
FT                   /product="mCG148254"
FT                   /note="gene_id=mCG148254.0 transcript_id=mCT188517.0
FT                   protein_id=mCP108087.0"
FT                   /protein_id="EDL36942.1"
FT   gene            5173365..5174732
FT                   /locus_tag="mCG_148271"
FT                   /note="gene_id=mCG148271.0"
FT   mRNA            join(5173365..5173403,5174014..5174732)
FT                   /locus_tag="mCG_148271"
FT                   /product="mCG148271"
FT                   /note="gene_id=mCG148271.0 transcript_id=mCT188534.0
FT                   created on 13-JAN-2004"
FT   CDS             5174163..5174324
FT                   /codon_start=1
FT                   /locus_tag="mCG_148271"
FT                   /product="mCG148271"
FT                   /note="gene_id=mCG148271.0 transcript_id=mCT188534.0
FT                   protein_id=mCP108105.0"
FT                   /protein_id="EDL36941.1"
FT                   FDSLDCGL"
FT   assembly_gap    5199946..5200413
FT                   /estimated_length=468
FT                   /gap_type="unknown"
FT   assembly_gap    5201628..5201647
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5223541..5223560
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5239541..5239876
FT                   /estimated_length=336
FT                   /gap_type="unknown"
FT   gene            <5290486..5570331
FT                   /gene="Myt1l"
FT                   /locus_tag="mCG_7819"
FT                   /note="gene_id=mCG7819.2"
FT   mRNA            join(<5290486..5290593,5376660..5376795,5423481..5423634,
FT                   5431650..5431704,5431884..5431917,5432250..5432312,
FT                   5459521..5459882,5475047..5476018,5480470..5480604,
FT                   5484527..5484617,5486217..5486324,5490556..5490770,
FT                   5497328..5497578,5499594..5499830,5502292..5502413,
FT                   5503274..5503342,5535521..5535583,5542735..5542818,
FT                   5544628..5544849,5560296..5560387,5563769..5563872,
FT                   5569375..5569518,5569821..5570331)
FT                   /gene="Myt1l"
FT                   /locus_tag="mCG_7819"
FT                   /product="myelin transcription factor 1-like, transcript
FT                   variant mCT193512"
FT                   /note="gene_id=mCG7819.2 transcript_id=mCT193512.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(5290487..5290593,5376660..5376795,5423481..5423634,
FT                   5431650..5431704,5431884..5431917,5432250..5432312,
FT                   5459521..5459882,5475050..5476018,5480470..5480604,
FT                   5484527..5484617,5486217..5486324,5490556..5490770,
FT                   5497328..5497578,5499594..5499830,5502292..5502413,
FT                   5503274..5503342,5535521..5535583,5542735..5542818,
FT                   5544628..5544849,5560296..5560387,5563769..5563872,
FT                   5569375..5569518,5569821..5570213)
FT                   /gene="Myt1l"
FT                   /locus_tag="mCG_7819"
FT                   /product="myelin transcription factor 1-like, transcript
FT                   variant mCT6994"
FT                   /note="gene_id=mCG7819.2 transcript_id=mCT6994.2 created on
FT                   08-NOV-2002"
FT   mRNA            join(<5290487..5290593,5376660..5376795,5423481..5423634,
FT                   5431650..5431704,5431884..5431917,5432250..5432312,
FT                   5459521..5459882,5475050..5476012,5480470..5480604,
FT                   5484527..5484617,5486217..5486324,5490556..5490770,
FT                   5497328..5497578,5499594..5499830,5502292..5502413,
FT                   5503274..5503342,5535521..5535583,5542735..5542818,
FT                   5544628..5544849,5560296..5560387,5563769..5563872,
FT                   5569375..5569518,5569821..5570213)
FT                   /gene="Myt1l"
FT                   /locus_tag="mCG_7819"
FT                   /product="myelin transcription factor 1-like, transcript
FT                   variant mCT193511"
FT                   /note="gene_id=mCG7819.2 transcript_id=mCT193511.0 created
FT                   on 09-MAR-2004"
FT   assembly_gap    5296938..5297060
FT                   /estimated_length=123
FT                   /gap_type="unknown"
FT   assembly_gap    5309996..5310015
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(5321565..5332410)
FT                   /locus_tag="mCG_148243"
FT                   /note="gene_id=mCG148243.0"
FT   mRNA            complement(join(5321565..5323656,5324955..5325055,
FT                   5328407..5329197,5332328..5332410))
FT                   /locus_tag="mCG_148243"
FT                   /product="mCG148243"
FT                   /note="gene_id=mCG148243.0 transcript_id=mCT188506.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(5322019..5322354)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148243"
FT                   /product="mCG148243"
FT                   /note="gene_id=mCG148243.0 transcript_id=mCT188506.0
FT                   protein_id=mCP108079.0"
FT                   /protein_id="EDL36940.1"
FT                   TAPCWKL"
FT   assembly_gap    5337590..5337609
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5346162..5347064
FT                   /estimated_length=903
FT                   /gap_type="unknown"
FT   assembly_gap    5358099..5358122
FT                   /estimated_length=24
FT                   /gap_type="unknown"
FT   assembly_gap    5362357..5362376
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5375249..5375268
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5404411..5404430
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5405510..5405529
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5407270..5407289
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(<5423557..5423634,5431650..5431704,5431884..5431917,
FT                   5432250..5432312,5459521..5459882,5475047..5476018,
FT                   5480470..5480604,5484527..5484617,5486217..5486324,
FT                   5490556..5490770,5497328..5497578,5499594..5499830,
FT                   5502292..5502413,5503274..5503342,5535521..5535583,
FT                   5542735..5542818,5544628..5544849,5560296..5560387,
FT                   5563769..5563872,5569375..5569518,5569821..5569961)
FT                   /codon_start=1
FT                   /gene="Myt1l"
FT                   /locus_tag="mCG_7819"
FT                   /product="myelin transcription factor 1-like, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG7819.2 transcript_id=mCT193512.0
FT                   protein_id=mCP114479.0 isoform=CRA_b"
FT                   /protein_id="EDL36938.1"
FT   CDS             join(<5423557..5423634,5431650..5431704,5431884..5431917,
FT                   5432250..5432312,5459521..5459882,5475050..5476012,
FT                   5480470..5480604,5484527..5484617,5486217..5486324,
FT                   5490556..5490770,5497328..5497578,5499594..5499830,
FT                   5502292..5502413,5503274..5503342,5535521..5535583,
FT                   5542735..5542818,5544628..5544849,5560296..5560387,
FT                   5563769..5563872,5569375..5569518,5569821..5569961)
FT                   /codon_start=1
FT                   /gene="Myt1l"
FT                   /locus_tag="mCG_7819"
FT                   /product="myelin transcription factor 1-like, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG7819.2 transcript_id=mCT193511.0
FT                   protein_id=mCP114478.0 isoform=CRA_a"
FT                   /protein_id="EDL36937.1"
FT   CDS             join(5431650..5431704,5431884..5431917,5432250..5432312,
FT                   5459521..5459882,5475050..5476018,5480470..5480604,
FT                   5484527..5484617,5486217..5486324,5490556..5490770,
FT                   5497328..5497578,5499594..5499830,5502292..5502413,
FT                   5503274..5503342,5535521..5535583,5542735..5542818,
FT                   5544628..5544849,5560296..5560387,5563769..5563872,
FT                   5569375..5569518,5569821..5569961)
FT                   /codon_start=1
FT                   /gene="Myt1l"
FT                   /locus_tag="mCG_7819"
FT                   /product="myelin transcription factor 1-like, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG7819.2 transcript_id=mCT6994.2
FT                   protein_id=mCP10273.2 isoform=CRA_c"
FT                   /protein_id="EDL36939.1"
FT   assembly_gap    5453633..5454420
FT                   /estimated_length=788
FT                   /gap_type="unknown"
FT   assembly_gap    5479384..5479403
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5495520..5495539
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5498938..5498957
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5512486..5512505
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5519487..5520004
FT                   /estimated_length=518
FT                   /gap_type="unknown"
FT   assembly_gap    5525948..5526072
FT                   /estimated_length=125
FT                   /gap_type="unknown"
FT   assembly_gap    5530128..5530261
FT                   /estimated_length=134
FT                   /gap_type="unknown"
FT   assembly_gap    5543603..5543622
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5545991..5546416
FT                   /estimated_length=426
FT                   /gap_type="unknown"
FT   assembly_gap    5561878..5561897
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5572494..5572768
FT                   /estimated_length=275
FT                   /gap_type="unknown"
FT   assembly_gap    5577444..5577463
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <5587598..5664899
FT                   /gene="Pxdn"
FT                   /locus_tag="mCG_7811"
FT                   /note="gene_id=mCG7811.1"
FT   mRNA            join(<5587598..5587788,5622183..5622254,5623856..5623927,
FT                   5627582..5627653,5630631..5630702,5631033..5631104,
FT                   5632764..5632933,5633174..5633291,5635375..5635544,
FT                   5639044..5639316,5641850..5641966,5642899..5643057,
FT                   5643747..5643859,5644891..5645047,5650366..5651869,
FT                   5654167..5654301,5654977..5655185,5660409..5660529,
FT                   5660791..5660920,5663044..5663157,5664641..5664899)
FT                   /gene="Pxdn"
FT                   /locus_tag="mCG_7811"
FT                   /product="peroxidasin homolog (Drosophila)"
FT                   /note="gene_id=mCG7811.1 transcript_id=mCT6946.1 created on
FT                   10-SEP-2002"
FT   CDS             join(5587598..5587788,5622183..5622254,5623856..5623927,
FT                   5627582..5627653,5630631..5630702,5631033..5631104,
FT                   5632764..5632933,5633174..5633291,5635375..5635544,
FT                   5639044..5639316,5641850..5641966,5642899..5643057,
FT                   5643747..5643859,5644891..5645047,5650366..5651869,
FT                   5654167..5654301,5654977..5655185,5660409..5660529,
FT                   5660791..5660920,5663044..5663157,5664641..5664739)
FT                   /codon_start=1
FT                   /gene="Pxdn"
FT                   /locus_tag="mCG_7811"
FT                   /product="peroxidasin homolog (Drosophila)"
FT                   /note="gene_id=mCG7811.1 transcript_id=mCT6946.1
FT                   protein_id=mCP10268.1"
FT                   /protein_id="EDL36936.1"
FT   assembly_gap    5596863..5596967
FT                   /estimated_length=105
FT                   /gap_type="unknown"
FT   assembly_gap    5622858..5622962
FT                   /estimated_length=105
FT                   /gap_type="unknown"
FT   assembly_gap    5641025..5641358
FT                   /estimated_length=334
FT                   /gap_type="unknown"
FT   assembly_gap    5656653..5657121
FT                   /estimated_length=469
FT                   /gap_type="unknown"
FT   gene            complement(5664833..5666217)
FT                   /locus_tag="mCG_1041692"
FT                   /note="gene_id=mCG1041692.1"
FT   mRNA            complement(join(5664833..5664886,5664912..5666217))
FT                   /locus_tag="mCG_1041692"
FT                   /product="mCG1041692"
FT                   /note="gene_id=mCG1041692.1 transcript_id=mCT159396.1
FT                   created on 26-SEP-2002"
FT   CDS             complement(5665242..5665376)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041692"
FT                   /product="mCG1041692"
FT                   /note="gene_id=mCG1041692.1 transcript_id=mCT159396.1
FT                   protein_id=mCP78466.1"
FT                   /protein_id="EDL36935.1"
FT   assembly_gap    5670610..5670629
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(5703198..>5771917)
FT                   /gene="Tpo"
FT                   /locus_tag="mCG_7809"
FT                   /note="gene_id=mCG7809.1"
FT   mRNA            complement(join(5703198..5703699,5721527..5721650,
FT                   5722833..5722932,5725067..5725198,5731623..5731793,
FT                   5733087..5733295,5735307..5735544,5738716..5738886,
FT                   5740537..5740795,5743269..5743769,5744121..5744327,
FT                   5745982..5746111,5756881..5757013,5759468..5759619,
FT                   5765281..5765365,5771824..>5771917))
FT                   /gene="Tpo"
FT                   /locus_tag="mCG_7809"
FT                   /product="thyroid peroxidase"
FT                   /note="gene_id=mCG7809.1 transcript_id=mCT6950.0 created on
FT                   03-SEP-2002"
FT   CDS             complement(join(5703661..5703699,5721527..5721650,
FT                   5722833..5722932,5725067..5725198,5731623..5731793,
FT                   5733087..5733295,5735307..5735544,5738716..5738886,
FT                   5740537..5740795,5743269..5743769,5744121..5744327,
FT                   5745982..5746111,5756881..5757013,5759468..5759619,
FT                   5765281..5765365,5771824..5771917))
FT                   /codon_start=1
FT                   /gene="Tpo"
FT                   /locus_tag="mCG_7809"
FT                   /product="thyroid peroxidase"
FT                   /note="gene_id=mCG7809.1 transcript_id=mCT6950.0
FT                   protein_id=mCP10280.0"
FT                   /protein_id="EDL36934.1"
FT   assembly_gap    5706077..5706199
FT                   /estimated_length=123
FT                   /gap_type="unknown"
FT   assembly_gap    5711749..5712037
FT                   /estimated_length=289
FT                   /gap_type="unknown"
FT   assembly_gap    5786513..5788824
FT                   /estimated_length=2312
FT                   /gap_type="unknown"
FT   assembly_gap    5803436..5803471
FT                   /estimated_length=36
FT                   /gap_type="unknown"
FT   assembly_gap    5804482..5804501
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5808775..5808794
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(5816461..>6014414)
FT                   /gene="Sntg2"
FT                   /locus_tag="mCG_7810"
FT                   /note="gene_id=mCG7810.2"
FT   mRNA            complement(join(5816461..5817238,5831282..5831392,
FT                   5837052..5837133,5862331..5862537,5865130..5865201,
FT                   5872121..5872237,5878828..5878866,5880595..5880724,
FT                   5893470..5893597,5902515..5902606,5912530..5912617,
FT                   5942903..5942960,5943058..5943109,5951131..5951268,
FT                   6014243..>6014414))
FT                   /gene="Sntg2"
FT                   /locus_tag="mCG_7810"
FT                   /product="syntrophin, gamma 2, transcript variant
FT                   mCT193501"
FT                   /note="gene_id=mCG7810.2 transcript_id=mCT193501.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(5816463..5817238,5831282..5831392,
FT                   5837041..5837133,5862331..5862537,5865130..5865201,
FT                   5872121..5872237,5878828..5878866,5880595..5880724,
FT                   5893470..5893597,5902515..5902606,5912530..5912617,
FT                   5951131..5951268,6014243..>6014395))
FT                   /gene="Sntg2"
FT                   /locus_tag="mCG_7810"
FT                   /product="syntrophin, gamma 2, transcript variant mCT6951"
FT                   /note="gene_id=mCG7810.2 transcript_id=mCT6951.1 created on
FT                   03-SEP-2002"
FT   mRNA            complement(join(5816969..5817238,5831282..5831392,
FT                   5837041..5837133,5862331..5862537,5865130..5865201,
FT                   5872121..5872237,5878828..5878866,5880595..5880724,
FT                   5902515..5902606,5912530..5912617,5942903..5942960,
FT                   5943058..5943114,5951131..5951268,6014243..6014350))
FT                   /gene="Sntg2"
FT                   /locus_tag="mCG_7810"
FT                   /product="syntrophin, gamma 2, transcript variant
FT                   mCT193502"
FT                   /note="gene_id=mCG7810.2 transcript_id=mCT193502.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(5816973..5817238,5831282..5831392,
FT                   5837041..5837133,5862331..5862537,5865130..5865201,
FT                   5872121..5872237,5878828..5878866,5880595..5880724,
FT                   5893470..5893597,5902515..5902606,5912530..5912617,
FT                   5942903..5942960,5943058..5943091,5951131..5951268,
FT                   6014243..>6014394))
FT                   /gene="Sntg2"
FT                   /locus_tag="mCG_7810"
FT                   /product="syntrophin, gamma 2, transcript variant
FT                   mCT193499"
FT                   /note="gene_id=mCG7810.2 transcript_id=mCT193499.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(5816973..5817238,5831282..5831392,
FT                   5837041..5837133,5862331..5862537,5865130..5865201,
FT                   5872121..5872237,5878828..5878866,5880595..5880724,
FT                   5893470..5893597,5902515..5902606,5912530..5912617,
FT                   5942903..5942960,5943058..5943114,5951131..5951268,
FT                   6014243..>6014315))
FT                   /gene="Sntg2"
FT                   /locus_tag="mCG_7810"
FT                   /product="syntrophin, gamma 2, transcript variant
FT                   mCT193500"
FT                   /note="gene_id=mCG7810.2 transcript_id=mCT193500.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(5817107..5817238,5831282..5831392,
FT                   5837041..5837133,5862331..5862537,5865130..5865201,
FT                   5872121..5872237,5878828..5878866,5880595..5880724,
FT                   5893470..5893597,5902515..5902606,5912530..5912617,
FT                   5951131..5951268,6014243..>6014395))
FT                   /codon_start=1
FT                   /gene="Sntg2"
FT                   /locus_tag="mCG_7810"
FT                   /product="syntrophin, gamma 2, isoform CRA_d"
FT                   /note="gene_id=mCG7810.2 transcript_id=mCT6951.1
FT                   protein_id=mCP10282.1 isoform=CRA_d"
FT                   /protein_id="EDL36933.1"
FT   CDS             complement(join(5817107..5817238,5831282..5831392,
FT                   5837041..5837133,5862331..5862537,5865130..5865201,
FT                   5872121..5872237,5878828..5878866,5880595..5880724,
FT                   5893470..5893597,5902515..5902606,5912530..5912617,
FT                   5942903..5942960,5943058..>5943065))
FT                   /codon_start=1
FT                   /gene="Sntg2"
FT                   /locus_tag="mCG_7810"
FT                   /product="syntrophin, gamma 2, isoform CRA_a"
FT                   /note="gene_id=mCG7810.2 transcript_id=mCT193499.0
FT                   protein_id=mCP114472.0 isoform=CRA_a"
FT                   /protein_id="EDL36929.1"
FT   CDS             complement(join(5817107..5817238,5831282..5831392,
FT                   5837041..5837133,5862331..5862537,5865130..5865201,
FT                   5872121..5872237,5878828..5878866,5880595..5880724,
FT                   5893470..5893597,5902515..5902606,5912530..5912617,
FT                   5942903..5942960,5943058..>5943065))
FT                   /codon_start=1
FT                   /gene="Sntg2"
FT                   /locus_tag="mCG_7810"
FT                   /product="syntrophin, gamma 2, isoform CRA_a"
FT                   /note="gene_id=mCG7810.2 transcript_id=mCT193500.0
FT                   protein_id=mCP114473.0 isoform=CRA_a"
FT                   /protein_id="EDL36930.1"
FT   CDS             complement(join(5817107..5817238,5831282..5831392,
FT                   5837041..5837133,5862331..5862537,5865130..5865201,
FT                   5872121..5872237,5878828..5878866,5880595..5880724,
FT                   5902515..5902534))
FT                   /codon_start=1
FT                   /gene="Sntg2"
FT                   /locus_tag="mCG_7810"
FT                   /product="syntrophin, gamma 2, isoform CRA_c"
FT                   /note="gene_id=mCG7810.2 transcript_id=mCT193502.0
FT                   protein_id=mCP114475.0 isoform=CRA_c"
FT                   /protein_id="EDL36932.1"
FT   assembly_gap    5825858..5826841
FT                   /estimated_length=984
FT                   /gap_type="unknown"
FT   assembly_gap    5827937..5827961
FT                   /estimated_length=25
FT                   /gap_type="unknown"
FT   CDS             complement(join(5831358..5831392,5837052..5837133,
FT                   5862331..5862537,5865130..5865201,5872121..5872237,
FT                   5878828..5878866,5880595..5880724,5893470..5893597,
FT                   5902515..5902606,5912530..5912617,5942903..5942960,
FT                   5943058..>5943065))
FT                   /codon_start=1
FT                   /gene="Sntg2"
FT                   /locus_tag="mCG_7810"
FT                   /product="syntrophin, gamma 2, isoform CRA_b"
FT                   /note="gene_id=mCG7810.2 transcript_id=mCT193501.0
FT                   protein_id=mCP114474.0 isoform=CRA_b"
FT                   /protein_id="EDL36931.1"
FT                   ERTLEIQVLSA"
FT   assembly_gap    5839909..5840167
FT                   /estimated_length=259
FT                   /gap_type="unknown"
FT   assembly_gap    5843319..5843362
FT                   /estimated_length=44
FT                   /gap_type="unknown"
FT   assembly_gap    5856603..5856666
FT                   /estimated_length=64
FT                   /gap_type="unknown"
FT   assembly_gap    5860608..5860751
FT                   /estimated_length=144
FT                   /gap_type="unknown"
FT   assembly_gap    5879181..5879200
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5894595..5894772
FT                   /estimated_length=178
FT                   /gap_type="unknown"
FT   assembly_gap    5897603..5898704
FT                   /estimated_length=1102
FT                   /gap_type="unknown"
FT   assembly_gap    5899851..5900196
FT                   /estimated_length=346
FT                   /gap_type="unknown"
FT   assembly_gap    5907203..5908029
FT                   /estimated_length=827
FT                   /gap_type="unknown"
FT   assembly_gap    5916465..5916808
FT                   /estimated_length=344
FT                   /gap_type="unknown"
FT   assembly_gap    5919571..5919590
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5924814..5924922
FT                   /estimated_length=109
FT                   /gap_type="unknown"
FT   assembly_gap    5946353..5946372
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5948822..5948841
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5950541..5950560
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5968738..5968975
FT                   /estimated_length=238
FT                   /gap_type="unknown"
FT   assembly_gap    5992380..5992399
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5993749..5993768
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5996207..5996226
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5997506..5997525
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6027951..6027970
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6051721..6051740
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6053889..6053908
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6057446..6057465
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6061636..6061655
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6103316..6103335
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6106786..6106931
FT                   /estimated_length=146
FT                   /gap_type="unknown"
FT   assembly_gap    6125087..6125199
FT                   /estimated_length=113
FT                   /gap_type="unknown"
FT   assembly_gap    6146247..6146266
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6179801..6179820
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6211289..6211308
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6212685..6212704
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6214357..6214376
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6221763..6221782
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6222949..6222968
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6224814..6224833
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6229726..6229745
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            6235068..6239761
FT                   /gene="Tmem18"
FT                   /locus_tag="mCG_7812"
FT                   /note="gene_id=mCG7812.2"
FT   mRNA            join(6235068..6235170,6236078..6236198,6237807..6237861,
FT                   6239082..6239175,6239260..6239761)
FT                   /gene="Tmem18"
FT                   /locus_tag="mCG_7812"
FT                   /product="transmembrane protein 18"
FT                   /note="gene_id=mCG7812.2 transcript_id=mCT6943.2 created on
FT                   10-SEP-2002"
FT   CDS             join(6235114..6235170,6236078..6236198,6237807..6237861,
FT                   6239082..6239175,6239260..6239355)
FT                   /codon_start=1
FT                   /gene="Tmem18"
FT                   /locus_tag="mCG_7812"
FT                   /product="transmembrane protein 18"
FT                   /note="gene_id=mCG7812.2 transcript_id=mCT6943.2
FT                   protein_id=mCP10274.2"
FT                   /protein_id="EDL36928.1"
FT   assembly_gap    6241000..6241291
FT                   /estimated_length=292
FT                   /gap_type="unknown"
FT   assembly_gap    6249498..6249517
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6263055..6265412
FT                   /estimated_length=2358
FT                   /gap_type="unknown"
FT   assembly_gap    6272538..6272560
FT                   /estimated_length=23
FT                   /gap_type="unknown"
FT   assembly_gap    6273544..6274384
FT                   /estimated_length=841
FT                   /gap_type="unknown"
FT   assembly_gap    6299285..6299309
FT                   /estimated_length=25
FT                   /gap_type="unknown"
FT   assembly_gap    6341990..6342022
FT                   /estimated_length=33
FT                   /gap_type="unknown"
FT   assembly_gap    6377759..6377778
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6384662..6385641
FT                   /estimated_length=980
FT                   /gap_type="unknown"
FT   assembly_gap    6386642..6387364
FT                   /estimated_length=723
FT                   /gap_type="unknown"
FT   assembly_gap    6411453..6411472
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6413159..6413178
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6414273..6414292
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6428502..6428521
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6438598..6438617
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6445373..6445846
FT                   /estimated_length=474
FT                   /gap_type="unknown"
FT   assembly_gap    6484011..6484030
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6504208..6504958
FT                   /estimated_length=751
FT                   /gap_type="unknown"
FT   assembly_gap    6510533..6510804
FT                   /estimated_length=272
FT                   /gap_type="unknown"
FT   gene            6522141..6531742
FT                   /locus_tag="mCG_56196"
FT                   /note="gene_id=mCG56196.2"
FT   mRNA            join(6522141..6522839,6524831..6524884,6524965..6525045,
FT                   6527810..6527875,6531179..6531742)
FT                   /locus_tag="mCG_56196"
FT                   /product="mCG56196"
FT                   /note="gene_id=mCG56196.2 transcript_id=mCT56379.2 created
FT                   on 03-JUL-2003"
FT   CDS             join(6522584..6522839,6524831..6524884,6524965..6525045,
FT                   6527810..6527874)
FT                   /codon_start=1
FT                   /locus_tag="mCG_56196"
FT                   /product="mCG56196"
FT                   /note="gene_id=mCG56196.2 transcript_id=mCT56379.2
FT                   protein_id=mCP32233.2"
FT                   /db_xref="GOA:Q80UG6"
FT                   /db_xref="InterPro:IPR029364"
FT                   /db_xref="MGI:MGI:3697448"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q80UG6"
FT                   /protein_id="EDL36927.1"
FT   gene            complement(6531879..6549592)
FT                   /locus_tag="mCG_7808"
FT                   /note="gene_id=mCG7808.2"
FT   mRNA            complement(join(6531879..6533864,6534027..6534132,
FT                   6535665..6535726,6542700..6542813,6543051..6543124,
FT                   6549489..6549592))
FT                   /locus_tag="mCG_7808"
FT                   /product="mCG7808, transcript variant mCT6949"
FT                   /note="gene_id=mCG7808.2 transcript_id=mCT6949.1 created on
FT                   10-JUN-2003"
FT   mRNA            complement(join(6532614..6533864,6534027..6534132,
FT                   6535665..6535726,6542852..6542965,6543051..6543124,
FT                   6549489..6549584))
FT                   /locus_tag="mCG_7808"
FT                   /product="mCG7808, transcript variant mCT185502"
FT                   /note="gene_id=mCG7808.2 transcript_id=mCT185502.0 created
FT                   on 10-JUN-2003"
FT   mRNA            complement(join(6532614..6533864,6534027..6534132,
FT                   6535665..6536031))
FT                   /locus_tag="mCG_7808"
FT                   /product="mCG7808, transcript variant mCT185501"
FT                   /note="gene_id=mCG7808.2 transcript_id=mCT185501.0 created
FT                   on 10-JUN-2003"
FT   CDS             complement(join(6533787..6533864,6534027..6534132,
FT                   6535665..6535726,6542700..6542813,6543051..6543124,
FT                   6549489..6549531))
FT                   /codon_start=1
FT                   /locus_tag="mCG_7808"
FT                   /product="mCG7808, isoform CRA_c"
FT                   /note="gene_id=mCG7808.2 transcript_id=mCT6949.1
FT                   protein_id=mCP10275.1 isoform=CRA_c"
FT                   /db_xref="GOA:Q561M1"
FT                   /db_xref="InterPro:IPR002115"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="MGI:MGI:87881"
FT                   /db_xref="UniProtKB/TrEMBL:Q561M1"
FT                   /protein_id="EDL36925.1"
FT   CDS             complement(join(6533787..6533864,6534027..6534132,
FT                   6535665..6535726,6542852..6542965,6543051..6543124,
FT                   6549489..6549531))
FT                   /codon_start=1
FT                   /locus_tag="mCG_7808"
FT                   /product="mCG7808, isoform CRA_b"
FT                   /note="gene_id=mCG7808.2 transcript_id=mCT185502.0
FT                   protein_id=mCP106760.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q4VAI2"
FT                   /db_xref="InterPro:IPR002115"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="MGI:MGI:87881"
FT                   /db_xref="UniProtKB/TrEMBL:Q4VAI2"
FT                   /protein_id="EDL36924.1"
FT   CDS             complement(join(6533787..6533864,6534027..6534132,
FT                   6535665..6535684))
FT                   /codon_start=1
FT                   /locus_tag="mCG_7808"
FT                   /product="mCG7808, isoform CRA_a"
FT                   /note="gene_id=mCG7808.2 transcript_id=mCT185501.0
FT                   protein_id=mCP106759.0 isoform=CRA_a"
FT                   /protein_id="EDL36923.1"
FT   gene            6548533..>6549078
FT                   /locus_tag="mCG_148267"
FT                   /note="gene_id=mCG148267.0"
FT   mRNA            join(6548533..6548615,6548943..>6549078)
FT                   /locus_tag="mCG_148267"
FT                   /product="mCG148267"
FT                   /note="gene_id=mCG148267.0 transcript_id=mCT188530.0
FT                   created on 13-JAN-2004"
FT   CDS             6548987..>6549078
FT                   /codon_start=1
FT                   /locus_tag="mCG_148267"
FT                   /product="mCG148267"
FT                   /note="gene_id=mCG148267.0 transcript_id=mCT188530.0
FT                   protein_id=mCP108097.0"
FT                   /protein_id="EDL36926.1"
FT                   /translation="MMPCLTTSPESTTIQKGPEPLKLSQNKSVLP"
FT   gene            6549684..6598073
FT                   /gene="Sh3yl1"
FT                   /locus_tag="mCG_7813"
FT                   /note="gene_id=mCG7813.2"
FT   mRNA            join(6549684..6550226,6560244..6560354,6562778..6562891,
FT                   6564824..6564888,6577513..6577625,6578230..6578358,
FT                   6579906..6580068,6580729..6580807,6596765..6596821,
FT                   6597721..6598073)
FT                   /gene="Sh3yl1"
FT                   /locus_tag="mCG_7813"
FT                   /product="Sh3 domain YSC-like 1, transcript variant
FT                   mCT6944"
FT                   /note="gene_id=mCG7813.2 transcript_id=mCT6944.1 created on
FT                   03-JUL-2003"
FT   mRNA            join(<6549691..6550226,6560244..6560354,6564824..6564888,
FT                   6577513..6577625,6578230..6578358,6579906..6580068,
FT                   6580729..6580807,6596765..6596821,6597721..6598066)
FT                   /gene="Sh3yl1"
FT                   /locus_tag="mCG_7813"
FT                   /product="Sh3 domain YSC-like 1, transcript variant
FT                   mCT193508"
FT                   /note="gene_id=mCG7813.2 transcript_id=mCT193508.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(<6549728..6550226,6560244..6560354,6562778..6562891,
FT                   6564824..6564888,6577513..6577625,6578230..6578358,
FT                   6579906..6580807,6596765..6596821,6597721..6597934)
FT                   /gene="Sh3yl1"
FT                   /locus_tag="mCG_7813"
FT                   /product="Sh3 domain YSC-like 1, transcript variant
FT                   mCT193507"
FT                   /note="gene_id=mCG7813.2 transcript_id=mCT193507.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<6550193..6550226,6560244..6560354,6564824..6564888,
FT                   6577513..6577625,6578230..6578358,6579906..6580068,
FT                   6580729..6580807,6596765..6596821,6597721..6597911)
FT                   /codon_start=1
FT                   /gene="Sh3yl1"
FT                   /locus_tag="mCG_7813"
FT                   /product="Sh3 domain YSC-like 1, isoform CRA_b"
FT                   /note="gene_id=mCG7813.2 transcript_id=mCT193508.0
FT                   protein_id=mCP114477.0 isoform=CRA_b"
FT                   /protein_id="EDL36921.1"
FT   CDS             join(<6550193..6550226,6560244..6560354,6562778..6562891,
FT                   6564824..6564888,6577513..6577625,6578230..6578358,
FT                   6579906..6580134)
FT                   /codon_start=1
FT                   /gene="Sh3yl1"
FT                   /locus_tag="mCG_7813"
FT                   /product="Sh3 domain YSC-like 1, isoform CRA_a"
FT                   /note="gene_id=mCG7813.2 transcript_id=mCT193507.0
FT                   protein_id=mCP114476.0 isoform=CRA_a"
FT                   /protein_id="EDL36920.1"
FT   CDS             join(6550226,6560244..6560354,6562778..6562891,
FT                   6564824..6564888,6577513..6577625,6578230..6578358,
FT                   6579906..6580068,6580729..6580807,6596765..6596821,
FT                   6597721..6597911)
FT                   /codon_start=1
FT                   /gene="Sh3yl1"
FT                   /locus_tag="mCG_7813"
FT                   /product="Sh3 domain YSC-like 1, isoform CRA_c"
FT                   /note="gene_id=mCG7813.2 transcript_id=mCT6944.1
FT                   protein_id=mCP10271.1 isoform=CRA_c"
FT                   /protein_id="EDL36922.1"
FT                   "
FT   assembly_gap    6565024..6565043
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6602855..6602874
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6618151..6618170
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6623177..6623196
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6630522..6635464
FT                   /estimated_length=4943
FT                   /gap_type="unknown"
FT   assembly_gap    6638166..6638343
FT                   /estimated_length=178
FT                   /gap_type="unknown"
FT   gene            6655851..6657138
FT                   /pseudo
FT                   /locus_tag="mCG_9933"
FT                   /note="gene_id=mCG9933.1"
FT   mRNA            join(6655851..6656166,6656284..6656457,6656530..6657138)
FT                   /pseudo
FT                   /locus_tag="mCG_9933"
FT                   /note="gene_id=mCG9933.1 transcript_id=mCT9672.1 created on
FT                   10-SEP-2002"
FT   assembly_gap    6665124..6665550
FT                   /estimated_length=427
FT                   /gap_type="unknown"
FT   assembly_gap    6683928..6683947
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <6708070..>6709194
FT                   /locus_tag="mCG_55594"
FT                   /note="gene_id=mCG55594.1"
FT   mRNA            <6708070..>6709194
FT                   /locus_tag="mCG_55594"
FT                   /product="mCG55594"
FT                   /note="gene_id=mCG55594.1 transcript_id=mCT55777.1 created
FT                   on 03-SEP-2002"
FT   CDS             6708070..6709194
FT                   /codon_start=1
FT                   /locus_tag="mCG_55594"
FT                   /product="mCG55594"
FT                   /note="gene_id=mCG55594.1 transcript_id=mCT55777.1
FT                   protein_id=mCP38879.1"
FT                   /protein_id="EDL36919.1"
FT   assembly_gap    6720195..6720876
FT                   /estimated_length=682
FT                   /gap_type="unknown"
FT   assembly_gap    6727477..6727739
FT                   /estimated_length=263
FT                   /gap_type="unknown"
FT   gene            complement(6732781..6733356)
FT                   /pseudo
FT                   /locus_tag="mCG_1041598"
FT                   /note="gene_id=mCG1041598.1"
FT   mRNA            complement(6732781..6733356)
FT                   /pseudo
FT                   /locus_tag="mCG_1041598"
FT                   /note="gene_id=mCG1041598.1 transcript_id=mCT159302.1
FT                   created on 26-SEP-2002"
FT   assembly_gap    6736278..6737001
FT                   /estimated_length=724
FT                   /gap_type="unknown"
FT   assembly_gap    6739393..6739412
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6741927..6741946
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6770269..6770288
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6790721..6790740
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6855146..6855165
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <6898481..6963073
FT                   /gene="Lamb1-1"
FT                   /locus_tag="mCG_22463"
FT                   /note="gene_id=mCG22463.1"
FT   mRNA            join(<6898481..6898785,6899875..6900050,6902241..6902376,
FT                   6905614..6905687,6911646..6911834,6911920..6911983,
FT                   6915741..6915943,6918810..6918930,6920600..6920788,
FT                   6921063..6921242,6921387..6921499,6922527..6922606,
FT                   6930811..6930946,6931997..6932155,6933109..6933236,
FT                   6933392..6933515,6934191..6934395,6935747..6935890,
FT                   6936090..6936321,6937776..6937939,6938953..6939177,
FT                   6940161..6940375,6941136..6941232,6951450..6951819,
FT                   6953105..6953289,6954084..6954325,6956647..6956850,
FT                   6957361..6957505,6959355..6959562,6959753..6959894,
FT                   6960830..6961006,6962295..6962454,6962542..6963073)
FT                   /gene="Lamb1-1"
FT                   /locus_tag="mCG_22463"
FT                   /product="laminin B1 subunit 1"
FT                   /note="gene_id=mCG22463.1 transcript_id=mCT22317.1 created
FT                   on 10-SEP-2002"
FT   CDS             join(<6898560..6898785,6899875..6900050,6902241..6902376,
FT                   6905614..6905687,6911646..6911834,6911920..6911983,
FT                   6915741..6915943,6918810..6918930,6920600..6920788,
FT                   6921063..6921242,6921387..6921499,6922527..6922606,
FT                   6930811..6930946,6931997..6932155,6933109..6933236,
FT                   6933392..6933515,6934191..6934395,6935747..6935890,
FT                   6936090..6936321,6937776..6937939,6938953..6939177,
FT                   6940161..6940375,6941136..6941232,6951450..6951819,
FT                   6953105..6953289,6954084..6954325,6956647..6956850,
FT                   6957361..6957505,6959355..6959562,6959753..6959894,
FT                   6960830..6961006,6962295..6962454,6962542..6962678)
FT                   /codon_start=1
FT                   /gene="Lamb1-1"
FT                   /locus_tag="mCG_22463"
FT                   /product="laminin B1 subunit 1"
FT                   /note="gene_id=mCG22463.1 transcript_id=mCT22317.1
FT                   protein_id=mCP11346.1"
FT                   /protein_id="EDL36918.1"
FT   gene            complement(6964834..>6984636)
FT                   /gene="Dld"
FT                   /locus_tag="mCG_22465"
FT                   /note="gene_id=mCG22465.1"
FT   mRNA            complement(join(6964834..6965425,6965522..6965611,
FT                   6966608..6966745,6967050..6967239,6967796..6967966,
FT                   6968649..6968839,6973463..6973564,6974047..6974190,
FT                   6974561..6974661,6975927..6975996,6976558..6976626,
FT                   6978006..6978085,6982780..6982858,6984484..>6984636))
FT                   /gene="Dld"
FT                   /locus_tag="mCG_22465"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /note="gene_id=mCG22465.1 transcript_id=mCT22318.0 created
FT                   on 03-SEP-2002"
FT   CDS             complement(join(6965360..6965425,6965522..6965611,
FT                   6966608..6966745,6967050..6967239,6967796..6967966,
FT                   6968649..6968839,6973463..6973564,6974047..6974190,
FT                   6974561..6974661,6975927..6975996,6976558..6976626,
FT                   6978006..6978085,6982780..6982858,6984484..>6984636))
FT                   /codon_start=1
FT                   /gene="Dld"
FT                   /locus_tag="mCG_22465"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /note="gene_id=mCG22465.1 transcript_id=mCT22318.0
FT                   protein_id=mCP11307.0"
FT                   /protein_id="EDL36917.1"
FT   assembly_gap    6991969..6996130
FT                   /estimated_length=4162
FT                   /gap_type="unknown"
FT   assembly_gap    7004891..7005089
FT                   /estimated_length=199
FT                   /gap_type="unknown"
FT   assembly_gap    7009878..7010054
FT                   /estimated_length=177
FT                   /gap_type="unknown"
FT   assembly_gap    7026533..7026552
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7046521..7047744
FT                   /estimated_length=1224
FT                   /gap_type="unknown"
FT   assembly_gap    7049471..7049490
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <7054577..7056097
FT                   /locus_tag="mCG_128434"
FT                   /note="gene_id=mCG128434.0"
FT   mRNA            <7054577..7056097
FT                   /locus_tag="mCG_128434"
FT                   /product="mCG128434"
FT                   /note="gene_id=mCG128434.0 transcript_id=mCT129730.0
FT                   created on 10-SEP-2002"
FT   CDS             <7055026..7055532
FT                   /codon_start=1
FT                   /locus_tag="mCG_128434"
FT                   /product="mCG128434"
FT                   /note="gene_id=mCG128434.0 transcript_id=mCT129730.0
FT                   protein_id=mCP78606.0"
FT                   /protein_id="EDL36916.1"
FT                   NEEEL"
FT   assembly_gap    7069521..7069906
FT                   /estimated_length=386
FT                   /gap_type="unknown"
FT   gene            7074301..7108091
FT                   /gene="Slc26a3"
FT                   /locus_tag="mCG_142287"
FT                   /note="gene_id=mCG142287.0"
FT   mRNA            join(7074301..7074342,7084631..7084743,7084980..7085146,
FT                   7086709..7086873,7088391..7088543,7089758..7089840,
FT                   7092891..7093038,7093134..7093247,7093353..7093430,
FT                   7096456..7096551,7098223..7098329,7099432..7099501,
FT                   7099593..7099687,7105246..7105388,7105494..7105559,
FT                   7107844..7108091)
FT                   /gene="Slc26a3"
FT                   /locus_tag="mCG_142287"
FT                   /product="solute carrier family 26, member 3"
FT                   /note="gene_id=mCG142287.0 transcript_id=mCT179802.0
FT                   created on 07-FEB-2003"
FT   assembly_gap    7082943..7084093
FT                   /estimated_length=1151
FT                   /gap_type="unknown"
FT   CDS             join(7085000..7085146,7086709..7086873,7088391..7088543,
FT                   7089758..7089840,7092891..7093038,7093134..7093247,
FT                   7093353..7093430,7096456..7096551,7098223..7098329,
FT                   7099432..7099501,7099593..7099687,7105246..7105249)
FT                   /codon_start=1
FT                   /gene="Slc26a3"
FT                   /locus_tag="mCG_142287"
FT                   /product="solute carrier family 26, member 3"
FT                   /note="gene_id=mCG142287.0 transcript_id=mCT179802.0
FT                   protein_id=mCP102724.0"
FT                   /protein_id="EDL36915.1"
FT   assembly_gap    7095719..7095738
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7099992..7102252
FT                   /estimated_length=2261
FT                   /gap_type="unknown"
FT   assembly_gap    7104051..7104070
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(7119183..>7134440)
FT                   /gene="Cbll1"
FT                   /locus_tag="mCG_22464"
FT                   /note="gene_id=mCG22464.1"
FT   mRNA            complement(join(7119183..7122671,7124828..7124901,
FT                   7126345..7126428,7126912..7127012,7129412..7129579,
FT                   7134346..>7134440))
FT                   /gene="Cbll1"
FT                   /locus_tag="mCG_22464"
FT                   /product="Casitas B-lineage lymphoma-like 1, transcript
FT                   variant mCT22319"
FT                   /note="gene_id=mCG22464.1 transcript_id=mCT22319.1 created
FT                   on 03-SEP-2002"
FT   mRNA            complement(join(7121258..7122671,7124828..7124901,
FT                   7126345..7126428,7126912..7127009,7129412..7129579,
FT                   7134346..>7134363))
FT                   /gene="Cbll1"
FT                   /locus_tag="mCG_22464"
FT                   /product="Casitas B-lineage lymphoma-like 1, transcript
FT                   variant mCT193455"
FT                   /note="gene_id=mCG22464.1 transcript_id=mCT193455.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(7121636..7122671,7124828..7124901,
FT                   7126345..7126428,7126912..7127012,7129412..7129579,
FT                   7134346..>7134391))
FT                   /codon_start=1
FT                   /gene="Cbll1"
FT                   /locus_tag="mCG_22464"
FT                   /product="Casitas B-lineage lymphoma-like 1, isoform CRA_b"
FT                   /note="gene_id=mCG22464.1 transcript_id=mCT22319.1
FT                   protein_id=mCP11320.1 isoform=CRA_b"
FT                   /protein_id="EDL36914.1"
FT   CDS             complement(join(7121636..7122671,7124828..7124901,
FT                   7126345..7126428,7126912..7127009,7129412..7129579,
FT                   7134346..>7134361))
FT                   /codon_start=1
FT                   /gene="Cbll1"
FT                   /locus_tag="mCG_22464"
FT                   /product="Casitas B-lineage lymphoma-like 1, isoform CRA_a"
FT                   /note="gene_id=mCG22464.1 transcript_id=mCT193455.0
FT                   protein_id=mCP114419.0 isoform=CRA_a"
FT                   /protein_id="EDL36913.1"
FT   assembly_gap    7125531..7125550
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7132314..7132449
FT                   /estimated_length=136
FT                   /gap_type="unknown"
FT   gene            7135325..7135569
FT                   /locus_tag="mCG_1041687"
FT                   /note="gene_id=mCG1041687.1"
FT   mRNA            7135325..7135569
FT                   /locus_tag="mCG_1041687"
FT                   /product="mCG1041687"
FT                   /note="gene_id=mCG1041687.1 transcript_id=mCT159391.1
FT                   created on 26-SEP-2002"
FT   CDS             7135409..7135432
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041687"
FT                   /product="mCG1041687"
FT                   /note="gene_id=mCG1041687.1 transcript_id=mCT159391.1
FT                   protein_id=mCP78429.1"
FT                   /protein_id="EDL36912.1"
FT                   /translation="MSRKEHN"
FT   assembly_gap    7136082..7136101
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7145412..7146432
FT                   /estimated_length=1021
FT                   /gap_type="unknown"
FT   gene            complement(7153914..>7194066)
FT                   /gene="Slc26a4"
FT                   /locus_tag="mCG_128433"
FT                   /note="gene_id=mCG128433.0"
FT   mRNA            complement(join(7153914..7154462,7156537..7156620,
FT                   7159546..7159691,7160698..7160752,7162716..7162946,
FT                   7163556..7163651,7167253..7167322,7169357..7169463,
FT                   7169718..7169813,7169943..7170020,7173299..7173412,
FT                   7174620..7174767,7178344..7178426,7178548..7178700,
FT                   7181220..7181384,7181964..7182148,7184031..7184141,
FT                   7191158..7191297,7193256..7193615,7194047..>7194066))
FT                   /gene="Slc26a4"
FT                   /locus_tag="mCG_128433"
FT                   /product="solute carrier family 26, member 4"
FT                   /note="gene_id=mCG128433.0 transcript_id=mCT129729.1
FT                   created on 03-SEP-2002"
FT   CDS             complement(join(7154439..7154462,7156537..7156620,
FT                   7159546..7159691,7160698..7160752,7162716..7162946,
FT                   7163556..7163651,7167253..7167322,7169357..7169463,
FT                   7169718..7169813,7169943..7170020,7173299..7173412,
FT                   7174620..7174767,7178344..7178426,7178548..7178700,
FT                   7181220..7181384,7181964..7182148,7184031..7184141,
FT                   7191158..7191297,7193256..7193615,7194047..>7194066))
FT                   /codon_start=1
FT                   /gene="Slc26a4"
FT                   /locus_tag="mCG_128433"
FT                   /product="solute carrier family 26, member 4"
FT                   /note="gene_id=mCG128433.0 transcript_id=mCT129729.1
FT                   protein_id=mCP78571.1"
FT                   /protein_id="EDL36911.1"
FT                   DEAMRRLAS"
FT   assembly_gap    7165362..7166029
FT                   /estimated_length=668
FT                   /gap_type="unknown"
FT   assembly_gap    7212886..7212905
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7222008..7222027
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(7230555..>7269321)
FT                   /gene="Bcap29"
FT                   /locus_tag="mCG_22467"
FT                   /note="gene_id=mCG22467.1"
FT   mRNA            complement(join(7230555..7231463,7235730..7235830,
FT                   7252032..7252137,7259051..7259186,7261663..7261813,
FT                   7265730..7265830,7269204..>7269321))
FT                   /gene="Bcap29"
FT                   /locus_tag="mCG_22467"
FT                   /product="B-cell receptor-associated protein 29"
FT                   /note="gene_id=mCG22467.1 transcript_id=mCT22321.1 created
FT                   on 30-AUG-2002"
FT   CDS             complement(join(7231428..7231463,7235730..7235830,
FT                   7252032..7252137,7259051..7259186,7261663..7261813,
FT                   7265730..7265830,7269204..>7269319))
FT                   /codon_start=1
FT                   /gene="Bcap29"
FT                   /locus_tag="mCG_22467"
FT                   /product="B-cell receptor-associated protein 29"
FT                   /note="gene_id=mCG22467.1 transcript_id=mCT22321.1
FT                   protein_id=mCP11315.0"
FT                   /protein_id="EDL36910.1"
FT   assembly_gap    7241193..7241309
FT                   /estimated_length=117
FT                   /gap_type="unknown"
FT   assembly_gap    7263341..7263801
FT                   /estimated_length=461
FT                   /gap_type="unknown"
FT   assembly_gap    7269456..7269475
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(7274877..7289643)
FT                   /gene="Dus4l"
FT                   /locus_tag="mCG_22472"
FT                   /note="gene_id=mCG22472.2"
FT   mRNA            complement(join(7274877..7275766,7276324..7276550,
FT                   7277587..7277709,7281446..7281563,7283587..7283708,
FT                   7287108..7287258,7289505..>7289642))
FT                   /gene="Dus4l"
FT                   /locus_tag="mCG_22472"
FT                   /product="dihydrouridine synthase 4-like (S. cerevisiae),
FT                   transcript variant mCT193467"
FT                   /note="gene_id=mCG22472.2 transcript_id=mCT193467.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(7274878..7275766,7276324..7276550,
FT                   7277587..7277709,7281446..7281563,7283587..7283708,
FT                   7287108..7287258,7289501..7289643))
FT                   /gene="Dus4l"
FT                   /locus_tag="mCG_22472"
FT                   /product="dihydrouridine synthase 4-like (S. cerevisiae),
FT                   transcript variant mCT22326"
FT                   /note="gene_id=mCG22472.2 transcript_id=mCT22326.1 created
FT                   on 07-APR-2003"
FT   CDS             complement(join(7275498..7275766,7276324..7276550,
FT                   7277587..7277709,7281446..7281563,7283587..7283708,
FT                   7287108..>7287232))
FT                   /codon_start=1
FT                   /gene="Dus4l"
FT                   /locus_tag="mCG_22472"
FT                   /product="dihydrouridine synthase 4-like (S. cerevisiae),
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG22472.2 transcript_id=mCT193467.0
FT                   protein_id=mCP114421.0 isoform=CRA_a"
FT                   /protein_id="EDL36908.1"
FT   CDS             complement(join(7275498..7275766,7276324..7276550,
FT                   7277587..7277709,7281446..7281563,7283587..7283708,
FT                   7287108..7287223))
FT                   /codon_start=1
FT                   /gene="Dus4l"
FT                   /locus_tag="mCG_22472"
FT                   /product="dihydrouridine synthase 4-like (S. cerevisiae),
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG22472.2 transcript_id=mCT22326.1
FT                   protein_id=mCP11327.2 isoform=CRA_b"
FT                   /protein_id="EDL36909.1"
FT   gene            <7289683..7577089
FT                   /locus_tag="mCG_22471"
FT                   /note="gene_id=mCG22471.2"
FT   mRNA            join(<7289683..7289798,7295531..7295670,7300294..7300351,
FT                   7304603..7304657,7305149..7305218,7320714..7320834,
FT                   7398012..7398142,7429012..7429177,7440169..7440281,
FT                   7440592..7440669,7458327..7458408,7472710..7472914,
FT                   7476717..7476878,7479278..7479377,7508920..7509030,
FT                   7509573..7509635,7525699..7525802,7533448..7533685,
FT                   7540401..7540477,7559121..7559247,7560022..7560101,
FT                   7565106..7565252,7576636..7577089)
FT                   /locus_tag="mCG_22471"
FT                   /product="mCG22471, transcript variant mCT193466"
FT                   /note="gene_id=mCG22471.2 transcript_id=mCT193466.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<7289684..7289798,7295531..7295670,7300294..7300351,
FT                   7304603..7304657,7305149..7305218,7320714..7320834,
FT                   7398012..7398142,7429012..7429177,7440169..7440281,
FT                   7440592..7440669,7458327..7458408,7472710..7472914,
FT                   7476717..7476878,7479278..7479377,7508920..7509030,
FT                   7509573..7509635,7525699..7525802,7533448..7533685,
FT                   7540401..7540477,7559121..7559247,7560022..7560101,
FT                   7565106..7565220)
FT                   /codon_start=1
FT                   /locus_tag="mCG_22471"
FT                   /product="mCG22471, isoform CRA_a"
FT                   /note="gene_id=mCG22471.2 transcript_id=mCT193466.0
FT                   protein_id=mCP114420.0 isoform=CRA_a"
FT                   /protein_id="EDL36903.1"
FT   mRNA            join(7289698..7289798,7295531..7295670,7300294..7300351,
FT                   7304603..7304657,7305149..7305218,7320714..7320834,
FT                   7398012..7398142,7429012..7429177,7440169..7440281,
FT                   7440592..7440669,7458327..7458408,7472710..7472914,
FT                   7479278..7479377,7508920..7509030,7525699..7525802,
FT                   7533448..7533685,7540401..7540477,7559121..7559247,
FT                   7560022..7560101,7565106..7565252,7576636..7577089)
FT                   /locus_tag="mCG_22471"
FT                   /product="mCG22471, transcript variant mCT22325"
FT                   /note="gene_id=mCG22471.2 transcript_id=mCT22325.1 created
FT                   on 11-SEP-2002"
FT   CDS             join(7289705..7289798,7295531..7295670,7300294..7300351,
FT                   7304603..7304657,7305149..7305218,7320714..7320834,
FT                   7398012..7398142,7429012..7429177,7440169..7440281,
FT                   7440592..7440669,7458327..7458408,7472710..7472914,
FT                   7479278..7479377,7508920..7509030,7525699..7525802,
FT                   7533448..7533685,7540401..7540477,7559121..7559247,
FT                   7560022..7560101,7565106..7565220)
FT                   /codon_start=1
FT                   /locus_tag="mCG_22471"
FT                   /product="mCG22471, isoform CRA_b"
FT                   /note="gene_id=mCG22471.2 transcript_id=mCT22325.1
FT                   protein_id=mCP11332.2 isoform=CRA_b"
FT                   /protein_id="EDL36904.1"
FT                   Q"
FT   assembly_gap    7306210..7306229
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7307246..7307265
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(7341894..7348939)
FT                   /gene="Gpr22"
FT                   /locus_tag="mCG_142736"
FT                   /note="gene_id=mCG142736.0"
FT   mRNA            complement(join(7341894..7345062,7346598..7347588,
FT                   7348527..7348939))
FT                   /gene="Gpr22"
FT                   /locus_tag="mCG_142736"
FT                   /product="G protein-coupled receptor 22"
FT                   /note="gene_id=mCG142736.0 transcript_id=mCT181979.0
FT                   created on 17-APR-2003"
FT   CDS             complement(join(7343739..7345062,7346598..7346683))
FT                   /codon_start=1
FT                   /gene="Gpr22"
FT                   /locus_tag="mCG_142736"
FT                   /product="G protein-coupled receptor 22"
FT                   /note="gene_id=mCG142736.0 transcript_id=mCT181979.0
FT                   protein_id=mCP104901.0"
FT                   /db_xref="GOA:G3X9C3"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:1920260"
FT                   /db_xref="UniProtKB/TrEMBL:G3X9C3"
FT                   /protein_id="EDL36907.1"
FT                   EKCLVPQVVTD"
FT   assembly_gap    7353681..7353700
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7366304..7366323
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7387131..7387150
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7407432..7407451
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7409374..7409393
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7420593..7421456
FT                   /estimated_length=864
FT                   /gap_type="unknown"
FT   assembly_gap    7438428..7438693
FT                   /estimated_length=266
FT                   /gap_type="unknown"
FT   assembly_gap    7453445..7453464
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7464189..7465340
FT                   /estimated_length=1152
FT                   /gap_type="unknown"
FT   gene            complement(<7486044..7489148)
FT                   /locus_tag="mCG_148264"
FT                   /note="gene_id=mCG148264.0"
FT   mRNA            complement(join(<7486044..7488150,7489030..7489148))
FT                   /locus_tag="mCG_148264"
FT                   /product="mCG148264"
FT                   /note="gene_id=mCG148264.0 transcript_id=mCT188527.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(<7486044..7486241)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148264"
FT                   /product="mCG148264"
FT                   /note="gene_id=mCG148264.0 transcript_id=mCT188527.0
FT                   protein_id=mCP108099.0"
FT                   /protein_id="EDL36906.1"
FT   gene            complement(7534103..>7534452)
FT                   /locus_tag="mCG_128325"
FT                   /note="gene_id=mCG128325.0"
FT   mRNA            complement(7534103..>7534452)
FT                   /locus_tag="mCG_128325"
FT                   /product="mCG128325"
FT                   /note="gene_id=mCG128325.0 transcript_id=mCT129619.0
FT                   created on 11-SEP-2002"
FT   CDS             complement(7534136..>7534438)
FT                   /codon_start=1
FT                   /locus_tag="mCG_128325"
FT                   /product="mCG128325"
FT                   /note="gene_id=mCG128325.0 transcript_id=mCT129619.0
FT                   protein_id=mCP78960.0"
FT                   /protein_id="EDL36905.1"
FT   assembly_gap    7540098..7540117
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(7565936..>7589662)
FT                   /gene="Hbp1"
FT                   /locus_tag="mCG_22473"
FT                   /note="gene_id=mCG22473.1"
FT   mRNA            complement(join(7565936..7566968,7568045..7568186,
FT                   7570140..7570463,7572815..7572959,7573743..7573899,
FT                   7576431..7576543,7576629..7576740,7577077..7577218,
FT                   7579737..7579965,7583287..7583470,7589623..>7589662))
FT                   /gene="Hbp1"
FT                   /locus_tag="mCG_22473"
FT                   /product="high mobility group box transcription factor 1,
FT                   transcript variant mCT22327"
FT                   /note="gene_id=mCG22473.1 transcript_id=mCT22327.1 created
FT                   on 11-SEP-2002"
FT   CDS             complement(join(7566951..7566968,7568045..7568186,
FT                   7570140..7570463,7572815..7572959,7573743..7573899,
FT                   7576431..7576543,7576629..7576740,7577077..7577218,
FT                   7579737..7579965,7583287..7583470,7589623..>7589661))
FT                   /codon_start=1
FT                   /gene="Hbp1"
FT                   /locus_tag="mCG_22473"
FT                   /product="high mobility group box transcription factor 1,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG22473.1 transcript_id=mCT22327.1
FT                   protein_id=mCP11343.1 isoform=CRA_b"
FT                   /protein_id="EDL36902.1"
FT                   NPDCWKRKRTNSGSQQH"
FT   mRNA            complement(join(7568841..7570463,7572815..7572959,
FT                   7573743..7573899,7576431..7576543,7576629..7576740,
FT                   7577077..7577218,7579737..7579965,7583287..7583470,
FT                   7589623..>7589650))
FT                   /gene="Hbp1"
FT                   /locus_tag="mCG_22473"
FT                   /product="high mobility group box transcription factor 1,
FT                   transcript variant mCT193470"
FT                   /note="gene_id=mCG22473.1 transcript_id=mCT193470.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(7570136..7570463,7572815..7572959,
FT                   7573743..7573899,7576431..7576543,7576629..7576740,
FT                   7577077..7577218,7579737..7579965,7583287..7583470,
FT                   7589623..>7589649))
FT                   /codon_start=1
FT                   /gene="Hbp1"
FT                   /locus_tag="mCG_22473"
FT                   /product="high mobility group box transcription factor 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG22473.1 transcript_id=mCT193470.0
FT                   protein_id=mCP114422.0 isoform=CRA_a"
FT                   /protein_id="EDL36901.1"
FT   gene            complement(7597879..>7695750)
FT                   /gene="Prkar2b"
FT                   /locus_tag="mCG_22474"
FT                   /note="gene_id=mCG22474.2"
FT   mRNA            complement(join(7597879..7598122,7599783..7599923,
FT                   7602399..7602537,7603288..7603353,7604505..7604579,
FT                   7606603..7606704,7611440..7611593,7615110..7615216,
FT                   7627083..7627166,7632920..7632972,7673152..7673187,
FT                   7695279..>7695737))
FT                   /gene="Prkar2b"
FT                   /locus_tag="mCG_22474"
FT                   /product="protein kinase, cAMP dependent regulatory, type
FT                   II beta, transcript variant mCT22330"
FT                   /note="gene_id=mCG22474.2 transcript_id=mCT22330.2 created
FT                   on 11-SEP-2002"
FT   mRNA            complement(join(7597883..7599923,7602399..7602537,
FT                   7603288..7603353,7604505..7604579,7606603..7606704,
FT                   7611440..7611593,7615110..7615216,7627083..7627166,
FT                   7632920..7632972,7673152..7673187,7694813..>7695087))
FT                   /gene="Prkar2b"
FT                   /locus_tag="mCG_22474"
FT                   /product="protein kinase, cAMP dependent regulatory, type
FT                   II beta, transcript variant mCT193472"
FT                   /note="gene_id=mCG22474.2 transcript_id=mCT193472.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(7599187..7599923,7602399..7602537,
FT                   7603288..7603353,7604505..7604579,7606603..7606704,
FT                   7611440..7611593,7615110..7615216,7627083..7627166,
FT                   7632920..7632972,7673152..7673187,7695279..>7695750))
FT                   /gene="Prkar2b"
FT                   /locus_tag="mCG_22474"
FT                   /product="protein kinase, cAMP dependent regulatory, type
FT                   II beta, transcript variant mCT193473"
FT                   /note="gene_id=mCG22474.2 transcript_id=mCT193473.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(7599790..7599923,7602399..7602537,
FT                   7603288..7603353,7604505..7604579,7606603..7606704,
FT                   7611440..7611593,7615110..7615216,7627083..7627166,
FT                   7632920..7632972,7673152..7673187,7695279..>7695675))
FT                   /codon_start=1
FT                   /gene="Prkar2b"
FT                   /locus_tag="mCG_22474"
FT                   /product="protein kinase, cAMP dependent regulatory, type
FT                   II beta, isoform CRA_b"
FT                   /note="gene_id=mCG22474.2 transcript_id=mCT193473.0
FT                   protein_id=mCP114466.0 isoform=CRA_b"
FT                   /protein_id="EDL36899.1"
FT   CDS             complement(join(7599790..7599923,7602399..7602537,
FT                   7603288..7603353,7604505..7604579,7606603..7606704,
FT                   7611440..7611593,7615110..7615216,7627083..7627166,
FT                   7632920..7632972,7673152..7673187,7695279..>7695675))
FT                   /codon_start=1
FT                   /gene="Prkar2b"
FT                   /locus_tag="mCG_22474"
FT                   /product="protein kinase, cAMP dependent regulatory, type
FT                   II beta, isoform CRA_b"
FT                   /note="gene_id=mCG22474.2 transcript_id=mCT22330.2
FT                   protein_id=mCP11335.2 isoform=CRA_b"
FT                   /protein_id="EDL36900.1"
FT   CDS             complement(join(7599790..7599923,7602399..7602537,
FT                   7603288..7603353,7604505..7604579,7606603..7606704,
FT                   7611440..7611593,7615110..7615216,7627083..7627166,
FT                   7632920..7632972,7673152..7673187,7694813..>7694813))
FT                   /codon_start=1
FT                   /gene="Prkar2b"
FT                   /locus_tag="mCG_22474"
FT                   /product="protein kinase, cAMP dependent regulatory, type
FT                   II beta, isoform CRA_a"
FT                   /note="gene_id=mCG22474.2 transcript_id=mCT193472.0
FT                   protein_id=mCP114465.0 isoform=CRA_a"
FT                   /protein_id="EDL36898.1"
FT   assembly_gap    7602641..7602660
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7613624..7613881
FT                   /estimated_length=258
FT                   /gap_type="unknown"
FT   assembly_gap    7647999..7648072
FT                   /estimated_length=74
FT                   /gap_type="unknown"
FT   assembly_gap    7745631..7745809
FT                   /estimated_length=179
FT                   /gap_type="unknown"
FT   gene            complement(7748086..7758120)
FT                   /locus_tag="mCG_148260"
FT                   /note="gene_id=mCG148260.0"
FT   mRNA            complement(join(7748086..7750624,7758039..7758120))
FT                   /locus_tag="mCG_148260"
FT                   /product="mCG148260"
FT                   /note="gene_id=mCG148260.0 transcript_id=mCT188523.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(7748609..7748788)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148260"
FT                   /product="mCG148260"
FT                   /note="gene_id=mCG148260.0 transcript_id=mCT188523.0
FT                   protein_id=mCP108095.0"
FT                   /protein_id="EDL36897.1"
FT                   RGGGERKIRGGLRA"
FT   assembly_gap    7766130..7766339
FT                   /estimated_length=210
FT                   /gap_type="unknown"
FT   assembly_gap    7771127..7771294
FT                   /estimated_length=168
FT                   /gap_type="unknown"
FT   assembly_gap    7775687..7775706
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7800801..7801500
FT                   /estimated_length=700
FT                   /gap_type="unknown"
FT   assembly_gap    7802565..7802927
FT                   /estimated_length=363
FT                   /gap_type="unknown"
FT   gene            complement(7812275..7850730)
FT                   /gene="Pik3cg"
FT                   /locus_tag="mCG_5362"
FT                   /note="gene_id=mCG5362.2"
FT   mRNA            complement(join(7812275..7812771,7814491..7815662,
FT                   7833682..7833839,7835719..7835830,7836814..7836944,
FT                   7837739..7837829,7839305..7839451,7841208..7841311,
FT                   7842620..7842845,7842955..7843020,7846112..7848118,
FT                   7850637..7850730))
FT                   /gene="Pik3cg"
FT                   /locus_tag="mCG_5362"
FT                   /product="phosphoinositide-3-kinase, catalytic, gamma
FT                   polypeptide, transcript variant mCT4753"
FT                   /note="gene_id=mCG5362.2 transcript_id=mCT4753.2 created on
FT                   28-MAY-2003"
FT   mRNA            complement(join(7814441..7815662,7833682..7833839,
FT                   7835719..7835830,7836814..7836944,7837739..7837829,
FT                   7839305..7839451,7841208..7841311,7842620..7842845,
FT                   7842955..7843020,7846112..7848118,7850281..>7850329))
FT                   /gene="Pik3cg"
FT                   /locus_tag="mCG_5362"
FT                   /product="phosphoinositide-3-kinase, catalytic, gamma
FT                   polypeptide, transcript variant mCT193448"
FT                   /note="gene_id=mCG5362.2 transcript_id=mCT193448.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(7814442..7814929,7829686..7829843,
FT                   7831543..7831654,7836814..7836944,7837739..7837829,
FT                   7839305..7839451,7841208..7841311,7842620..7842845,
FT                   7842955..7843020,7846112..7848118,7850281..7850589))
FT                   /gene="Pik3cg"
FT                   /locus_tag="mCG_5362"
FT                   /product="phosphoinositide-3-kinase, catalytic, gamma
FT                   polypeptide, transcript variant mCT182226"
FT                   /note="gene_id=mCG5362.2 transcript_id=mCT182226.0 created
FT                   on 28-MAY-2003"
FT   CDS             complement(join(7814876..7814929,7829686..7829843,
FT                   7831543..7831654,7836814..7836944,7837739..7837829,
FT                   7839305..7839451,7841208..7841311,7842620..7842845,
FT                   7842955..7843020,7846112..7848106))
FT                   /codon_start=1
FT                   /gene="Pik3cg"
FT                   /locus_tag="mCG_5362"
FT                   /product="phosphoinositide-3-kinase, catalytic, gamma
FT                   polypeptide, isoform CRA_c"
FT                   /note="gene_id=mCG5362.2 transcript_id=mCT182226.0
FT                   protein_id=mCP105122.0 isoform=CRA_c"
FT                   /protein_id="EDL36895.1"
FT   CDS             complement(join(7815384..7815662,7833682..7833839,
FT                   7835719..7835830,7836814..7836944,7837739..7837829,
FT                   7839305..7839451,7841208..7841311,7842620..7842845,
FT                   7842955..7843020,7846112..>7848109))
FT                   /codon_start=1
FT                   /gene="Pik3cg"
FT                   /locus_tag="mCG_5362"
FT                   /product="phosphoinositide-3-kinase, catalytic, gamma
FT                   polypeptide, isoform CRA_b"
FT                   /note="gene_id=mCG5362.2 transcript_id=mCT193448.0
FT                   protein_id=mCP114426.0 isoform=CRA_b"
FT                   /protein_id="EDL36894.1"
FT   mRNA            complement(join(7815384..7815662,7824240..7824270,
FT                   7833682..7833839,7835719..7835830,7836814..7836944,
FT                   7837739..7837829,7839305..7839451,7841208..7841311,
FT                   7842620..7842845,7842955..7843020,7846112..>7848106))
FT                   /gene="Pik3cg"
FT                   /locus_tag="mCG_5362"
FT                   /product="phosphoinositide-3-kinase, catalytic, gamma
FT                   polypeptide, transcript variant mCT182225"
FT                   /note="gene_id=mCG5362.2 transcript_id=mCT182225.0 created
FT                   on 28-MAY-2003"
FT   CDS             complement(join(7815384..7815662,7833682..7833839,
FT                   7835719..7835830,7836814..7836944,7837739..7837829,
FT                   7839305..7839451,7841208..7841311,7842620..7842845,
FT                   7842955..7843020,7846112..7848106))
FT                   /codon_start=1
FT                   /gene="Pik3cg"
FT                   /locus_tag="mCG_5362"
FT                   /product="phosphoinositide-3-kinase, catalytic, gamma
FT                   polypeptide, isoform CRA_d"
FT                   /note="gene_id=mCG5362.2 transcript_id=mCT4753.2
FT                   protein_id=mCP11339.2 isoform=CRA_d"
FT                   /protein_id="EDL36896.1"
FT   CDS             complement(join(7815649..7815662,7824240..7824270,
FT                   7833682..7833839,7835719..7835830,7836814..7836944,
FT                   7837739..7837829,7839305..7839451,7841208..7841311,
FT                   7842620..7842845,7842955..7843020,7846112..7848106))
FT                   /codon_start=1
FT                   /gene="Pik3cg"
FT                   /locus_tag="mCG_5362"
FT                   /product="phosphoinositide-3-kinase, catalytic, gamma
FT                   polypeptide, isoform CRA_a"
FT                   /note="gene_id=mCG5362.2 transcript_id=mCT182225.0
FT                   protein_id=mCP105121.0 isoform=CRA_a"
FT                   /protein_id="EDL36893.1"
FT   assembly_gap    7829085..7829104
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7830449..7830468
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7831666..7831685
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7835401..7835420
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7864114..7864133
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7888535..7889058
FT                   /estimated_length=524
FT                   /gap_type="unknown"
FT   assembly_gap    7892861..7892880
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7903128..7903147
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7918373..7918409
FT                   /estimated_length=37
FT                   /gap_type="unknown"
FT   assembly_gap    7923569..7923911
FT                   /estimated_length=343
FT                   /gap_type="unknown"
FT   assembly_gap    7930625..7930753
FT                   /estimated_length=129
FT                   /gap_type="unknown"
FT   assembly_gap    7933212..7933231
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7933727..7933773
FT                   /estimated_length=47
FT                   /gap_type="unknown"
FT   assembly_gap    7982112..7982363
FT                   /estimated_length=252
FT                   /gap_type="unknown"
FT   assembly_gap    8006947..8006966
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8015729..8015748
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <8022286..8026090
FT                   /locus_tag="mCG_142431"
FT                   /note="gene_id=mCG142431.1"
FT   mRNA            join(<8022286..8022388,8022576..8026090)
FT                   /locus_tag="mCG_142431"
FT                   /product="mCG142431"
FT                   /note="gene_id=mCG142431.1 transcript_id=mCT180469.1
FT                   created on 10-JUN-2003"
FT   CDS             <8022792..8023295
FT                   /codon_start=1
FT                   /locus_tag="mCG_142431"
FT                   /product="mCG142431"
FT                   /note="gene_id=mCG142431.1 transcript_id=mCT180469.1
FT                   protein_id=mCP103391.1"
FT                   /protein_id="EDL36892.1"
FT                   LRVF"
FT   assembly_gap    8038856..8038875
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8040583..8040707
FT                   /estimated_length=125
FT                   /gap_type="unknown"
FT   assembly_gap    8049644..8050205
FT                   /estimated_length=562
FT                   /gap_type="unknown"
FT   assembly_gap    8052153..8052172
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8054813..8054832
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8058587..8058606
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(8070316..8072518)
FT                   /locus_tag="mCG_1041686"
FT                   /note="gene_id=mCG1041686.1"
FT   mRNA            complement(8070316..8072518)
FT                   /locus_tag="mCG_1041686"
FT                   /product="mCG1041686"
FT                   /note="gene_id=mCG1041686.1 transcript_id=mCT159390.1
FT                   created on 26-SEP-2002"
FT   CDS             complement(8070392..8070544)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041686"
FT                   /product="mCG1041686"
FT                   /note="gene_id=mCG1041686.1 transcript_id=mCT159390.1
FT                   protein_id=mCP78422.1"
FT                   /protein_id="EDL36891.1"
FT                   VSPST"
FT   assembly_gap    8092823..8092842
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8146716..8146969
FT                   /estimated_length=254
FT                   /gap_type="unknown"
FT   assembly_gap    8154104..8154129
FT                   /estimated_length=26
FT                   /gap_type="unknown"
FT   assembly_gap    8177632..8177651
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8196842..8196861
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8219974..8220272
FT                   /estimated_length=299
FT                   /gap_type="unknown"
FT   assembly_gap    8227836..8229103
FT                   /estimated_length=1268
FT                   /gap_type="unknown"
FT   assembly_gap    8255067..8255379
FT                   /estimated_length=313
FT                   /gap_type="unknown"
FT   assembly_gap    8296561..8296727
FT                   /estimated_length=167
FT                   /gap_type="unknown"
FT   assembly_gap    8303966..8303985
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8308049..8308244
FT                   /estimated_length=196
FT                   /gap_type="unknown"
FT   assembly_gap    8320498..8320517
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            8341468..8345131
FT                   /pseudo
FT                   /locus_tag="mCG_127170"
FT                   /note="gene_id=mCG127170.0"
FT   mRNA            join(8341468..8341634,8341685..8342213,8343130..8343312,
FT                   8343336..8345131)
FT                   /pseudo
FT                   /locus_tag="mCG_127170"
FT                   /note="gene_id=mCG127170.0 transcript_id=mCT128451.0
FT                   created on 10-SEP-2002"
FT   assembly_gap    8352201..8353223
FT                   /estimated_length=1023
FT                   /gap_type="unknown"
FT   assembly_gap    8354573..8355168
FT                   /estimated_length=596
FT                   /gap_type="unknown"
FT   gene            complement(8382346..8402043)
FT                   /locus_tag="mCG_148266"
FT                   /note="gene_id=mCG148266.0"
FT   mRNA            complement(join(8382346..8384255,8401804..8402043))
FT                   /locus_tag="mCG_148266"
FT                   /product="mCG148266"
FT                   /note="gene_id=mCG148266.0 transcript_id=mCT188529.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(8382643..8382861)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148266"
FT                   /product="mCG148266"
FT                   /note="gene_id=mCG148266.0 transcript_id=mCT188529.0
FT                   protein_id=mCP108101.0"
FT                   /protein_id="EDL36890.1"
FT   assembly_gap    8392767..8392864
FT                   /estimated_length=98
FT                   /gap_type="unknown"
FT   assembly_gap    8406592..8406611
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8432353..8432395
FT                   /estimated_length=43
FT                   /gap_type="unknown"
FT   assembly_gap    8442455..8442496
FT                   /estimated_length=42
FT                   /gap_type="unknown"
FT   assembly_gap    8448591..8448650
FT                   /estimated_length=60
FT                   /gap_type="unknown"
FT   gene            <8450010..8481285
FT                   /gene="Pbef1"
FT                   /locus_tag="mCG_5364"
FT                   /note="gene_id=mCG5364.1"
FT   mRNA            join(<8450010..8450161,8459702..8459858,8462567..8462670,
FT                   8464436..8464564,8467952..8468110,8468804..8468940,
FT                   8470578..8470803,8472363..8472482,8476384..8476524,
FT                   8478295..8478429,8480101..8481285)
FT                   /gene="Pbef1"
FT                   /locus_tag="mCG_5364"
FT                   /product="pre-B-cell colony-enhancing factor 1"
FT                   /note="gene_id=mCG5364.1 transcript_id=mCT4756.1 created on
FT                   30-AUG-2002"
FT   CDS             join(<8450018..8450161,8459702..8459858,8462567..8462670,
FT                   8464436..8464564,8467952..8468110,8468804..8468940,
FT                   8470578..8470803,8472363..8472482,8476384..8476524,
FT                   8478295..8478429,8480101..8480211)
FT                   /codon_start=1
FT                   /gene="Pbef1"
FT                   /locus_tag="mCG_5364"
FT                   /product="pre-B-cell colony-enhancing factor 1"
FT                   /note="gene_id=mCG5364.1 transcript_id=mCT4756.1
FT                   protein_id=mCP11308.1"
FT                   /protein_id="EDL36889.1"
FT                   APH"
FT   gene            8451409..8455518
FT                   /pseudo
FT                   /locus_tag="mCG_142302"
FT                   /note="gene_id=mCG142302.0"
FT   mRNA            8451409..8455518
FT                   /pseudo
FT                   /locus_tag="mCG_142302"
FT                   /note="gene_id=mCG142302.0 transcript_id=mCT179818.0
FT                   created on 07-FEB-2003"
FT   assembly_gap    8465409..8465526
FT                   /estimated_length=118
FT                   /gap_type="unknown"
FT   assembly_gap    8494754..8494773
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8500092..8500111
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8504071..8504192
FT                   /estimated_length=122
FT                   /gap_type="unknown"
FT   gene            <8526591..8536495
FT                   /locus_tag="mCG_145559"
FT                   /note="gene_id=mCG145559.0"
FT   mRNA            join(<8526591..8527006,8527855..8527969,8532703..8536495)
FT                   /locus_tag="mCG_145559"
FT                   /product="mCG145559"
FT                   /note="gene_id=mCG145559.0 transcript_id=mCT184983.0
FT                   created on 05-JUN-2003"
FT   CDS             <8533769..8535196
FT                   /codon_start=1
FT                   /locus_tag="mCG_145559"
FT                   /product="mCG145559"
FT                   /note="gene_id=mCG145559.0 transcript_id=mCT184983.0
FT                   protein_id=mCP105143.0"
FT                   /protein_id="EDL36888.1"
FT                   AALGDNVDISTPNDGDV"
FT   assembly_gap    8545678..8545731
FT                   /estimated_length=54
FT                   /gap_type="unknown"
FT   assembly_gap    8549056..8549078
FT                   /estimated_length=23
FT                   /gap_type="unknown"
FT   gene            complement(8549319..8584777)
FT                   /locus_tag="mCG_54161"
FT                   /note="gene_id=mCG54161.2"
FT   mRNA            complement(join(8549319..8550115,8550430..8550663,
FT                   8550758..8550838,8555408..8555469,8584188..8584361,
FT                   8584491..8584777))
FT                   /locus_tag="mCG_54161"
FT                   /product="mCG54161, transcript variant mCT54344"
FT                   /note="gene_id=mCG54161.2 transcript_id=mCT54344.3 created
FT                   on 13-JUN-2003"
FT   CDS             complement(join(8550079..8550115,8550430..8550635))
FT                   /codon_start=1
FT                   /locus_tag="mCG_54161"
FT                   /product="mCG54161, isoform CRA_b"
FT                   /note="gene_id=mCG54161.2 transcript_id=mCT54344.3
FT                   protein_id=mCP33129.3 isoform=CRA_b"
FT                   /protein_id="EDL36887.1"
FT   mRNA            complement(join(8554891..8555469,8555566..8555689,
FT                   8556810..8556921,8563024..8563090,8573357..8573472,
FT                   8584188..8584361,8584491..8584770))
FT                   /locus_tag="mCG_54161"
FT                   /product="mCG54161, transcript variant mCT173191"
FT                   /note="gene_id=mCG54161.2 transcript_id=mCT173191.1 created
FT                   on 13-JUN-2003"
FT   assembly_gap    8560947..8560966
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(8570160..8610480)
FT                   /locus_tag="mCG_148256"
FT                   /note="gene_id=mCG148256.0"
FT   mRNA            complement(join(8570160..8570189,8608375..8610480))
FT                   /locus_tag="mCG_148256"
FT                   /product="mCG148256"
FT                   /note="gene_id=mCG148256.0 transcript_id=mCT188519.0
FT                   created on 13-JAN-2004"
FT   assembly_gap    8582708..8582727
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             complement(join(8584247..8584361,8584491..8584579))
FT                   /codon_start=1
FT                   /locus_tag="mCG_54161"
FT                   /product="mCG54161, isoform CRA_a"
FT                   /note="gene_id=mCG54161.2 transcript_id=mCT173191.1
FT                   protein_id=mCP96110.0 isoform=CRA_a"
FT                   /protein_id="EDL36886.1"
FT   gene            <8584954..8607908
FT                   /gene="Sypl"
FT                   /locus_tag="mCG_5358"
FT                   /note="gene_id=mCG5358.3"
FT   mRNA            join(<8584954..8585004,8585274..8585345,8596362..8596489,
FT                   8598534..8598741,8605131..8605322,8606594..>8606728)
FT                   /gene="Sypl"
FT                   /locus_tag="mCG_5358"
FT                   /product="synaptophysin-like protein, transcript variant
FT                   mCT4754"
FT                   /note="gene_id=mCG5358.3 transcript_id=mCT4754.0 created on
FT                   30-AUG-2002"
FT   CDS             join(8584954..8585004,8585274..8585345,8596362..8596489,
FT                   8598534..8598741,8605131..8605322,8606594..8606728)
FT                   /codon_start=1
FT                   /gene="Sypl"
FT                   /locus_tag="mCG_5358"
FT                   /product="synaptophysin-like protein, isoform CRA_c"
FT                   /note="gene_id=mCG5358.3 transcript_id=mCT4754.0
FT                   protein_id=mCP11314.0 isoform=CRA_c"
FT                   /protein_id="EDL36885.1"
FT   mRNA            join(<8585215..8585345,8596362..8596489,8598534..8598741,
FT                   8605131..8605322,8606594..8607908)
FT                   /gene="Sypl"
FT                   /locus_tag="mCG_5358"
FT                   /product="synaptophysin-like protein, transcript variant
FT                   mCT193431"
FT                   /note="gene_id=mCG5358.3 transcript_id=mCT193431.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<8585217..8585345,8596362..8596489,8598534..8598741,
FT                   8605131..8605322,8606594..8606728)
FT                   /codon_start=1
FT                   /gene="Sypl"
FT                   /locus_tag="mCG_5358"
FT                   /product="synaptophysin-like protein, isoform CRA_b"
FT                   /note="gene_id=mCG5358.3 transcript_id=mCT193431.0
FT                   protein_id=mCP114425.0 isoform=CRA_b"
FT                   /protein_id="EDL36884.1"
FT   mRNA            join(<8585545..8585968,8596362..8596489,8598534..8598741,
FT                   8605131..8605322,8606734..8607509)
FT                   /gene="Sypl"
FT                   /locus_tag="mCG_5358"
FT                   /product="synaptophysin-like protein, transcript variant
FT                   mCT172866"
FT                   /note="gene_id=mCG5358.3 transcript_id=mCT172866.0 created
FT                   on 30-AUG-2002"
FT   CDS             join(<8585960..8585968,8596362..8596489,8598534..8598741,
FT                   8605131..8605322,8606734..8606820)
FT                   /codon_start=1
FT                   /gene="Sypl"
FT                   /locus_tag="mCG_5358"
FT                   /product="synaptophysin-like protein, isoform CRA_a"
FT                   /note="gene_id=mCG5358.3 transcript_id=mCT172866.0
FT                   protein_id=mCP95785.0 isoform=CRA_a"
FT                   /protein_id="EDL36883.1"
FT   CDS             complement(8608384..8608539)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148256"
FT                   /product="mCG148256"
FT                   /note="gene_id=mCG148256.0 transcript_id=mCT188519.0
FT                   protein_id=mCP108091.0"
FT                   /protein_id="EDL36882.1"
FT                   RKRWYM"
FT   assembly_gap    8624539..8625044
FT                   /estimated_length=506
FT                   /gap_type="unknown"
FT   assembly_gap    8626188..8626207
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8627213..8627232
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8628383..8628402
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8631633..8633171
FT                   /estimated_length=1539
FT                   /gap_type="unknown"
FT   gene            complement(8684767..8716188)
FT                   /gene="1110049B09Rik"
FT                   /locus_tag="mCG_5360"
FT                   /note="gene_id=mCG5360.2"
FT   mRNA            complement(join(8684767..8685063,8686140..8686242,
FT                   8687422..8687593,8694214..8694403,8695502..8695650,
FT                   8701023..8701127,8701865..8701959,8714137..8714234,
FT                   8716023..8716188))
FT                   /gene="1110049B09Rik"
FT                   /locus_tag="mCG_5360"
FT                   /product="RIKEN cDNA 1110049B09"
FT                   /note="gene_id=mCG5360.2 transcript_id=mCT4751.2 created on
FT                   11-SEP-2002"
FT   CDS             complement(join(8684924..8685063,8686140..8686242,
FT                   8687422..8687593,8694214..8694403,8695502..8695650,
FT                   8701023..8701127,8701865..8701926))
FT                   /codon_start=1
FT                   /gene="1110049B09Rik"
FT                   /locus_tag="mCG_5360"
FT                   /product="RIKEN cDNA 1110049B09"
FT                   /note="gene_id=mCG5360.2 transcript_id=mCT4751.2
FT                   protein_id=mCP11330.2"
FT                   /protein_id="EDL36881.1"
FT   assembly_gap    8685387..8685406
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8691143..8691233
FT                   /estimated_length=91
FT                   /gap_type="unknown"
FT   assembly_gap    8694817..8694952
FT                   /estimated_length=136
FT                   /gap_type="unknown"
FT   assembly_gap    8696141..8696334
FT                   /estimated_length=194
FT                   /gap_type="unknown"
FT   assembly_gap    8700089..8700108
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8716969..8717229
FT                   /estimated_length=261
FT                   /gap_type="unknown"
FT   assembly_gap    8718489..8718710
FT                   /estimated_length=222
FT                   /gap_type="unknown"
FT   assembly_gap    8720016..8720035
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8748585..8748662
FT                   /estimated_length=78
FT                   /gap_type="unknown"
FT   assembly_gap    8764119..8765093
FT                   /estimated_length=975
FT                   /gap_type="unknown"
FT   assembly_gap    8768324..8768343
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(8769538..8782109)
FT                   /locus_tag="mCG_148244"
FT                   /note="gene_id=mCG148244.0"
FT   mRNA            complement(join(8769538..8770255,8775536..8775696,
FT                   8777222..8777319,8781715..8781767,8781863..8782109))
FT                   /locus_tag="mCG_148244"
FT                   /product="mCG148244"
FT                   /note="gene_id=mCG148244.0 transcript_id=mCT188507.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(join(8770078..8770255,8775536..8775555))
FT                   /codon_start=1
FT                   /locus_tag="mCG_148244"
FT                   /product="mCG148244"
FT                   /note="gene_id=mCG148244.0 transcript_id=mCT188507.0
FT                   protein_id=mCP108077.0"
FT                   /protein_id="EDL36880.1"
FT   assembly_gap    8770522..8774812
FT                   /estimated_length=4291
FT                   /gap_type="unknown"
FT   assembly_gap    8782110..8782129
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            8782313..>8997308
FT                   /locus_tag="mCG_142289"
FT                   /note="gene_id=mCG142289.0"
FT   mRNA            join(8782313..8782455,8782973..8783041,8852110..8852214,
FT                   8955319..8955541,8971391..8971644,8974339..8974421,
FT                   8975287..8975537,8988107..8988299,8992424..8992545,
FT                   8996423..>8997308)
FT                   /locus_tag="mCG_142289"
FT                   /product="mCG142289, transcript variant mCT179805"
FT                   /note="gene_id=mCG142289.0 transcript_id=mCT179805.0
FT                   created on 15-JUL-2003"
FT   mRNA            join(8782319..8782455,8782973..8783041,8852110..8852214,
FT                   8878904..8879147,8879667..8880562)
FT                   /locus_tag="mCG_142289"
FT                   /product="mCG142289, transcript variant mCT179804"
FT                   /note="gene_id=mCG142289.0 transcript_id=mCT179804.0
FT                   created on 15-JUL-2003"
FT   CDS             join(8782359..8782455,8782973..8783041,8852110..8852214,
FT                   8878904..8878989)
FT                   /codon_start=1
FT                   /locus_tag="mCG_142289"
FT                   /product="mCG142289, isoform CRA_a"
FT                   /note="gene_id=mCG142289.0 transcript_id=mCT179804.0
FT                   protein_id=mCP102726.0 isoform=CRA_a"
FT                   /protein_id="EDL36878.1"
FT                   SGAESRQALEQRQV"
FT   assembly_gap    8795794..8795857
FT                   /estimated_length=64
FT                   /gap_type="unknown"
FT   assembly_gap    8835667..8835686
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8837601..8837620
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8853729..8853748
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8854862..8854881
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8859229..8859248
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8861897..8862289
FT                   /estimated_length=393
FT                   /gap_type="unknown"
FT   assembly_gap    8879148..8879666
FT                   /estimated_length=519
FT                   /gap_type="unknown"
FT   assembly_gap    8880696..8880926
FT                   /estimated_length=231
FT                   /gap_type="unknown"
FT   assembly_gap    8890360..8890379
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8896909..8897015
FT                   /estimated_length=107
FT                   /gap_type="unknown"
FT   assembly_gap    8904639..8904658
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8907507..8907699
FT                   /estimated_length=193
FT                   /gap_type="unknown"
FT   assembly_gap    8910708..8910831
FT                   /estimated_length=124
FT                   /gap_type="unknown"
FT   assembly_gap    8912058..8913384
FT                   /estimated_length=1327
FT                   /gap_type="unknown"
FT   assembly_gap    8931374..8931393
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8935599..8935719
FT                   /estimated_length=121
FT                   /gap_type="unknown"
FT   assembly_gap    8939766..8940424
FT                   /estimated_length=659
FT                   /gap_type="unknown"
FT   gene            <8944848..>9002354
FT                   /locus_tag="mCG_127168"
FT                   /note="gene_id=mCG127168.2"
FT   mRNA            join(<8944848..8944912,8955319..8955541,8971370..8971644,
FT                   8974339..8974421,8975287..8975537,8988107..8988299,
FT                   8992424..8992545,8996423..8997365,9000434..9001808)
FT                   /locus_tag="mCG_127168"
FT                   /product="mCG127168, transcript variant mCT193460"
FT                   /note="gene_id=mCG127168.2 transcript_id=mCT193460.0
FT                   created on 09-MAR-2004"
FT   CDS             join(<8944882..8944912,8955319..8955541,8971370..8971644,
FT                   8974339..8974421,8975287..8975537,8988107..8988299,
FT                   8992424..8992545,8996423..8997365,9000434..9000586)
FT                   /codon_start=1
FT                   /locus_tag="mCG_127168"
FT                   /product="mCG127168, isoform CRA_a"
FT                   /note="gene_id=mCG127168.2 transcript_id=mCT193460.0
FT                   protein_id=mCP114403.0 isoform=CRA_a"
FT                   /protein_id="EDL36876.1"
FT                   RVRP"
FT   mRNA            join(8944891..8944912,8955319..8955541,8971370..8971644,
FT                   8974339..8974421,8975287..8975537,8988107..8988299,
FT                   8992424..8992545,8996423..8997365,9000434..9000508,
FT                   9002316..>9002354)
FT                   /locus_tag="mCG_127168"
FT                   /product="mCG127168, transcript variant mCT128449"
FT                   /note="gene_id=mCG127168.2 transcript_id=mCT128449.1
FT                   created on 11-SEP-2002"
FT   CDS             join(8955336..8955541,8971370..8971644,8974339..8974421,
FT                   8975287..8975537,8988107..8988299,8992424..8992545,
FT                   8996423..8997365,9000434..9000508,9002316..>9002354)
FT                   /codon_start=1
FT                   /locus_tag="mCG_127168"
FT                   /product="mCG127168, isoform CRA_b"
FT                   /note="gene_id=mCG127168.2 transcript_id=mCT128449.1
FT                   protein_id=mCP78618.1 isoform=CRA_b"
FT                   /protein_id="EDL36877.1"
FT   CDS             join(8955336..8955541,8971391..8971644,8974339..8974421,
FT                   8975287..8975537,8988107..8988299,8992424..8992545,
FT                   8996423..>8997308)
FT                   /codon_start=1
FT                   /locus_tag="mCG_142289"
FT                   /product="mCG142289, isoform CRA_b"
FT                   /note="gene_id=mCG142289.0 transcript_id=mCT179805.0
FT                   protein_id=mCP102727.0 isoform=CRA_b"
FT                   /protein_id="EDL36879.1"
FT   assembly_gap    8968846..8968872
FT                   /estimated_length=27
FT                   /gap_type="unknown"
FT   gene            complement(8987694..>9024249)
FT                   /locus_tag="mCG_146095"
FT                   /note="gene_id=mCG146095.0"
FT   mRNA            complement(join(8987694..8989491,8995716..8995774,
FT                   9013257..9013354,9024185..>9024249))
FT                   /locus_tag="mCG_146095"
FT                   /product="mCG146095"
FT                   /note="gene_id=mCG146095.0 transcript_id=mCT186198.0
FT                   created on 14-JUL-2003"
FT   CDS             complement(8988103..>8988459)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146095"
FT                   /product="mCG146095"
FT                   /note="gene_id=mCG146095.0 transcript_id=mCT186198.0
FT                   protein_id=mCP107274.0"
FT                   /protein_id="EDL36875.1"
FT                   LKKYCCLCCLQTMV"
FT   assembly_gap    9014984..9015015
FT                   /estimated_length=32
FT                   /gap_type="unknown"
FT   gene            9024341..9030863
FT                   /locus_tag="mCG_12459"
FT                   /note="gene_id=mCG12459.1"
FT   mRNA            join(9024341..9024686,9027775..9027939,9028044..9028131,
FT                   9030786..9030863)
FT                   /locus_tag="mCG_12459"
FT                   /product="mCG12459"
FT                   /note="gene_id=mCG12459.1 transcript_id=mCT13176.1 created
FT                   on 11-SEP-2002"
FT   CDS             join(9024578..9024686,9027775..9027939,9028044..9028131,
FT                   9030786..9030822)
FT                   /codon_start=1
FT                   /locus_tag="mCG_12459"
FT                   /product="mCG12459"
FT                   /note="gene_id=mCG12459.1 transcript_id=mCT13176.1
FT                   protein_id=mCP11349.1"
FT                   /protein_id="EDL36874.1"
FT   assembly_gap    9028257..9028856
FT                   /estimated_length=600
FT                   /gap_type="unknown"
FT   assembly_gap    9030094..9030319
FT                   /estimated_length=226
FT                   /gap_type="unknown"
FT   assembly_gap    9038956..9039260
FT                   /estimated_length=305
FT                   /gap_type="unknown"
FT   gene            9059011..9070032
FT                   /gene="Twistnb"
FT                   /locus_tag="mCG_12460"
FT                   /note="gene_id=mCG12460.1"
FT   mRNA            join(9059011..9059374,9062977..9063118,9066408..9066616,
FT                   9067165..9070032)
FT                   /gene="Twistnb"
FT                   /locus_tag="mCG_12460"
FT                   /product="TWIST neighbor"
FT                   /note="gene_id=mCG12460.1 transcript_id=mCT13177.1 created
FT                   on 11-SEP-2002"
FT   CDS             join(9059121..9059374,9062977..9063118,9066408..9066616,
FT                   9067165..9067552)
FT                   /codon_start=1
FT                   /gene="Twistnb"
FT                   /locus_tag="mCG_12460"
FT                   /product="TWIST neighbor"
FT                   /note="gene_id=mCG12460.1 transcript_id=mCT13177.1
FT                   protein_id=mCP11348.1"
FT                   /db_xref="GOA:B2RT77"
FT                   /db_xref="InterPro:IPR005576"
FT                   /db_xref="InterPro:IPR036898"
FT                   /db_xref="MGI:MGI:106292"
FT                   /db_xref="UniProtKB/TrEMBL:B2RT77"
FT                   /protein_id="EDL36873.1"
FT   assembly_gap    9080250..9080269
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9091964..9102990
FT                   /estimated_length=11027
FT                   /gap_type="unknown"
FT   assembly_gap    9106230..9106332
FT                   /estimated_length=103
FT                   /gap_type="unknown"
FT   gene            complement(9107786..9108861)
FT                   /pseudo
FT                   /locus_tag="mCG_1041682"
FT                   /note="gene_id=mCG1041682.1"
FT   mRNA            complement(9107786..9108861)
FT                   /pseudo
FT                   /locus_tag="mCG_1041682"
FT                   /note="gene_id=mCG1041682.1 transcript_id=mCT159386.1
FT                   created on 26-SEP-2002"
FT   assembly_gap    9115199..9117234
FT                   /estimated_length=2036
FT                   /gap_type="unknown"
FT   assembly_gap    9122521..9122635
FT                   /estimated_length=115
FT                   /gap_type="unknown"
FT   assembly_gap    9125217..9125379
FT                   /estimated_length=163
FT                   /gap_type="unknown"
FT   assembly_gap    9133845..9133927
FT                   /estimated_length=83
FT                   /gap_type="unknown"
FT   assembly_gap    9135367..9135386
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9169643..9169662
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9208236..9208263
FT                   /estimated_length=28
FT                   /gap_type="unknown"
FT   assembly_gap    9225765..9226338
FT                   /estimated_length=574
FT                   /gap_type="unknown"
FT   assembly_gap    9277106..9277125
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9292117..9292136
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9293514..9293533
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9294846..9294865
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9295966..9295985
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9322395..9322414
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9327015..9327138
FT                   /estimated_length=124
FT                   /gap_type="unknown"
FT   assembly_gap    9332738..9332757
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9336576..9336595
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9353953..9354069
FT                   /estimated_length=117
FT                   /gap_type="unknown"
FT   assembly_gap    9357723..9357742
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9364630..9364649
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9379871..9384405
FT                   /estimated_length=4535
FT                   /gap_type="unknown"
FT   assembly_gap    9385238..9385535
FT                   /estimated_length=298
FT                   /gap_type="unknown"
FT   assembly_gap    9420531..9420592
FT                   /estimated_length=62
FT                   /gap_type="unknown"
FT   assembly_gap    9443640..9443659
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9454402..9456492
FT                   /estimated_length=2091
FT                   /gap_type="unknown"
FT   gene            9460830..9461876
FT                   /pseudo
FT                   /locus_tag="mCG_49714"
FT                   /note="gene_id=mCG49714.2"
FT   mRNA            9460830..9461876
FT                   /pseudo
FT                   /locus_tag="mCG_49714"
FT                   /note="gene_id=mCG49714.2 transcript_id=mCT49897.2 created
FT                   on 09-SEP-2002"
FT   assembly_gap    9484533..9484552
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9488938..9488957
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9490124..9493123
FT                   /estimated_length=3000
FT                   /gap_type="unknown"
FT   assembly_gap    9498468..9498487
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9534430..9534449
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9544677..9544696
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <9547050..>9547556
FT                   /gene="Ferd3l"
FT                   /locus_tag="mCG_54967"
FT                   /note="gene_id=mCG54967.1"
FT   mRNA            <9547050..>9547556
FT                   /gene="Ferd3l"
FT                   /locus_tag="mCG_54967"
FT                   /product="Fer3-like (Drosophila)"
FT                   /note="gene_id=mCG54967.1 transcript_id=mCT55150.1 created
FT                   on 30-AUG-2002"
FT   CDS             9547050..9547556
FT                   /codon_start=1
FT                   /gene="Ferd3l"
FT                   /locus_tag="mCG_54967"
FT                   /product="Fer3-like (Drosophila)"
FT                   /note="gene_id=mCG54967.1 transcript_id=mCT55150.1
FT                   protein_id=mCP33143.1"
FT                   /protein_id="EDL36872.1"
FT                   EKEAS"
FT   gene            <9576372..9578386
FT                   /gene="Twist1"
FT                   /locus_tag="mCG_12458"
FT                   /note="gene_id=mCG12458.1"
FT   mRNA            join(<9576372..9577198,9577730..9578386)
FT                   /gene="Twist1"
FT                   /locus_tag="mCG_12458"
FT                   /product="twist gene homolog 1 (Drosophila)"
FT                   /note="gene_id=mCG12458.1 transcript_id=mCT13175.1 created
FT                   on 30-AUG-2002"
FT   CDS             <9576469..9577158
FT                   /codon_start=1
FT                   /gene="Twist1"
FT                   /locus_tag="mCG_12458"
FT                   /product="twist gene homolog 1 (Drosophila)"
FT                   /note="gene_id=mCG12458.1 transcript_id=mCT13175.1
FT                   protein_id=mCP11345.1"
FT                   /protein_id="EDL36871.1"
FT                   WSMSASH"
FT   assembly_gap    9612471..9618236
FT                   /estimated_length=5766
FT                   /gap_type="unknown"
FT   assembly_gap    9622995..9623395
FT                   /estimated_length=401
FT                   /gap_type="unknown"
FT   gene            complement(9668407..>9862420)
FT                   /locus_tag="mCG_145563"
FT                   /note="gene_id=mCG145563.0"
FT   mRNA            complement(join(9668407..9670082,9689319..9689466,
FT                   9711281..9711365,9722553..9722686,9783794..9783912,
FT                   9828839..9828936,9829249..9829368,9834700..9834787,
FT                   9835032..9835087,9862096..>9862420))
FT                   /locus_tag="mCG_145563"
FT                   /product="mCG145563"
FT                   /note="gene_id=mCG145563.0 transcript_id=mCT184987.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(9670043..9670082,9689319..9689466,
FT                   9711281..9711365,9722553..9722686,9783794..9783912,
FT                   9828839..9828936,9829249..9829368,9834700..9834787,
FT                   9835032..9835087,9862096..>9862398))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145563"
FT                   /product="mCG145563"
FT                   /note="gene_id=mCG145563.0 transcript_id=mCT184987.0
FT                   protein_id=mCP105147.0"
FT                   /protein_id="EDL36870.1"
FT   assembly_gap    9690124..9690143
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9692405..9695289
FT                   /estimated_length=2885
FT                   /gap_type="unknown"
FT   assembly_gap    9734932..9735172
FT                   /estimated_length=241
FT                   /gap_type="unknown"
FT   assembly_gap    9744513..9747010
FT                   /estimated_length=2498
FT                   /gap_type="unknown"
FT   assembly_gap    9747999..9748032
FT                   /estimated_length=34
FT                   /gap_type="unknown"
FT   assembly_gap    9753180..9754373
FT                   /estimated_length=1194
FT                   /gap_type="unknown"
FT   assembly_gap    9854784..9854894
FT                   /estimated_length=111
FT                   /gap_type="unknown"
FT   assembly_gap    9873680..9873699
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9935823..9935842
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(9987017..>10143509)
FT                   /gene="Hdac9"
FT                   /locus_tag="mCG_5365"
FT                   /note="gene_id=mCG5365.1"
FT   mRNA            complement(join(9987017..9987367,10002474..10002691,
FT                   10003371..10003581,10006512..10006634,10015981..10016096,
FT                   10020996..10021127,10045180..10045301,10047551..10047671,
FT                   10048763..10048904,10052819..10053060,10143488..>10143509))
FT                   /gene="Hdac9"
FT                   /locus_tag="mCG_5365"
FT                   /product="histone deacetylase 9, transcript variant
FT                   mCT5054"
FT                   /note="gene_id=mCG5365.1 transcript_id=mCT5054.0 created on
FT                   30-AUG-2002"
FT   mRNA            complement(join(<9987056..9987367,10002474..10002691,
FT                   10003371..10003581,10006512..10006634,10015981..10016096,
FT                   10045180..10045301,10047545..10047671,10048763..10048904,
FT                   10052819..10053060,10143488..>10143509))
FT                   /gene="Hdac9"
FT                   /locus_tag="mCG_5365"
FT                   /product="histone deacetylase 9, transcript variant
FT                   mCT193449"
FT                   /note="gene_id=mCG5365.1 transcript_id=mCT193449.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(<9987056..9987367,10002474..10002691,
FT                   10003371..10003581,10006512..10006634,10015981..10016096,
FT                   10020996..10021127,10045180..10045301,10047545..10047671,
FT                   10048763..10048904,10052819..10053060,10143488..>10143509))
FT                   /gene="Hdac9"
FT                   /locus_tag="mCG_5365"
FT                   /product="histone deacetylase 9, transcript variant
FT                   mCT193450"
FT                   /note="gene_id=mCG5365.1 transcript_id=mCT193450.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(9987056..9987367,10002474..10002691,
FT                   10003371..10003581,10006512..10006634,10015981..10016096,
FT                   10020996..10021127,10045180..10045301,10047551..10047671,
FT                   10048763..10048904,10052819..10053060,10143488..10143509))
FT                   /codon_start=1
FT                   /gene="Hdac9"
FT                   /locus_tag="mCG_5365"
FT                   /product="histone deacetylase 9, isoform CRA_c"
FT                   /note="gene_id=mCG5365.1 transcript_id=mCT5054.0
FT                   protein_id=mCP11331.0 isoform=CRA_c"
FT                   /protein_id="EDL36869.1"
FT                   APGFVIKVII"
FT   CDS             complement(join(9987056..9987367,10002474..10002691,
FT                   10003371..10003581,10006512..10006634,10015981..10016096,
FT                   10045180..10045301,10047545..10047671,10048763..10048904,
FT                   10052819..10053060,10143488..10143509))
FT                   /codon_start=1
FT                   /gene="Hdac9"
FT                   /locus_tag="mCG_5365"
FT                   /product="histone deacetylase 9, isoform CRA_a"
FT                   /note="gene_id=mCG5365.1 transcript_id=mCT193449.0
FT                   protein_id=mCP114427.0 isoform=CRA_a"
FT                   /db_xref="InterPro:IPR024643"
FT                   /db_xref="MGI:MGI:1931221"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1B0GS15"
FT                   /protein_id="EDL36867.1"
FT   CDS             complement(join(9987056..9987367,10002474..10002691,
FT                   10003371..10003581,10006512..10006634,10015981..10016096,
FT                   10020996..10021127,10045180..10045301,10047545..10047671,
FT                   10048763..10048904,10052819..10053060,10143488..10143509))
FT                   /codon_start=1
FT                   /gene="Hdac9"
FT                   /locus_tag="mCG_5365"
FT                   /product="histone deacetylase 9, isoform CRA_b"
FT                   /note="gene_id=mCG5365.1 transcript_id=mCT193450.0
FT                   protein_id=mCP114428.0 isoform=CRA_b"
FT                   /db_xref="GOA:A0A0R4J1F3"
FT                   /db_xref="InterPro:IPR024643"
FT                   /db_xref="MGI:MGI:1931221"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J1F3"
FT                   /protein_id="EDL36868.1"
FT                   DLAPGFVIKVII"
FT   assembly_gap    10036210..10036229
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10037721..10038074
FT                   /estimated_length=354
FT                   /gap_type="unknown"
FT   assembly_gap    10069194..10069213
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10070262..10070281
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10085587..10085606
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10116152..10116171
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10149010..10149220
FT                   /estimated_length=211
FT                   /gap_type="unknown"
FT   assembly_gap    10168217..10168236
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10170066..10171344
FT                   /estimated_length=1279
FT                   /gap_type="unknown"
FT   assembly_gap    10241710..10242999
FT                   /estimated_length=1290
FT                   /gap_type="unknown"
FT   assembly_gap    10254766..10254886
FT                   /estimated_length=121
FT                   /gap_type="unknown"
FT   assembly_gap    10267358..10267377
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10285982..10286084
FT                   /estimated_length=103
FT                   /gap_type="unknown"
FT   assembly_gap    10288639..10288658
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10321907..10321951
FT                   /estimated_length=45
FT                   /gap_type="unknown"
FT   assembly_gap    10336680..10336699
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10348520..10348751
FT                   /estimated_length=232
FT                   /gap_type="unknown"
FT   assembly_gap    10370224..10370243
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10381908..10382726
FT                   /estimated_length=819
FT                   /gap_type="unknown"
FT   assembly_gap    10391541..10391560
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10393155..10393834
FT                   /estimated_length=680
FT                   /gap_type="unknown"
FT   assembly_gap    10450056..10450075
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10453364..10453383
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10461057..10461193
FT                   /estimated_length=137
FT                   /gap_type="unknown"
FT   assembly_gap    10474904..10475168
FT                   /estimated_length=265
FT                   /gap_type="unknown"
FT   assembly_gap    10476385..10476404
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10485936..10485955
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10502812..10502925
FT                   /estimated_length=114
FT                   /gap_type="unknown"
FT   assembly_gap    10505887..10506119
FT                   /estimated_length=233
FT                   /gap_type="unknown"
FT   assembly_gap    10507313..10507466
FT                   /estimated_length=154
FT                   /gap_type="unknown"
FT   assembly_gap    10509585..10524198
FT                   /estimated_length=14614
FT                   /gap_type="unknown"
FT   assembly_gap    10525907..10532863
FT                   /estimated_length=6957
FT                   /gap_type="unknown"
FT   assembly_gap    10539147..10539166
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10547288..10547307
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10549540..10549559
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10564993..10565012
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10571491..10571510
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10572583..10572602
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10573700..10573778
FT                   /estimated_length=79
FT                   /gap_type="unknown"
FT   assembly_gap    10579055..10579074
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10580183..10580202
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10582384..10582403
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            10595784..10597416
FT                   /gene="1700011K15Rik"
FT                   /locus_tag="mCG_48722"
FT                   /note="gene_id=mCG48722.1"
FT   mRNA            10595784..10597416
FT                   /gene="1700011K15Rik"
FT                   /locus_tag="mCG_48722"
FT                   /product="RIKEN cDNA 1700011K15"
FT                   /note="gene_id=mCG48722.1 transcript_id=mCT48905.2 created
FT                   on 25-SEP-2002"
FT   CDS             10595868..10596824
FT                   /codon_start=1
FT                   /gene="1700011K15Rik"
FT                   /locus_tag="mCG_48722"
FT                   /product="RIKEN cDNA 1700011K15"
FT                   /note="gene_id=mCG48722.1 transcript_id=mCT48905.2
FT                   protein_id=mCP33107.0"
FT                   /db_xref="GOA:Q8C5R8"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="MGI:MGI:1922706"
FT                   /db_xref="UniProtKB/TrEMBL:Q8C5R8"
FT                   /protein_id="EDL36866.1"
FT   assembly_gap    10629366..10629385
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <10655772..10755648
FT                   /gene="Snx13"
FT                   /locus_tag="mCG_13956"
FT                   /note="gene_id=mCG13956.2"
FT   mRNA            join(<10655772..10655981,10688253..10688365,
FT                   10692090..10692192,10695171..10695260,10696096..10696217,
FT                   10700649..10700770,10700855..10700956,10702111..10702199,
FT                   10707504..10707587,10709725..10709863,10714294..10714487,
FT                   10715900..10716004,10716607..10716744,10721641..10721710,
FT                   10728977..10729116,10732137..10732244,10733650..10733760,
FT                   10742173..10742334,10743442..10743513,10748165..10748310,
FT                   10748541..10748609,10750306..10750418,10754363..10754830)
FT                   /gene="Snx13"
FT                   /locus_tag="mCG_13956"
FT                   /product="sorting nexin 13, transcript variant mCT18508"
FT                   /note="gene_id=mCG13956.2 transcript_id=mCT18508.1 created
FT                   on 09-SEP-2002"
FT   CDS             join(<10655772..10655981,10688253..10688365,
FT                   10692090..10692192,10695171..10695260,10696096..10696217,
FT                   10700649..10700770,10700855..10700956,10702111..10702199,
FT                   10707504..10707587,10709725..10709863,10714294..10714487,
FT                   10715900..10716004,10716607..10716744,10721641..10721710,
FT                   10728977..10729116,10732137..10732244,10733650..10733760,
FT                   10742173..10742334,10743442..10743513,10748165..10748310,
FT                   10748541..10748609,10750306..10750418,10754363..10754610)
FT                   /codon_start=1
FT                   /gene="Snx13"
FT                   /locus_tag="mCG_13956"
FT                   /product="sorting nexin 13, isoform CRA_a"
FT                   /note="gene_id=mCG13956.2 transcript_id=mCT18508.1
FT                   protein_id=mCP11325.1 isoform=CRA_a"
FT                   /protein_id="EDL36864.1"
FT   mRNA            join(<10655787..10655981,10688253..10688365,
FT                   10692090..10692192,10695171..10695260,10696096..10696217,
FT                   10700649..10700770,10700855..10700956,10702111..10702199,
FT                   10707504..10707587,10709725..10709863,10710207..10710295,
FT                   10712227..10712326,10714294..10714487,10715900..10716004,
FT                   10716607..10716739,10719830..10719867,10721641..10721710,
FT                   10728977..10729116,10732137..10732244,10733650..10733760,
FT                   10742173..10742334,10743442..10743513,10748165..10748310,
FT                   10748541..10748609,10750306..10750418,10754363..10755648)
FT                   /gene="Snx13"
FT                   /locus_tag="mCG_13956"
FT                   /product="sorting nexin 13, transcript variant mCT193424"
FT                   /note="gene_id=mCG13956.2 transcript_id=mCT193424.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<10655787..10655981,10688253..10688365,
FT                   10692090..10692192,10695171..10695260,10696096..10696217,
FT                   10700649..10700770,10700855..10700956,10702111..10702199,
FT                   10707504..10707587,10709725..10709863,10710207..10710295,
FT                   10712227..10712326,10714294..10714487,10715900..10716004,
FT                   10716607..10716739,10719830..10719867,10721641..10721710,
FT                   10728977..10729116,10732137..10732244,10733650..10733760,
FT                   10742173..10742334,10743442..10743513,10748165..10748310,
FT                   10748541..10748609,10750306..10750418,10754363..10754610)
FT                   /codon_start=1
FT                   /gene="Snx13"
FT                   /locus_tag="mCG_13956"
FT                   /product="sorting nexin 13, isoform CRA_b"
FT                   /note="gene_id=mCG13956.2 transcript_id=mCT193424.0
FT                   protein_id=mCP114404.0 isoform=CRA_b"
FT                   /protein_id="EDL36865.1"
FT   assembly_gap    10662502..10662550
FT                   /estimated_length=49
FT                   /gap_type="unknown"
FT   assembly_gap    10667952..10671412
FT                   /estimated_length=3461
FT                   /gap_type="unknown"
FT   assembly_gap    10683798..10683817
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10689750..10689769
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10696493..10696512
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10709243..10709262
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10735697..10735716
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10737077..10737096
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10750607..10750754
FT                   /estimated_length=148
FT                   /gap_type="unknown"
FT   assembly_gap    10801356..10801375
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10802669..10802688
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10803897..10805673
FT                   /estimated_length=1777
FT                   /gap_type="unknown"
FT   assembly_gap    10806971..10806990
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10808129..10808148
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10809557..10809576
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10812650..10813270
FT                   /estimated_length=621
FT                   /gap_type="unknown"
FT   assembly_gap    10838515..10840209
FT                   /estimated_length=1695
FT                   /gap_type="unknown"
FT   assembly_gap    10852162..10852812
FT                   /estimated_length=651
FT                   /gap_type="unknown"
FT   assembly_gap    10854229..10854829
FT                   /estimated_length=601
FT                   /gap_type="unknown"
FT   assembly_gap    10855839..10856853
FT                   /estimated_length=1015
FT                   /gap_type="unknown"
FT   assembly_gap    10870171..10870190
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10889229..10889248
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10890515..10892559
FT                   /estimated_length=2045
FT                   /gap_type="unknown"
FT   assembly_gap    10895098..10895174
FT                   /estimated_length=77
FT                   /gap_type="unknown"
FT   assembly_gap    10899158..10899177
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10905023..10905042
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10930199..10930218
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10947799..10947818
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10948900..10948919
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10950182..10950201
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10969208..10972529
FT                   /estimated_length=3322
FT                   /gap_type="unknown"
FT   assembly_gap    10991197..10991216
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11013646..11013665
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11015365..11015384
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11019107..11019126
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11020146..11020165
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11022175..11024854
FT                   /estimated_length=2680
FT                   /gap_type="unknown"
FT   assembly_gap    11038520..11038539
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11042870..11042889
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11066651..11066670
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11067771..11067790
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11077062..11079453
FT                   /estimated_length=2392
FT                   /gap_type="unknown"
FT   assembly_gap    11082150..11082169
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11083472..11084396
FT                   /estimated_length=925
FT                   /gap_type="unknown"
FT   assembly_gap    11102797..11106801
FT                   /estimated_length=4005
FT                   /gap_type="unknown"
FT   assembly_gap    11108510..11108529
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11127236..11127401
FT                   /estimated_length=166
FT                   /gap_type="unknown"
FT   gene            complement(11133719..>11169264)
FT                   /gene="Ahr"
FT                   /locus_tag="mCG_13952"
FT                   /note="gene_id=mCG13952.1"
FT   mRNA            complement(join(11133719..11136406,11139415..11140678,
FT                   11141948..11142089,11143105..11143214,11143815..11144017,
FT                   11145670..11145800,11146762..11146873,11148566..11148655,
FT                   11150731..11150834,11160970..11161157,11168922..>11169264))
FT                   /gene="Ahr"
FT                   /locus_tag="mCG_13952"
FT                   /product="aryl-hydrocarbon receptor"
FT                   /note="gene_id=mCG13952.1 transcript_id=mCT18503.1 created
FT                   on 30-AUG-2002"
FT   CDS             complement(join(11136266..11136406,11139415..11140678,
FT                   11141948..11142089,11143105..11143214,11143815..11144017,
FT                   11145670..11145800,11146762..11146873,11148566..11148655,
FT                   11150731..11150834,11160970..11161157,11168922..>11169190))
FT                   /codon_start=1
FT                   /gene="Ahr"
FT                   /locus_tag="mCG_13952"
FT                   /product="aryl-hydrocarbon receptor"
FT                   /note="gene_id=mCG13952.1 transcript_id=mCT18503.1
FT                   protein_id=mCP11341.1"
FT                   /protein_id="EDL36863.1"
FT   assembly_gap    11221461..11224416
FT                   /estimated_length=2956
FT                   /gap_type="unknown"
FT   assembly_gap    11288154..11288173
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11290393..11290412
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11294746..11294836
FT                   /estimated_length=91
FT                   /gap_type="unknown"
FT   assembly_gap    11296168..11296187
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11297195..11297214
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(11312668..11335384)
FT                   /locus_tag="mCG_148270"
FT                   /note="gene_id=mCG148270.0"
FT   mRNA            complement(join(11312668..11312827,11314399..11314567,
FT                   11332214..11332375,11334735..11334912,11335220..11335384))
FT                   /locus_tag="mCG_148270"
FT                   /product="mCG148270"
FT                   /note="gene_id=mCG148270.0 transcript_id=mCT188533.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(join(11312752..11312827,11314399..11314472))
FT                   /codon_start=1
FT                   /locus_tag="mCG_148270"
FT                   /product="mCG148270"
FT                   /note="gene_id=mCG148270.0 transcript_id=mCT188533.0
FT                   protein_id=mCP108104.0"
FT                   /protein_id="EDL36861.1"
FT                   YKKK"
FT   gene            11322726..11334949
FT                   /locus_tag="mCG_148257"
FT                   /note="gene_id=mCG148257.0"
FT   mRNA            join(11322726..11322931,11334594..11334949)
FT                   /locus_tag="mCG_148257"
FT                   /product="mCG148257"
FT                   /note="gene_id=mCG148257.0 transcript_id=mCT188520.0
FT                   created on 13-JAN-2004"
FT   CDS             join(11322786..11322931,11334594..11334603)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148257"
FT                   /product="mCG148257"
FT                   /note="gene_id=mCG148257.0 transcript_id=mCT188520.0
FT                   protein_id=mCP108088.0"
FT                   /protein_id="EDL36862.1"
FT                   RGTRPQ"
FT   assembly_gap    11329409..11329428
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11336681..11336700
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11338559..11338578
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11340162..11340181
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11383565..11383584
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11385523..11385542
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11387022..11387041
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11389271..11389380
FT                   /estimated_length=110
FT                   /gap_type="unknown"
FT   assembly_gap    11392378..11392768
FT                   /estimated_length=391
FT                   /gap_type="unknown"
FT   gene            <11416108..>11417675
FT                   /locus_tag="mCG_13955"
FT                   /note="gene_id=mCG13955.0"
FT   mRNA            join(<11416108..11416566,11416819..11416991,
FT                   11417060..>11417675)
FT                   /locus_tag="mCG_13955"
FT                   /product="mCG13955"
FT                   /note="gene_id=mCG13955.0 transcript_id=mCT18507.0 created
FT                   on 09-SEP-2002"
FT   CDS             join(<11416108..11416566,11416819..11416991,
FT                   11417060..11417675)
FT                   /codon_start=1
FT                   /locus_tag="mCG_13955"
FT                   /product="mCG13955"
FT                   /note="gene_id=mCG13955.0 transcript_id=mCT18507.0
FT                   protein_id=mCP11321.0"
FT                   /protein_id="EDL36860.1"
FT                   KKMEESKAKFEDHCRL"
FT   assembly_gap    11437234..11437493
FT                   /estimated_length=260
FT                   /gap_type="unknown"
FT   assembly_gap    11445444..11445463
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11447512..11470714
FT                   /estimated_length=23203
FT                   /gap_type="unknown"
FT   assembly_gap    11493657..11495177
FT                   /estimated_length=1521
FT                   /gap_type="unknown"
FT   assembly_gap    11500948..11500967
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11512796..11512815
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11532247..11532723
FT                   /estimated_length=477
FT                   /gap_type="unknown"
FT   assembly_gap    11561237..11561542
FT                   /estimated_length=306
FT                   /gap_type="unknown"
FT   gene            <11564060..11588500
FT                   /gene="E030025L21Rik"
FT                   /locus_tag="mCG_13957"
FT                   /note="gene_id=mCG13957.2"
FT   mRNA            join(<11564060..11564167,11566677..11566812,
FT                   11572893..11572956,11585417..11585469,11586034..11586110,
FT                   11586309..11586372,11586786..11586869,11588018..11588500)
FT                   /gene="E030025L21Rik"
FT                   /locus_tag="mCG_13957"
FT                   /product="RIKEN cDNA E030025L21"
FT                   /note="gene_id=mCG13957.2 transcript_id=mCT18505.2 created
FT                   on 09-SEP-2002"
FT   CDS             join(<11564147..11564167,11566677..11566812,
FT                   11572893..11572956,11585417..11585469,11586034..11586110,
FT                   11586309..11586372,11586786..11586869,11588018..11588067)
FT                   /codon_start=1
FT                   /gene="E030025L21Rik"
FT                   /locus_tag="mCG_13957"
FT                   /product="RIKEN cDNA E030025L21"
FT                   /note="gene_id=mCG13957.2 transcript_id=mCT18505.2
FT                   protein_id=mCP11344.1"
FT                   /protein_id="EDL36859.1"
FT   assembly_gap    11568062..11568081
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11572088..11572745
FT                   /estimated_length=658
FT                   /gap_type="unknown"
FT   gene            complement(11616264..11617621)
FT                   /locus_tag="mCG_148255"
FT                   /note="gene_id=mCG148255.0"
FT   mRNA            complement(join(11616264..11617305,11617337..11617621))
FT                   /locus_tag="mCG_148255"
FT                   /product="mCG148255"
FT                   /note="gene_id=mCG148255.0 transcript_id=mCT188518.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(11616365..11616622)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148255"
FT                   /product="mCG148255"
FT                   /note="gene_id=mCG148255.0 transcript_id=mCT188518.0
FT                   protein_id=mCP108090.0"
FT                   /protein_id="EDL36858.1"
FT   assembly_gap    11617314..11617333
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11629346..11629365
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <11631446..11642549
FT                   /gene="Agr2"
FT                   /locus_tag="mCG_13953"
FT                   /note="gene_id=mCG13953.1"
FT   mRNA            join(<11631446..11631490,11634028..11634173,
FT                   11634413..11634476,11634593..11634645,11635941..11636014,
FT                   11637101..11637164,11640159..11640242,11642321..11642549)
FT                   /gene="Agr2"
FT                   /locus_tag="mCG_13953"
FT                   /product="anterior gradient 2 (Xenopus laevis)"
FT                   /note="gene_id=mCG13953.1 transcript_id=mCT18504.1 created
FT                   on 30-AUG-2002"
FT   CDS             join(<11631447..11631490,11634028..11634173,
FT                   11634413..11634476,11634593..11634645,11635941..11636014,
FT                   11637101..11637164,11640159..11640242,11642321..11642370)
FT                   /codon_start=1
FT                   /gene="Agr2"
FT                   /locus_tag="mCG_13953"
FT                   /product="anterior gradient 2 (Xenopus laevis)"
FT                   /note="gene_id=mCG13953.1 transcript_id=mCT18504.1
FT                   protein_id=mCP11310.0"
FT                   /protein_id="EDL36857.1"
FT   assembly_gap    11651402..11651421
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11652500..11652519
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(11653639..>11681486)
FT                   /gene="Tspan13"
FT                   /locus_tag="mCG_127095"
FT                   /note="gene_id=mCG127095.0"
FT   mRNA            complement(join(11653639..11654855,11659583..11659696,
FT                   11660874..11660987,11661826..11661906,11662983..11663150,
FT                   11681320..>11681486))
FT                   /gene="Tspan13"
FT                   /locus_tag="mCG_127095"
FT                   /product="tetraspanin 13, transcript variant mCT128376"
FT                   /note="gene_id=mCG127095.0 transcript_id=mCT128376.0
FT                   created on 30-AUG-2002"
FT   mRNA            complement(join(11653959..11654855,11659583..11659696,
FT                   11660874..11660987,11661826..11661906,11662983..11663150,
FT                   11678547..>11678997))
FT                   /gene="Tspan13"
FT                   /locus_tag="mCG_127095"
FT                   /product="tetraspanin 13, transcript variant mCT172853"
FT                   /note="gene_id=mCG127095.0 transcript_id=mCT172853.0
FT                   created on 30-AUG-2002"
FT   CDS             complement(join(11654781..11654855,11659583..11659696,
FT                   11660874..11660987,11661826..11661906,11662983..11663150,
FT                   11681320..>11681481))
FT                   /codon_start=1
FT                   /gene="Tspan13"
FT                   /locus_tag="mCG_127095"
FT                   /product="tetraspanin 13, isoform CRA_b"
FT                   /note="gene_id=mCG127095.0 transcript_id=mCT128376.0
FT                   protein_id=mCP78889.0 isoform=CRA_b"
FT                   /protein_id="EDL36856.1"
FT                   YRNQKDPRANPSAFL"
FT   CDS             complement(join(11654781..11654855,11659583..11659696,
FT                   11660874..11660987,11661826..11661906,11662983..11663150,
FT                   11678547..>11678609))
FT                   /codon_start=1
FT                   /gene="Tspan13"
FT                   /locus_tag="mCG_127095"
FT                   /product="tetraspanin 13, isoform CRA_a"
FT                   /note="gene_id=mCG127095.0 transcript_id=mCT172853.0
FT                   protein_id=mCP95772.0 isoform=CRA_a"
FT                   /protein_id="EDL36855.1"
FT   assembly_gap    11662499..11662518
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11700077..11700096
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11720636..11720655
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <11720774..11730530
FT                   /locus_tag="mCG_50154"
FT                   /note="gene_id=mCG50154.2"
FT   mRNA            join(<11720774..11720823,11729545..11730530)
FT                   /locus_tag="mCG_50154"
FT                   /product="mCG50154"
FT                   /note="gene_id=mCG50154.2 transcript_id=mCT50337.2 created
FT                   on 25-SEP-2002"
FT   CDS             join(11720774..11720823,11729545..11730115)
FT                   /codon_start=1
FT                   /locus_tag="mCG_50154"
FT                   /product="mCG50154"
FT                   /note="gene_id=mCG50154.2 transcript_id=mCT50337.2
FT                   protein_id=mCP33106.1"
FT                   /protein_id="EDL36854.1"
FT   gene            complement(11731338..>11796139)
FT                   /gene="Bzw2"
FT                   /locus_tag="mCG_15552"
FT                   /note="gene_id=mCG15552.1"
FT   mRNA            complement(join(11731338..11731385,11732366..11732488,
FT                   11741298..11741436,11746949..11747095,11749157..11749327,
FT                   11753420..11753529,11758437..11758572,11760139..11760204,
FT                   11763358..11763461,11769415..11769591,11774314..11774378,
FT                   11796025..>11796139))
FT                   /gene="Bzw2"
FT                   /locus_tag="mCG_15552"
FT                   /product="basic leucine zipper and W2 domains 2"
FT                   /note="gene_id=mCG15552.1 transcript_id=mCT18563.0 created
FT                   on 30-AUG-2002"
FT   CDS             complement(join(11731357..11731385,11732366..11732488,
FT                   11741298..11741436,11746949..11747095,11749157..11749327,
FT                   11753420..11753529,11758437..11758572,11760139..11760204,
FT                   11763358..11763461,11769415..11769591,11774314..11774378,
FT                   11796025..>11796137))
FT                   /codon_start=1
FT                   /gene="Bzw2"
FT                   /locus_tag="mCG_15552"
FT                   /product="basic leucine zipper and W2 domains 2"
FT                   /note="gene_id=mCG15552.1 transcript_id=mCT18563.0
FT                   protein_id=mCP11318.0"
FT                   /protein_id="EDL36853.1"
FT                   S"
FT   assembly_gap    11731943..11732327
FT                   /estimated_length=385
FT                   /gap_type="unknown"
FT   assembly_gap    11741971..11741990
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11743156..11743175
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11743963..11743982
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11745052..11745071
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11791666..11791685
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <11796524..11839142
FT                   /gene="Ankmy2"
FT                   /locus_tag="mCG_15556"
FT                   /note="gene_id=mCG15556.2"
FT   mRNA            join(<11796524..11796780,11805350..11805414,
FT                   11809928..11810066,11816097..11816195,11821989..11822149,
FT                   11826367..11826581,11827291..11827426,11833311..11833439,
FT                   11836834..11836963,11838070..11838458)
FT                   /gene="Ankmy2"
FT                   /locus_tag="mCG_15556"
FT                   /product="ankyrin repeat and MYND domain containing 2,
FT                   transcript variant mCT193515"
FT                   /note="gene_id=mCG15556.2 transcript_id=mCT193515.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(<11796526..11796780,11805350..11805414,
FT                   11809928..11810066,11816097..11816195,11821989..11822149,
FT                   11826367..11826581,11827291..11827426,11833311..11833439,
FT                   11833834..11833962,11836834..11836963,11838070..11839142)
FT                   /gene="Ankmy2"
FT                   /locus_tag="mCG_15556"
FT                   /product="ankyrin repeat and MYND domain containing 2,
FT                   transcript variant mCT18567"
FT                   /note="gene_id=mCG15556.2 transcript_id=mCT18567.1 created
FT                   on 09-SEP-2002"
FT   CDS             join(<11796567..11796780,11805350..11805414,
FT                   11809928..11810066,11816097..11816195,11821989..11822149,
FT                   11826367..11826581,11827291..11827426,11833311..11833439,
FT                   11833834..11833962,11836834..11836963,11838070..11838251)
FT                   /codon_start=1
FT                   /gene="Ankmy2"
FT                   /locus_tag="mCG_15556"
FT                   /product="ankyrin repeat and MYND domain containing 2,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG15556.2 transcript_id=mCT18567.1
FT                   protein_id=mCP11336.1 isoform=CRA_b"
FT                   /protein_id="EDL36852.1"
FT                   ASAQDAPTGPQLSEE"
FT   CDS             join(<11796567..11796780,11805350..11805414,
FT                   11809928..11810066,11816097..11816195,11821989..11822149,
FT                   11826367..11826581,11827291..11827426,11833311..11833439,
FT                   11836834..11836963,11838070..11838251)
FT                   /codon_start=1
FT                   /gene="Ankmy2"
FT                   /locus_tag="mCG_15556"
FT                   /product="ankyrin repeat and MYND domain containing 2,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG15556.2 transcript_id=mCT193515.0
FT                   protein_id=mCP114457.0 isoform=CRA_a"
FT                   /protein_id="EDL36851.1"
FT   assembly_gap    11798927..11799276
FT                   /estimated_length=350
FT                   /gap_type="unknown"
FT   assembly_gap    11811208..11811289
FT                   /estimated_length=82
FT                   /gap_type="unknown"
FT   assembly_gap    11817756..11818271
FT                   /estimated_length=516
FT                   /gap_type="unknown"
FT   assembly_gap    11833715..11833734
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11835483..11835502
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(11843781..11888876)
FT                   /gene="1700108M19Rik"
FT                   /locus_tag="mCG_15553"
FT                   /note="gene_id=mCG15553.1"
FT   mRNA            complement(join(11843781..11844136,11845216..11845243,
FT                   11848089..11848241,11856964..11857083,11858232..11858313,
FT                   11878757..11878826,11883079..11883171,11888696..11888876))
FT                   /gene="1700108M19Rik"
FT                   /locus_tag="mCG_15553"
FT                   /product="RIKEN cDNA 1700108M19, transcript variant
FT                   mCT18564"
FT                   /note="gene_id=mCG15553.1 transcript_id=mCT18564.2 created
FT                   on 09-SEP-2002"
FT   CDS             complement(join(11843971..11844136,11845216..11845243,
FT                   11848089..11848215))
FT                   /codon_start=1
FT                   /gene="1700108M19Rik"
FT                   /locus_tag="mCG_15553"
FT                   /product="RIKEN cDNA 1700108M19, isoform CRA_a"
FT                   /note="gene_id=mCG15553.1 transcript_id=mCT18564.2
FT                   protein_id=mCP11329.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q9D9C3"
FT                   /db_xref="MGI:MGI:1920830"
FT                   /db_xref="UniProtKB/TrEMBL:Q9D9C3"
FT                   /protein_id="EDL36849.1"
FT                   LR"
FT   mRNA            complement(join(11845088..11845243,11848089..11848241,
FT                   11849801..11849890,11856973..11857083,11858232..11858313,
FT                   11878757..11878826,11883079..11883171,11888696..>11888875))
FT                   /gene="1700108M19Rik"
FT                   /locus_tag="mCG_15553"
FT                   /product="RIKEN cDNA 1700108M19, transcript variant
FT                   mCT193510"
FT                   /note="gene_id=mCG15553.1 transcript_id=mCT193510.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(11845212..11845243,11848089..11848241,
FT                   11849801..11849890,11856973..11857083,11858232..11858313,
FT                   11878757..11878826,11883079..11883171,11888696..>11888697))
FT                   /codon_start=1
FT                   /gene="1700108M19Rik"
FT                   /locus_tag="mCG_15553"
FT                   /product="RIKEN cDNA 1700108M19, isoform CRA_b"
FT                   /note="gene_id=mCG15553.1 transcript_id=mCT193510.0
FT                   protein_id=mCP114456.0 isoform=CRA_b"
FT                   /protein_id="EDL36850.1"
FT   assembly_gap    11849160..11849544
FT                   /estimated_length=385
FT                   /gap_type="unknown"
FT   assembly_gap    11900594..11900775
FT                   /estimated_length=182
FT                   /gap_type="unknown"
FT   assembly_gap    11904595..11904961
FT                   /estimated_length=367
FT                   /gap_type="unknown"
FT   assembly_gap    11914903..11920123
FT                   /estimated_length=5221
FT                   /gap_type="unknown"
FT   assembly_gap    11922337..11922356
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11923415..11923434
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11928467..11929220
FT                   /estimated_length=754
FT                   /gap_type="unknown"
FT   assembly_gap    11941758..11941777
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <11948202..11952339
FT                   /gene="Sostdc1"
FT                   /locus_tag="mCG_127093"
FT                   /note="gene_id=mCG127093.0"
FT   mRNA            join(<11948202..11948475,11951009..11952339)
FT                   /gene="Sostdc1"
FT                   /locus_tag="mCG_127093"
FT                   /product="sclerostin domain containing 1"
FT                   /note="gene_id=mCG127093.0 transcript_id=mCT128374.0
FT                   created on 30-AUG-2002"
FT   CDS             join(<11948238..11948475,11951009..11951430)
FT                   /codon_start=1
FT                   /gene="Sostdc1"
FT                   /locus_tag="mCG_127093"
FT                   /product="sclerostin domain containing 1"
FT                   /note="gene_id=mCG127093.0 transcript_id=mCT128374.0
FT                   protein_id=mCP78884.0 partial"
FT                   /protein_id="EDL36848.1"
FT   assembly_gap    11951329..11951377
FT                   /estimated_length=49
FT                   /gap_type="unknown"
FT   assembly_gap    11964636..11964697
FT                   /estimated_length=62
FT                   /gap_type="unknown"
FT   assembly_gap    11966776..11966795
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11968126..11968145
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11972173..11972584
FT                   /estimated_length=412
FT                   /gap_type="unknown"
FT   assembly_gap    12006277..12006487
FT                   /estimated_length=211
FT                   /gap_type="unknown"
FT   gene            <12010256..12205491
FT                   /gene="4930579E17Rik"
FT                   /locus_tag="mCG_15551"
FT                   /note="gene_id=mCG15551.2"
FT   mRNA            join(<12010256..12010831,12019158..12019434,
FT                   12055561..12055710,12102291..12102395,12105726..12105771,
FT                   12124025..12124119,12143498..12143587,12144024..12144116,
FT                   12169891..12170022,12205131..12205491)
FT                   /gene="4930579E17Rik"
FT                   /locus_tag="mCG_15551"
FT                   /product="RIKEN cDNA 4930579E17, transcript variant
FT                   mCT193509"
FT                   /note="gene_id=mCG15551.2 transcript_id=mCT193509.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<12010506..12010831,12019158..12019434,
FT                   12055561..12055710,12102291..12102395,12105726..12105771,
FT                   12124025..12124119,12143498..12143587,12144024..12144116,
FT                   12169891..12170022,12205131..12205151)
FT                   /codon_start=1
FT                   /gene="4930579E17Rik"
FT                   /locus_tag="mCG_15551"
FT                   /product="RIKEN cDNA 4930579E17, isoform CRA_b"
FT                   /note="gene_id=mCG15551.2 transcript_id=mCT193509.0
FT                   protein_id=mCP114455.0 isoform=CRA_b"
FT                   /protein_id="EDL36847.1"
FT   mRNA            join(<12010986..12011110,12019158..12019434,
FT                   12055561..12055710,12102291..12102395,12105726..12105771,
FT                   12124025..12124119,12169891..12170022,12205131..12205488)
FT                   /gene="4930579E17Rik"
FT                   /locus_tag="mCG_15551"
FT                   /product="RIKEN cDNA 4930579E17, transcript variant
FT                   mCT18562"
FT                   /note="gene_id=mCG15551.2 transcript_id=mCT18562.1 created
FT                   on 09-SEP-2002"
FT   CDS             join(<12011103..12011110,12019158..12019434,
FT                   12055561..12055710,12102291..12102395,12105726..12105771,
FT                   12124025..12124119,12169891..12170022,12205131..12205151)
FT                   /codon_start=1
FT                   /gene="4930579E17Rik"
FT                   /locus_tag="mCG_15551"
FT                   /product="RIKEN cDNA 4930579E17, isoform CRA_a"
FT                   /note="gene_id=mCG15551.2 transcript_id=mCT18562.1
FT                   protein_id=mCP11342.1 isoform=CRA_a"
FT                   /protein_id="EDL36846.1"
FT   assembly_gap    12044060..12044079
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12085525..12085544
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12113108..12113884
FT                   /estimated_length=777
FT                   /gap_type="unknown"
FT   assembly_gap    12132072..12132091
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12178567..12178586
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12205536..12205555
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12206637..12206656
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12234235..12234384
FT                   /estimated_length=150
FT                   /gap_type="unknown"
FT   assembly_gap    12251428..12251447
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12252090..12252221
FT                   /estimated_length=132
FT                   /gap_type="unknown"
FT   assembly_gap    12262814..12262833
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            12299752..12311738
FT                   /locus_tag="mCG_148263"
FT                   /note="gene_id=mCG148263.0"
FT   mRNA            join(12299752..12300049,12311419..12311738)
FT                   /locus_tag="mCG_148263"
FT                   /product="mCG148263"
FT                   /note="gene_id=mCG148263.0 transcript_id=mCT188526.0
FT                   created on 13-JAN-2004"
FT   CDS             join(12299870..12300049,12311419..12311523)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148263"
FT                   /product="mCG148263"
FT                   /note="gene_id=mCG148263.0 transcript_id=mCT188526.0
FT                   protein_id=mCP108096.0"
FT                   /protein_id="EDL36845.1"
FT   assembly_gap    12303530..12303549
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12321486..12321505
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12332201..12332220
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12350449..12350470
FT                   /estimated_length=22
FT                   /gap_type="unknown"
FT   assembly_gap    12360804..12360823
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12433188..12433207
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12437137..12437156
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12439914..12444458
FT                   /estimated_length=4545
FT                   /gap_type="unknown"
FT   assembly_gap    12454297..12454534
FT                   /estimated_length=238
FT                   /gap_type="unknown"
FT   assembly_gap    12475928..12476347
FT                   /estimated_length=420
FT                   /gap_type="unknown"
FT   assembly_gap    12494671..12494690
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12496598..12496617
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12521729..12522027
FT                   /estimated_length=299
FT                   /gap_type="unknown"
FT   assembly_gap    12533357..12533446
FT                   /estimated_length=90
FT                   /gap_type="unknown"
FT   assembly_gap    12536400..12536419
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12583456..12583475
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12584518..12584537
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12614659..12614678
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12727897..12727919
FT                   /estimated_length=23
FT                   /gap_type="unknown"
FT   gene            <12733448..12793467
FT                   /gene="Meox2"
FT                   /locus_tag="mCG_49365"
FT                   /note="gene_id=mCG49365.1"
FT   mRNA            join(<12733448..12734237,12781244..12781416,
FT                   12792091..12793467)
FT                   /gene="Meox2"
FT                   /locus_tag="mCG_49365"
FT                   /product="mesenchyme homeobox 2"
FT                   /note="gene_id=mCG49365.1 transcript_id=mCT49548.1 created
FT                   on 09-SEP-2002"
FT   CDS             join(<12733691..12734237,12781244..12781416,
FT                   12792091..12792315)
FT                   /codon_start=1
FT                   /gene="Meox2"
FT                   /locus_tag="mCG_49365"
FT                   /product="mesenchyme homeobox 2"
FT                   /note="gene_id=mCG49365.1 transcript_id=mCT49548.1
FT                   protein_id=mCP42611.1"
FT                   /protein_id="EDL36844.1"
FT   assembly_gap    12798373..12804988
FT                   /estimated_length=6616
FT                   /gap_type="unknown"
FT   assembly_gap    12806461..12806589
FT                   /estimated_length=129
FT                   /gap_type="unknown"
FT   assembly_gap    12807711..12807730
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12810525..12817657
FT                   /estimated_length=7133
FT                   /gap_type="unknown"
FT   assembly_gap    12818890..12819120
FT                   /estimated_length=231
FT                   /gap_type="unknown"
FT   assembly_gap    12821974..12821993
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12824710..12824729
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12826124..12826143
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12837396..12837415
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12848262..12848281
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12849703..12849722
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12853476..12855347
FT                   /estimated_length=1872
FT                   /gap_type="unknown"
FT   gene            12864584..13206338
FT                   /gene="A530016O06Rik"
FT                   /locus_tag="mCG_8101"
FT                   /note="gene_id=mCG8101.2"
FT   mRNA            join(12864584..12865000,12866539..12866669,
FT                   12877999..12878150,12972849..12972952,12983196..12983291,
FT                   13023351..13023417,13026592..13026657,13026749..13026828,
FT                   13029981..13030115,13030590..13030706,13038668..13038750,
FT                   13039555..13039660,13206194..13206338)
FT                   /gene="A530016O06Rik"
FT                   /locus_tag="mCG_8101"
FT                   /product="RIKEN cDNA A530016O06, transcript variant
FT                   mCT7150"
FT                   /note="gene_id=mCG8101.2 transcript_id=mCT7150.2 created on
FT                   09-APR-2003"
FT   CDS             join(12864875..12865000,12866539..12866669,
FT                   12877999..12878150,12972849..12972952,12983196..12983291,
FT                   13023351..13023417,13026592..13026657,13026749..13026828,
FT                   13029981..13030115,13030590..13030706,13038668..13038750,
FT                   13039555..13039660,13206194..13206274)
FT                   /codon_start=1
FT                   /gene="A530016O06Rik"
FT                   /locus_tag="mCG_8101"
FT                   /product="RIKEN cDNA A530016O06, isoform CRA_b"
FT                   /note="gene_id=mCG8101.2 transcript_id=mCT7150.2
FT                   protein_id=mCP22790.2 isoform=CRA_b"
FT                   /protein_id="EDL36843.1"
FT   mRNA            join(<12864901..12865000,12866539..12866669,
FT                   12877999..12878150,12972849..12972952,12983196..12983291,
FT                   13023351..13023417,13026592..13026657,13026749..13026828,
FT                   13029981..13030115,13030590..13030706,13038668..13038750,
FT                   13039555..13039660,13189016..13189946)
FT                   /gene="A530016O06Rik"
FT                   /locus_tag="mCG_8101"
FT                   /product="RIKEN cDNA A530016O06, transcript variant
FT                   mCT193491"
FT                   /note="gene_id=mCG8101.2 transcript_id=mCT193491.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<12864902..12865000,12866539..12866669,
FT                   12877999..12878150,12972849..12972952,12983196..12983291,
FT                   13023351..13023417,13026592..13026657,13026749..13026828,
FT                   13029981..13030115,13030590..13030706,13038668..13038750,
FT                   13039555..13039660,13189016..13189060)
FT                   /codon_start=1
FT                   /gene="A530016O06Rik"
FT                   /locus_tag="mCG_8101"
FT                   /product="RIKEN cDNA A530016O06, isoform CRA_a"
FT                   /note="gene_id=mCG8101.2 transcript_id=mCT193491.0
FT                   protein_id=mCP114484.0 isoform=CRA_a"
FT                   /protein_id="EDL36842.1"
FT   assembly_gap    12868855..12868874
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12873288..12873307
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12911885..12911904
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12988059..12992482
FT                   /estimated_length=4424
FT                   /gap_type="unknown"
FT   assembly_gap    12994052..12994071
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13055435..13055683
FT                   /estimated_length=249
FT                   /gap_type="unknown"
FT   assembly_gap    13140199..13140328
FT                   /estimated_length=130
FT                   /gap_type="unknown"
FT   assembly_gap    13144046..13144199
FT                   /estimated_length=154
FT                   /gap_type="unknown"
FT   assembly_gap    13159465..13159574
FT                   /estimated_length=110
FT                   /gap_type="unknown"
FT   assembly_gap    13165298..13165364
FT                   /estimated_length=67
FT                   /gap_type="unknown"
FT   assembly_gap    13198547..13198566
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13223998..13224017
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13225250..13225269
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13226325..13226344
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13227623..13227642
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13233674..13233841
FT                   /estimated_length=168
FT                   /gap_type="unknown"
FT   assembly_gap    13273494..13273541
FT                   /estimated_length=48
FT                   /gap_type="unknown"
FT   assembly_gap    13302051..13302070
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13332790..13332809
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13338343..13338387
FT                   /estimated_length=45
FT                   /gap_type="unknown"
FT   assembly_gap    13401090..13401109
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            13501791..14243856
FT                   /gene="Dgkb"
FT                   /locus_tag="mCG_145718"
FT                   /note="gene_id=mCG145718.0"
FT   mRNA            join(13501791..13502200,13602916..13603171,
FT                   13691042..13691118,13707240..13707393,13724413..13724553,
FT                   13730487..13730536,13734058..13734132,13737154..13737273,
FT                   13746430..13746547,13749294..13749382,13749459..13749575,
FT                   13757429..13757527,13776605..13776637,13783591..13783707,
FT                   13794723..13794796,13821007..13821092,13822735..13822824,
FT                   13836718..13836878,13939683..13939747,14037377..14037467,
FT                   14048503..14048698,14212656..14212776,14214043..14214103,
FT                   14240190..14243856)
FT                   /gene="Dgkb"
FT                   /locus_tag="mCG_145718"
FT                   /product="diacylglycerol kinase, beta, transcript variant
FT                   mCT185314"
FT                   /note="gene_id=mCG145718.0 transcript_id=mCT185314.0
FT                   created on 11-JUN-2003"
FT   mRNA            join(13501961..13502200,13602916..13603171,
FT                   13691042..13691118,13694448..13694468,13707240..13707393,
FT                   13724413..13724553,13730487..13730536,13734058..13734132,
FT                   13737154..13737273,13746430..13746547,13749294..13749382,
FT                   13749459..13749575,13757429..13757527,13776605..13776637,
FT                   13783591..13783707,13794723..13794796,13821007..13821092,
FT                   13822735..13822824,13836718..13836878,13939683..13939747,
FT                   14037377..14037467,14048503..14048698,14212656..14212776,
FT                   14214043..14214103,14240190..14243856)
FT                   /gene="Dgkb"
FT                   /locus_tag="mCG_145718"
FT                   /product="diacylglycerol kinase, beta, transcript variant
FT                   mCT185315"
FT                   /note="gene_id=mCG145718.0 transcript_id=mCT185315.0
FT                   created on 11-JUN-2003"
FT   assembly_gap    13503955..13503974
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13515159..13515178
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13528551..13528570
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13557858..13557877
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13562876..13563320
FT                   /estimated_length=445
FT                   /gap_type="unknown"
FT   CDS             join(13603102..13603171,13691042..13691118,
FT                   13694448..13694468,13707240..13707393,13724413..13724553,
FT                   13730487..13730536,13734058..13734132,13737154..13737273,
FT                   13746430..13746547,13749294..13749382,13749459..13749575,
FT                   13757429..13757527,13776605..13776637,13783591..13783707,
FT                   13794723..13794796,13821007..13821092,13822735..13822824,
FT                   13836718..13836878,13939683..13939747,14037377..14037467,
FT                   14048503..14048698,14212656..14212776,14214043..14214103,
FT                   14240190..14240297)
FT                   /codon_start=1
FT                   /gene="Dgkb"
FT                   /locus_tag="mCG_145718"
FT                   /product="diacylglycerol kinase, beta, isoform CRA_b"
FT                   /note="gene_id=mCG145718.0 transcript_id=mCT185315.0
FT                   protein_id=mCP106573.0 isoform=CRA_b"
FT                   /protein_id="EDL36840.1"
FT   CDS             join(13603102..13603171,13691042..13691118,
FT                   13707240..13707393,13724413..13724553,13730487..13730536,
FT                   13734058..13734132,13737154..13737273,13746430..13746547,
FT                   13749294..13749382,13749459..13749575,13757429..13757527,
FT                   13776605..13776637,13783591..13783707,13794723..13794796,
FT                   13821007..13821092,13822735..13822824,13836718..13836878,
FT                   13939683..13939747,14037377..14037467,14048503..14048698,
FT                   14212656..14212776,14214043..14214103,14240190..14240297)
FT                   /codon_start=1
FT                   /gene="Dgkb"
FT                   /locus_tag="mCG_145718"
FT                   /product="diacylglycerol kinase, beta, isoform CRA_a"
FT                   /note="gene_id=mCG145718.0 transcript_id=mCT185314.0
FT                   protein_id=mCP106572.0 isoform=CRA_a"
FT                   /protein_id="EDL36839.1"
FT                   TGLFCSLIKRTRNRSKE"
FT   assembly_gap    13615139..13615247
FT                   /estimated_length=109
FT                   /gap_type="unknown"
FT   assembly_gap    13651649..13651668
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13659810..13659978
FT                   /estimated_length=169
FT                   /gap_type="unknown"
FT   assembly_gap    13661285..13663327
FT                   /estimated_length=2043
FT                   /gap_type="unknown"
FT   assembly_gap    13681854..13682281
FT                   /estimated_length=428
FT                   /gap_type="unknown"
FT   assembly_gap    13714291..13714310
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13715526..13715545
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13716768..13716787
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13733743..13733762
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13771051..13771070
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13791479..13791498
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13798630..13799751
FT                   /estimated_length=1122
FT                   /gap_type="unknown"
FT   assembly_gap    13800809..13800828
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13802683..13802702
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13804178..13804197
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13805957..13806209
FT                   /estimated_length=253
FT                   /gap_type="unknown"
FT   assembly_gap    13811119..13811138
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13828434..13828453
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13830350..13830369
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13833054..13833073
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13849568..13849587
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13881395..13881414
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13925579..13925598
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13952261..13952280
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13977120..13977159
FT                   /estimated_length=40
FT                   /gap_type="unknown"
FT   gene            complement(13978334..13978893)
FT                   /pseudo
FT                   /locus_tag="mCG_53631"
FT                   /note="gene_id=mCG53631.0"
FT   mRNA            complement(join(13978334..13978496,13978751..13978893))
FT                   /pseudo
FT                   /locus_tag="mCG_53631"
FT                   /note="gene_id=mCG53631.0 transcript_id=mCT53814.0 created
FT                   on 09-SEP-2002"
FT   assembly_gap    14019391..14019410
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14038413..14039400
FT                   /estimated_length=988
FT                   /gap_type="unknown"
FT   assembly_gap    14041614..14041751
FT                   /estimated_length=138
FT                   /gap_type="unknown"
FT   assembly_gap    14051458..14051477
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14068235..14068502
FT                   /estimated_length=268
FT                   /gap_type="unknown"
FT   assembly_gap    14081394..14081413
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14122921..14123913
FT                   /estimated_length=993
FT                   /gap_type="unknown"
FT   assembly_gap    14130954..14130973
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14134192..14134240
FT                   /estimated_length=49
FT                   /gap_type="unknown"
FT   assembly_gap    14138068..14139957
FT                   /estimated_length=1890
FT                   /gap_type="unknown"
FT   assembly_gap    14160088..14160107
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(14162430..>14225393)
FT                   /locus_tag="mCG_1041909"
FT                   /note="gene_id=mCG1041909.0"
FT   mRNA            complement(join(14162430..14162480,14165616..14165703,
FT                   14170237..14170312,14170563..14170695,14172135..14172166,
FT                   14195063..14195245,14200096..14200198,14200622..14200689,
FT                   14224276..>14225393))
FT                   /locus_tag="mCG_1041909"
FT                   /product="mCG1041909"
FT                   /note="gene_id=mCG1041909.0 transcript_id=mCT159613.0
FT                   created on 25-SEP-2002"
FT   assembly_gap    14177364..14177383
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14200052..14200073
FT                   /estimated_length=22
FT                   /gap_type="unknown"
FT   assembly_gap    14211082..14211471
FT                   /estimated_length=390
FT                   /gap_type="unknown"
FT   CDS             complement(14225211..14225393)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041909"
FT                   /product="mCG1041909"
FT                   /note="gene_id=mCG1041909.0 transcript_id=mCT159613.0
FT                   protein_id=mCP78873.1"
FT                   /protein_id="EDL36841.1"
FT                   DLEKEQKELKEFANP"
FT   assembly_gap    14233422..14233590
FT                   /estimated_length=169
FT                   /gap_type="unknown"
FT   assembly_gap    14235482..14235551
FT                   /estimated_length=70
FT                   /gap_type="unknown"
FT   assembly_gap    14272203..14272222
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14286417..14286608
FT                   /estimated_length=192
FT                   /gap_type="unknown"
FT   gene            14317558..14318273
FT                   /pseudo
FT                   /locus_tag="mCG_1041677"
FT                   /note="gene_id=mCG1041677.0"
FT   mRNA            join(14317558..14317574,14317594..14317728,
FT                   14317775..14317889,14318152..14318273)
FT                   /pseudo
FT                   /locus_tag="mCG_1041677"
FT                   /note="gene_id=mCG1041677.0 transcript_id=mCT159381.0
FT                   created on 25-SEP-2002"
FT   assembly_gap    14318490..14318509
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14321343..14321362
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14348670..14348689
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<14351281..>14351772)
FT                   /locus_tag="mCG_64478"
FT                   /note="gene_id=mCG64478.0"
FT   mRNA            complement(<14351281..>14351772)
FT                   /locus_tag="mCG_64478"
FT                   /product="mCG64478"
FT                   /note="gene_id=mCG64478.0 transcript_id=mCT64661.0 created
FT                   on 25-SEP-2002"
FT   CDS             complement(14351281..14351772)
FT                   /codon_start=1
FT                   /locus_tag="mCG_64478"
FT                   /product="mCG64478"
FT                   /note="gene_id=mCG64478.0 transcript_id=mCT64661.0
FT                   protein_id=mCP42607.0"
FT                   /protein_id="EDL36838.1"
FT                   "
FT   assembly_gap    14355504..14355690
FT                   /estimated_length=187
FT                   /gap_type="unknown"
FT   gene            14386592..14475136
FT                   /gene="Etv1"
FT                   /locus_tag="mCG_19074"
FT                   /note="gene_id=mCG19074.3"
FT   mRNA            join(14386592..14386704,14387132..14387263,
FT                   14388083..14388170,14389522..14389569,14399455..14399508,
FT                   14434613..14434742,14437928..14438116,14441916..14442163,
FT                   14459068..14459135,14461006..14461074,14463787..14463956,
FT                   14468217..14468318,14472481..14475136)
FT                   /gene="Etv1"
FT                   /locus_tag="mCG_19074"
FT                   /product="ets variant gene 1, transcript variant mCT16917"
FT                   /note="gene_id=mCG19074.3 transcript_id=mCT16917.3 created
FT                   on 24-NOV-2004"
FT   CDS             join(14387219..14387263,14388083..14388170,
FT                   14389522..14389569,14399455..14399508,14434613..14434742,
FT                   14437928..14438116,14441916..14442163,14459068..14459135,
FT                   14461006..14461074,14463787..14463873)
FT                   /codon_start=1
FT                   /gene="Etv1"
FT                   /locus_tag="mCG_19074"
FT                   /product="ets variant gene 1, isoform CRA_c"
FT                   /note="gene_id=mCG19074.3 transcript_id=mCT16917.3
FT                   protein_id=mCP22794.3 isoform=CRA_c"
FT                   /protein_id="EDL36836.1"
FT                   W"
FT   mRNA            join(14387413..14387586,14388083..14388170,
FT                   14389522..14389569,14399455..14399508,14434613..14434742,
FT                   14437928..14438116,14441916..14442163,14459068..14459135,
FT                   14461006..14461074,14463787..14463956,14468217..14468318,
FT                   14472481..14475136)
FT                   /gene="Etv1"
FT                   /locus_tag="mCG_19074"
FT                   /product="ets variant gene 1, transcript variant mCT193489"
FT                   /note="gene_id=mCG19074.3 transcript_id=mCT193489.1 created
FT                   on 24-NOV-2004"
FT   CDS             join(14387494..14387586,14388083..14388170,
FT                   14389522..14389569,14399455..14399508,14434613..14434742,
FT                   14437928..14438116,14441916..14442163,14459068..14459135,
FT                   14461006..14461074,14463787..14463873)
FT                   /codon_start=1
FT                   /gene="Etv1"
FT                   /locus_tag="mCG_19074"
FT                   /product="ets variant gene 1, isoform CRA_b"
FT                   /note="gene_id=mCG19074.3 transcript_id=mCT193489.1
FT                   protein_id=mCP114462.1 isoform=CRA_b"
FT                   /protein_id="EDL36835.1"
FT                   KDPRTRGEDPSSSGSFW"
FT   mRNA            join(14387848..14387994,14388083..14388170,
FT                   14389522..14389569,14399455..14399508,14434613..14434742,
FT                   14437928..14438116,14441916..14442163,14459068..14459135,
FT                   14461006..14461074,14463787..14463956,14468217..14468318,
FT                   14472481..14475136)
FT                   /gene="Etv1"
FT                   /locus_tag="mCG_19074"
FT                   /product="ets variant gene 1, transcript variant mCT193488"
FT                   /note="gene_id=mCG19074.3 transcript_id=mCT193488.1 created
FT                   on 24-NOV-2004"
FT   CDS             join(14387863..14387994,14388083..14388170,
FT                   14389522..14389569,14399455..14399508,14434613..14434742,
FT                   14437928..14438116,14441916..14442163,14459068..14459135,
FT                   14461006..14461074,14463787..14463873)
FT                   /codon_start=1
FT                   /gene="Etv1"
FT                   /locus_tag="mCG_19074"
FT                   /product="ets variant gene 1, isoform CRA_a"
FT                   /note="gene_id=mCG19074.3 transcript_id=mCT193488.1
FT                   protein_id=mCP114461.1 isoform=CRA_a"
FT                   /protein_id="EDL36834.1"
FT   mRNA            join(14389994..14390086,14399455..14399508,
FT                   14434613..14434742,14437928..14438116,14441916..14442163,
FT                   14459068..14459135,14461006..14461074,14463787..14463956,
FT                   14468217..14468318,14472481..14475136)
FT                   /gene="Etv1"
FT                   /locus_tag="mCG_19074"
FT                   /product="ets variant gene 1, transcript variant mCT194590"
FT                   /note="gene_id=mCG19074.3 transcript_id=mCT194590.0 created
FT                   on 24-NOV-2004"
FT   CDS             join(14390026..14390086,14399455..14399508,
FT                   14434613..14434742,14437928..14438116,14441916..14442163,
FT                   14459068..14459135,14461006..14461074,14463787..14463873)
FT                   /codon_start=1
FT                   /gene="Etv1"
FT                   /locus_tag="mCG_19074"
FT                   /product="ets variant gene 1, isoform CRA_d"
FT                   /note="gene_id=mCG19074.3 transcript_id=mCT194590.0
FT                   protein_id=mCP115619.0 isoform=CRA_d"
FT                   /protein_id="EDL36837.1"
FT   assembly_gap    14413311..14413330
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14422600..14423908
FT                   /estimated_length=1309
FT                   /gap_type="unknown"
FT   assembly_gap    14432158..14432331
FT                   /estimated_length=174
FT                   /gap_type="unknown"
FT   assembly_gap    14466567..14466586
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14475242..14475261
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14478965..14478984
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14483301..14483320
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14493612..14493631
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14502732..14502789
FT                   /estimated_length=58
FT                   /gap_type="unknown"
FT   assembly_gap    14521736..14521755
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14523486..14524796
FT                   /estimated_length=1311
FT                   /gap_type="unknown"
FT   assembly_gap    14562679..14562726
FT                   /estimated_length=48
FT                   /gap_type="unknown"
FT   assembly_gap    14595428..14596303
FT                   /estimated_length=876
FT                   /gap_type="unknown"
FT   assembly_gap    14596905..14598972
FT                   /estimated_length=2068
FT                   /gap_type="unknown"
FT   assembly_gap    14600856..14600875
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14606152..14606171
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14645679..14645698
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14670824..14670843
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14695294..14695313
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14723061..14723080
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14747877..14747907
FT                   /estimated_length=31
FT                   /gap_type="unknown"
FT   assembly_gap    14798515..14799334
FT                   /estimated_length=820
FT                   /gap_type="unknown"
FT   assembly_gap    14804366..14804385
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14806207..14806248
FT                   /estimated_length=42
FT                   /gap_type="unknown"
FT   assembly_gap    14818246..14818381
FT                   /estimated_length=136
FT                   /gap_type="unknown"
FT   assembly_gap    14845284..14845820
FT                   /estimated_length=537
FT                   /gap_type="unknown"
FT   assembly_gap    14848502..14853501
FT                   /estimated_length=5000
FT                   /gap_type="unknown"
FT   assembly_gap    14944159..14944178
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14956126..14956201
FT                   /estimated_length=76
FT                   /gap_type="unknown"
FT   assembly_gap    14966432..14966465
FT                   /estimated_length=34
FT                   /gap_type="unknown"
FT   assembly_gap    14972297..14975411
FT                   /estimated_length=3115
FT                   /gap_type="unknown"
FT   assembly_gap    14977588..14977649
FT                   /estimated_length=62
FT                   /gap_type="unknown"
FT   assembly_gap    15026655..15026674
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15028974..15030291
FT                   /estimated_length=1318
FT                   /gap_type="unknown"
FT   assembly_gap    15057822..15057891
FT                   /estimated_length=70
FT                   /gap_type="unknown"
FT   assembly_gap    15064711..15064730
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15086444..15086463
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15092481..15092500
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15113828..15115371
FT                   /estimated_length=1544
FT                   /gap_type="unknown"
FT   assembly_gap    15150475..15151901
FT                   /estimated_length=1427
FT                   /gap_type="unknown"
FT   assembly_gap    15177186..15177205
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15186642..15186661
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15188908..15188927
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15235284..15235396
FT                   /estimated_length=113
FT                   /gap_type="unknown"
FT   assembly_gap    15250831..15250851
FT                   /estimated_length=21
FT                   /gap_type="unknown"
FT   assembly_gap    15328732..15328751
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15378655..15378674
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15391215..15391234
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15413611..15413630
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15435229..15435248
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15436280..15436299
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15461561..15461884
FT                   /estimated_length=324
FT                   /gap_type="unknown"
FT   assembly_gap    15476662..15476839
FT                   /estimated_length=178
FT                   /gap_type="unknown"
FT   gene            <15488287..15489714
FT                   /locus_tag="mCG_5065"
FT                   /note="gene_id=mCG5065.1"
FT   mRNA            join(<15488287..15488459,15489039..15489714)
FT                   /locus_tag="mCG_5065"
FT                   /product="mCG5065"
FT                   /note="gene_id=mCG5065.1 transcript_id=mCT4253.1 created on
FT                   09-SEP-2002"
FT   CDS             join(15488287..15488459,15489039..15489273)
FT                   /codon_start=1
FT                   /locus_tag="mCG_5065"
FT                   /product="mCG5065"
FT                   /note="gene_id=mCG5065.1 transcript_id=mCT4253.1
FT                   protein_id=mCP22802.1"
FT                   /protein_id="EDL36833.1"
FT   assembly_gap    15493531..15493550
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15496335..15496779
FT                   /estimated_length=445
FT                   /gap_type="unknown"
FT   assembly_gap    15514802..15517586
FT                   /estimated_length=2785
FT                   /gap_type="unknown"
FT   assembly_gap    15536851..15537058
FT                   /estimated_length=208
FT                   /gap_type="unknown"
FT   assembly_gap    15563351..15563476
FT                   /estimated_length=126
FT                   /gap_type="unknown"
FT   assembly_gap    15616407..15616506
FT                   /estimated_length=100
FT                   /gap_type="unknown"
FT   gene            complement(15620128..15651331)
FT                   /locus_tag="mCG_5062"
FT                   /note="gene_id=mCG5062.1"
FT   mRNA            complement(join(15620128..15620193,15621521..15621554,
FT                   15623102..15623220,15624692..15624860,15649968..15650234,
FT                   15650664..15650819))
FT                   /locus_tag="mCG_5062"
FT                   /product="mCG5062, transcript variant mCT172865"
FT                   /note="gene_id=mCG5062.1 transcript_id=mCT172865.0 created
FT                   on 13-JUN-2003"
FT   CDS             complement(join(15624846..15624860,15649968..15650147))
FT                   /codon_start=1
FT                   /locus_tag="mCG_5062"
FT                   /product="mCG5062, isoform CRA_a"
FT                   /note="gene_id=mCG5062.1 transcript_id=mCT172865.0
FT                   protein_id=mCP95784.0 isoform=CRA_a"
FT                   /db_xref="GOA:G3UVX1"
FT                   /db_xref="InterPro:IPR006689"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:99437"
FT                   /db_xref="UniProtKB/TrEMBL:G3UVX1"
FT                   /protein_id="EDL36829.1"
FT   mRNA            complement(join(15646693..15648286,15648576..15650234,
FT                   15650664..15650819))
FT                   /locus_tag="mCG_5062"
FT                   /product="mCG5062, transcript variant mCT185587"
FT                   /note="gene_id=mCG5062.1 transcript_id=mCT185587.0 created
FT                   on 13-JUN-2003"
FT   mRNA            complement(join(15647443..15650234,15651239..15651331))
FT                   /locus_tag="mCG_5062"
FT                   /product="mCG5062, transcript variant mCT185588"
FT                   /note="gene_id=mCG5062.1 transcript_id=mCT185588.0 created
FT                   on 13-JUN-2003"
FT   mRNA            complement(join(15647443..15650234,15650664..15650819))
FT                   /locus_tag="mCG_5062"
FT                   /product="mCG5062, transcript variant mCT4255"
FT                   /note="gene_id=mCG5062.1 transcript_id=mCT4255.1 created on
FT                   13-JUN-2003"
FT   CDS             complement(15649545..15650147)
FT                   /codon_start=1
FT                   /locus_tag="mCG_5062"
FT                   /product="mCG5062, isoform CRA_b"
FT                   /note="gene_id=mCG5062.1 transcript_id=mCT185587.0
FT                   protein_id=mCP106845.0 isoform=CRA_b"
FT                   /protein_id="EDL36830.1"
FT   CDS             complement(15649545..15650147)
FT                   /codon_start=1
FT                   /locus_tag="mCG_5062"
FT                   /product="mCG5062, isoform CRA_b"
FT                   /note="gene_id=mCG5062.1 transcript_id=mCT185588.0
FT                   protein_id=mCP106846.0 isoform=CRA_b"
FT                   /protein_id="EDL36831.1"
FT   CDS             complement(15649545..15650147)
FT                   /codon_start=1
FT                   /locus_tag="mCG_5062"
FT                   /product="mCG5062, isoform CRA_b"
FT                   /note="gene_id=mCG5062.1 transcript_id=mCT4255.1
FT                   protein_id=mCP22797.1 isoform=CRA_b"
FT                   /protein_id="EDL36832.1"
FT   gene            15651728..15653426
FT                   /locus_tag="mCG_148258"
FT                   /note="gene_id=mCG148258.0"
FT   mRNA            join(15651728..15651906,15653088..15653426)
FT                   /locus_tag="mCG_148258"
FT                   /product="mCG148258"
FT                   /note="gene_id=mCG148258.0 transcript_id=mCT188521.0
FT                   created on 13-JAN-2004"
FT   CDS             join(15651819..15651906,15653088..15653236)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148258"
FT                   /product="mCG148258"
FT                   /note="gene_id=mCG148258.0 transcript_id=mCT188521.0
FT                   protein_id=mCP108092.0"
FT                   /protein_id="EDL36828.1"
FT   gene            complement(15673174..>15747828)
FT                   /gene="Scin"
FT                   /locus_tag="mCG_5064"
FT                   /note="gene_id=mCG5064.1"
FT   mRNA            complement(join(15673174..15674028,15674558..15674618,
FT                   15676613..15676690,15686703..15686873,15690338..15690428,
FT                   15690872..15690993,15692997..15693212,15694333..15694421,
FT                   15695043..15695175,15698137..15698229,15718674..15718823,
FT                   15738212..15738373,15741526..15741680,15747555..>15747828))
FT                   /gene="Scin"
FT                   /locus_tag="mCG_5064"
FT                   /product="scinderin"
FT                   /note="gene_id=mCG5064.1 transcript_id=mCT4252.1 created on
FT                   30-AUG-2002"
FT   CDS             complement(join(15673901..15674028,15674558..15674618,
FT                   15676613..15676690,15686703..15686873,15690338..15690428,
FT                   15690872..15690993,15692997..15693212,15694333..15694421,
FT                   15695043..15695175,15698137..15698229,15718674..15718823,
FT                   15738212..15738373,15741526..15741680,15747555..>15747828))
FT                   /codon_start=1
FT                   /gene="Scin"
FT                   /locus_tag="mCG_5064"
FT                   /product="scinderin"
FT                   /note="gene_id=mCG5064.1 transcript_id=mCT4252.1
FT                   protein_id=mCP22798.0"
FT                   /protein_id="EDL36827.1"
FT                   DSSRW"
FT   assembly_gap    15696560..15696579
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15718552..15718619
FT                   /estimated_length=68
FT                   /gap_type="unknown"
FT   assembly_gap    15733272..15733291
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15750571..15751109
FT                   /estimated_length=539
FT                   /gap_type="unknown"
FT   gene            complement(15790405..15812536)
FT                   /locus_tag="mCG_65656"
FT                   /note="gene_id=mCG65656.2"
FT   mRNA            complement(join(15790405..15790897,15794315..15794443,
FT                   15798884..15799015,15812430..15812536))
FT                   /locus_tag="mCG_65656"
FT                   /product="mCG65656"
FT                   /note="gene_id=mCG65656.2 transcript_id=mCT65839.2 created
FT                   on 09-SEP-2002"
FT   CDS             complement(join(15790767..15790897,15794315..15794443,
FT                   15798884..15799010))
FT                   /codon_start=1
FT                   /locus_tag="mCG_65656"
FT                   /product="mCG65656"
FT                   /note="gene_id=mCG65656.2 transcript_id=mCT65839.2
FT                   protein_id=mCP42608.2"
FT                   /db_xref="GOA:B2RVW5"
FT                   /db_xref="InterPro:IPR028099"
FT                   /db_xref="MGI:MGI:2685735"
FT                   /db_xref="UniProtKB/TrEMBL:B2RVW5"
FT                   /protein_id="EDL36826.1"
FT   assembly_gap    15800526..15801019
FT                   /estimated_length=494
FT                   /gap_type="unknown"
FT   gene            complement(15816353..15836387)
FT                   /gene="Ifrd1"
FT                   /locus_tag="mCG_5061"
FT                   /note="gene_id=mCG5061.1"
FT   mRNA            complement(join(15816353..15816674,15817142..15817237,
FT                   15817520..15817648,15820212..15820346,15825533..15825641,
FT                   15826162..15826340,15826432..15826482,15827201..15827358,
FT                   15829413..15829537,15830381..15830465,15830601..15830705,
FT                   15836092..15836387))
FT                   /gene="Ifrd1"
FT                   /locus_tag="mCG_5061"
FT                   /product="interferon-related developmental regulator 1"
FT                   /note="gene_id=mCG5061.1 transcript_id=mCT4262.1 created on
FT                   25-SEP-2002"
FT   CDS             complement(join(15816585..15816674,15817142..15817237,
FT                   15817520..15817648,15820212..15820346,15825533..15825641,
FT                   15826162..15826340,15826432..15826482,15827201..15827358,
FT                   15829413..15829537,15830381..15830465,15830601..15830705,
FT                   15836092..15836179))
FT                   /codon_start=1
FT                   /gene="Ifrd1"
FT                   /locus_tag="mCG_5061"
FT                   /product="interferon-related developmental regulator 1"
FT                   /note="gene_id=mCG5061.1 transcript_id=mCT4262.1
FT                   protein_id=mCP22799.1"
FT                   /db_xref="GOA:P19182"
FT                   /db_xref="InterPro:IPR006921"
FT                   /db_xref="InterPro:IPR007701"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="MGI:MGI:1316717"
FT                   /db_xref="UniProtKB/Swiss-Prot:P19182"
FT                   /protein_id="EDL36825.1"
FT   gene            <15836267..15842411
FT                   /locus_tag="mCG_5063"
FT                   /note="gene_id=mCG5063.1"
FT   mRNA            join(<15836267..15836776,15837892..15838099,
FT                   15842250..15842411)
FT                   /locus_tag="mCG_5063"
FT                   /product="mCG5063"
FT                   /note="gene_id=mCG5063.1 transcript_id=mCT4251.1 created on
FT                   09-SEP-2002"
FT   CDS             <15836323..15836763
FT                   /codon_start=1
FT                   /locus_tag="mCG_5063"
FT                   /product="mCG5063"
FT                   /note="gene_id=mCG5063.1 transcript_id=mCT4251.1
FT                   protein_id=mCP22803.1"
FT                   /protein_id="EDL36824.1"
FT   assembly_gap    15846808..15846827
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15911609..15911628
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(15928247..>16057311)
FT                   /locus_tag="mCG_61794"
FT                   /note="gene_id=mCG61794.2"
FT   mRNA            complement(join(15928247..15929104,15930292..15930466,
FT                   15931736..15931778,15933826..15933922,15935754..15935821,
FT                   15941899..15942031,15942709..15942819,15948508..15948599,
FT                   15976365..15976447,15977313..15977401,15989691..15989892,
FT                   16022113..16022490,16057195..>16057304))
FT                   /locus_tag="mCG_61794"
FT                   /product="mCG61794, transcript variant mCT193439"
FT                   /note="gene_id=mCG61794.2 transcript_id=mCT193439.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(15928249..15928613,15928982..15929104,
FT                   15935754..15935821,15941899..15942024,15948548..15948599,
FT                   15989691..15989892,16057195..16057307))
FT                   /locus_tag="mCG_61794"
FT                   /product="mCG61794, transcript variant mCT61977"
FT                   /note="gene_id=mCG61794.2 transcript_id=mCT61977.1 created
FT                   on 25-SEP-2002"
FT   CDS             complement(join(15928544..15928613,15928982..15929104,
FT                   15935754..15935821,15941899..15942024,15948548..15948599,
FT                   15989691..15989892,16057195..16057288))
FT                   /codon_start=1
FT                   /locus_tag="mCG_61794"
FT                   /product="mCG61794, isoform CRA_d"
FT                   /note="gene_id=mCG61794.2 transcript_id=mCT61977.1
FT                   protein_id=mCP42603.2 isoform=CRA_d"
FT                   /protein_id="EDL36823.1"
FT   mRNA            complement(join(15928761..15929104,15930292..15930466,
FT                   15931736..15931778,15933826..15933922,15935754..15935821,
FT                   15941899..15942031,15942709..15942819,15948508..15948599,
FT                   15976365..15976447,15977313..15977401,15989691..15989892,
FT                   16057195..>16057311))
FT                   /locus_tag="mCG_61794"
FT                   /product="mCG61794, transcript variant mCT193438"
FT                   /note="gene_id=mCG61794.2 transcript_id=mCT193438.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(15928918..15929104,15930292..15930466,
FT                   15931736..15931778,15933826..15933922,15935754..15935821,
FT                   15941899..15942031,15942709..15942819,15948508..15948599,
FT                   15976365..15976447,15977313..15977401,15989691..15989892,
FT                   16057195..>16057309))
FT                   /codon_start=1
FT                   /locus_tag="mCG_61794"
FT                   /product="mCG61794, isoform CRA_b"
FT                   /note="gene_id=mCG61794.2 transcript_id=mCT193438.0
FT                   protein_id=mCP114438.0 isoform=CRA_b"
FT                   /protein_id="EDL36821.1"
FT                   QGCLEN"
FT   CDS             complement(join(15928918..15929104,15930292..15930466,
FT                   15931736..15931778,15933826..15933922,15935754..15935821,
FT                   15941899..15942031,15942709..15942819,15948508..15948599,
FT                   15976365..15976447,15977313..15977401,15989691..15989892,
FT                   16022113..16022490,16057195..>16057303))
FT                   /codon_start=1
FT                   /locus_tag="mCG_61794"
FT                   /product="mCG61794, isoform CRA_c"
FT                   /note="gene_id=mCG61794.2 transcript_id=mCT193439.0
FT                   protein_id=mCP114439.0 isoform=CRA_c"
FT                   /protein_id="EDL36822.1"
FT                   LNQLLLQGCLEN"
FT   mRNA            complement(join(<15933834..15933922,15935754..15935821,
FT                   15941899..15942031,15942709..15942819,15948508..15948599,
FT                   15976365..15976447,15977313..15977401,16057195..>16057286))
FT                   /locus_tag="mCG_61794"
FT                   /product="mCG61794, transcript variant mCT193437"
FT                   /note="gene_id=mCG61794.2 transcript_id=mCT193437.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(<15933834..15933922,15935754..15935821,
FT                   15941899..15942031,15942709..15942819,15948508..15948599,
FT                   15976365..15976447,15977313..15977401,16057195..>16057196))
FT                   /codon_start=1
FT                   /locus_tag="mCG_61794"
FT                   /product="mCG61794, isoform CRA_a"
FT                   /note="gene_id=mCG61794.2 transcript_id=mCT193437.0
FT                   protein_id=mCP114437.0 isoform=CRA_a"
FT                   /protein_id="EDL36820.1"
FT                   "
FT   assembly_gap    15952804..15952904
FT                   /estimated_length=101
FT                   /gap_type="unknown"
FT   assembly_gap    15985475..15985494
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16004813..16004844
FT                   /estimated_length=32
FT                   /gap_type="unknown"
FT   assembly_gap    16005610..16005629
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16013014..16016472
FT                   /estimated_length=3459
FT                   /gap_type="unknown"
FT   assembly_gap    16019159..16019178
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16077040..16077059
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16146024..16146120
FT                   /estimated_length=97
FT                   /gap_type="unknown"
FT   assembly_gap    16162123..16162142
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16172753..16172772
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16207553..16207572
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16214872..16214891
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            16248910..>16457797
FT                   /gene="Dock4"
FT                   /locus_tag="mCG_125566"
FT                   /note="gene_id=mCG125566.0"
FT   mRNA            join(16248910..16249058,16253189..16253273,
FT                   16262007..16262158,16281075..16281156,16281677..16281737,
FT                   16285412..16285544,16289373..16289461,16305636..16305761,
FT                   16315583..16315707,16317053..16317215,16323516..16323622,
FT                   16338368..16338529,16342765..16342848,16343009..16343109,
FT                   16344546..16344627,16345897..16346067,16350086..16350278,
FT                   16358376..16358503,16360697..16360831,16378717..16378811,
FT                   16389650..16389725,16391583..16391683,16392106..16392164,
FT                   16400688..16400836,16402536..16402621,16407228..16407323,
FT                   16408097..16408157,16412121..16412235,16420025..16420173,
FT                   16423620..16423706,16425395..16425499,16430770..16430928,
FT                   16433765..16433851,16441932..16442108,16442764..16442847,
FT                   16445366..16445485,16446322..16446387,16449782..16449854,
FT                   16457393..>16457797)
FT                   /gene="Dock4"
FT                   /locus_tag="mCG_125566"
FT                   /product="dedicator of cytokinesis 4"
FT                   /note="gene_id=mCG125566.0 transcript_id=mCT126827.0
FT                   created on 09-SEP-2002"
FT   CDS             join(16248949..16249058,16253189..16253273,
FT                   16262007..16262158,16281075..16281156,16281677..16281737,
FT                   16285412..16285544,16289373..16289461,16305636..16305761,
FT                   16315583..16315707,16317053..16317215,16323516..16323622,
FT                   16338368..16338529,16342765..16342848,16343009..16343109,
FT                   16344546..16344627,16345897..16346067,16350086..16350278,
FT                   16358376..16358503,16360697..16360831,16378717..16378811,
FT                   16389650..16389725,16391583..16391683,16392106..16392164,
FT                   16400688..16400836,16402536..16402621,16407228..16407323,
FT                   16408097..16408157,16412121..16412235,16420025..16420173,
FT                   16423620..16423706,16425395..16425499,16430770..16430928,
FT                   16433765..16433851,16441932..16442108,16442764..16442847,
FT                   16445366..16445485,16446322..16446387,16449782..16449854,
FT                   16457393..>16457797)
FT                   /codon_start=1
FT                   /gene="Dock4"
FT                   /locus_tag="mCG_125566"
FT                   /product="dedicator of cytokinesis 4"
FT                   /note="gene_id=mCG125566.0 transcript_id=mCT126827.0
FT                   protein_id=mCP78444.1"
FT                   /protein_id="EDL36819.1"
FT   assembly_gap    16376029..16376481
FT                   /estimated_length=453
FT                   /gap_type="unknown"
FT   assembly_gap    16415455..16415474
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16484257..16493417
FT                   /estimated_length=9161
FT                   /gap_type="unknown"
FT   gene            complement(16494939..>16496047)
FT                   /locus_tag="mCG_14809"
FT                   /note="gene_id=mCG14809.1"
FT   mRNA            complement(16494939..>16496047)
FT                   /locus_tag="mCG_14809"
FT                   /product="mCG14809"
FT                   /note="gene_id=mCG14809.1 transcript_id=mCT20323.1 created
FT                   on 06-SEP-2002"
FT   CDS             complement(16495139..>16495810)
FT                   /codon_start=1
FT                   /locus_tag="mCG_14809"
FT                   /product="mCG14809"
FT                   /note="gene_id=mCG14809.1 transcript_id=mCT20323.1
FT                   protein_id=mCP22792.1"
FT                   /protein_id="EDL36818.1"
FT                   D"
FT   assembly_gap    16505095..16505645
FT                   /estimated_length=551
FT                   /gap_type="unknown"
FT   assembly_gap    16543924..16544713
FT                   /estimated_length=790
FT                   /gap_type="unknown"
FT   assembly_gap    16596059..16596256
FT                   /estimated_length=198
FT                   /gap_type="unknown"
FT   assembly_gap    16602467..16602680
FT                   /estimated_length=214
FT                   /gap_type="unknown"
FT   gene            16635992..17550181
FT                   /gene="Immp2l"
FT                   /locus_tag="mCG_142422"
FT                   /note="gene_id=mCG142422.0"
FT   mRNA            join(16635992..16636052,16680122..16680258,
FT                   16722658..16722761,17228606..17228671,17303367..17303469,
FT                   17549920..17550181)
FT                   /gene="Immp2l"
FT                   /locus_tag="mCG_142422"
FT                   /product="IMP2 inner mitochondrial membrane peptidase-like
FT                   (S. cerevisiae)"
FT                   /note="gene_id=mCG142422.0 transcript_id=mCT180460.0
FT                   created on 13-FEB-2003"
FT   assembly_gap    16655042..16655061
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(16680124..16680258,16722658..16722761,
FT                   17228606..17228671,17303367..17303469,17549920..17550039)
FT                   /codon_start=1
FT                   /gene="Immp2l"
FT                   /locus_tag="mCG_142422"
FT                   /product="IMP2 inner mitochondrial membrane peptidase-like
FT                   (S. cerevisiae)"
FT                   /note="gene_id=mCG142422.0 transcript_id=mCT180460.0
FT                   protein_id=mCP103382.0"
FT                   /protein_id="EDL36816.1"
FT                   PPERCPLQTGEK"
FT   assembly_gap    16727973..16727992
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16729168..16729187
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16750792..16750811
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16752310..16752329
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16758997..16759573
FT                   /estimated_length=577
FT                   /gap_type="unknown"
FT   assembly_gap    16760564..16761518
FT                   /estimated_length=955
FT                   /gap_type="unknown"
FT   assembly_gap    16836246..16836265
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16845631..16846433
FT                   /estimated_length=803
FT                   /gap_type="unknown"
FT   assembly_gap    16852847..16852891
FT                   /estimated_length=45
FT                   /gap_type="unknown"
FT   assembly_gap    16865256..16865955
FT                   /estimated_length=700
FT                   /gap_type="unknown"
FT   assembly_gap    16867267..16867286
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16871236..16871284
FT                   /estimated_length=49
FT                   /gap_type="unknown"
FT   assembly_gap    16878916..16879585
FT                   /estimated_length=670
FT                   /gap_type="unknown"
FT   assembly_gap    16881759..16881989
FT                   /estimated_length=231
FT                   /gap_type="unknown"
FT   assembly_gap    16891411..16892658
FT                   /estimated_length=1248
FT                   /gap_type="unknown"
FT   assembly_gap    16902355..16902374
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16903866..16903885
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16905337..16905356
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16933565..16933584
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16957785..16958131
FT                   /estimated_length=347
FT                   /gap_type="unknown"
FT   assembly_gap    16975592..16975611
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16985015..16990135
FT                   /estimated_length=5121
FT                   /gap_type="unknown"
FT   assembly_gap    16993048..16993071
FT                   /estimated_length=24
FT                   /gap_type="unknown"
FT   assembly_gap    17001157..17001235
FT                   /estimated_length=79
FT                   /gap_type="unknown"
FT   assembly_gap    17019404..17019444
FT                   /estimated_length=41
FT                   /gap_type="unknown"
FT   assembly_gap    17020188..17020598
FT                   /estimated_length=411
FT                   /gap_type="unknown"
FT   assembly_gap    17028961..17028980
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(17058067..17092401)
FT                   /gene="Lrrn3"
FT                   /locus_tag="mCG_148259"
FT                   /note="gene_id=mCG148259.1"
FT   mRNA            complement(join(17058067..17061069,17092004..17092401))
FT                   /gene="Lrrn3"
FT                   /locus_tag="mCG_148259"
FT                   /product="leucine rich repeat protein 3, neuronal"
FT                   /note="gene_id=mCG148259.1 transcript_id=mCT188522.1
FT                   created on 28-SEP-2004"
FT   CDS             complement(17058591..17060714)
FT                   /codon_start=1
FT                   /gene="Lrrn3"
FT                   /locus_tag="mCG_148259"
FT                   /product="leucine rich repeat protein 3, neuronal"
FT                   /note="gene_id=mCG148259.1 transcript_id=mCT188522.1
FT                   protein_id=mCP108094.1"
FT                   /protein_id="EDL36817.1"
FT                   VKATAIGVPTNMS"
FT   assembly_gap    17109958..17114553
FT                   /estimated_length=4596
FT                   /gap_type="unknown"
FT   assembly_gap    17140873..17140892
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17173265..17173284
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17180047..17180100
FT                   /estimated_length=54
FT                   /gap_type="unknown"
FT   assembly_gap    17209755..17210102
FT                   /estimated_length=348
FT                   /gap_type="unknown"
FT   assembly_gap    17300483..17300829
FT                   /estimated_length=347
FT                   /gap_type="unknown"
FT   assembly_gap    17351861..17351980
FT                   /estimated_length=120
FT                   /gap_type="unknown"
FT   assembly_gap    17377477..17377720
FT                   /estimated_length=244
FT                   /gap_type="unknown"
FT   assembly_gap    17412125..17412261
FT                   /estimated_length=137
FT                   /gap_type="unknown"
FT   assembly_gap    17419355..17419379
FT                   /estimated_length=25
FT                   /gap_type="unknown"
FT   assembly_gap    17425546..17426699
FT                   /estimated_length=1154
FT                   /gap_type="unknown"
FT   assembly_gap    17434581..17434600
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17457268..17457896
FT                   /estimated_length=629
FT                   /gap_type="unknown"
FT   assembly_gap    17465219..17465736
FT                   /estimated_length=518
FT                   /gap_type="unknown"
FT   assembly_gap    17505922..17505953
FT                   /estimated_length=32
FT                   /gap_type="unknown"
FT   assembly_gap    17510942..17513169
FT                   /estimated_length=2228
FT                   /gap_type="unknown"
FT   assembly_gap    17516139..17516413
FT                   /estimated_length=275
FT                   /gap_type="unknown"
FT   assembly_gap    17528796..17528861
FT                   /estimated_length=66
FT                   /gap_type="unknown"
FT   assembly_gap    17567942..17567961
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17571058..17572057
FT                   /estimated_length=1000
FT                   /gap_type="unknown"
FT   assembly_gap    17573034..17574792
FT                   /estimated_length=1759
FT                   /gap_type="unknown"
FT   assembly_gap    17609274..17609343
FT                   /estimated_length=70
FT                   /gap_type="unknown"
FT   assembly_gap    17640487..17640511
FT                   /estimated_length=25
FT                   /gap_type="unknown"
FT   assembly_gap    17707778..17707966
FT                   /estimated_length=189
FT                   /gap_type="unknown"
FT   assembly_gap    17739207..17739303
FT                   /estimated_length=97
FT                   /gap_type="unknown"
FT   assembly_gap    17822559..17822786
FT                   /estimated_length=228
FT                   /gap_type="unknown"
FT   assembly_gap    17834697..17835606
FT                   /estimated_length=910
FT                   /gap_type="unknown"
FT   assembly_gap    17838783..17838802
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17854794..17854813
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17874907..17875007
FT                   /estimated_length=101
FT                   /gap_type="unknown"
FT   assembly_gap    17895578..17895599
FT                   /estimated_length=22
FT                   /gap_type="unknown"
FT   assembly_gap    17908110..17908746
FT                   /estimated_length=637
FT                   /gap_type="unknown"
FT   assembly_gap    17926161..17931170
FT                   /estimated_length=5010
FT                   /gap_type="unknown"
FT   assembly_gap    17948496..17950288
FT                   /estimated_length=1793
FT                   /gap_type="unknown"
FT   assembly_gap    17955027..17955078
FT                   /estimated_length=52
FT                   /gap_type="unknown"
FT   assembly_gap    18010759..18010778
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18033571..18033830
FT                   /estimated_length=260
FT                   /gap_type="unknown"
FT   assembly_gap    18034980..18036865
FT                   /estimated_length=1886
FT                   /gap_type="unknown"
FT   assembly_gap    18091433..18091525
FT                   /estimated_length=93
FT                   /gap_type="unknown"
FT   assembly_gap    18101103..18101872
FT                   /estimated_length=770
FT                   /gap_type="unknown"
FT   assembly_gap    18110486..18110562
FT                   /estimated_length=77
FT                   /gap_type="unknown"
FT   assembly_gap    18112627..18112986
FT                   /estimated_length=360
FT                   /gap_type="unknown"
FT   assembly_gap    18120162..18120264
FT                   /estimated_length=103
FT                   /gap_type="unknown"
FT   assembly_gap    18137231..18137250
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18152974..18158540
FT                   /estimated_length=5567
FT                   /gap_type="unknown"
FT   assembly_gap    18172027..18172064
FT                   /estimated_length=38
FT                   /gap_type="unknown"
FT   assembly_gap    18177184..18177222
FT                   /estimated_length=39
FT                   /gap_type="unknown"
FT   assembly_gap    18183962..18185960
FT                   /estimated_length=1999
FT                   /gap_type="unknown"
FT   assembly_gap    18209539..18209558
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18252557..18252576
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18261209..18261228
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18268945..18268964
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18270457..18270476
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18272692..18273767
FT                   /estimated_length=1076
FT                   /gap_type="unknown"
FT   assembly_gap    18300676..18300695
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18312529..18312769
FT                   /estimated_length=241
FT                   /gap_type="unknown"
FT   assembly_gap    18321513..18322725
FT                   /estimated_length=1213
FT                   /gap_type="unknown"
FT   assembly_gap    18332736..18332800
FT                   /estimated_length=65
FT                   /gap_type="unknown"
FT   assembly_gap    18353792..18354525
FT                   /estimated_length=734
FT                   /gap_type="unknown"
FT   assembly_gap    18357242..18357338
FT                   /estimated_length=97
FT                   /gap_type="unknown"
FT   assembly_gap    18358260..18358665
FT                   /estimated_length=406
FT                   /gap_type="unknown"
FT   assembly_gap    18360199..18361543
FT                   /estimated_length=1345
FT                   /gap_type="unknown"
FT   assembly_gap    18379678..18380108
FT                   /estimated_length=431
FT                   /gap_type="unknown"
FT   assembly_gap    18403839..18407527
FT                   /estimated_length=3689
FT                   /gap_type="unknown"
FT   assembly_gap    18416264..18416436
FT                   /estimated_length=173
FT                   /gap_type="unknown"
FT   assembly_gap    18421360..18421502
FT                   /estimated_length=143
FT                   /gap_type="unknown"
FT   assembly_gap    18569522..18569541
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18620155..18622531
FT                   /estimated_length=2377
FT                   /gap_type="unknown"
FT   assembly_gap    18640007..18640026
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18660051..18660070
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18697079..18697098
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18713548..18713645
FT                   /estimated_length=98
FT                   /gap_type="unknown"
FT   assembly_gap    18723988..18724026
FT                   /estimated_length=39
FT                   /gap_type="unknown"
FT   assembly_gap    18740505..18740524
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18758559..18758578
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18771189..18771208
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18773606..18773625
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18794372..18794391
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18796464..18796483
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18809057..18815672
FT                   /estimated_length=6616
FT                   /gap_type="unknown"
FT   assembly_gap    18817836..18817855
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18894884..18894903
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18908257..18908276
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18909318..18909337
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18919773..18919792
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18971148..18971167
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18988972..18989076
FT                   /estimated_length=105
FT                   /gap_type="unknown"
FT   assembly_gap    18998349..18998368
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19002303..19002322
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19042409..19042976
FT                   /estimated_length=568
FT                   /gap_type="unknown"
FT   assembly_gap    19056758..19056777
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19066726..19066745
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19068582..19068982
FT                   /estimated_length=401
FT                   /gap_type="unknown"
FT   assembly_gap    19113547..19113566
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19127038..19127281
FT                   /estimated_length=244
FT                   /gap_type="unknown"
FT   assembly_gap    19130278..19131699
FT                   /estimated_length=1422
FT                   /gap_type="unknown"
FT   assembly_gap    19159804..19159967
FT                   /estimated_length=164
FT                   /gap_type="unknown"
FT   assembly_gap    19179477..19179705
FT                   /estimated_length=229
FT                   /gap_type="unknown"
FT   assembly_gap    19235527..19236270
FT                   /estimated_length=744
FT                   /gap_type="unknown"
FT   assembly_gap    19240500..19240519
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19249771..19249915
FT                   /estimated_length=145
FT                   /gap_type="unknown"
FT   assembly_gap    19252209..19252228
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19253595..19253711
FT                   /estimated_length=117
FT                   /gap_type="unknown"
FT   assembly_gap    19280618..19284226
FT                   /estimated_length=3609
FT                   /gap_type="unknown"
FT   assembly_gap    19311266..19311285
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(19368258..19401931)
FT                   /locus_tag="mCG_1051103"
FT                   /note="gene_id=mCG1051103.0"
FT   mRNA            complement(join(19368258..19370387,19398701..19398801,
FT                   19401783..19401931))
FT                   /locus_tag="mCG_1051103"
FT                   /product="mCG1051103"
FT                   /note="gene_id=mCG1051103.0 transcript_id=mCT194892.0
FT                   created on 27-JAN-2005"
FT   CDS             complement(19369397..19369666)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1051103"
FT                   /product="mCG1051103"
FT                   /note="gene_id=mCG1051103.0 transcript_id=mCT194892.0
FT                   protein_id=mCP115921.0"
FT                   /protein_id="EDL36815.1"
FT   assembly_gap    19377156..19377192
FT                   /estimated_length=37
FT                   /gap_type="unknown"
FT   assembly_gap    19422932..19422972
FT                   /estimated_length=41
FT                   /gap_type="unknown"
FT   assembly_gap    19441792..19441811
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19445053..19446487
FT                   /estimated_length=1435
FT                   /gap_type="unknown"
FT   assembly_gap    19447871..19449834
FT                   /estimated_length=1964
FT                   /gap_type="unknown"
FT   assembly_gap    19486956..19492493
FT                   /estimated_length=5538
FT                   /gap_type="unknown"
FT   assembly_gap    19511691..19517356
FT                   /estimated_length=5666
FT                   /gap_type="unknown"
FT   assembly_gap    19521292..19521447
FT                   /estimated_length=156
FT                   /gap_type="unknown"
FT   assembly_gap    19524068..19524264
FT                   /estimated_length=197
FT                   /gap_type="unknown"
FT   assembly_gap    19528044..19528457
FT                   /estimated_length=414
FT                   /gap_type="unknown"
FT   assembly_gap    19597774..19597793
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19606822..19607051
FT                   /estimated_length=230
FT                   /gap_type="unknown"
FT   assembly_gap    19625793..19627430
FT                   /estimated_length=1638
FT                   /gap_type="unknown"
FT   assembly_gap    19640682..19640701
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19666560..19666579
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19683019..19683038
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19693579..19698120
FT                   /estimated_length=4542
FT                   /gap_type="unknown"
FT   assembly_gap    19711024..19711043
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<19757601..>19758029)
FT                   /locus_tag="mCG_7334"
FT                   /note="gene_id=mCG7334.1"
FT   mRNA            complement(<19757601..>19758029)
FT                   /locus_tag="mCG_7334"
FT                   /product="mCG7334"
FT                   /note="gene_id=mCG7334.1 transcript_id=mCT6281.1 created on
FT                   25-SEP-2002"
FT   CDS             complement(19757601..19758029)
FT                   /codon_start=1
FT                   /locus_tag="mCG_7334"
FT                   /product="mCG7334"
FT                   /note="gene_id=mCG7334.1 transcript_id=mCT6281.1
FT                   protein_id=mCP22012.1"
FT                   /protein_id="EDL36814.1"
FT   assembly_gap    19758536..19758555
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(19761096..>19765526)
FT                   /gene="Dnajb9"
FT                   /locus_tag="mCG_7339"
FT                   /note="gene_id=mCG7339.2"
FT   mRNA            complement(join(19761096..19762605,19763287..19763513,
FT                   19765140..>19765526))
FT                   /gene="Dnajb9"
FT                   /locus_tag="mCG_7339"
FT                   /product="DnaJ (Hsp40) homolog, subfamily B, member 9"
FT                   /note="gene_id=mCG7339.2 transcript_id=mCT6278.2 created on
FT                   30-AUG-2002"
FT   CDS             complement(join(19762154..19762605,19763287..19763513,
FT                   19765140..>19765240))
FT                   /codon_start=1
FT                   /gene="Dnajb9"
FT                   /locus_tag="mCG_7339"
FT                   /product="DnaJ (Hsp40) homolog, subfamily B, member 9"
FT                   /note="gene_id=mCG7339.2 transcript_id=mCT6278.2
FT                   protein_id=mCP22009.1"
FT                   /protein_id="EDL36813.1"
FT   assembly_gap    19775291..19775728
FT                   /estimated_length=438
FT                   /gap_type="unknown"
FT   assembly_gap    19787125..19787144
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19792961..19793414
FT                   /estimated_length=454
FT                   /gap_type="unknown"
FT   assembly_gap    19798620..19798670
FT                   /estimated_length=51
FT                   /gap_type="unknown"
FT   assembly_gap    19802214..19802299
FT                   /estimated_length=86
FT                   /gap_type="unknown"
FT   gene            <19812032..19851922
FT                   /gene="Pnpla8"
FT                   /locus_tag="mCG_7336"
FT                   /note="gene_id=mCG7336.1"
FT   mRNA            join(<19812032..19812147,19825229..19826359,
FT                   19826444..19826593,19830813..19830964,19833201..19833295,
FT                   19835500..19835671,19838836..19838893,19844546..19844740,
FT                   19847554..19847749,19850960..19851922)
FT                   /gene="Pnpla8"
FT                   /locus_tag="mCG_7336"
FT                   /product="patatin-like phospholipase domain containing 8,
FT                   transcript variant mCT6283"
FT                   /note="gene_id=mCG7336.1 transcript_id=mCT6283.1 created on
FT                   30-AUG-2002"
FT   mRNA            join(<19812032..19812147,19825229..19826355,
FT                   19826444..19826593,19830813..19830964,19833201..19833295,
FT                   19835500..19835671,19838836..19838893,19844546..19844740,
FT                   19847554..19847749,19850960..19851922)
FT                   /gene="Pnpla8"
FT                   /locus_tag="mCG_7336"
FT                   /product="patatin-like phospholipase domain containing 8,
FT                   transcript variant mCT193464"
FT                   /note="gene_id=mCG7336.1 transcript_id=mCT193464.0 created
FT                   on 09-MAR-2004"
FT   assembly_gap    19815899..19815918
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(<19825315..19826355,19826444..19826593,
FT                   19830813..19830964,19833201..19833295,19835500..19835671,
FT                   19838836..19838893,19844546..19844740,19847554..19847749,
FT                   19850960..19851234)
FT                   /codon_start=1
FT                   /gene="Pnpla8"
FT                   /locus_tag="mCG_7336"
FT                   /product="patatin-like phospholipase domain containing 8,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG7336.1 transcript_id=mCT193464.0
FT                   protein_id=mCP114440.0 isoform=CRA_a"
FT                   /protein_id="EDL36811.1"
FT   CDS             join(<19826240..19826359,19826444..19826593,
FT                   19830813..19830964,19833201..19833295,19835500..19835671,
FT                   19838836..19838893,19844546..19844740,19847554..19847749,
FT                   19850960..19851234)
FT                   /codon_start=1
FT                   /gene="Pnpla8"
FT                   /locus_tag="mCG_7336"
FT                   /product="patatin-like phospholipase domain containing 8,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG7336.1 transcript_id=mCT6283.1
FT                   protein_id=mCP22014.1 isoform=CRA_b"
FT                   /protein_id="EDL36812.1"
FT                   DMYEGLPFFSKL"
FT   assembly_gap    19840591..19840694
FT                   /estimated_length=104
FT                   /gap_type="unknown"
FT   assembly_gap    19843327..19843346
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19868421..19868537
FT                   /estimated_length=117
FT                   /gap_type="unknown"
FT   gene            19868632..19932949
FT                   /locus_tag="mCG_148253"
FT                   /note="gene_id=mCG148253.0"
FT   mRNA            join(19868632..19868843,19930552..19932949)
FT                   /locus_tag="mCG_148253"
FT                   /product="mCG148253"
FT                   /note="gene_id=mCG148253.0 transcript_id=mCT188516.0
FT                   created on 13-JAN-2004"
FT   assembly_gap    19883369..19883388
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19905096..19905115
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19906415..19906434
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19928539..19928594
FT                   /estimated_length=56
FT                   /gap_type="unknown"
FT   CDS             19931224..19931487
FT                   /codon_start=1
FT                   /locus_tag="mCG_148253"
FT                   /product="mCG148253"
FT                   /note="gene_id=mCG148253.0 transcript_id=mCT188516.0
FT                   protein_id=mCP108089.0"
FT                   /protein_id="EDL36810.1"
FT   assembly_gap    19971285..19977797
FT                   /estimated_length=6513
FT                   /gap_type="unknown"
FT   gene            19988860..20149725
FT                   /locus_tag="mCG_125252"
FT                   /note="gene_id=mCG125252.1"
FT   mRNA            join(19988860..19988916,20006421..20006498,
FT                   20073195..20073396,20077989..20078094,20080168..20080364,
FT                   20094288..20094458,20094942..20094998,20096795..20096906,
FT                   20099437..20099621,20100868..20100999,20109221..20109364,
FT                   20111986..20112097,20113523..20113689,20113786..20113933,
FT                   20115850..20115974,20118106..20118234,20119772..20119969,
FT                   20120068..20120138,20121077..20121302,20121764..20121879,
FT                   20123382..20123586,20125438..20125560,20126166..20126342,
FT                   20133229..20133354,20134397..20134549,20139670..20139801,
FT                   20140498..20140621,20147912..20149725)
FT                   /locus_tag="mCG_125252"
FT                   /product="mCG125252"
FT                   /note="gene_id=mCG125252.1 transcript_id=mCT126512.1
FT                   created on 06-SEP-2002"
FT   assembly_gap    20024520..20024539
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20026039..20026058
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20040177..20040196
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20060848..20060867
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(20073306..20073396,20077989..20078094,
FT                   20080168..20080364,20094288..20094458,20094942..20094998,
FT                   20096795..20096906,20099437..20099621,20100868..20100999,
FT                   20109221..20109364,20111986..20112097,20113523..20113689,
FT                   20113786..20113933,20115850..20115974,20118106..20118234,
FT                   20119772..20119969,20120068..20120138,20121077..20121302,
FT                   20121764..20121879,20123382..20123586,20125438..20125560,
FT                   20126166..20126342,20133229..20133354,20134397..20134549,
FT                   20139670..20139801,20140498..20140621,20147912..20148149)
FT                   /codon_start=1
FT                   /locus_tag="mCG_125252"
FT                   /product="mCG125252"
FT                   /note="gene_id=mCG125252.1 transcript_id=mCT126512.1
FT                   protein_id=mCP78521.0"
FT                   /protein_id="EDL36809.1"
FT   assembly_gap    20082430..20087124
FT                   /estimated_length=4695
FT                   /gap_type="unknown"
FT   assembly_gap    20089958..20089977
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20163088..20163107
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(20169164..>20173916)
FT                   /locus_tag="mCG_125251"
FT                   /note="gene_id=mCG125251.0"
FT   mRNA            complement(join(20169164..20171807,20171920..20172200,
FT                   20172267..20173341,20173788..>20173916))
FT                   /locus_tag="mCG_125251"
FT                   /product="mCG125251"
FT                   /note="gene_id=mCG125251.0 transcript_id=mCT126511.0
FT                   created on 06-SEP-2002"
FT   CDS             complement(join(20170440..20171807,20171920..20172200,
FT                   20172267..20173341,20173788..20173916))
FT                   /codon_start=1
FT                   /locus_tag="mCG_125251"
FT                   /product="mCG125251"
FT                   /note="gene_id=mCG125251.0 transcript_id=mCT126511.0
FT                   protein_id=mCP78510.0"
FT                   /protein_id="EDL36808.1"
FT   assembly_gap    20174999..20175126
FT                   /estimated_length=128
FT                   /gap_type="unknown"
FT   assembly_gap    20194815..20194834
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20196232..20196689
FT                   /estimated_length=458
FT                   /gap_type="unknown"
FT   assembly_gap    20199269..20199309
FT                   /estimated_length=41
FT                   /gap_type="unknown"
FT   assembly_gap    20218726..20218745
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20220387..20220436
FT                   /estimated_length=50
FT                   /gap_type="unknown"
FT   assembly_gap    20233236..20233255
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20250544..20250563
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20267023..20271168
FT                   /estimated_length=4146
FT                   /gap_type="unknown"
FT   assembly_gap    20277715..20278201
FT                   /estimated_length=487
FT                   /gap_type="unknown"
FT   assembly_gap    20283900..20283919
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20287697..20287762
FT                   /estimated_length=66
FT                   /gap_type="unknown"
FT   assembly_gap    20289488..20292356
FT                   /estimated_length=2869
FT                   /gap_type="unknown"
FT   assembly_gap    20339507..20339842
FT                   /estimated_length=336
FT                   /gap_type="unknown"
FT   gene            complement(20368317..20417497)
FT                   /locus_tag="mCG_4824"
FT                   /note="gene_id=mCG4824.1"
FT   mRNA            complement(join(20368317..20371670,20377986..20378143,
FT                   20416380..20416545,20417366..20417497))
FT                   /locus_tag="mCG_4824"
FT                   /product="mCG4824"
FT                   /note="gene_id=mCG4824.1 transcript_id=mCT4392.1 created on
FT                   06-SEP-2002"
FT   CDS             complement(join(20371647..20371670,20377986..20378143,
FT                   20416380..20416545,20417366..20417410))
FT                   /codon_start=1
FT                   /locus_tag="mCG_4824"
FT                   /product="mCG4824"
FT                   /note="gene_id=mCG4824.1 transcript_id=mCT4392.1
FT                   protein_id=mCP22015.2"
FT                   /protein_id="EDL36807.1"
FT   assembly_gap    20373848..20373867
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20420032..20420051
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20422966..20423040
FT                   /estimated_length=75
FT                   /gap_type="unknown"
FT   gene            complement(20476290..>20479288)
FT                   /locus_tag="mCG_144958"
FT                   /note="gene_id=mCG144958.0"
FT   mRNA            complement(join(20476290..20478450,20478455..20478565,
FT                   20478567..>20479288))
FT                   /locus_tag="mCG_144958"
FT                   /product="mCG144958"
FT                   /note="gene_id=mCG144958.0 transcript_id=mCT184382.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(20478373..20478450,20478455..20478565,
FT                   20478567..>20478620))
FT                   /codon_start=1
FT                   /locus_tag="mCG_144958"
FT                   /product="mCG144958"
FT                   /note="gene_id=mCG144958.0 transcript_id=mCT184382.0
FT                   protein_id=mCP105138.0"
FT                   /protein_id="EDL36806.1"
FT   assembly_gap    20482423..20482442
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20496395..20496501
FT                   /estimated_length=107
FT                   /gap_type="unknown"
FT   gene            complement(20526845..20589488)
FT                   /locus_tag="mCG_7109"
FT                   /note="gene_id=mCG7109.1"
FT   mRNA            complement(join(20526845..20527432,20528113..20528213,
FT                   20529877..20529945,20533917..20534105,20588973..20589488))
FT                   /locus_tag="mCG_7109"
FT                   /product="mCG7109"
FT                   /note="gene_id=mCG7109.1 transcript_id=mCT6403.1 created on
FT                   06-SEP-2002"
FT   CDS             complement(join(20534024..20534105,20588973..20589286))
FT                   /codon_start=1
FT                   /locus_tag="mCG_7109"
FT                   /product="mCG7109"
FT                   /note="gene_id=mCG7109.1 transcript_id=mCT6403.1
FT                   protein_id=mCP5071.2"
FT                   /protein_id="EDL36805.1"
FT   assembly_gap    20622916..20622939
FT                   /estimated_length=24
FT                   /gap_type="unknown"
FT   assembly_gap    20632485..20633400
FT                   /estimated_length=916
FT                   /gap_type="unknown"
FT   assembly_gap    20671692..20671711
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20688990..20689009
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20695258..20695277
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20696680..20696699
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20697982..20698001
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20701750..20701769
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20711812..20711832
FT                   /estimated_length=21
FT                   /gap_type="unknown"
FT   assembly_gap    20716990..20717009
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20721141..20721160
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20724433..20724794
FT                   /estimated_length=362
FT                   /gap_type="unknown"
FT   assembly_gap    20733782..20740694
FT                   /estimated_length=6913
FT                   /gap_type="unknown"
FT   assembly_gap    20767355..20767374
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20803288..20803307
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20807190..20807209
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20812878..20812897
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20814072..20814091
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20815510..20815529
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20820410..20820773
FT                   /estimated_length=364
FT                   /gap_type="unknown"
FT   assembly_gap    20822751..20822770
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20827103..20827567
FT                   /estimated_length=465
FT                   /gap_type="unknown"
FT   assembly_gap    20829479..20829786
FT                   /estimated_length=308
FT                   /gap_type="unknown"
FT   assembly_gap    20833213..20833232
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20834312..20834331
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20835368..20835822
FT                   /estimated_length=455
FT                   /gap_type="unknown"
FT   assembly_gap    20841403..20841529
FT                   /estimated_length=127
FT                   /gap_type="unknown"
FT   assembly_gap    20884141..20885201
FT                   /estimated_length=1061
FT                   /gap_type="unknown"
FT   assembly_gap    20887067..20887567
FT                   /estimated_length=501
FT                   /gap_type="unknown"
FT   assembly_gap    20929021..20929040
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20946532..20947387
FT                   /estimated_length=856
FT                   /gap_type="unknown"
FT   gene            20957943..20962461
FT                   /locus_tag="mCG_148277"
FT                   /note="gene_id=mCG148277.0"
FT   mRNA            join(20957943..20958057,20958177..20962461)
FT                   /locus_tag="mCG_148277"
FT                   /product="mCG148277"
FT                   /note="gene_id=mCG148277.0 transcript_id=mCT188540.0
FT                   created on 13-JAN-2004"
FT   CDS             20961188..20961550
FT                   /codon_start=1
FT                   /locus_tag="mCG_148277"
FT                   /product="mCG148277"
FT                   /note="gene_id=mCG148277.0 transcript_id=mCT188540.0
FT                   protein_id=mCP108111.0"
FT                   /protein_id="EDL36804.1"
FT                   SSLLVLLPVILNSHNT"
FT   assembly_gap    20969084..20969377
FT                   /estimated_length=294
FT                   /gap_type="unknown"
FT   assembly_gap    20970398..20970417
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <20981143..21061588
FT                   /locus_tag="mCG_145556"
FT                   /note="gene_id=mCG145556.0"
FT   mRNA            join(<20981143..20981374,21003538..21003699,
FT                   21005055..21005177,21007105..21007271,21058871..21061588)
FT                   /locus_tag="mCG_145556"
FT                   /product="mCG145556"
FT                   /note="gene_id=mCG145556.0 transcript_id=mCT184980.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<20981342..20981374,21003538..21003699,
FT                   21005055..21005111)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145556"
FT                   /product="mCG145556"
FT                   /note="gene_id=mCG145556.0 transcript_id=mCT184980.0
FT                   protein_id=mCP105142.0"
FT                   /protein_id="EDL36803.1"
FT   assembly_gap    20995631..20996349
FT                   /estimated_length=719
FT                   /gap_type="unknown"
FT   assembly_gap    21067203..21067594
FT                   /estimated_length=392
FT                   /gap_type="unknown"
FT   assembly_gap    21069047..21069066
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21071045..21071137
FT                   /estimated_length=93
FT                   /gap_type="unknown"
FT   assembly_gap    21071466..21071494
FT                   /estimated_length=29
FT                   /gap_type="unknown"
FT   assembly_gap    21076062..21076432
FT                   /estimated_length=371
FT                   /gap_type="unknown"
FT   assembly_gap    21086282..21086301
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21095904..21095923
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21097831..21097850
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21100890..21100909
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21104584..21104910
FT                   /estimated_length=327
FT                   /gap_type="unknown"
FT   assembly_gap    21139361..21139380
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21143222..21143272
FT                   /estimated_length=51
FT                   /gap_type="unknown"
FT   assembly_gap    21178224..21178243
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21185279..21185298
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21218775..21219012
FT                   /estimated_length=238
FT                   /gap_type="unknown"
FT   assembly_gap    21286029..21286314
FT                   /estimated_length=286
FT                   /gap_type="unknown"
FT   assembly_gap    21311653..21311803
FT                   /estimated_length=151
FT                   /gap_type="unknown"
FT   assembly_gap    21398926..21399000
FT                   /estimated_length=75
FT                   /gap_type="unknown"
FT   assembly_gap    21467181..21474863
FT                   /estimated_length=7683
FT                   /gap_type="unknown"
FT   assembly_gap    21477805..21478214
FT                   /estimated_length=410
FT                   /gap_type="unknown"
FT   assembly_gap    21514493..21514512
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21547742..21547761
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21560857..21560876
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21622463..21622594
FT                   /estimated_length=132
FT                   /gap_type="unknown"
FT   assembly_gap    21642902..21643030
FT                   /estimated_length=129
FT                   /gap_type="unknown"
FT   assembly_gap    21646284..21646378
FT                   /estimated_length=95
FT                   /gap_type="unknown"
FT   assembly_gap    21648475..21648523
FT                   /estimated_length=49
FT                   /gap_type="unknown"
FT   assembly_gap    21666617..21666744
FT                   /estimated_length=128
FT                   /gap_type="unknown"
FT   assembly_gap    21750663..21750720
FT                   /estimated_length=58
FT                   /gap_type="unknown"
FT   assembly_gap    21762096..21765279
FT                   /estimated_length=3184
FT                   /gap_type="unknown"
FT   assembly_gap    21766625..21766644
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21769823..21769842
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21770847..21771355
FT                   /estimated_length=509
FT                   /gap_type="unknown"
FT   assembly_gap    21779725..21780088
FT                   /estimated_length=364
FT                   /gap_type="unknown"
FT   assembly_gap    21785056..21785114
FT                   /estimated_length=59
FT                   /gap_type="unknown"
FT   assembly_gap    21786221..21786240
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21787448..21787467
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21792841..21792918
FT                   /estimated_length=78
FT                   /gap_type="unknown"
FT   assembly_gap    21810445..21810464
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21868833..21868979
FT                   /estimated_length=147
FT                   /gap_type="unknown"
FT   assembly_gap    21875466..21876108
FT                   /estimated_length=643
FT                   /gap_type="unknown"
FT   assembly_gap    21912375..21912394
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21914489..21914508
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21916878..21916897
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21919489..21919508
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21921627..21922129
FT                   /estimated_length=503
FT                   /gap_type="unknown"
FT   assembly_gap    21927846..21928154
FT                   /estimated_length=309
FT                   /gap_type="unknown"
FT   assembly_gap    21960759..21960893
FT                   /estimated_length=135
FT                   /gap_type="unknown"
FT   assembly_gap    21973307..21973615
FT                   /estimated_length=309
FT                   /gap_type="unknown"
FT   gene            complement(21990471..21991087)
FT                   /pseudo
FT                   /locus_tag="mCG_20029"
FT                   /note="gene_id=mCG20029.1"
FT   mRNA            complement(join(21990471..21990614,21990653..21991087))
FT                   /pseudo
FT                   /locus_tag="mCG_20029"
FT                   /note="gene_id=mCG20029.1 transcript_id=mCT18235.1 created
FT                   on 06-SEP-2002"
FT   assembly_gap    22026369..22026388
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22064892..22064973
FT                   /estimated_length=82
FT                   /gap_type="unknown"
FT   assembly_gap    22102672..22102691
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22131507..22131526
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <22179823..22205430
FT                   /locus_tag="mCG_145555"
FT                   /note="gene_id=mCG145555.0"
FT   mRNA            join(<22179823..22179897,22200203..22200382,
FT                   22201788..22205430)
FT                   /locus_tag="mCG_145555"
FT                   /product="mCG145555"
FT                   /note="gene_id=mCG145555.0 transcript_id=mCT184979.0
FT                   created on 05-JUN-2003"
FT   assembly_gap    22183577..22183744
FT                   /estimated_length=168
FT                   /gap_type="unknown"
FT   CDS             <22203927..22204220
FT                   /codon_start=1
FT                   /locus_tag="mCG_145555"
FT                   /product="mCG145555"
FT                   /note="gene_id=mCG145555.0 transcript_id=mCT184979.0
FT                   protein_id=mCP105141.0"
FT                   /protein_id="EDL36802.1"
FT   gene            complement(22206233..22331930)
FT                   /locus_tag="mCG_140771"
FT                   /note="gene_id=mCG140771.0"
FT   mRNA            complement(join(22206233..22213422,22225509..22225580,
FT                   22232687..22232853,22330040..22330183,22331770..22331930))
FT                   /locus_tag="mCG_140771"
FT                   /product="mCG140771, transcript variant mCT171375"
FT                   /note="gene_id=mCG140771.0 transcript_id=mCT171375.0
FT                   created on 29-JUL-2002"
FT   CDS             complement(join(22212418..22213422,22225509..22225580,
FT                   22232687..22232853,22330040..22330183,22331770..22331905))
FT                   /codon_start=1
FT                   /locus_tag="mCG_140771"
FT                   /product="mCG140771, isoform CRA_b"
FT                   /note="gene_id=mCG140771.0 transcript_id=mCT171375.0
FT                   protein_id=mCP94294.0 isoform=CRA_b"
FT                   /protein_id="EDL36801.1"
FT   assembly_gap    22219769..22220706
FT                   /estimated_length=938
FT                   /gap_type="unknown"
FT   mRNA            complement(join(22223714..22223929,22225509..22225580,
FT                   22232687..22232853,22330040..22330183,22331770..22331929))
FT                   /locus_tag="mCG_140771"
FT                   /product="mCG140771, transcript variant mCT171374"
FT                   /note="gene_id=mCG140771.0 transcript_id=mCT171374.0
FT                   created on 29-JUL-2002"
FT   CDS             complement(join(22223906..22223929,22225509..22225580,
FT                   22232687..22232853,22330040..22330183,22331770..22331905))
FT                   /codon_start=1
FT                   /locus_tag="mCG_140771"
FT                   /product="mCG140771, isoform CRA_a"
FT                   /note="gene_id=mCG140771.0 transcript_id=mCT171374.0
FT                   protein_id=mCP94293.0 isoform=CRA_a"
FT                   /protein_id="EDL36800.1"
FT                   DPMTTSRANQKHSSWIT"
FT   assembly_gap    22244818..22245021
FT                   /estimated_length=204
FT                   /gap_type="unknown"
FT   assembly_gap    22248329..22248348
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22288605..22288624
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22307745..22307764
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22320945..22321308
FT                   /estimated_length=364
FT                   /gap_type="unknown"
FT   assembly_gap    22332240..22332600
FT                   /estimated_length=361
FT                   /gap_type="unknown"
FT   assembly_gap    22339294..22339313
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22355635..22355654
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22387804..22387965
FT                   /estimated_length=162
FT                   /gap_type="unknown"
FT   assembly_gap    22392199..22392353
FT                   /estimated_length=155
FT                   /gap_type="unknown"
FT   assembly_gap    22475199..22481279
FT                   /estimated_length=6081
FT                   /gap_type="unknown"
FT   assembly_gap    22482456..22482840
FT                   /estimated_length=385
FT                   /gap_type="unknown"
FT   assembly_gap    22485499..22493230
FT                   /estimated_length=7732
FT                   /gap_type="unknown"
FT   assembly_gap    22495031..22495050
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22496892..22496911
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22499176..22555575
FT                   /estimated_length=56400
FT                   /gap_type="unknown"
FT   assembly_gap    22563178..22563237
FT                   /estimated_length=60
FT                   /gap_type="unknown"
FT   assembly_gap    22593228..22593247
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22646090..22646241
FT                   /estimated_length=152
FT                   /gap_type="unknown"
FT   assembly_gap    22671978..22671997
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22685200..22685632
FT                   /estimated_length=433
FT                   /gap_type="unknown"
FT   assembly_gap    22696531..22696579
FT                   /estimated_length=49
FT                   /gap_type="unknown"
FT   assembly_gap    22732572..22732679
FT                   /estimated_length=108
FT                   /gap_type="unknown"
FT   assembly_gap    22740861..22740880
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22756145..22756164
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22798374..22798393
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22812590..22812609
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22814225..22814244
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22815548..22815567
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22830967..22830986
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22868675..22869350
FT                   /estimated_length=676
FT                   /gap_type="unknown"
FT   assembly_gap    22884121..22884267
FT                   /estimated_length=147
FT                   /gap_type="unknown"
FT   assembly_gap    22911789..22911854
FT                   /estimated_length=66
FT                   /gap_type="unknown"
FT   assembly_gap    22926024..22926043
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22935787..22935806
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22955237..22956603
FT                   /estimated_length=1367
FT                   /gap_type="unknown"
FT   assembly_gap    22957461..22957480
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22979710..22979796
FT                   /estimated_length=87
FT                   /gap_type="unknown"
FT   assembly_gap    23009394..23009565
FT                   /estimated_length=172
FT                   /gap_type="unknown"
FT   assembly_gap    23047520..23047642
FT                   /estimated_length=123
FT                   /gap_type="unknown"
FT   assembly_gap    23049372..23049831
FT                   /estimated_length=460
FT                   /gap_type="unknown"
FT   assembly_gap    23076437..23080043
FT                   /estimated_length=3607
FT                   /gap_type="unknown"
FT   assembly_gap    23098209..23098228
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23157784..23157803
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23174917..23174936
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23195130..23195149
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23197587..23197606
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23264026..23264119
FT                   /estimated_length=94
FT                   /gap_type="unknown"
FT   assembly_gap    23267595..23270893
FT                   /estimated_length=3299
FT                   /gap_type="unknown"
FT   assembly_gap    23303740..23303902
FT                   /estimated_length=163
FT                   /gap_type="unknown"
FT   gene            <23309487..23309912
FT                   /locus_tag="mCG_12232"
FT                   /note="gene_id=mCG12232.0"
FT   mRNA            <23309487..23309912
FT                   /locus_tag="mCG_12232"
FT                   /product="mCG12232"
FT                   /note="gene_id=mCG12232.0 transcript_id=mCT17051.0 created
FT                   on 06-SEP-2002"
FT   CDS             <23309489..23309758
FT                   /codon_start=1
FT                   /locus_tag="mCG_12232"
FT                   /product="mCG12232"
FT                   /note="gene_id=mCG12232.0 transcript_id=mCT17051.0
FT                   protein_id=mCP12228.0"
FT                   /protein_id="EDL36799.1"
FT   assembly_gap    23353538..23353852
FT                   /estimated_length=315
FT                   /gap_type="unknown"
FT   assembly_gap    23356409..23359963
FT                   /estimated_length=3555
FT                   /gap_type="unknown"
FT   assembly_gap    23386798..23386817
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23425815..23425891
FT                   /estimated_length=77
FT                   /gap_type="unknown"
FT   assembly_gap    23455318..23455337
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23493513..23493532
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23500903..23500922
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23510238..23510257
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23542112..23542131
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23546761..23546911
FT                   /estimated_length=151
FT                   /gap_type="unknown"
FT   assembly_gap    23589988..23590007
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23610280..23610299
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23611784..23611803
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23613275..23613294
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23617443..23617462
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23619447..23619466
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23620592..23620611
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23631707..23631726
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23632952..23632971
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23634364..23634383
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23653111..23653130
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23654137..23654162
FT                   /estimated_length=26
FT                   /gap_type="unknown"
FT   assembly_gap    23673068..23673087
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23687423..23687818
FT                   /estimated_length=396
FT                   /gap_type="unknown"
FT   assembly_gap    23725150..23725169
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23752211..23754861
FT                   /estimated_length=2651
FT                   /gap_type="unknown"
FT   assembly_gap    23770841..23770897
FT                   /estimated_length=57
FT                   /gap_type="unknown"
FT   assembly_gap    23810756..23810775
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23848195..23848214
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23855102..23855121
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23891826..23891845
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23929659..23930299
FT                   /estimated_length=641
FT                   /gap_type="unknown"
FT   assembly_gap    23933523..23933655
FT                   /estimated_length=133
FT                   /gap_type="unknown"
FT   assembly_gap    23961019..23961038
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23990024..23990043
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    24019647..24020354
FT                   /estimated_length=708
FT                   /gap_type="unknown"
FT   assembly_gap    24021074..24024497
FT                   /estimated_length=3424
FT                   /gap_type="unknown"
FT   assembly_gap    24050009..24050115
FT                   /estimated_length=107
FT                   /gap_type="unknown"
FT   gene            complement(24059195..>24064988)
FT                   /locus_tag="mCG_124508"
FT                   /note="gene_id=mCG124508.0"
FT   mRNA            complement(join(24059195..24061360,24064753..>24064988))
FT                   /locus_tag="mCG_124508"
FT                   /product="mCG124508"
FT                   /note="gene_id=mCG124508.0 transcript_id=mCT125752.0
FT                   created on 06-SEP-2002"
FT   CDS             complement(join(24060319..24061360,24064753..>24064907))
FT                   /codon_start=1
FT                   /locus_tag="mCG_124508"
FT                   /product="mCG124508"
FT                   /note="gene_id=mCG124508.0 transcript_id=mCT125752.0
FT                   protein_id=mCP79006.0"
FT                   /protein_id="EDL36798.1"
FT   assembly_gap    24079502..24079632
FT                   /estimated_length=131
FT                   /gap_type="unknown"
FT   assembly_gap    24087469..24087488
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    24123479..24123498
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    24170303..24171781
FT                   /estimated_length=1479
FT                   /gap_type="unknown"
FT   assembly_gap    24173945..24174322
FT                   /estimated_length=378
FT                   /gap_type="unknown"
FT   assembly_gap    24175544..24175889
FT                   /estimated_length=346
FT                   /gap_type="unknown"
FT   assembly_gap    24204148..24204167
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    24236333..24236352
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    24248196..24248215
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    24292406..24292425
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    24301199..24301218
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    24344783..24344934
FT                   /estimated_length=152
FT                   /gap_type="unknown"
FT   assembly_gap    24347512..24352735
FT                   /estimated_length=5224
FT                   /gap_type="unknown"
FT   assembly_gap    24377759..24377778
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    24404259..24404608
FT                   /estimated_length=350
FT                   /gap_type="unknown"
FT   assembly_gap    24444894..24444913
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    24475352..24475371
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    24499687..24506844
FT                   /estimated_length=7158
FT                   /gap_type="unknown"
FT   assembly_gap    24539929..24540034
FT                   /estimated_length=106
FT                   /gap_type="unknown"
FT   assembly_gap    24555093..24555471
FT                   /estimated_length=379
FT                   /gap_type="unknown"
FT   assembly_gap    24572794..24572813
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    24582199..24587122
FT                   /estimated_length=4924
FT                   /gap_type="unknown"
FT   assembly_gap    24632074..24634931
FT                   /estimated_length=2858
FT                   /gap_type="unknown"
FT   gene            <24643475..>24644220
FT                   /locus_tag="mCG_17415"
FT                   /note="gene_id=mCG17415.0"
FT   mRNA            join(<24643475..24643876,24643966..>24644220)
FT                   /locus_tag="mCG_17415"
FT                   /product="mCG17415"
FT                   /note="gene_id=mCG17415.0 transcript_id=mCT13082.0 created
FT                   on 06-SEP-2002"
FT   CDS             join(24643475..24643876,24643966..24644220)
FT                   /codon_start=1
FT                   /locus_tag="mCG_17415"
FT                   /product="mCG17415"
FT                   /note="gene_id=mCG17415.0 transcript_id=mCT13082.0
FT                   protein_id=mCP12227.0"
FT                   /protein_id="EDL36797.1"
FT   assembly_gap    24655380..24655486
FT                   /estimated_length=107
FT                   /gap_type="unknown"
FT   assembly_gap    24681864..24681883
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    24695939..24704826
FT                   /estimated_length=8888
FT                   /gap_type="unknown"
FT   assembly_gap    24706073..24706092
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    24726356..24726375
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    24750540..24756695
FT                   /estimated_length=6156
FT                   /gap_type="unknown"
FT   assembly_gap    24768897..24772100
FT                   /estimated_length=3204
FT                   /gap_type="unknown"
FT   assembly_gap    24777818..24778850
FT                   /estimated_length=1033
FT                   /gap_type="unknown"
FT   assembly_gap    24810136..24810155
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    24812948..24812993
FT                   /estimated_length=46
FT                   /gap_type="unknown"
FT   assembly_gap    24819820..24819961
FT                   /estimated_length=142
FT                   /gap_type="unknown"
FT   assembly_gap    24856760..24856779
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <24888202..24891860
FT                   /locus_tag="mCG_5477"
FT                   /note="gene_id=mCG5477.1"
FT   mRNA            join(<24888202..24888581,24889558..24891860)
FT                   /locus_tag="mCG_5477"
FT                   /product="mCG5477"
FT                   /note="gene_id=mCG5477.1 transcript_id=mCT4573.2 created on
FT                   29-NOV-2004"
FT   assembly_gap    24889099..24889557
FT                   /estimated_length=459
FT                   /gap_type="unknown"
FT   CDS             <24889559..24890935
FT                   /codon_start=1
FT                   /locus_tag="mCG_5477"
FT                   /product="mCG5477"
FT                   /note="gene_id=mCG5477.1 transcript_id=mCT4573.2
FT                   protein_id=mCP1778.2"
FT                   /protein_id="EDL36796.1"
FT                   "
FT   gene            <24894891..24912358
FT                   /locus_tag="mCG_5478"
FT                   /note="gene_id=mCG5478.1"
FT   mRNA            join(<24894891..24894943,24895407..24895474,
FT                   24911859..24912358)
FT                   /locus_tag="mCG_5478"
FT                   /product="mCG5478"
FT                   /note="gene_id=mCG5478.1 transcript_id=mCT4574.0 created on
FT                   06-SEP-2002"
FT   CDS             join(<24894892..24894943,24895407..24895474,
FT                   24911859..24912026)
FT                   /codon_start=1
FT                   /locus_tag="mCG_5478"
FT                   /product="mCG5478"
FT                   /note="gene_id=mCG5478.1 transcript_id=mCT4574.0
FT                   protein_id=mCP1779.0"
FT                   /protein_id="EDL36794.1"
FT   gene            24906285..24909174
FT                   /locus_tag="mCG_148242"
FT                   /note="gene_id=mCG148242.0"
FT   mRNA            24906285..24909174
FT                   /locus_tag="mCG_148242"
FT                   /product="mCG148242"
FT                   /note="gene_id=mCG148242.0 transcript_id=mCT188505.0
FT                   created on 13-JAN-2004"
FT   CDS             24908290..24908475
FT                   /codon_start=1
FT                   /locus_tag="mCG_148242"
FT                   /product="mCG148242"
FT                   /note="gene_id=mCG148242.0 transcript_id=mCT188505.0
FT                   protein_id=mCP108076.0"
FT                   /protein_id="EDL36795.1"
FT                   WAISSTLSYLLLNDSI"
FT   assembly_gap    24917907..24917926
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    24953335..24953354
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    24961276..24961467
FT                   /estimated_length=192
FT                   /gap_type="unknown"
FT   assembly_gap    24976518..24976537
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    24979956..24979975
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(24981787..>24985662)
FT                   /locus_tag="mCG_146096"
FT                   /note="gene_id=mCG146096.0"
FT   mRNA            complement(join(24981787..24982015,24982806..24982953,
FT                   24985326..>24985662))
FT                   /locus_tag="mCG_146096"
FT                   /product="mCG146096"
FT                   /note="gene_id=mCG146096.0 transcript_id=mCT186199.0
FT                   created on 14-JUL-2003"
FT   CDS             complement(join(24982830..24982953,24985326..>24985459))
FT                   /codon_start=1
FT                   /locus_tag="mCG_146096"
FT                   /product="mCG146096"
FT                   /note="gene_id=mCG146096.0 transcript_id=mCT186199.0
FT                   protein_id=mCP107275.0"
FT                   /protein_id="EDL36793.1"
FT   assembly_gap    25005441..25005460
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    25024316..25024605
FT                   /estimated_length=290
FT                   /gap_type="unknown"
FT   assembly_gap    25032594..25035731
FT                   /estimated_length=3138
FT                   /gap_type="unknown"
FT   assembly_gap    25052966..25054841
FT                   /estimated_length=1876
FT                   /gap_type="unknown"
FT   assembly_gap    25059458..25059488
FT                   /estimated_length=31
FT                   /gap_type="unknown"
FT   assembly_gap    25065538..25065935
FT                   /estimated_length=398
FT                   /gap_type="unknown"
FT   assembly_gap    25087662..25087681
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    25090416..25090435
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    25103838..25104035
FT                   /estimated_length=198
FT                   /gap_type="unknown"
FT   assembly_gap    25111684..25111703
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    25193128..25193263
FT                   /estimated_length=136
FT                   /gap_type="unknown"
FT   assembly_gap    25201510..25202039
FT                   /estimated_length=530
FT                   /gap_type="unknown"
FT   assembly_gap    25205373..25207171
FT                   /estimated_length=1799
FT                   /gap_type="unknown"
FT   assembly_gap    25273771..25273941
FT                   /estimated_length=171
FT                   /gap_type="unknown"
FT   gene            complement(25274842..25275606)
FT                   /pseudo
FT                   /locus_tag="mCG_5480"
FT                   /note="gene_id=mCG5480.1"
FT   mRNA            complement(join(25274842..25275437,25275460..25275606))
FT                   /pseudo
FT                   /locus_tag="mCG_5480"
FT                   /note="gene_id=mCG5480.1 transcript_id=mCT4571.1 created on
FT                   06-SEP-2002"
FT   assembly_gap    25280907..25281023
FT                   /estimated_length=117
FT                   /gap_type="unknown"
FT   assembly_gap    25287129..25287148
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    25288050..25288647
FT                   /estimated_length=598
FT                   /gap_type="unknown"
FT   assembly_gap    25297369..25297508
FT                   /estimated_length=140
FT                   /gap_type="unknown"
FT   assembly_gap    25297777..25297998
FT                   /estimated_length=222
FT                   /gap_type="unknown"
FT   assembly_gap    25311176..25311195
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    25316657..25316676
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(25338290..25339389)
FT                   /pseudo
FT                   /locus_tag="mCG_5479"
FT                   /note="gene_id=mCG5479.1"
FT   mRNA            complement(join(25338290..25338776,25338847..25339280,
FT                   25339310..25339389))
FT                   /pseudo
FT                   /locus_tag="mCG_5479"
FT                   /note="gene_id=mCG5479.1 transcript_id=mCT4575.1 created on
FT                   06-SEP-2002"
FT   assembly_gap    25368100..25368204
FT                   /estimated_length=105
FT                   /gap_type="unknown"
FT   assembly_gap    25402400..25402419
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    25412056..25412172
FT                   /estimated_length=117
FT                   /gap_type="unknown"
FT   assembly_gap    25431051..25431320
FT                   /estimated_length=270
FT                   /gap_type="unknown"
FT   assembly_gap    25439545..25439591
FT                   /estimated_length=47
FT                   /gap_type="unknown"
FT   assembly_gap    25504917..25504936
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    25527995..25528014
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    25554854..25554873
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    25568918..25569042
FT                   /estimated_length=125
FT                   /gap_type="unknown"
FT   assembly_gap    25586889..25586908
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    25596244..25596545
FT                   /estimated_length=302
FT                   /gap_type="unknown"
FT   assembly_gap    25598666..25605711
FT                   /estimated_length=7046
FT                   /gap_type="unknown"
FT   assembly_gap    25639125..25639144
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    25673876..25673895
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    25699780..25699799
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    25712023..25712328
FT                   /estimated_length=306
FT                   /gap_type="unknown"
FT   assembly_gap    25722280..25722490
FT                   /estimated_length=211
FT                   /gap_type="unknown"
FT   assembly_gap    25723894..25724064
FT                   /estimated_length=171
FT                   /gap_type="unknown"
FT   assembly_gap    25734072..25734278
FT                   /estimated_length=207
FT                   /gap_type="unknown"
FT   assembly_gap    25740026..25745745
FT                   /estimated_length=5720
FT                   /gap_type="unknown"
FT   assembly_gap    25751741..25755202
FT                   /estimated_length=3462
FT                   /gap_type="unknown"
FT   assembly_gap    25760287..25760484
FT                   /estimated_length=198
FT                   /gap_type="unknown"
FT   assembly_gap    25776757..25776793
FT                   /estimated_length=37
FT                   /gap_type="unknown"
FT   assembly_gap    25838762..25839073
FT                   /estimated_length=312
FT                   /gap_type="unknown"
FT   gene            complement(25839799..>25988990)
FT                   /gene="Prkcm"
FT                   /locus_tag="mCG_124725"
FT                   /note="gene_id=mCG124725.0"
FT   mRNA            complement(join(25839799..25840298,25841132..25841217,
FT                   25862553..25862837,25863651..25863753,25864343..25864504,
FT                   25881319..25881425,25883062..25883134,25885138..25885190,
FT                   25886175..25886454,25889223..25889300,25890912..25891035,
FT                   25892421..25892625,25894185..25894262,25894416..25894626,
FT                   25918749..25918772,25924335..25924495,25926999..25927130,
FT                   25988852..>25988990))
FT                   /gene="Prkcm"
FT                   /locus_tag="mCG_124725"
FT                   /product="protein kinase C, mu"
FT                   /note="gene_id=mCG124725.0 transcript_id=mCT125973.1
FT                   created on 30-AUG-2002"
FT   CDS             complement(join(25840080..25840298,25841132..25841217,
FT                   25862553..25862837,25863651..25863753,25864343..25864504,
FT                   25881319..25881425,25883062..25883134,25885138..25885190,
FT                   25886175..25886454,25889223..25889300,25890912..25891035,
FT                   25892421..25892625,25894185..25894262,25894416..25894626,
FT                   25918749..25918772,25924335..25924495,25926999..25927130,
FT                   25988852..>25988990))
FT                   /codon_start=1
FT                   /gene="Prkcm"
FT                   /locus_tag="mCG_124725"
FT                   /product="protein kinase C, mu"
FT                   /note="gene_id=mCG124725.0 transcript_id=mCT125973.1
FT                   protein_id=mCP78634.1"
FT                   /protein_id="EDL36792.1"
FT   assembly_gap    25872401..25872420
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    25874176..25874195
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    25888466..25888485
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    25889634..25889653
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    25898516..25898678
FT                   /estimated_length=163
FT                   /gap_type="unknown"
FT   assembly_gap    25900048..25900067
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    25903053..25904311
FT                   /estimated_length=1259
FT                   /gap_type="unknown"
FT   assembly_gap    25905327..25907155
FT                   /estimated_length=1829
FT                   /gap_type="unknown"
FT   assembly_gap    25940162..25940688
FT                   /estimated_length=527
FT                   /gap_type="unknown"
FT   assembly_gap    25977521..25977647
FT                   /estimated_length=127
FT                   /gap_type="unknown"
FT   assembly_gap    26008271..26008432
FT                   /estimated_length=162
FT                   /gap_type="unknown"
FT   assembly_gap    26118429..26118592
FT                   /estimated_length=164
FT                   /gap_type="unknown"
FT   assembly_gap    26124055..26124756
FT                   /estimated_length=702
FT                   /gap_type="unknown"
FT   assembly_gap    26131298..26131539
FT                   /estimated_length=242
FT                   /gap_type="unknown"
FT   assembly_gap    26132331..26132388
FT                   /estimated_length=58
FT                   /gap_type="unknown"
FT   assembly_gap    26140686..26140941
FT                   /estimated_length=256
FT                   /gap_type="unknown"
FT   assembly_gap    26155478..26155602
FT                   /estimated_length=125
FT                   /gap_type="unknown"
FT   assembly_gap    26170026..26171357
FT                   /estimated_length=1332
FT                   /gap_type="unknown"
FT   assembly_gap    26176506..26176525
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26177891..26177910
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26179591..26179610
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26182118..26182137
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26183457..26183476
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26185128..26185147
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26187194..26187213
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26192620..26192987
FT                   /estimated_length=368
FT                   /gap_type="unknown"
FT   assembly_gap    26197369..26197388
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26216681..26216813
FT                   /estimated_length=133
FT                   /gap_type="unknown"
FT   assembly_gap    26218038..26218730
FT                   /estimated_length=693
FT                   /gap_type="unknown"
FT   assembly_gap    26242514..26242670
FT                   /estimated_length=157
FT                   /gap_type="unknown"
FT   assembly_gap    26265108..26265127
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26278815..26279165
FT                   /estimated_length=351
FT                   /gap_type="unknown"
FT   assembly_gap    26296858..26296877
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26301535..26301554
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26340590..26343791
FT                   /estimated_length=3202
FT                   /gap_type="unknown"
FT   assembly_gap    26345202..26345385
FT                   /estimated_length=184
FT                   /gap_type="unknown"
FT   assembly_gap    26347518..26347705
FT                   /estimated_length=188
FT                   /gap_type="unknown"
FT   assembly_gap    26352339..26353835
FT                   /estimated_length=1497
FT                   /gap_type="unknown"
FT   assembly_gap    26355062..26356020
FT                   /estimated_length=959
FT                   /gap_type="unknown"
FT   assembly_gap    26359920..26359939
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26398903..26399561
FT                   /estimated_length=659
FT                   /gap_type="unknown"
FT   assembly_gap    26425782..26425801
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<26463639..>26477504)
FT                   /locus_tag="mCG_66755"
FT                   /note="gene_id=mCG66755.1"
FT   mRNA            complement(join(<26463639..26463806,26466106..26466270,
FT                   26466387..26466449,26470601..26470869,26472206..26472411,
FT                   26477440..>26477504))
FT                   /locus_tag="mCG_66755"
FT                   /product="mCG66755"
FT                   /note="gene_id=mCG66755.1 transcript_id=mCT66938.1 created
FT                   on 25-SEP-2002"
FT   CDS             complement(join(26463639..26463806,26466106..26466270,
FT                   26466387..26466449,26470601..26470869,26472206..26472411,
FT                   26477440..26477504))
FT                   /codon_start=1
FT                   /locus_tag="mCG_66755"
FT                   /product="mCG66755"
FT                   /note="gene_id=mCG66755.1 transcript_id=mCT66938.1
FT                   protein_id=mCP24712.1"
FT                   /protein_id="EDL36791.1"
FT   assembly_gap    26465046..26465127
FT                   /estimated_length=82
FT                   /gap_type="unknown"
FT   assembly_gap    26474912..26474931
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26475701..26475720
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26484767..26484786
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <26488030..26544190
FT                   /locus_tag="mCG_145558"
FT                   /note="gene_id=mCG145558.0"
FT   mRNA            join(<26488030..26488165,26498883..26499010,
FT                   26526255..26526341,26534175..26534381,26543948..26544190)
FT                   /locus_tag="mCG_145558"
FT                   /product="mCG145558"
FT                   /note="gene_id=mCG145558.0 transcript_id=mCT184982.0
FT                   created on 05-JUN-2003"
FT   assembly_gap    26497187..26497206
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26517398..26517513
FT                   /estimated_length=116
FT                   /gap_type="unknown"
FT   assembly_gap    26518230..26518787
FT                   /estimated_length=558
FT                   /gap_type="unknown"
FT   CDS             join(<26526310..26526341,26534175..26534379)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145558"
FT                   /product="mCG145558"
FT                   /note="gene_id=mCG145558.0 transcript_id=mCT184982.0
FT                   protein_id=mCP105140.0"
FT                   /protein_id="EDL36790.1"
FT   assembly_gap    26551933..26551952
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26552906..26552925
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26554054..26554073
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26555002..26555386
FT                   /estimated_length=385
FT                   /gap_type="unknown"
FT   assembly_gap    26558395..26558414
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26561028..26561047
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26570388..26570407
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26609700..26609719
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(26621089..>26622645)
FT                   /locus_tag="mCG_125663"
FT                   /note="gene_id=mCG125663.0"
FT   mRNA            complement(26621089..>26622645)
FT                   /locus_tag="mCG_125663"
FT                   /product="mCG125663"
FT                   /note="gene_id=mCG125663.0 transcript_id=mCT126926.0
FT                   created on 06-SEP-2002"
FT   CDS             complement(26621276..>26622457)
FT                   /codon_start=1
FT                   /locus_tag="mCG_125663"
FT                   /product="mCG125663"
FT                   /note="gene_id=mCG125663.0 transcript_id=mCT126926.0
FT                   protein_id=mCP79055.0"
FT                   /protein_id="EDL36789.1"
FT   assembly_gap    26658942..26661461
FT                   /estimated_length=2520
FT                   /gap_type="unknown"
FT   assembly_gap    26671579..26671598
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26693253..26708856
FT                   /estimated_length=15604
FT                   /gap_type="unknown"
FT   assembly_gap    26710409..26710428
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26736144..26736208
FT                   /estimated_length=65
FT                   /gap_type="unknown"
FT   assembly_gap    26758496..26758646
FT                   /estimated_length=151
FT                   /gap_type="unknown"
FT   assembly_gap    26766152..26766455
FT                   /estimated_length=304
FT                   /gap_type="unknown"
FT   gene            <26775698..26776226
FT                   /locus_tag="mCG_49907"
FT                   /note="gene_id=mCG49907.2"
FT   mRNA            <26775698..26776226
FT                   /locus_tag="mCG_49907"
FT                   /product="mCG49907"
FT                   /note="gene_id=mCG49907.2 transcript_id=mCT50090.2 created
FT                   on 25-SEP-2002"
FT   CDS             26775698..26776174
FT                   /codon_start=1
FT                   /locus_tag="mCG_49907"
FT                   /product="mCG49907"
FT                   /note="gene_id=mCG49907.2 transcript_id=mCT50090.2
FT                   protein_id=mCP24719.1"
FT                   /protein_id="EDL36788.1"
FT   assembly_gap    26776273..26776292
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26782983..26783192
FT                   /estimated_length=210
FT                   /gap_type="unknown"
FT   assembly_gap    26790247..26795072
FT                   /estimated_length=4826
FT                   /gap_type="unknown"
FT   assembly_gap    26796142..26796161
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26813740..26813796
FT                   /estimated_length=57
FT                   /gap_type="unknown"
FT   gene            <26825798..26853145
FT                   /gene="6030408C04Rik"
FT                   /locus_tag="mCG_8289"
FT                   /note="gene_id=mCG8289.2"
FT   mRNA            join(<26825798..26825954,26828915..26828955,
FT                   26831116..26831213,26831312..26831413,26833393..26833517,
FT                   26834539..26834704,26837257..26837363,26838446..26838562,
FT                   26840701..26840825,26840932..26841061,26841467..26841535,
FT                   26842770..26843074,26845290..26845471,26846561..26846733,
FT                   26849078..26849268,26849948..26850787)
FT                   /gene="6030408C04Rik"
FT                   /locus_tag="mCG_8289"
FT                   /product="RIKEN cDNA 6030408C04, transcript variant
FT                   mCT193480"
FT                   /note="gene_id=mCG8289.2 transcript_id=mCT193480.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(<26825872..26825954,26828915..26828955,
FT                   26831116..26831213,26831312..26831413,26833393..26833517,
FT                   26834539..26834704,26837257..26837363,26838446..26838562,
FT                   26840701..26840825,26840932..26841061,26842770..26843074,
FT                   26845290..26845471,26846561..26846733,26849078..26849268,
FT                   26849948..26853145)
FT                   /gene="6030408C04Rik"
FT                   /locus_tag="mCG_8289"
FT                   /product="RIKEN cDNA 6030408C04, transcript variant
FT                   mCT7511"
FT                   /note="gene_id=mCG8289.2 transcript_id=mCT7511.2 created on
FT                   06-SEP-2002"
FT   mRNA            join(<26825879..26825954,26828915..26828955,
FT                   26831116..26831213,26831312..26831413,26833393..26833517,
FT                   26834539..26834704,26837257..26837363,26838446..26838562,
FT                   26840701..26840825,26840932..26841061,26845267..26845471,
FT                   26846561..26846733,26849078..26849268,26849948..26850888)
FT                   /gene="6030408C04Rik"
FT                   /locus_tag="mCG_8289"
FT                   /product="RIKEN cDNA 6030408C04, transcript variant
FT                   mCT193481"
FT                   /note="gene_id=mCG8289.2 transcript_id=mCT193481.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<26825914..26825954,26828915..26828955,
FT                   26831116..26831213,26831312..26831413,26833393..26833517,
FT                   26834539..26834704,26837257..26837363,26838446..26838562,
FT                   26840701..26840825,26840932..26841061,26841467..26841535,
FT                   26842770..26843074,26845290..26845471,26846561..26846733,
FT                   26849078..26849268,26849948..26850240)
FT                   /codon_start=1
FT                   /gene="6030408C04Rik"
FT                   /locus_tag="mCG_8289"
FT                   /product="RIKEN cDNA 6030408C04, isoform CRA_a"
FT                   /note="gene_id=mCG8289.2 transcript_id=mCT193480.0
FT                   protein_id=mCP114487.0 isoform=CRA_a"
FT                   /protein_id="EDL36785.1"
FT                   I"
FT   CDS             join(<26825914..26825954,26828915..26828955,
FT                   26831116..26831213,26831312..26831413,26833393..26833517,
FT                   26834539..26834704,26837257..26837363,26838446..26838562,
FT                   26840701..26840825,26840932..26841061,26842770..26843074,
FT                   26845290..26845471,26846561..26846733,26849078..26849268,
FT                   26849948..26850240)
FT                   /codon_start=1
FT                   /gene="6030408C04Rik"
FT                   /locus_tag="mCG_8289"
FT                   /product="RIKEN cDNA 6030408C04, isoform CRA_c"
FT                   /note="gene_id=mCG8289.2 transcript_id=mCT7511.2
FT                   protein_id=mCP1782.2 isoform=CRA_c"
FT                   /protein_id="EDL36787.1"
FT   CDS             join(<26825914..26825954,26828915..26828955,
FT                   26831116..26831213,26831312..26831413,26833393..26833517,
FT                   26834539..26834704,26837257..26837363,26838446..26838562,
FT                   26840701..26840825,26840932..26841061,26845267..26845471,
FT                   26846561..26846733,26849078..26849268,26849948..26850240)
FT                   /codon_start=1
FT                   /gene="6030408C04Rik"
FT                   /locus_tag="mCG_8289"
FT                   /product="RIKEN cDNA 6030408C04, isoform CRA_b"
FT                   /note="gene_id=mCG8289.2 transcript_id=mCT193481.0
FT                   protein_id=mCP114488.0 isoform=CRA_b"
FT                   /protein_id="EDL36786.1"
FT                   LI"
FT   gene            <26855098..26931246
FT                   /gene="Scfd1"
FT                   /locus_tag="mCG_50215"
FT                   /note="gene_id=mCG50215.1"
FT   mRNA            join(<26855098..26855155,26861629..26861699,
FT                   26864566..26864654,26866798..26866888,26867822..26867944,
FT                   26875209..26875294,26877515..26877614,26890041..26890180,
FT                   26891632..26891722,26892387..26892460,26903633..26903703,
FT                   26909551..26909644,26912632..26912694,26914375..26914450,
FT                   26920427..26920480,26926816..26926881,26928711..26928779,
FT                   26931046..26931246)
FT                   /gene="Scfd1"
FT                   /locus_tag="mCG_50215"
FT                   /product="sec1 family domain containing 1"
FT                   /note="gene_id=mCG50215.1 transcript_id=mCT50398.1 created
FT                   on 06-SEP-2002"
FT   CDS             join(<26855098..26855155,26861629..26861699,
FT                   26864566..26864654,26866798..26866888,26867822..26867944,
FT                   26875209..26875294,26877515..26877614,26890041..26890180,
FT                   26891632..26891722,26892387..26892460,26903633..26903703,
FT                   26909551..26909644,26912632..26912694,26914375..26914450,
FT                   26920427..26920480,26926816..26926881,26928711..26928779,
FT                   26931046..26931069)
FT                   /codon_start=1
FT                   /gene="Scfd1"
FT                   /locus_tag="mCG_50215"
FT                   /product="sec1 family domain containing 1"
FT                   /note="gene_id=mCG50215.1 transcript_id=mCT50398.1
FT                   protein_id=mCP24708.1"
FT                   /protein_id="EDL36783.1"
FT   gene            <26886309..26888523
FT                   /locus_tag="mCG_125662"
FT                   /note="gene_id=mCG125662.0"
FT   mRNA            <26886309..26888523
FT                   /locus_tag="mCG_125662"
FT                   /product="mCG125662"
FT                   /note="gene_id=mCG125662.0 transcript_id=mCT126925.0
FT                   created on 06-SEP-2002"
FT   CDS             <26886309..26886773
FT                   /codon_start=1
FT                   /locus_tag="mCG_125662"
FT                   /product="mCG125662"
FT                   /note="gene_id=mCG125662.0 transcript_id=mCT126925.0
FT                   protein_id=mCP79049.0"
FT                   /protein_id="EDL36784.1"
FT   assembly_gap    26896728..26896747
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26898573..26902925
FT                   /estimated_length=4353
FT                   /gap_type="unknown"
FT   assembly_gap    26904410..26904429
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26907340..26907359
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26908580..26908599
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26910486..26910505
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26940104..26940211
FT                   /estimated_length=108
FT                   /gap_type="unknown"
FT   assembly_gap    26945688..26946022
FT                   /estimated_length=335
FT                   /gap_type="unknown"
FT   assembly_gap    26954770..26954789
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26955898..26955917
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26957394..26957413
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <26958783..26959398
FT                   /locus_tag="mCG_125660"
FT                   /note="gene_id=mCG125660.0"
FT   mRNA            <26958783..26959398
FT                   /locus_tag="mCG_125660"
FT                   /product="mCG125660"
FT                   /note="gene_id=mCG125660.0 transcript_id=mCT126923.0
FT                   created on 06-SEP-2002"
FT   CDS             <26958783..26959223
FT                   /codon_start=1
FT                   /locus_tag="mCG_125660"
FT                   /product="mCG125660"
FT                   /note="gene_id=mCG125660.0 transcript_id=mCT126923.0
FT                   protein_id=mCP79033.0"
FT                   /protein_id="EDL36782.1"
FT   assembly_gap    26959399..26959418
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26964254..26964273
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26977348..26978016
FT                   /estimated_length=669
FT                   /gap_type="unknown"
FT   assembly_gap    26991078..26991097
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27013063..27013082
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27014158..27014177
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27019219..27019238
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27024617..27024636
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27044673..27045700
FT                   /estimated_length=1028
FT                   /gap_type="unknown"
FT   assembly_gap    27060273..27060295
FT                   /estimated_length=23
FT                   /gap_type="unknown"
FT   assembly_gap    27063438..27063457
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27074997..27075222
FT                   /estimated_length=226
FT                   /gap_type="unknown"
FT   gene            <27081689..27094104
FT                   /gene="Coch"
FT                   /locus_tag="mCG_8286"
FT                   /note="gene_id=mCG8286.2"
FT   mRNA            join(<27081689..27081737,27081937..27081989,
FT                   27082071..27082124,27083668..27083824,27084777..27084910,
FT                   27085348..27085410,27086360..27086404,27086484..27086631,
FT                   27090147..27090250,27090978..27091204,27091527..27092043,
FT                   27093188..27094092)
FT                   /gene="Coch"
FT                   /locus_tag="mCG_8286"
FT                   /product="coagulation factor C homolog (Limulus
FT                   polyphemus), transcript variant mCT7512"
FT                   /note="gene_id=mCG8286.2 transcript_id=mCT7512.0 created on
FT                   30-AUG-2002"
FT   CDS             join(<27081691..27081737,27081937..27081989,
FT                   27082071..27082124,27083668..27083824,27084777..27084910,
FT                   27085348..27085410,27086360..27086404,27086484..27086631,
FT                   27090147..27090250,27090978..27091204,27091527..27092043,
FT                   27093188..27093363)
FT                   /codon_start=1
FT                   /gene="Coch"
FT                   /locus_tag="mCG_8286"
FT                   /product="coagulation factor C homolog (Limulus
FT                   polyphemus), isoform CRA_b"
FT                   /note="gene_id=mCG8286.2 transcript_id=mCT7512.0
FT                   protein_id=mCP1783.0 isoform=CRA_b"
FT                   /protein_id="EDL36781.1"
FT   mRNA            join(<27081786..27081989,27082071..27082124,
FT                   27083668..27083824,27084777..27084910,27085348..27085410,
FT                   27086360..27086404,27086484..27086631,27090147..27090250,
FT                   27090978..27091204,27091527..27092043,27093188..27094104)
FT                   /gene="Coch"
FT                   /locus_tag="mCG_8286"
FT                   /product="coagulation factor C homolog (Limulus
FT                   polyphemus), transcript variant mCT193479"
FT                   /note="gene_id=mCG8286.2 transcript_id=mCT193479.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<27081788..27081989,27082071..27082124,
FT                   27083668..27083824,27084777..27084910,27085348..27085410,
FT                   27086360..27086404,27086484..27086631,27090147..27090250,
FT                   27090978..27091204,27091527..27092043,27093188..27093363)
FT                   /codon_start=1
FT                   /gene="Coch"
FT                   /locus_tag="mCG_8286"
FT                   /product="coagulation factor C homolog (Limulus
FT                   polyphemus), isoform CRA_a"
FT                   /note="gene_id=mCG8286.2 transcript_id=mCT193479.0
FT                   protein_id=mCP114486.0 isoform=CRA_a"
FT                   /protein_id="EDL36780.1"
FT   gene            complement(27097976..>27180387)
FT                   /gene="Strn3"
FT                   /locus_tag="mCG_8277"
FT                   /note="gene_id=mCG8277.1"
FT   mRNA            complement(join(27097976..27098603,27098690..27098776,
FT                   27108115..27108222,27110081..27110221,27111495..27111662,
FT                   27115426..27115547,27115829..27115876,27116017..27116196,
FT                   27117690..27117823,27121846..27121986,27131256..27131366,
FT                   27136146..27136287,27138256..27138382,27140824..27140997,
FT                   27143811..27143892,27149561..27149634,27150020..27150123,
FT                   27179850..27179925,27180268..>27180387))
FT                   /gene="Strn3"
FT                   /locus_tag="mCG_8277"
FT                   /product="striatin, calmodulin binding protein 3"
FT                   /note="gene_id=mCG8277.1 transcript_id=mCT7520.2 created on
FT                   30-AUG-2002"
FT   assembly_gap    27101406..27101425
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             complement(join(27115838..27115876,27116017..27116196,
FT                   27117690..27117823,27121846..27121986,27131256..27131366,
FT                   27136146..27136287,27138256..27138382,27140824..27140997,
FT                   27143811..27143892,27149561..27149634,27150020..27150123,
FT                   27179850..27179925,27180268..>27180377))
FT                   /codon_start=1
FT                   /gene="Strn3"
FT                   /locus_tag="mCG_8277"
FT                   /product="striatin, calmodulin binding protein 3"
FT                   /note="gene_id=mCG8277.1 transcript_id=mCT7520.2
FT                   protein_id=mCP1790.2"
FT                   /protein_id="EDL36779.1"
FT   assembly_gap    27120063..27120082
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27124967..27124990
FT                   /estimated_length=24
FT                   /gap_type="unknown"
FT   assembly_gap    27141409..27142482
FT                   /estimated_length=1074
FT                   /gap_type="unknown"
FT   gene            <27179394..27228310
FT                   /gene="Ap4s1"
FT                   /locus_tag="mCG_8283"
FT                   /note="gene_id=mCG8283.2"
FT   mRNA            join(<27179394..27179742,27206312..27206520,
FT                   27210006..27210092,27212350..27212418,27220256..>27220341)
FT                   /gene="Ap4s1"
FT                   /locus_tag="mCG_8283"
FT                   /product="adaptor-related protein complex AP-4, sigma 1,
FT                   transcript variant mCT193475"
FT                   /note="gene_id=mCG8283.2 transcript_id=mCT193475.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(<27179416..27179742,27206312..27206520,
FT                   27210006..27210092,27212350..27212418,27227921..27228310)
FT                   /gene="Ap4s1"
FT                   /locus_tag="mCG_8283"
FT                   /product="adaptor-related protein complex AP-4, sigma 1,
FT                   transcript variant mCT7515"
FT                   /note="gene_id=mCG8283.2 transcript_id=mCT7515.1 created on
FT                   30-AUG-2002"
FT   assembly_gap    27179926..27180267
FT                   /estimated_length=342
FT                   /gap_type="unknown"
FT   assembly_gap    27200157..27200768
FT                   /estimated_length=612
FT                   /gap_type="unknown"
FT   assembly_gap    27203195..27203214
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(<27206341..27206520,27210006..27210092,
FT                   27212350..27212418,27227921..27228049)
FT                   /codon_start=1
FT                   /gene="Ap4s1"
FT                   /locus_tag="mCG_8283"
FT                   /product="adaptor-related protein complex AP-4, sigma 1,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG8283.2 transcript_id=mCT7515.1
FT                   protein_id=mCP1774.1 isoform=CRA_b"
FT                   /protein_id="EDL36778.1"
FT   CDS             join(<27206341..27206520,27210006..27210092,
FT                   27212350..27212418,27220256..>27220341)
FT                   /codon_start=1
FT                   /gene="Ap4s1"
FT                   /locus_tag="mCG_8283"
FT                   /product="adaptor-related protein complex AP-4, sigma 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG8283.2 transcript_id=mCT193475.0
FT                   protein_id=mCP114485.0 isoform=CRA_a"
FT                   /protein_id="EDL36777.1"
FT   assembly_gap    27231631..27231875
FT                   /estimated_length=245
FT                   /gap_type="unknown"
FT   assembly_gap    27238562..27239180
FT                   /estimated_length=619
FT                   /gap_type="unknown"
FT   assembly_gap    27239596..27240156
FT                   /estimated_length=561
FT                   /gap_type="unknown"
FT   assembly_gap    27268726..27268745
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27283705..27284216
FT                   /estimated_length=512
FT                   /gap_type="unknown"
FT   assembly_gap    27285220..27285239
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27294353..27294372
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27308194..27308213
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27318769..27319248
FT                   /estimated_length=480
FT                   /gap_type="unknown"
FT   gene            27319293..27320711
FT                   /locus_tag="mCG_1041833"
FT                   /note="gene_id=mCG1041833.1"
FT   mRNA            join(27319293..27320177,27320576..27320711)
FT                   /locus_tag="mCG_1041833"
FT                   /product="mCG1041833"
FT                   /note="gene_id=mCG1041833.1 transcript_id=mCT159537.1
FT                   created on 25-SEP-2002"
FT   CDS             join(27320020..27320177,27320576..27320657)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041833"
FT                   /product="mCG1041833"
FT                   /note="gene_id=mCG1041833.1 transcript_id=mCT159537.1
FT                   protein_id=mCP78931.1"
FT                   /protein_id="EDL36776.1"
FT   gene            <27330080..>27358566
FT                   /locus_tag="mCG_1041582"
FT                   /note="gene_id=mCG1041582.0"
FT   mRNA            join(<27330080..27330195,27334456..27334711,
FT                   27347207..27347313,27348756..27348862,27353124..27353204,
FT                   27358481..>27358566)
FT                   /locus_tag="mCG_1041582"
FT                   /product="mCG1041582"
FT                   /note="gene_id=mCG1041582.0 transcript_id=mCT159286.0
FT                   created on 25-SEP-2002"
FT   CDS             join(27330080..27330195,27334456..27334711,
FT                   27347207..27347313,27348756..27348862,27353124..27353204,
FT                   27358481..27358566)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041582"
FT                   /product="mCG1041582"
FT                   /note="gene_id=mCG1041582.0 transcript_id=mCT159286.0
FT                   protein_id=mCP78837.0"
FT                   /protein_id="EDL36775.1"
FT   assembly_gap    27349612..27349834
FT                   /estimated_length=223
FT                   /gap_type="unknown"
FT   assembly_gap    27357732..27358384
FT                   /estimated_length=653
FT                   /gap_type="unknown"
FT   gene            complement(27365942..>27461105)
FT                   /gene="D930036F22Rik"
FT                   /locus_tag="mCG_8281"
FT                   /note="gene_id=mCG8281.1"
FT   mRNA            complement(join(27365942..27367741,27369373..27369586,
FT                   27371232..27371383,27374377..27374577,27377953..27378225,
FT                   27378809..27378956,27379542..27379669,27381182..27381427,
FT                   27383594..27383816,27384207..27384386,27386507..27386575,
FT                   27387691..27387872,27388999..27389235,27395495..27395674,
FT                   27400112..27400247,27405127..27405296,27406220..27406409,
FT                   27411491..27411596,27415152..27415327,27415408..27415571,
FT                   27429685..27429837,27435324..27435435,27437656..27437906,
FT                   27439830..27439985,27440827..27440989,27442385..27442542,
FT                   27445307..27445481,27446048..27446197,27447016..27447124,
FT                   27448823..27449034,27460989..>27461105))
FT                   /gene="D930036F22Rik"
FT                   /locus_tag="mCG_8281"
FT                   /product="RIKEN cDNA D930036F22, transcript variant
FT                   mCT7519"
FT                   /note="gene_id=mCG8281.1 transcript_id=mCT7519.1 created on
FT                   06-SEP-2002"
FT   mRNA            complement(join(27365998..27367741,27369373..27369586,
FT                   27371232..27371383,27374377..27374601,27377953..27378225,
FT                   27378809..27378956,27379542..27379669,27381182..27381427,
FT                   27383594..27383816,27384207..27384386,27386507..27386575,
FT                   27387691..27387872,27388999..27389235,27395495..27395674,
FT                   27400112..27400247,27405127..27405296,27406220..27406409,
FT                   27408737..27408893,27410543..27410730,27411491..27411596,
FT                   27415152..27415327,27415408..27415571,27420330..27420439,
FT                   27428184..27428283,27429685..27429837,27435324..27435435,
FT                   27437656..27437906,27439830..27439985,27440827..27441082,
FT                   27442385..27442542,27445307..27445481,27446048..27446197,
FT                   27447016..27447124,27448823..27449034,27451403..27451614,
FT                   27460964..>27461082))
FT                   /gene="D930036F22Rik"
FT                   /locus_tag="mCG_8281"
FT                   /product="RIKEN cDNA D930036F22, transcript variant
FT                   mCT193468"
FT                   /note="gene_id=mCG8281.1 transcript_id=mCT193468.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(27367437..27367741,27369373..27369586,
FT                   27371232..27371383,27374377..27374577,27377953..27378225,
FT                   27378809..27378956,27379542..27379669,27381182..27381427,
FT                   27383594..27383816,27384207..27384386,27386507..27386575,
FT                   27387691..27387872,27388999..27389235,27395495..27395674,
FT                   27400112..27400247,27405127..27405296,27406220..27406409,
FT                   27411491..27411596,27415152..27415327,27415408..27415571,
FT                   27429685..27429837,27435324..27435435,27437656..27437906,
FT                   27439830..27439985,27440827..27440989,27442385..27442542,
FT                   27445307..27445481,27446048..27446197,27447016..27447124,
FT                   27448823..27449034,27460989..27461105))
FT                   /codon_start=1
FT                   /gene="D930036F22Rik"
FT                   /locus_tag="mCG_8281"
FT                   /product="RIKEN cDNA D930036F22, isoform CRA_b"
FT                   /note="gene_id=mCG8281.1 transcript_id=mCT7519.1
FT                   protein_id=mCP1795.1 isoform=CRA_b"
FT                   /protein_id="EDL36774.1"
FT   CDS             complement(join(27367437..27367741,27369373..27369586,
FT                   27371232..27371383,27374377..27374601,27377953..27378225,
FT                   27378809..27378956,27379542..27379669,27381182..27381427,
FT                   27383594..27383816,27384207..27384386,27386507..27386575,
FT                   27387691..27387872,27388999..27389235,27395495..27395674,
FT                   27400112..27400247,27405127..27405296,27406220..27406409,
FT                   27408737..27408893,27410543..27410730,27411491..27411596,
FT                   27415152..27415327,27415408..27415571,27420330..27420439,
FT                   27428184..27428283,27429685..27429837,27435324..27435435,
FT                   27437656..27437906,27439830..27439985,27440827..27441082,
FT                   27442385..27442542,27445307..27445481,27446048..27446197,
FT                   27447016..27447124,27448823..27449034,27451403..>27451546))
FT                   /codon_start=1
FT                   /gene="D930036F22Rik"
FT                   /locus_tag="mCG_8281"
FT                   /product="RIKEN cDNA D930036F22, isoform CRA_a"
FT                   /note="gene_id=mCG8281.1 transcript_id=mCT193468.0
FT                   protein_id=mCP114443.0 isoform=CRA_a"
FT                   /protein_id="EDL36773.1"
FT   assembly_gap    27392618..27392928
FT                   /estimated_length=311
FT                   /gap_type="unknown"
FT   assembly_gap    27394711..27394830
FT                   /estimated_length=120
FT                   /gap_type="unknown"
FT   assembly_gap    27397588..27397617
FT                   /estimated_length=30
FT                   /gap_type="unknown"
FT   assembly_gap    27417867..27417886
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27426284..27426395
FT                   /estimated_length=112
FT                   /gap_type="unknown"
FT   assembly_gap    27460745..27460764
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27472282..27472350
FT                   /estimated_length=69
FT                   /gap_type="unknown"
FT   assembly_gap    27476482..27476501
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27479302..27479321
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(27479894..>27498298)
FT                   /gene="6530401N04Rik"
FT                   /locus_tag="mCG_124772"
FT                   /note="gene_id=mCG124772.0"
FT   mRNA            complement(join(27479894..27480433,27490919..27491195,
FT                   27496673..27496742,27498169..>27498298))
FT                   /gene="6530401N04Rik"
FT                   /locus_tag="mCG_124772"
FT                   /product="RIKEN cDNA 6530401N04, transcript variant
FT                   mCT126022"
FT                   /note="gene_id=mCG124772.0 transcript_id=mCT126022.0
FT                   created on 06-SEP-2002"
FT   mRNA            complement(join(27479894..27480439,27490925..27491195,
FT                   27496673..27496742,27498169..>27498297))
FT                   /gene="6530401N04Rik"
FT                   /locus_tag="mCG_124772"
FT                   /product="RIKEN cDNA 6530401N04, transcript variant
FT                   mCT193492"
FT                   /note="gene_id=mCG124772.0 transcript_id=mCT193492.0
FT                   created on 09-MAR-2004"
FT   CDS             complement(join(27480391..27480439,27490925..27491195,
FT                   27496673..27496742,27498169..>27498297))
FT                   /codon_start=1
FT                   /gene="6530401N04Rik"
FT                   /locus_tag="mCG_124772"
FT                   /product="RIKEN cDNA 6530401N04, isoform CRA_b"
FT                   /note="gene_id=mCG124772.0 transcript_id=mCT193492.0
FT                   protein_id=mCP114449.0 isoform=CRA_b"
FT                   /protein_id="EDL36771.1"
FT                   ELQTLLTAF"
FT   CDS             complement(join(27480391..27480433,27490919..27491195,
FT                   27496673..27496742,27498169..>27498297))
FT                   /codon_start=1
FT                   /gene="6530401N04Rik"
FT                   /locus_tag="mCG_124772"
FT                   /product="RIKEN cDNA 6530401N04, isoform CRA_a"
FT                   /note="gene_id=mCG124772.0 transcript_id=mCT126022.0
FT                   protein_id=mCP78445.0 isoform=CRA_a"
FT                   /protein_id="EDL36770.1"
FT                   ELQTLLTAF"
FT   assembly_gap    27481106..27481125
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27484920..27485546
FT                   /estimated_length=627
FT                   /gap_type="unknown"
FT   gene            27486873..27487705
FT                   /locus_tag="mCG_51950"
FT                   /note="gene_id=mCG51950.1"
FT   mRNA            27486873..27487705
FT                   /locus_tag="mCG_51950"
FT                   /product="mCG51950"
FT                   /note="gene_id=mCG51950.1 transcript_id=mCT52133.1 created
FT                   on 25-SEP-2002"
FT   CDS             27487099..27487524
FT                   /codon_start=1
FT                   /locus_tag="mCG_51950"
FT                   /product="mCG51950"
FT                   /note="gene_id=mCG51950.1 transcript_id=mCT52133.1
FT                   protein_id=mCP24695.0"
FT                   /protein_id="EDL36772.1"
FT   assembly_gap    27487806..27488326
FT                   /estimated_length=521
FT                   /gap_type="unknown"
FT   assembly_gap    27495143..27495670
FT                   /estimated_length=528
FT                   /gap_type="unknown"
FT   assembly_gap    27505643..27506006
FT                   /estimated_length=364
FT                   /gap_type="unknown"
FT   gene            complement(27514604..27523196)
FT                   /gene="Gpr33"
FT                   /locus_tag="mCG_52399"
FT                   /note="gene_id=mCG52399.3"
FT   mRNA            complement(join(27514604..27515858,27521580..>27521713))
FT                   /gene="Gpr33"
FT                   /locus_tag="mCG_52399"
FT                   /product="G protein-coupled receptor 33, transcript variant
FT                   mCT193430"
FT                   /note="gene_id=mCG52399.3 transcript_id=mCT193430.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(<27514833..27515858,27523067..27523196))
FT                   /gene="Gpr33"
FT                   /locus_tag="mCG_52399"
FT                   /product="G protein-coupled receptor 33, transcript variant
FT                   mCT52582"
FT                   /note="gene_id=mCG52399.3 transcript_id=mCT52582.1 created
FT                   on 24-SEP-2002"
FT   CDS             complement(27514833..>27515858)
FT                   /codon_start=1
FT                   /gene="Gpr33"
FT                   /locus_tag="mCG_52399"
FT                   /product="G protein-coupled receptor 33, isoform CRA_a"
FT                   /note="gene_id=mCG52399.3 transcript_id=mCT193430.0
FT                   protein_id=mCP114424.0 isoform=CRA_a"
FT                   /protein_id="EDL36768.1"
FT                   I"
FT   CDS             complement(27514833..27515852)
FT                   /codon_start=1
FT                   /gene="Gpr33"
FT                   /locus_tag="mCG_52399"
FT                   /product="G protein-coupled receptor 33, isoform CRA_b"
FT                   /note="gene_id=mCG52399.3 transcript_id=mCT52582.1
FT                   protein_id=mCP24720.1 isoform=CRA_b"
FT                   /protein_id="EDL36769.1"
FT   assembly_gap    27517558..27517577
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27518671..27518690
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27522128..27522147
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27528294..27528313
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27529574..27529593
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27530780..27531187
FT                   /estimated_length=408
FT                   /gap_type="unknown"
FT   assembly_gap    27532610..27532629
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27537450..27537469
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27540210..27540229
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27549444..27549463
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27550792..27550811
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27567339..27567358
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <27577859..27578473
FT                   /locus_tag="mCG_8285"
FT                   /note="gene_id=mCG8285.0"
FT   mRNA            <27577859..27578473
FT                   /locus_tag="mCG_8285"
FT                   /product="mCG8285"
FT                   /note="gene_id=mCG8285.0 transcript_id=mCT7517.1 created on
FT                   06-SEP-2002"
FT   CDS             <27577861..27578160
FT                   /codon_start=1
FT                   /locus_tag="mCG_8285"
FT                   /product="mCG8285"
FT                   /note="gene_id=mCG8285.0 transcript_id=mCT7517.1
FT                   protein_id=mCP1775.0"
FT                   /protein_id="EDL36767.1"
FT   gene            <27589172..27792689
FT                   /locus_tag="mCG_124774"
FT                   /note="gene_id=mCG124774.0"
FT   mRNA            join(<27589172..27589326,27589788..27589935,
FT                   27591902..27591936,27628719..27628809,27768070..27768155,
FT                   27784411..27784609,27787528..27787610,27792432..27792689)
FT                   /locus_tag="mCG_124774"
FT                   /product="mCG124774"
FT                   /note="gene_id=mCG124774.0 transcript_id=mCT126024.0
FT                   created on 06-SEP-2002"
FT   CDS             join(<27589174..27589326,27589788..27589935,
FT                   27591902..27591936,27628719..27628809,27768070..27768155,
FT                   27784411..27784609,27787528..27787610,27792432..27792494)
FT                   /codon_start=1
FT                   /locus_tag="mCG_124774"
FT                   /product="mCG124774"
FT                   /note="gene_id=mCG124774.0 transcript_id=mCT126024.0
FT                   protein_id=mCP78485.0"
FT                   /protein_id="EDL36766.1"
FT                   SSPE"
FT   assembly_gap    27637977..27637996
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27643986..27644933
FT                   /estimated_length=948
FT                   /gap_type="unknown"
FT   assembly_gap    27647819..27649184
FT                   /estimated_length=1366
FT                   /gap_type="unknown"
FT   assembly_gap    27659268..27663038
FT                   /estimated_length=3771
FT                   /gap_type="unknown"
FT   assembly_gap    27664391..27664410
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27672702..27672721
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27688576..27689011
FT                   /estimated_length=436
FT                   /gap_type="unknown"
FT   assembly_gap    27698624..27704241
FT                   /estimated_length=5618
FT                   /gap_type="unknown"
FT   assembly_gap    27726508..27726663
FT                   /estimated_length=156
FT                   /gap_type="unknown"
FT   assembly_gap    27742780..27744575
FT                   /estimated_length=1796
FT                   /gap_type="unknown"
FT   assembly_gap    27760047..27760066
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27841784..27841803
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27842570..27842589
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27868625..27868644
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27875067..27875086
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27906369..27906705
FT                   /estimated_length=337
FT                   /gap_type="unknown"
FT   assembly_gap    27943204..27943223
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27988889..27989606
FT                   /estimated_length=718
FT                   /gap_type="unknown"
FT   gene            <28001283..28056970
FT                   /gene="Arhgap5"
FT                   /locus_tag="mCG_14971"
FT                   /note="gene_id=mCG14971.2"
FT   mRNA            join(<28001283..28005002,28027551..28027698,
FT                   28046095..28046172,28048573..28048704,28050893..28050998,
FT                   28055574..28056970)
FT                   /gene="Arhgap5"
FT                   /locus_tag="mCG_14971"
FT                   /product="Rho GTPase activating protein 5"
FT                   /note="gene_id=mCG14971.2 transcript_id=mCT21445.2 created
FT                   on 30-AUG-2002"
FT   CDS             join(28001283..28005002,28027551..28027698,
FT                   28046095..28046172,28048573..28048704,28050893..28050998,
FT                   28055574..28055901)
FT                   /codon_start=1
FT                   /gene="Arhgap5"
FT                   /locus_tag="mCG_14971"
FT                   /product="Rho GTPase activating protein 5"
FT                   /note="gene_id=mCG14971.2 transcript_id=mCT21445.2
FT                   protein_id=mCP1767.2"
FT                   /db_xref="GOA:B9EKC3"
FT                   /db_xref="InterPro:IPR000198"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR002713"
FT                   /db_xref="InterPro:IPR008936"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032835"
FT                   /db_xref="InterPro:IPR036517"
FT                   /db_xref="MGI:MGI:1332637"
FT                   /db_xref="UniProtKB/TrEMBL:B9EKC3"
FT                   /protein_id="EDL36765.1"
FT   assembly_gap    28031255..28032207
FT                   /estimated_length=953
FT                   /gap_type="unknown"
FT   assembly_gap    28033479..28033498
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    28035403..28035422
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    28036569..28036588
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            28057211..28060059
FT                   /locus_tag="mCG_148250"
FT                   /note="gene_id=mCG148250.0"
FT   mRNA            join(28057211..28058648,28059121..28060059)
FT                   /locus_tag="mCG_148250"
FT                   /product="mCG148250"
FT                   /note="gene_id=mCG148250.0 transcript_id=mCT188513.0
FT                   created on 13-JAN-2004"
FT   CDS             28058102..28058260
FT                   /codon_start=1
FT                   /locus_tag="mCG_148250"
FT                   /product="mCG148250"
FT                   /note="gene_id=mCG148250.0 transcript_id=mCT188513.0
FT                   protein_id=mCP108084.0"
FT                   /protein_id="EDL36764.1"
FT                   VCFWPRV"
FT   assembly_gap    28058747..28058766
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    28079369..28079388
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(28088833..28091170)
FT                   /locus_tag="mCG_1051101"
FT                   /note="gene_id=mCG1051101.0"
FT   mRNA            complement(join(28088833..28088927,28090837..28090902,
FT                   28091027..28091170))
FT                   /locus_tag="mCG_1051101"
FT                   /product="mCG1051101"
FT                   /note="gene_id=mCG1051101.0 transcript_id=mCT194890.0
FT                   created on 27-JAN-2005"
FT   CDS             complement(28091072..28091158)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1051101"
FT                   /product="mCG1051101"
FT                   /note="gene_id=mCG1051101.0 transcript_id=mCT194890.0
FT                   protein_id=mCP115919.0"
FT                   /protein_id="EDL36763.1"
FT                   /translation="MKTSPPSHPTHLVFLGYRLYPSPQRGHF"
FT   gene            28096516..28117727
FT                   /locus_tag="mCG_1041828"
FT                   /note="gene_id=mCG1041828.0"
FT   mRNA            join(28096516..28096584,28110291..28110527,
FT                   28116279..28116389,28117678..28117727)
FT                   /locus_tag="mCG_1041828"
FT                   /product="mCG1041828"
FT                   /note="gene_id=mCG1041828.0 transcript_id=mCT159532.0
FT                   created on 24-SEP-2002"
FT   CDS             join(28110439..28110527,28116279..28116324)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041828"
FT                   /product="mCG1041828"
FT                   /note="gene_id=mCG1041828.0 transcript_id=mCT159532.0
FT                   protein_id=mCP78568.1"
FT                   /protein_id="EDL36762.1"
FT   assembly_gap    28114045..28114516
FT                   /estimated_length=472
FT                   /gap_type="unknown"
FT   assembly_gap    28125940..28126809
FT                   /estimated_length=870
FT                   /gap_type="unknown"
FT   assembly_gap    28141086..28141105
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    28142388..28142407
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    28143876..28143895
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    28177625..28177644
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    28178852..28178871
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    28180018..28180389
FT                   /estimated_length=372
FT                   /gap_type="unknown"
FT   assembly_gap    28189669..28189688
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    28190698..28190717
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    28191866..28191885
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    28194886..28195211
FT                   /estimated_length=326
FT                   /gap_type="unknown"
FT   assembly_gap    28217459..28217478
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    28218649..28218668
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    28219743..28219762
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    28222022..28222041
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    28226228..28226247
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    28228169..28228895
FT                   /estimated_length=727
FT                   /gap_type="unknown"
FT   assembly_gap    28242092..28242111
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(28245189..28250618)
FT                   /locus_tag="mCG_148262"
FT                   /note="gene_id=mCG148262.0"
FT   mRNA            complement(join(28245189..28248251,28250552..28250618))
FT                   /locus_tag="mCG_148262"
FT                   /product="mCG148262"
FT                   /note="gene_id=mCG148262.0 transcript_id=mCT188525.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(28247958..28248242)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148262"
FT                   /product="mCG148262"
FT                   /note="gene_id=mCG148262.0 transcript_id=mCT188525.0
FT                   protein_id=mCP108098.0"
FT                   /protein_id="EDL36761.1"
FT   assembly_gap    28252513..28252532
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    28262232..28262288
FT                   /estimated_length=57
FT                   /gap_type="unknown"
FT   assembly_gap    28269296..28270083
FT                   /estimated_length=788
FT                   /gap_type="unknown"
FT   assembly_gap    28271017..28271226
FT                   /estimated_length=210
FT                   /gap_type="unknown"
FT   gene            <28289728..28628574
FT                   /locus_tag="mCG_14970"
FT                   /note="gene_id=mCG14970.1"
FT   mRNA            join(<28289728..28290015,28375142..28375393,
FT                   28380813..28381610,28382070..28382567,28401318..28401440,
FT                   28421153..28421249,28422358..28422524,28496262..28496410,
FT                   28511523..28511643,28554951..28555097,28590330..28590545,
FT                   28625186..28628574)
FT                   /locus_tag="mCG_14970"
FT                   /product="mCG14970"
FT                   /note="gene_id=mCG14970.1 transcript_id=mCT21444.1 created
FT                   on 06-SEP-2002"
FT   CDS             join(<28289728..28290015,28375142..28375393,
FT                   28380813..28381610,28382070..28382567,28401318..28401440,
FT                   28421153..28421249,28422358..28422524,28496262..28496410,
FT                   28511523..28511643,28554951..28555097,28590330..28590545,
FT                   28625186..28628533)
FT                   /codon_start=1
FT                   /locus_tag="mCG_14970"
FT                   /product="mCG14970"
FT                   /note="gene_id=mCG14970.1 transcript_id=mCT21444.1
FT                   protein_id=mCP1784.1"
FT                   /protein_id="EDL36760.1"
FT                   EKLVSFHEDRHSNMHR"
FT   assembly_gap    28307613..28307632
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    28316911..28317422
FT                   /estimated_length=512
FT                   /gap_type="unknown"
FT   assembly_gap    28320004..28320140
FT                   /estimated_length=137
FT                   /gap_type="unknown"
FT   assembly_gap    28321559..28321593
FT                   /estimated_length=35
FT                   /gap_type="unknown"
FT   assembly_gap    28328395..28328414
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    28330366..28330385
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    28331554..28331663
FT                   /estimated_length=110
FT                   /gap_type="unknown"
FT   assembly_gap    28333097..28335860
FT                   /estimated_length=2764
FT                   /gap_type="unknown"
FT   assembly_gap    28337832..28339133
FT                   /estimated_length=1302
FT                   /gap_type="unknown"
FT   assembly_gap    28340063..28340272
FT                   /estimated_length=210
FT                   /gap_type="unknown"
FT   assembly_gap    28341692..28342621
FT                   /estimated_length=930
FT                   /gap_type="unknown"
FT   assembly_gap    28346338..28350444
FT                   /estimated_length=4107
FT                   /gap_type="unknown"
FT   assembly_gap    28356256..28356275
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    28359844..28359863
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    28385887..28386265
FT                   /estimated_length=379
FT                   /gap_type="unknown"
FT   assembly_gap    28390828..28396540
FT                   /estimated_length=5713
FT                   /gap_type="unknown"
FT   assembly_gap    28413280..28413471
FT                   /estimated_length=192
FT                   /gap_type="unknown"
FT   assembly_gap    28417879..28418152
FT                   /estimated_length=274
FT                   /gap_type="unknown"
FT   assembly_gap    28429976..28429995
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    28431004..28431023
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    28435192..28435379
FT                   /estimated_length=188
FT                   /gap_type="unknown"
FT   assembly_gap    28437054..28437073
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    28525641..28525660
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    28583575..28583653
FT                   /estimated_length=79
FT                   /gap_type="unknown"
FT   assembly_gap    28621483..28621788
FT                   /estimated_length=306
FT                   /gap_type="unknown"
FT   assembly_gap    28655363..28655382
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    28667930..28668959
FT                   /estimated_length=1030
FT                   /gap_type="unknown"
FT   assembly_gap    28669724..28670987
FT                   /estimated_length=1264
FT                   /gap_type="unknown"
FT   assembly_gap    28693417..28694235
FT                   /estimated_length=819
FT                   /gap_type="unknown"
FT   assembly_gap    28703461..28704599
FT                   /estimated_length=1139
FT                   /gap_type="unknown"
FT   assembly_gap    28726522..28726541
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    28734621..28734797
FT                   /estimated_length=177
FT                   /gap_type="unknown"
FT   assembly_gap    28738358..28739824
FT                   /estimated_length=1467
FT                   /gap_type="unknown"
FT   assembly_gap    28743674..28743693
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    28744777..28744979
FT                   /estimated_length=203
FT                   /gap_type="unknown"
FT   assembly_gap    28752077..28752298
FT                   /estimated_length=222
FT                   /gap_type="unknown"
FT   assembly_gap    28757626..28758096
FT                   /estimated_length=471
FT                   /gap_type="unknown"
FT   assembly_gap    28768447..28768466
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    28771991..28772010
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(28789438..28795982)
FT                   /locus_tag="mCG_148274"
FT                   /note="gene_id=mCG148274.0"
FT   mRNA            complement(join(28789438..28789858,28795697..28795982))
FT                   /locus_tag="mCG_148274"
FT                   /product="mCG148274"
FT                   /note="gene_id=mCG148274.0 transcript_id=mCT188537.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(28789476..28789610)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148274"
FT                   /product="mCG148274"
FT                   /note="gene_id=mCG148274.0 transcript_id=mCT188537.0
FT                   protein_id=mCP108106.0"
FT                   /protein_id="EDL36759.1"
FT   assembly_gap    28791252..28791271
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    28807934..28807953
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    28814795..28814814
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    28816139..28816158
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    28817194..28817213
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    28818417..28818436
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    28852734..28852761
FT                   /estimated_length=28
FT                   /gap_type="unknown"
FT   assembly_gap    28857127..28857146
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<28937595..>28959185)
FT                   /locus_tag="mCG_1041824"
FT                   /note="gene_id=mCG1041824.0"
FT   mRNA            complement(join(<28937595..28937670,28946249..28946503,
FT                   28959052..>28959185))
FT                   /locus_tag="mCG_1041824"
FT                   /product="mCG1041824"
FT                   /note="gene_id=mCG1041824.0 transcript_id=mCT159528.0
FT                   created on 24-SEP-2002"
FT   CDS             complement(join(28937595..28937670,28946249..28946503,
FT                   28959052..28959185))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041824"
FT                   /product="mCG1041824"
FT                   /note="gene_id=mCG1041824.0 transcript_id=mCT159528.0
FT                   protein_id=mCP78532.0"
FT                   /protein_id="EDL36758.1"
FT   gene            complement(28960728..28961333)
FT                   /locus_tag="mCG_64162"
FT                   /note="gene_id=mCG64162.2"
FT   mRNA            complement(28960728..28961333)
FT                   /locus_tag="mCG_64162"
FT                   /product="mCG64162"
FT                   /note="gene_id=mCG64162.2 transcript_id=mCT64345.2 created
FT                   on 24-SEP-2002"
FT   CDS             complement(28960855..28961016)
FT                   /codon_start=1
FT                   /locus_tag="mCG_64162"
FT                   /product="mCG64162"
FT                   /note="gene_id=mCG64162.2 transcript_id=mCT64345.2
FT                   protein_id=mCP24705.2"
FT                   /protein_id="EDL36757.1"
FT                   IWLPKTQI"
FT   assembly_gap    28976229..28978057
FT                   /estimated_length=1829
FT                   /gap_type="unknown"
FT   assembly_gap    28979165..28979184
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    28990487..28990506
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    28992076..29000298
FT                   /estimated_length=8223
FT                   /gap_type="unknown"
FT   assembly_gap    29001643..29001719
FT                   /estimated_length=77
FT                   /gap_type="unknown"
FT   assembly_gap    29008749..29008768
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    29010281..29010300
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    29025459..29025517
FT                   /estimated_length=59
FT                   /gap_type="unknown"
FT   assembly_gap    29038790..29041548
FT                   /estimated_length=2759
FT                   /gap_type="unknown"
FT   assembly_gap    29077329..29078413
FT                   /estimated_length=1085
FT                   /gap_type="unknown"
FT   assembly_gap    29124984..29125090
FT                   /estimated_length=107
FT                   /gap_type="unknown"
FT   assembly_gap    29167187..29167206
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    29192434..29192453
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    29194938..29194957
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    29215013..29215342
FT                   /estimated_length=330
FT                   /gap_type="unknown"
FT   assembly_gap    29239439..29239458
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    29267263..29267282
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    29268544..29268563
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    29394919..29394938
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            29441128..>29558482
FT                   /gene="Npas3"
FT                   /locus_tag="mCG_124421"
FT                   /note="gene_id=mCG124421.0"
FT   mRNA            join(29441128..29441310,29497379..29497497,
FT                   29533973..29534166,29538207..29538313,29551429..29551576,
FT                   29555229..29555353,29557182..>29558482)
FT                   /gene="Npas3"
FT                   /locus_tag="mCG_124421"
FT                   /product="neuronal PAS domain protein 3"
FT                   /note="gene_id=mCG124421.0 transcript_id=mCT125663.0
FT                   created on 02-APR-2003"
FT   CDS             join(29441193..29441310,29497379..29497497,
FT                   29533973..29534166,29538207..29538313,29551429..29551576,
FT                   29555229..29555353,29557182..29558482)
FT                   /codon_start=1
FT                   /gene="Npas3"
FT                   /locus_tag="mCG_124421"
FT                   /product="neuronal PAS domain protein 3"
FT                   /note="gene_id=mCG124421.0 transcript_id=mCT125663.0
FT                   protein_id=mCP78616.1 partial"
FT                   /protein_id="EDL36756.1"
FT                   AQTLERKED"
FT   assembly_gap    29451075..29451641
FT                   /estimated_length=567
FT                   /gap_type="unknown"
FT   assembly_gap    29485458..29485505
FT                   /estimated_length=48
FT                   /gap_type="unknown"
FT   assembly_gap    29525378..29531613
FT                   /estimated_length=6236
FT                   /gap_type="unknown"
FT   assembly_gap    29557777..29557796
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    29590894..29591154
FT                   /estimated_length=261
FT                   /gap_type="unknown"
FT   assembly_gap    29592328..29592409
FT                   /estimated_length=82
FT                   /gap_type="unknown"
FT   assembly_gap    29609209..29609228
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    29632441..29632460
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    29634106..29634125
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    29636658..29636677
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    29638529..29638717
FT                   /estimated_length=189
FT                   /gap_type="unknown"
FT   assembly_gap    29640353..29640372
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    29642343..29642362
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    29645399..29646016
FT                   /estimated_length=618
FT                   /gap_type="unknown"
FT   assembly_gap    29651516..29655655
FT                   /estimated_length=4140
FT                   /gap_type="unknown"
FT   assembly_gap    29659379..29659907
FT                   /estimated_length=529
FT                   /gap_type="unknown"
FT   gene            complement(29667746..29672740)
FT                   /locus_tag="mCG_1041818"
FT                   /note="gene_id=mCG1041818.0"
FT   mRNA            complement(join(29667746..29668418,29672535..29672740))
FT                   /locus_tag="mCG_1041818"
FT                   /product="mCG1041818"
FT                   /note="gene_id=mCG1041818.0 transcript_id=mCT159522.0
FT                   created on 24-SEP-2002"
FT   CDS             complement(29668059..29668382)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041818"
FT                   /product="mCG1041818"
FT                   /note="gene_id=mCG1041818.0 transcript_id=mCT159522.0
FT                   protein_id=mCP78487.1"
FT                   /protein_id="EDL36755.1"
FT                   VFP"
FT   gene            complement(29676461..29701196)
FT                   /gene="Egln3"
FT                   /locus_tag="mCG_12077"
FT                   /note="gene_id=mCG12077.1"
FT   mRNA            complement(join(29676461..29678125,29679101..29679174,
FT                   29681350..29681486,29683011..29683130,29700553..29701196))
FT                   /gene="Egln3"
FT                   /locus_tag="mCG_12077"
FT                   /product="EGL nine homolog 3 (C. elegans)"
FT                   /note="gene_id=mCG12077.1 transcript_id=mCT15676.1 created
FT                   on 04-APR-2003"
FT   assembly_gap    29676738..29676757
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             complement(join(29678094..29678125,29679101..29679174,
FT                   29681350..29681486,29683011..29683130,29700553..29700909))
FT                   /codon_start=1
FT                   /gene="Egln3"
FT                   /locus_tag="mCG_12077"
FT                   /product="EGL nine homolog 3 (C. elegans)"
FT                   /note="gene_id=mCG12077.1 transcript_id=mCT15676.1
FT                   protein_id=mCP16833.2 partial"
FT                   /db_xref="GOA:A0A0R4J0H9"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR006620"
FT                   /db_xref="MGI:MGI:1932288"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J0H9"
FT                   /protein_id="EDL36754.1"
FT                   KKFRNLTRKTESALAKD"
FT   assembly_gap    29687627..29687803
FT                   /estimated_length=177
FT                   /gap_type="unknown"
FT   assembly_gap    29696592..29696710
FT                   /estimated_length=119
FT                   /gap_type="unknown"
FT   assembly_gap    29728411..29728500
FT                   /estimated_length=90
FT                   /gap_type="unknown"
FT   gene            29730944..29739703
FT                   /locus_tag="mCG_148276"
FT                   /note="gene_id=mCG148276.0"
FT   mRNA            join(29730944..29731084,29739018..29739132,
FT                   29739359..29739703)
FT                   /locus_tag="mCG_148276"
FT                   /product="mCG148276"
FT                   /note="gene_id=mCG148276.0 transcript_id=mCT188539.0
FT                   created on 13-JAN-2004"
FT   CDS             join(29731059..29731084,29739018..29739132,
FT                   29739359..29739385)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148276"
FT                   /product="mCG148276"
FT                   /note="gene_id=mCG148276.0 transcript_id=mCT188539.0
FT                   protein_id=mCP108110.0"
FT                   /protein_id="EDL36753.1"
FT                   CPVLKMVASL"
FT   assembly_gap    29752425..29760374
FT                   /estimated_length=7950
FT                   /gap_type="unknown"
FT   assembly_gap    29766504..29766523
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    29771371..29771390
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    29776168..29776909
FT                   /estimated_length=742
FT                   /gap_type="unknown"
FT   assembly_gap    29792612..29792631
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    29819059..29819078
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    29829857..29830081
FT                   /estimated_length=225
FT                   /gap_type="unknown"
FT   assembly_gap    29849083..29849243
FT                   /estimated_length=161
FT                   /gap_type="unknown"
FT   assembly_gap    29855643..29855662
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    29863877..29863896
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    29865133..29865152
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(29888619..29892176)
FT                   /locus_tag="mCG_1041816"
FT                   /note="gene_id=mCG1041816.0"
FT   mRNA            complement(join(29888619..29889065,29892061..29892176))
FT                   /locus_tag="mCG_1041816"
FT                   /product="mCG1041816"
FT                   /note="gene_id=mCG1041816.0 transcript_id=mCT159520.0
FT                   created on 24-SEP-2002"
FT   CDS             complement(join(29888790..29889065,29892061..29892072))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041816"
FT                   /product="mCG1041816"
FT                   /note="gene_id=mCG1041816.0 transcript_id=mCT159520.0
FT                   protein_id=mCP78470.1"
FT                   /protein_id="EDL36752.1"
FT   assembly_gap    29893214..29895197
FT                   /estimated_length=1984
FT                   /gap_type="unknown"
FT   assembly_gap    29915894..29917119
FT                   /estimated_length=1226
FT                   /gap_type="unknown"
FT   gene            <29929855..29930422
FT                   /locus_tag="mCG_12076"
FT                   /note="gene_id=mCG12076.1"
FT   mRNA            <29929855..29930422
FT                   /locus_tag="mCG_12076"
FT                   /product="mCG12076"
FT                   /note="gene_id=mCG12076.1 transcript_id=mCT15675.1 created
FT                   on 06-SEP-2002"
FT   CDS             <29929986..29930372
FT                   /codon_start=1
FT                   /locus_tag="mCG_12076"
FT                   /product="mCG12076"
FT                   /note="gene_id=mCG12076.1 transcript_id=mCT15675.1
FT                   protein_id=mCP16836.0"
FT                   /protein_id="EDL36751.1"
FT   assembly_gap    29934209..29934951
FT                   /estimated_length=743
FT                   /gap_type="unknown"
FT   assembly_gap    29978426..29978609
FT                   /estimated_length=184
FT                   /gap_type="unknown"
FT   assembly_gap    30029291..30029310
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    30035697..30036098
FT                   /estimated_length=402
FT                   /gap_type="unknown"
FT   assembly_gap    30037936..30038055
FT                   /estimated_length=120
FT                   /gap_type="unknown"
FT   assembly_gap    30050231..30050250
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    30067011..30067030
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    30068166..30068185
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    30077968..30077987
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    30084261..30084380
FT                   /estimated_length=120
FT                   /gap_type="unknown"
FT   assembly_gap    30086945..30087198
FT                   /estimated_length=254
FT                   /gap_type="unknown"
FT   assembly_gap    30092989..30093008
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <30124769..30125435
FT                   /locus_tag="mCG_12075"
FT                   /note="gene_id=mCG12075.1"
FT   mRNA            <30124769..30125435
FT                   /locus_tag="mCG_12075"
FT                   /product="mCG12075"
FT                   /note="gene_id=mCG12075.1 transcript_id=mCT15674.1 created
FT                   on 06-SEP-2002"
FT   CDS             <30124820..30125422
FT                   /codon_start=1
FT                   /locus_tag="mCG_12075"
FT                   /product="mCG12075"
FT                   /note="gene_id=mCG12075.1 transcript_id=mCT15674.1
FT                   protein_id=mCP16835.1"
FT                   /protein_id="EDL36750.1"
FT   assembly_gap    30128780..30130869
FT                   /estimated_length=2090
FT                   /gap_type="unknown"
FT   gene            complement(30147074..30158205)
FT                   /gene="1110002B05Rik"
FT                   /locus_tag="mCG_54886"
FT                   /note="gene_id=mCG54886.2"
FT   mRNA            complement(join(30147074..30148204,30158048..30158205))
FT                   /gene="1110002B05Rik"
FT                   /locus_tag="mCG_54886"
FT                   /product="RIKEN cDNA 1110002B05"
FT                   /note="gene_id=mCG54886.2 transcript_id=mCT55069.1 created
FT                   on 23-DEC-2002"
FT   CDS             complement(join(30148101..30148204,30158048..30158159))
FT                   /codon_start=1
FT                   /gene="1110002B05Rik"
FT                   /locus_tag="mCG_54886"
FT                   /product="RIKEN cDNA 1110002B05"
FT                   /note="gene_id=mCG54886.2 transcript_id=mCT55069.1
FT                   protein_id=mCP37677.1"
FT                   /protein_id="EDL36749.1"
FT   assembly_gap    30160373..30160746
FT                   /estimated_length=374
FT                   /gap_type="unknown"
FT   gene            <30172878..30180743
FT                   /locus_tag="mCG_145562"
FT                   /note="gene_id=mCG145562.0"
FT   mRNA            join(<30172878..30173446,30179595..30179651,
FT                   30180248..30180743)
FT                   /locus_tag="mCG_145562"
FT                   /product="mCG145562"
FT                   /note="gene_id=mCG145562.0 transcript_id=mCT184986.0
FT                   created on 05-JUN-2003"
FT   CDS             <30172912..30173163
FT                   /codon_start=1
FT                   /locus_tag="mCG_145562"
FT                   /product="mCG145562"
FT                   /note="gene_id=mCG145562.0 transcript_id=mCT184986.0
FT                   protein_id=mCP105145.0"
FT                   /protein_id="EDL36747.1"
FT   gene            30173605..30174338
FT                   /locus_tag="mCG_1041812"
FT                   /note="gene_id=mCG1041812.1"
FT   mRNA            30173605..30174338
FT                   /locus_tag="mCG_1041812"
FT                   /product="mCG1041812"
FT                   /note="gene_id=mCG1041812.1 transcript_id=mCT159516.1
FT                   created on 24-SEP-2002"
FT   CDS             30174189..30174308
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041812"
FT                   /product="mCG1041812"
FT                   /note="gene_id=mCG1041812.1 transcript_id=mCT159516.1
FT                   protein_id=mCP78918.1"
FT                   /protein_id="EDL36748.1"
FT   gene            complement(30174829..>30195581)
FT                   /gene="1810011O16Rik"
FT                   /locus_tag="mCG_12404"
FT                   /note="gene_id=mCG12404.1"
FT   mRNA            complement(join(30174829..30175211,30179892..30180005,
FT                   30185592..30185703,30191756..30191851,30192537..30192718,
FT                   30195472..>30195581))
FT                   /gene="1810011O16Rik"
FT                   /locus_tag="mCG_12404"
FT                   /product="RIKEN cDNA 1810011O16"
FT                   /note="gene_id=mCG12404.1 transcript_id=mCT15673.1 created
FT                   on 29-AUG-2002"
FT   CDS             complement(join(30174944..30175211,30179892..30180005,
FT                   30185592..30185703,30191756..30191851,30192537..30192718,
FT                   30195472..>30195581))
FT                   /codon_start=1
FT                   /gene="1810011O16Rik"
FT                   /locus_tag="mCG_12404"
FT                   /product="RIKEN cDNA 1810011O16"
FT                   /note="gene_id=mCG12404.1 transcript_id=mCT15673.1
FT                   protein_id=mCP16834.0"
FT                   /protein_id="EDL36746.1"
FT                   VFHFFNVLASHS"
FT   gene            complement(30201003..30201430)
FT                   /locus_tag="mCG_49033"
FT                   /note="gene_id=mCG49033.2"
FT   mRNA            complement(30201003..30201430)
FT                   /locus_tag="mCG_49033"
FT                   /product="mCG49033"
FT                   /note="gene_id=mCG49033.2 transcript_id=mCT49216.2 created
FT                   on 24-SEP-2002"
FT   CDS             complement(30201036..30201413)
FT                   /codon_start=1
FT                   /locus_tag="mCG_49033"
FT                   /product="mCG49033"
FT                   /note="gene_id=mCG49033.2 transcript_id=mCT49216.2
FT                   protein_id=mCP37679.1"
FT                   /protein_id="EDL36745.1"
FT   assembly_gap    30221132..30233844
FT                   /estimated_length=12713
FT                   /gap_type="unknown"
FT   assembly_gap    30235048..30241061
FT                   /estimated_length=6014
FT                   /gap_type="unknown"
FT   gene            complement(<30241063..30278851)
FT                   /gene="Snx6"
FT                   /locus_tag="mCG_21236"
FT                   /note="gene_id=mCG21236.1"
FT   mRNA            complement(join(<30241063..30241112,30241186..30241345,
FT                   30243930..30244016,30245822..30245908,30249326..30249365,
FT                   30252577..30252652,30255802..30255907,30257766..30257861,
FT                   30260212..30260335,30262917..30263038,30266607..30266717,
FT                   30267219..30267323,30278604..30278651,30278798..30278851))
FT                   /gene="Snx6"
FT                   /locus_tag="mCG_21236"
FT                   /product="sorting nexin 6, transcript variant mCT20734"
FT                   /note="gene_id=mCG21236.1 transcript_id=mCT20734.2 created
FT                   on 05-SEP-2002"
FT   CDS             complement(join(<30241063..30241112,30241186..30241345,
FT                   30243930..30244016,30245822..30245908,30249326..30249365,
FT                   30252577..30252652,30255802..30255907,30257766..30257861,
FT                   30260212..30260335,30262917..30263038,30266607..30266717,
FT                   30267219..30267323,30278604..30278651,30278798..30278803))
FT                   /codon_start=1
FT                   /gene="Snx6"
FT                   /locus_tag="mCG_21236"
FT                   /product="sorting nexin 6, isoform CRA_b"
FT                   /note="gene_id=mCG21236.1 transcript_id=mCT20734.2
FT                   protein_id=mCP1802.2 isoform=CRA_b"
FT                   /protein_id="EDL36744.1"
FT                   CCIQKKI"
FT   assembly_gap    30242612..30242631
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    30244903..30244922
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            complement(join(30248376..30248605,30252577..30252652,
FT                   30255802..30255907,30257766..30257861,30260212..30260335,
FT                   30262917..30263038,30266607..30266717,30267219..30267323,
FT                   30278604..>30278653))
FT                   /gene="Snx6"
FT                   /locus_tag="mCG_21236"
FT                   /product="sorting nexin 6, transcript variant mCT193461"
FT                   /note="gene_id=mCG21236.1 transcript_id=mCT193461.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(30248533..30248605,30252577..30252652,
FT                   30255802..30255907,30257766..30257861,30260212..30260335,
FT                   30262917..30263038,30266607..30266717,30267219..30267323,
FT                   30278604..>30278651))
FT                   /codon_start=1
FT                   /gene="Snx6"
FT                   /locus_tag="mCG_21236"
FT                   /product="sorting nexin 6, isoform CRA_a"
FT                   /note="gene_id=mCG21236.1 transcript_id=mCT193461.0
FT                   protein_id=mCP114416.0 isoform=CRA_a"
FT                   /protein_id="EDL36743.1"
FT                   VRAAA"
FT   assembly_gap    30248910..30248929
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    30250257..30250656
FT                   /estimated_length=400
FT                   /gap_type="unknown"
FT   assembly_gap    30276122..30276141
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    30284412..30284832
FT                   /estimated_length=421
FT                   /gap_type="unknown"
FT   assembly_gap    30300077..30300373
FT                   /estimated_length=297
FT                   /gap_type="unknown"
FT   assembly_gap    30309730..30310189
FT                   /estimated_length=460
FT                   /gap_type="unknown"
FT   assembly_gap    30313420..30314092
FT                   /estimated_length=673
FT                   /gap_type="unknown"
FT   gene            complement(30342009..>30345935)
FT                   /gene="Cfl2"
FT                   /locus_tag="mCG_21240"
FT                   /note="gene_id=mCG21240.1"
FT   mRNA            complement(join(30342009..30344408,30344508..30344584,
FT                   30344951..30345004,30345915..>30345935))
FT                   /gene="Cfl2"
FT                   /locus_tag="mCG_21240"
FT                   /product="cofilin 2, muscle, transcript variant mCT172860"
FT                   /note="gene_id=mCG21240.1 transcript_id=mCT172860.0 created
FT                   on 29-AUG-2002"
FT   mRNA            complement(join(30342009..30344408,30344508..30344584,
FT                   30344840..30345004,30345915..>30345935))
FT                   /gene="Cfl2"
FT                   /locus_tag="mCG_21240"
FT                   /product="cofilin 2, muscle, transcript variant mCT172861"
FT                   /note="gene_id=mCG21240.1 transcript_id=mCT172861.0 created
FT                   on 29-AUG-2002"
FT   mRNA            complement(join(30342009..30344408,30344508..30344584,
FT                   30344697..30345004,30345915..>30345935))
FT                   /gene="Cfl2"
FT                   /locus_tag="mCG_21240"
FT                   /product="cofilin 2, muscle, transcript variant mCT20738"
FT                   /note="gene_id=mCG21240.1 transcript_id=mCT20738.1 created
FT                   on 29-AUG-2002"
FT   CDS             complement(30343584..>30343835)
FT                   /codon_start=1
FT                   /gene="Cfl2"
FT                   /locus_tag="mCG_21240"
FT                   /product="cofilin 2, muscle, isoform CRA_a"
FT                   /note="gene_id=mCG21240.1 transcript_id=mCT172860.0
FT                   protein_id=mCP95780.0 isoform=CRA_a"
FT                   /protein_id="EDL36740.1"
FT   CDS             complement(30343584..>30343835)
FT                   /codon_start=1
FT                   /gene="Cfl2"
FT                   /locus_tag="mCG_21240"
FT                   /product="cofilin 2, muscle, isoform CRA_a"
FT                   /note="gene_id=mCG21240.1 transcript_id=mCT172861.0
FT                   protein_id=mCP95779.0 isoform=CRA_a"
FT                   /protein_id="EDL36741.1"
FT   CDS             complement(join(30344296..30344408,30344508..30344584,
FT                   30344697..30345004,30345915..>30345935))
FT                   /codon_start=1
FT                   /gene="Cfl2"
FT                   /locus_tag="mCG_21240"
FT                   /product="cofilin 2, muscle, isoform CRA_b"
FT                   /note="gene_id=mCG21240.1 transcript_id=mCT20738.1
FT                   protein_id=mCP1799.1 isoform=CRA_b"
FT                   /protein_id="EDL36742.1"
FT                   VVSLEGKPL"
FT   assembly_gap    30345936..30346134
FT                   /estimated_length=199
FT                   /gap_type="unknown"
FT   gene            30346202..30346877
FT                   /locus_tag="mCG_148275"
FT                   /note="gene_id=mCG148275.0"
FT   mRNA            join(30346202..30346322,30346490..30346877)
FT                   /locus_tag="mCG_148275"
FT                   /product="mCG148275"
FT                   /note="gene_id=mCG148275.0 transcript_id=mCT188538.0
FT                   created on 13-JAN-2004"
FT   CDS             30346690..30346863
FT                   /codon_start=1
FT                   /locus_tag="mCG_148275"
FT                   /product="mCG148275"
FT                   /note="gene_id=mCG148275.0 transcript_id=mCT188538.0
FT                   protein_id=mCP108109.0"
FT                   /protein_id="EDL36739.1"
FT                   PCKWDVLRLLEK"
FT   assembly_gap    30351866..30352216
FT                   /estimated_length=351
FT                   /gap_type="unknown"
FT   assembly_gap    30353838..30353857
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    30356897..30357803
FT                   /estimated_length=907
FT                   /gap_type="unknown"
FT   assembly_gap    30359076..30359095
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    30360253..30360294
FT                   /estimated_length=42
FT                   /gap_type="unknown"
FT   assembly_gap    30370093..30373953
FT                   /estimated_length=3861
FT                   /gap_type="unknown"
FT   gene            complement(<30373986..30465569)
FT                   /locus_tag="mCG_126024"
FT                   /note="gene_id=mCG126024.0"
FT   mRNA            complement(join(<30373986..30374078,30375048..30375190,
FT                   30377516..30377820,30379018..30379090,30379133..30379244,
FT                   30379329..30379576,30388045..30388193,30390359..30390510,
FT                   30391624..30391787,30395547..30396146,30397517..30397641,
FT                   30400104..30400211,30401513..30401678,30402110..30402259,
FT                   30402455..30402550,30406634..30406780,30414596..30414695,
FT                   30420623..30420674,30423171..30423258,30425990..30426091,
FT                   30433895..30434038,30454304..30454582,30465261..30465569))
FT                   /locus_tag="mCG_126024"
FT                   /product="mCG126024"
FT                   /note="gene_id=mCG126024.0 transcript_id=mCT127290.1
FT                   created on 03-APR-2003"
FT   CDS             complement(join(<30373986..30374078,30375048..30375190,
FT                   30377516..30377820,30379018..30379090,30379133..30379244,
FT                   30379329..30379576,30388045..30388193,30390359..30390510,
FT                   30391624..30391787,30395547..30396146,30397517..30397641,
FT                   30400104..30400211,30401513..30401678,30402110..30402259,
FT                   30402455..30402550,30406634..30406780,30414596..30414695,
FT                   30420623..30420674,30423171..30423190))
FT                   /codon_start=1
FT                   /locus_tag="mCG_126024"
FT                   /product="mCG126024"
FT                   /note="gene_id=mCG126024.0 transcript_id=mCT127290.1
FT                   protein_id=mCP79124.1"
FT                   /protein_id="EDL36738.1"
FT                   KVNKCEYKLACE"
FT   assembly_gap    30464624..30465255
FT                   /estimated_length=632
FT                   /gap_type="unknown"
FT   assembly_gap    30485845..30486400
FT                   /estimated_length=556
FT                   /gap_type="unknown"
FT   assembly_gap    30487828..30487889
FT                   /estimated_length=62
FT                   /gap_type="unknown"
FT   assembly_gap    30499382..30499401
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    30500532..30500551
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    30506998..30507017
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    30509045..30509064
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    30511045..30511164
FT                   /estimated_length=120
FT                   /gap_type="unknown"
FT   assembly_gap    30514841..30515017
FT                   /estimated_length=177
FT                   /gap_type="unknown"
FT   gene            complement(30520867..30555848)
FT                   /gene="2700097O09Rik"
FT                   /locus_tag="mCG_21241"
FT                   /note="gene_id=mCG21241.2"
FT   mRNA            complement(join(30520867..30521149,30524397..30524487,
FT                   30528770..30528876,30532707..30532817,30534923..30535044,
FT                   30536521..30536659,30538458..30538579,30555718..30555848))
FT                   /gene="2700097O09Rik"
FT                   /locus_tag="mCG_21241"
FT                   /product="RIKEN cDNA 2700097O09"
FT                   /note="gene_id=mCG21241.2 transcript_id=mCT20739.2 created
FT                   on 17-JUN-2003"
FT   CDS             complement(join(30521033..30521149,30524397..30524487,
FT                   30528770..30528876,30532707..30532817,30534923..30535044,
FT                   30536521..30536659,30538458..30538579,30555718..30555814))
FT                   /codon_start=1
FT                   /gene="2700097O09Rik"
FT                   /locus_tag="mCG_21241"
FT                   /product="RIKEN cDNA 2700097O09"
FT                   /note="gene_id=mCG21241.2 transcript_id=mCT20739.2
FT                   protein_id=mCP1801.2"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="MGI:MGI:1919908"
FT                   /db_xref="UniProtKB/TrEMBL:Q6PGK3"
FT                   /protein_id="EDL36737.1"
FT   assembly_gap    30528340..30528359
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    30540214..30540233
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    30542714..30542733
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    30549842..30549861
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <30556265..30592227
FT                   /gene="Srp54"
FT                   /locus_tag="mCG_126023"
FT                   /note="gene_id=mCG126023.1"
FT   mRNA            join(<30556265..30556463,30578331..30578481,
FT                   30579971..30580119,30580454..30580554,30581099..30581185,
FT                   30583465..30583635,30589610..30589705,30591334..30592227)
FT                   /gene="Srp54"
FT                   /locus_tag="mCG_126023"
FT                   /product="signal recognition particle 54, transcript
FT                   variant mCT127289"
FT                   /note="gene_id=mCG126023.1 transcript_id=mCT127289.1
FT                   created on 17-JUN-2003"
FT   mRNA            join(<30556268..30556473,30578331..30578481,
FT                   30579971..30580119,30580454..30580554,30581099..30581185,
FT                   30583465..30583635,30589610..30589705,30591334..30592227)
FT                   /gene="Srp54"
FT                   /locus_tag="mCG_126023"
FT                   /product="signal recognition particle 54, transcript
FT                   variant mCT185783"
FT                   /note="gene_id=mCG126023.1 transcript_id=mCT185783.0
FT                   created on 17-JUN-2003"
FT   CDS             join(<30556333..30556463,30578331..30578481,
FT                   30579971..30580119,30580454..30580554,30581099..30581185,
FT                   30583465..30583635,30589610..30589705,30591334..30591425)
FT                   /codon_start=1
FT                   /gene="Srp54"
FT                   /locus_tag="mCG_126023"
FT                   /product="signal recognition particle 54, isoform CRA_a"
FT                   /note="gene_id=mCG126023.1 transcript_id=mCT127289.1
FT                   protein_id=mCP79115.2 isoform=CRA_a"
FT                   /protein_id="EDL36735.1"
FT   CDS             join(<30556460..30556473,30578331..30578481,
FT                   30579971..30580119,30580454..30580554,30581099..30581185,
FT                   30583465..30583635,30589610..30589705,30591334..30591425)
FT                   /codon_start=1
FT                   /gene="Srp54"
FT                   /locus_tag="mCG_126023"
FT                   /product="signal recognition particle 54, isoform CRA_b"
FT                   /note="gene_id=mCG126023.1 transcript_id=mCT185783.0
FT                   protein_id=mCP107041.0 isoform=CRA_b"
FT                   /protein_id="EDL36736.1"
FT                   GFNNM"
FT   assembly_gap    30557230..30557249
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    30558552..30575397
FT                   /estimated_length=16846
FT                   /gap_type="unknown"
FT   assembly_gap    30577634..30577975
FT                   /estimated_length=342
FT                   /gap_type="unknown"
FT   assembly_gap    30581266..30581285
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    30585445..30585464
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    30592698..30592841
FT                   /estimated_length=144
FT                   /gap_type="unknown"
FT   gene            30604617..30610881
FT                   /locus_tag="mCG_145759"
FT                   /note="gene_id=mCG145759.0"
FT   mRNA            join(30604617..30604691,30606088..30606185,
FT                   30607754..30610881)
FT                   /locus_tag="mCG_145759"
FT                   /product="mCG145759"
FT                   /note="gene_id=mCG145759.0 transcript_id=mCT185764.0
FT                   created on 17-JUN-2003"
FT   CDS             join(30604661..30604691,30606088..30606185,
FT                   30607754..30607957)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145759"
FT                   /product="mCG145759"
FT                   /note="gene_id=mCG145759.0 transcript_id=mCT185764.0
FT                   protein_id=mCP107022.0"
FT                   /protein_id="EDL36734.1"
FT                   PVSVPP"
FT   gene            complement(30609956..30632060)
FT                   /gene="4930511A21Rik"
FT                   /locus_tag="mCG_126018"
FT                   /note="gene_id=mCG126018.1"
FT   mRNA            complement(join(30609956..30611046,30612137..30612196,
FT                   30613995..30614132,30617139..30617275,30617657..30617732,
FT                   30618718..30618850,30621575..30621645,30622853..30622950,
FT                   30626849..30626961,30627482..30627586,30627965..30628092,
FT                   30631665..30631866,30631986..30632060))
FT                   /gene="4930511A21Rik"
FT                   /locus_tag="mCG_126018"
FT                   /product="RIKEN cDNA 4930511A21"
FT                   /note="gene_id=mCG126018.1 transcript_id=mCT127284.1
FT                   created on 17-JUN-2003"
FT   CDS             complement(join(30617722..30617732,30618718..30618850,
FT                   30621575..30621645,30622853..30622950,30626849..30626961,
FT                   30627482..30627586,30627965..30628092,30631665..30631722))
FT                   /codon_start=1
FT                   /gene="4930511A21Rik"
FT                   /locus_tag="mCG_126018"
FT                   /product="RIKEN cDNA 4930511A21"
FT                   /note="gene_id=mCG126018.1 transcript_id=mCT127284.1
FT                   protein_id=mCP79080.1"
FT                   /protein_id="EDL36733.1"
FT                   VRKFFFFLDPLRTAKR"
FT   assembly_gap    30617800..30618356
FT                   /estimated_length=557
FT                   /gap_type="unknown"
FT   gene            30628648..30716835
FT                   /locus_tag="mCG_22352"
FT                   /note="gene_id=mCG22352.3"
FT   mRNA            join(30628648..30628737,30635408..30635455,
FT                   30637798..30637930,30672485..30672592,30711426..30711574,
FT                   30713594..30713789,30716569..30716748,30716776..30716835)
FT                   /locus_tag="mCG_22352"
FT                   /product="mCG22352, transcript variant mCT172863"
FT                   /note="gene_id=mCG22352.3 transcript_id=mCT172863.1 created
FT                   on 17-JUN-2003"
FT   CDS             join(30628700..30628737,30635408..30635455,
FT                   30637798..30637930,30672485..30672592,30711426..30711574,
FT                   30713594..30713789,30716569..30716712)
FT                   /codon_start=1
FT                   /locus_tag="mCG_22352"
FT                   /product="mCG22352, isoform CRA_a"
FT                   /note="gene_id=mCG22352.3 transcript_id=mCT172863.1
FT                   protein_id=mCP95782.0 isoform=CRA_a"
FT                   /db_xref="GOA:V9GXF2"
FT                   /db_xref="InterPro:IPR031595"
FT                   /db_xref="InterPro:IPR033495"
FT                   /db_xref="MGI:MGI:1913382"
FT                   /db_xref="UniProtKB/TrEMBL:V9GXF2"
FT                   /protein_id="EDL36730.1"
FT   mRNA            join(30631820..30633955,30635408..30635455,
FT                   30637798..30637930,30672485..30672592,30711426..30711574,
FT                   30713594..30713789,30716569..30716748,30716776..30716835)
FT                   /locus_tag="mCG_22352"
FT                   /product="mCG22352, transcript variant mCT21719"
FT                   /note="gene_id=mCG22352.3 transcript_id=mCT21719.3 created
FT                   on 17-JUN-2003"
FT   mRNA            join(30631820..30633955,30635408..30636656)
FT                   /locus_tag="mCG_22352"
FT                   /product="mCG22352, transcript variant mCT185787"
FT                   /note="gene_id=mCG22352.3 transcript_id=mCT185787.0 created
FT                   on 17-JUN-2003"
FT   CDS             join(30632979..30633955,30635408..30635455,
FT                   30637798..30637930,30672485..30672592,30711426..30711574,
FT                   30713594..30713789,30716569..30716712)
FT                   /codon_start=1
FT                   /locus_tag="mCG_22352"
FT                   /product="mCG22352, isoform CRA_c"
FT                   /note="gene_id=mCG22352.3 transcript_id=mCT21719.3
FT                   protein_id=mCP3415.2 isoform=CRA_c"
FT                   /db_xref="GOA:Q8JZY4"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR031595"
FT                   /db_xref="InterPro:IPR033495"
FT                   /db_xref="MGI:MGI:1913382"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8JZY4"
FT                   /protein_id="EDL36732.1"
FT                   QRKTPDPC"
FT   CDS             join(30632979..30633955,30635408..30635459)
FT                   /codon_start=1
FT                   /locus_tag="mCG_22352"
FT                   /product="mCG22352, isoform CRA_b"
FT                   /note="gene_id=mCG22352.3 transcript_id=mCT185787.0
FT                   protein_id=mCP107045.0 isoform=CRA_b"
FT                   /protein_id="EDL36731.1"
FT                   KR"
FT   assembly_gap    30651341..30651999
FT                   /estimated_length=659
FT                   /gap_type="unknown"
FT   assembly_gap    30653105..30653124
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    30654307..30654326
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    30655480..30655499
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    30657171..30657190
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    30666061..30666080
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    30702225..30702244
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    30705120..30705322
FT                   /estimated_length=203
FT                   /gap_type="unknown"
FT   assembly_gap    30716749..30716768
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    30722971..30722990
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(30729995..30730597)
FT                   /locus_tag="mCG_49804"
FT                   /note="gene_id=mCG49804.1"
FT   mRNA            complement(30729995..30730597)
FT                   /locus_tag="mCG_49804"
FT                   /product="mCG49804"
FT                   /note="gene_id=mCG49804.1 transcript_id=mCT49987.1 created
FT                   on 24-SEP-2002"
FT   CDS             complement(30730151..30730561)
FT                   /codon_start=1
FT                   /locus_tag="mCG_49804"
FT                   /product="mCG49804"
FT                   /note="gene_id=mCG49804.1 transcript_id=mCT49987.1
FT                   protein_id=mCP26448.0"
FT                   /protein_id="EDL36729.1"
FT   gene            <30733178..>30779248
FT                   /gene="Psma6"
FT                   /locus_tag="mCG_22345"
FT                   /note="gene_id=mCG22345.2"
FT   mRNA            join(<30733178..30733323,30741801..30741895,
FT                   30742334..30742415,30744459..30744608,30779234..>30779248)
FT                   /gene="Psma6"
FT                   /locus_tag="mCG_22345"
FT                   /product="proteasome (prosome, macropain) subunit, alpha
FT                   type 6, transcript variant mCT172862"
FT                   /note="gene_id=mCG22345.2 transcript_id=mCT172862.0 created
FT                   on 29-AUG-2002"
FT   mRNA            join(<30733229..30733323,30741801..30741895,
FT                   30742334..30742415,30744459..30744614,30746519..30746697,
FT                   30748736..30748830,30752569..30752783)
FT                   /gene="Psma6"
FT                   /locus_tag="mCG_22345"
FT                   /product="proteasome (prosome, macropain) subunit, alpha
FT                   type 6, transcript variant mCT21712"
FT                   /note="gene_id=mCG22345.2 transcript_id=mCT21712.1 created
FT                   on 29-AUG-2002"
FT   CDS             join(<30733233..30733323,30741801..30741895,
FT                   30742334..30742415,30744459..30744608,30779234..>30779248)
FT                   /codon_start=1
FT                   /gene="Psma6"
FT                   /locus_tag="mCG_22345"
FT                   /product="proteasome (prosome, macropain) subunit, alpha
FT                   type 6, isoform CRA_a"
FT                   /note="gene_id=mCG22345.2 transcript_id=mCT172862.0
FT                   protein_id=mCP95781.0 isoform=CRA_a"
FT                   /protein_id="EDL36727.1"
FT   CDS             join(<30733233..30733323,30741801..30741895,
FT                   30742334..30742415,30744459..30744614,30746519..30746697,
FT                   30748736..30748830,30752569..30752626)
FT                   /codon_start=1
FT                   /gene="Psma6"
FT                   /locus_tag="mCG_22345"
FT                   /product="proteasome (prosome, macropain) subunit, alpha
FT                   type 6, isoform CRA_b"
FT                   /note="gene_id=mCG22345.2 transcript_id=mCT21712.1
FT                   protein_id=mCP3431.1 isoform=CRA_b"
FT                   /protein_id="EDL36728.1"
FT   assembly_gap    30769741..30769760
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    30812874..30812932
FT                   /estimated_length=59
FT                   /gap_type="unknown"
FT   gene            complement(30824098..>30827772)
FT                   /gene="Nfkbia"
FT                   /locus_tag="mCG_22347"
FT                   /note="gene_id=mCG22347.2"
FT   mRNA            complement(join(30824098..30824656,30825093..30825353,
FT                   30825458..30825546,30825807..30826017,30826357..30826465,
FT                   30826868..>30827772))
FT                   /gene="Nfkbia"
FT                   /locus_tag="mCG_22347"
FT                   /product="nuclear factor of kappa light chain gene enhancer
FT                   in B-cells inhibitor, alpha"
FT                   /note="gene_id=mCG22347.2 transcript_id=mCT21714.2 created
FT                   on 29-AUG-2002"
FT   CDS             complement(join(30824609..30824656,30825093..30825353,
FT                   30825458..30825546,30825807..30826017,30826357..30826465,
FT                   30826868..>30827157))
FT                   /codon_start=1
FT                   /gene="Nfkbia"
FT                   /locus_tag="mCG_22347"
FT                   /product="nuclear factor of kappa light chain gene enhancer
FT                   in B-cells inhibitor, alpha"
FT                   /note="gene_id=mCG22347.2 transcript_id=mCT21714.2
FT                   protein_id=mCP3400.1"
FT                   /protein_id="EDL36726.1"
FT   assembly_gap    30826747..30826785
FT                   /estimated_length=39
FT                   /gap_type="unknown"
FT   assembly_gap    30832673..30832824
FT                   /estimated_length=152
FT                   /gap_type="unknown"
FT   assembly_gap    30848993..30849012
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    30873402..30873421
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    30885445..30885590
FT                   /estimated_length=146
FT                   /gap_type="unknown"
FT   gene            <30900009..30901667
FT                   /locus_tag="mCG_22349"
FT                   /note="gene_id=mCG22349.0"
FT   mRNA            <30900009..30901667
FT                   /locus_tag="mCG_22349"
FT                   /product="mCG22349"
FT                   /note="gene_id=mCG22349.0 transcript_id=mCT21716.0 created
FT                   on 29-AUG-2002"
FT   CDS             <30900009..30901157
FT                   /codon_start=1
FT                   /locus_tag="mCG_22349"
FT                   /product="mCG22349"
FT                   /note="gene_id=mCG22349.0 transcript_id=mCT21716.0
FT                   protein_id=mCP3405.0"
FT                   /protein_id="EDL36725.1"
FT   assembly_gap    30926862..30926913
FT                   /estimated_length=52
FT                   /gap_type="unknown"
FT   assembly_gap    30930434..30930480
FT                   /estimated_length=47
FT                   /gap_type="unknown"
FT   gene            <30934194..>30935675
FT                   /gene="Insm2"
FT                   /locus_tag="mCG_22350"
FT                   /note="gene_id=mCG22350.1"
FT   mRNA            <30934194..>30935675
FT                   /gene="Insm2"
FT                   /locus_tag="mCG_22350"
FT                   /product="insulinoma-associated 2"
FT                   /note="gene_id=mCG22350.1 transcript_id=mCT21717.1 created
FT                   on 29-AUG-2002"
FT   CDS             30934194..30935675
FT                   /codon_start=1
FT                   /gene="Insm2"
FT                   /locus_tag="mCG_22350"
FT                   /product="insulinoma-associated 2"
FT                   /note="gene_id=mCG22350.1 transcript_id=mCT21717.1
FT                   protein_id=mCP3406.1"
FT                   /protein_id="EDL36724.1"
FT   gene            complement(30938588..>31033385)
FT                   /locus_tag="mCG_22351"
FT                   /note="gene_id=mCG22351.2"
FT   mRNA            complement(join(30938588..30938989,30947355..30947479,
FT                   30975103..30975230,30976844..30977002,30993568..30993723,
FT                   31000054..31000177,31007954..31008025,31010905..31011766,
FT                   31018408..31018591,31018988..31019122,31024260..31024328,
FT                   31027857..31027967,31029645..31029753,31032337..31032395,
FT                   31033260..>31033385))
FT                   /locus_tag="mCG_22351"
FT                   /product="mCG22351"
FT                   /note="gene_id=mCG22351.2 transcript_id=mCT21718.1 created
FT                   on 29-AUG-2002"
FT   CDS             complement(join(30938841..30938989,30947355..30947479,
FT                   30975103..30975230,30976844..30977002,30993568..30993723,
FT                   31000054..31000177,31007954..31008025,31010905..31011766,
FT                   31018408..31018591,31018988..31019122,31024260..31024328,
FT                   31027857..31027967,31029645..>31029707))
FT                   /codon_start=1
FT                   /locus_tag="mCG_22351"
FT                   /product="mCG22351"
FT                   /note="gene_id=mCG22351.2 transcript_id=mCT21718.1
FT                   protein_id=mCP3407.1"
FT                   /protein_id="EDL36723.1"
FT   assembly_gap    30967673..30974152
FT                   /estimated_length=6480
FT                   /gap_type="unknown"
FT   assembly_gap    30998584..30998603
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(31046967..>31155625)
FT                   /locus_tag="mCG_145561"
FT                   /note="gene_id=mCG145561.1"
FT   mRNA            complement(join(31046967..31047284,31051460..31051636,
FT                   31052591..31052807,31054082..31054206,31057272..31057439,
FT                   31072709..31072870,31073830..31074067,31075932..31076061,
FT                   31081612..31081760,31092418..31092552,31097026..31097223,
FT                   31105105..31105344,31110505..31110713,31111778..31111916,
FT                   31117271..31117386,31120660..31120837,31121913..31121956,
FT                   31124802..31124859,31129485..31129534,31130156..31130266,
FT                   31155118..>31155539))
FT                   /locus_tag="mCG_145561"
FT                   /product="mCG145561, transcript variant mCT184985"
FT                   /note="gene_id=mCG145561.1 transcript_id=mCT184985.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(31047121..31047284,31051460..31051636,
FT                   31052591..31052807,31054082..31054206,31057272..31057439,
FT                   31072709..31072870,31073830..31074067,31075932..31076061,
FT                   31081612..31081760,31092418..31092552,31097026..31097223,
FT                   31105105..31105344,31110505..31110713,31111778..31111916,
FT                   31117271..31117386,31120660..31120837,31121913..31121956,
FT                   31124802..31124859,31129485..31129534,31130156..31130266,
FT                   31155118..>31155292))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145561"
FT                   /product="mCG145561, isoform CRA_a"
FT                   /note="gene_id=mCG145561.1 transcript_id=mCT184985.0
FT                   protein_id=mCP105146.0 isoform=CRA_a"
FT                   /protein_id="EDL36721.1"
FT                   SVLQTPDDLGNA"
FT   mRNA            complement(join(<31056681..31057439,31072709..31072870,
FT                   31073830..31074067,31075932..31076061,31081612..31081760,
FT                   31092418..31092552,31097026..31097223,31105105..31105344,
FT                   31110505..31110713,31111778..31111916,31117271..31117386,
FT                   31120660..31120837,31121913..31121956,31124802..31124859,
FT                   31129485..31129534,31130156..31130266,31155118..>31155625))
FT                   /locus_tag="mCG_145561"
FT                   /product="mCG145561, transcript variant mCT193462"
FT                   /note="gene_id=mCG145561.1 transcript_id=mCT193462.0
FT                   created on 09-MAR-2004"
FT   CDS             complement(join(<31056681..31057439,31072709..31072870,
FT                   31073830..31074067,31075932..31076061,31081612..31081760,
FT                   31092418..31092552,31097026..31097223,31105105..31105344,
FT                   31110505..31110713,31111778..31111916,31117271..31117386,
FT                   31120660..31120837,31121913..31121956,31124802..31124859,
FT                   31129485..31129534,31130156..31130266,31155118..>31155292))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145561"
FT                   /product="mCG145561, isoform CRA_b"
FT                   /note="gene_id=mCG145561.1 transcript_id=mCT193462.0
FT                   protein_id=mCP114405.0 isoform=CRA_b"
FT                   /protein_id="EDL36722.1"
FT   assembly_gap    31151551..31151570
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            31155066..31156036
FT                   /locus_tag="mCG_148265"
FT                   /note="gene_id=mCG148265.0"
FT   mRNA            31155066..31156036
FT                   /locus_tag="mCG_148265"
FT                   /product="mCG148265"
FT                   /note="gene_id=mCG148265.0 transcript_id=mCT188528.0
FT                   created on 13-JAN-2004"
FT   CDS             31155309..31155536
FT                   /codon_start=1
FT                   /locus_tag="mCG_148265"
FT                   /product="mCG148265"
FT                   /note="gene_id=mCG148265.0 transcript_id=mCT188528.0
FT                   protein_id=mCP108100.0"
FT                   /protein_id="EDL36720.1"
FT   gene            <31170859..31204195
FT                   /locus_tag="mCG_22342"
FT                   /note="gene_id=mCG22342.2"
FT   mRNA            join(<31170859..31171101,31176027..31176117,
FT                   31178852..31178979,31179740..31179819,31195542..31195625,
FT                   31195844..31195908,31200409..31200535,31202620..31202978,
FT                   31203856..31204193)
FT                   /locus_tag="mCG_22342"
FT                   /product="mCG22342, transcript variant mCT193429"
FT                   /note="gene_id=mCG22342.2 transcript_id=mCT193429.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(<31170860..31171101,31176027..31176117,
FT                   31178852..31178979,31179740..31179819,31194545..31194641,
FT                   31195542..31195712,31195856..31195908,31197588..31197627,
FT                   31200409..31200535,31202620..31204195)
FT                   /locus_tag="mCG_22342"
FT                   /product="mCG22342, transcript variant mCT21709"
FT                   /note="gene_id=mCG22342.2 transcript_id=mCT21709.1 created
FT                   on 05-SEP-2002"
FT   CDS             join(<31170861..31171101,31176027..31176117,
FT                   31178852..31178979,31179740..31179819,31194545..31194641,
FT                   31195542..31195712,31195856..31195908,31197588..31197627,
FT                   31200409..31200535,31202620..31202737)
FT                   /codon_start=1
FT                   /locus_tag="mCG_22342"
FT                   /product="mCG22342, isoform CRA_c"
FT                   /note="gene_id=mCG22342.2 transcript_id=mCT21709.1
FT                   protein_id=mCP3419.1 isoform=CRA_c"
FT                   /protein_id="EDL36719.1"
FT   CDS             join(<31170861..31171101,31176027..31176117,
FT                   31178852..31178979,31179740..31179819,31195542..31195625,
FT                   31195844..31195855)
FT                   /codon_start=1
FT                   /locus_tag="mCG_22342"
FT                   /product="mCG22342, isoform CRA_b"
FT                   /note="gene_id=mCG22342.2 transcript_id=mCT193429.0
FT                   protein_id=mCP114418.0 isoform=CRA_b"
FT                   /protein_id="EDL36718.1"
FT   mRNA            join(<31171073..31171101,31176027..31176117,
FT                   31178852..31178979,31179740..31179819,31194545..31194641,
FT                   31195542..31195625,31195844..31195908,31197588..31197627,
FT                   31200409..31200535,31202620..31204193)
FT                   /locus_tag="mCG_22342"
FT                   /product="mCG22342, transcript variant mCT193428"
FT                   /note="gene_id=mCG22342.2 transcript_id=mCT193428.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<31171074..31171101,31176027..31176117,
FT                   31178852..31178979,31179740..31179819,31194545..31194641,
FT                   31195542..31195625,31195844..31195908,31197588..31197627,
FT                   31200409..31200535,31202620..31202737)
FT                   /codon_start=1
FT                   /locus_tag="mCG_22342"
FT                   /product="mCG22342, isoform CRA_a"
FT                   /note="gene_id=mCG22342.2 transcript_id=mCT193428.0
FT                   protein_id=mCP114417.0 isoform=CRA_a"
FT                   /protein_id="EDL36717.1"
FT                   IKHS"
FT   assembly_gap    31222780..31222799
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    31270455..31270614
FT                   /estimated_length=160
FT                   /gap_type="unknown"
FT   assembly_gap    31303620..31303639
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    31307833..31307852
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    31343274..31343521
FT                   /estimated_length=248
FT                   /gap_type="unknown"
FT   assembly_gap    31354873..31355134
FT                   /estimated_length=262
FT                   /gap_type="unknown"
FT   assembly_gap    31357469..31357488
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    31386195..31386806
FT                   /estimated_length=612
FT                   /gap_type="unknown"
FT   assembly_gap    31389766..31389910
FT                   /estimated_length=145
FT                   /gap_type="unknown"
FT   assembly_gap    31433558..31433617
FT                   /estimated_length=60
FT                   /gap_type="unknown"
FT   assembly_gap    31441782..31442004
FT                   /estimated_length=223
FT                   /gap_type="unknown"
FT   assembly_gap    31467084..31467103
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    31469582..31470012
FT                   /estimated_length=431
FT                   /gap_type="unknown"
FT   assembly_gap    31482355..31482412
FT                   /estimated_length=58
FT                   /gap_type="unknown"
FT   assembly_gap    31510469..31510500
FT                   /estimated_length=32
FT                   /gap_type="unknown"
FT   gene            31523357..31524763
FT                   /pseudo
FT                   /locus_tag="mCG_22343"
FT                   /note="gene_id=mCG22343.1"
FT   mRNA            join(31523357..31523449,31523683..31523877,
FT                   31524407..31524763)
FT                   /pseudo
FT                   /locus_tag="mCG_22343"
FT                   /note="gene_id=mCG22343.1 transcript_id=mCT21710.1 created
FT                   on 05-SEP-2002"
FT   assembly_gap    31537661..31537680
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    31546437..31546456
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <31587031..31600198
FT                   /locus_tag="mCG_145557"
FT                   /note="gene_id=mCG145557.0"
FT   mRNA            join(<31587031..31587127,31595130..31595276,
FT                   31597724..31597761,31599259..31600198)
FT                   /locus_tag="mCG_145557"
FT                   /product="mCG145557"
FT                   /note="gene_id=mCG145557.0 transcript_id=mCT184981.0
FT                   created on 05-JUN-2003"
FT   assembly_gap    31596645..31596664
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    31597309..31597485
FT                   /estimated_length=177
FT                   /gap_type="unknown"
FT   CDS             <31599892..31600134
FT                   /codon_start=1
FT                   /locus_tag="mCG_145557"
FT                   /product="mCG145557"
FT                   /note="gene_id=mCG145557.0 transcript_id=mCT184981.0
FT                   protein_id=mCP105139.0"
FT                   /protein_id="EDL36716.1"
FT   gene            complement(31662099..31679616)
FT                   /gene="Mbip"
FT                   /locus_tag="mCG_15696"
FT                   /note="gene_id=mCG15696.1"
FT   mRNA            complement(join(31662099..31662579,31664009..31664047,
FT                   31669578..31669675,31671083..31671235,31671544..31671609,
FT                   31673981..31674077,31674137..31674383,31676016..31676189,
FT                   31679452..31679616))
FT                   /gene="Mbip"
FT                   /locus_tag="mCG_15696"
FT                   /product="MAP3K12 binding inhibitory protein 1, transcript
FT                   variant mCT19236"
FT                   /note="gene_id=mCG15696.1 transcript_id=mCT19236.2 created
FT                   on 05-SEP-2002"
FT   mRNA            complement(join(31662127..31662576,31664009..31664047,
FT                   31669578..31669675,31671083..31671235,31671544..31671609,
FT                   31673981..31674077,31674165..31674383,31676016..31676135,
FT                   31679452..31679577))
FT                   /gene="Mbip"
FT                   /locus_tag="mCG_15696"
FT                   /product="MAP3K12 binding inhibitory protein 1, transcript
FT                   variant mCT172854"
FT                   /note="gene_id=mCG15696.1 transcript_id=mCT172854.0 created
FT                   on 05-SEP-2002"
FT   CDS             complement(join(31662475..31662576,31664009..31664047,
FT                   31669578..31669675,31671083..31671235,31671544..31671609,
FT                   31673981..31674077,31674165..31674356))
FT                   /codon_start=1
FT                   /gene="Mbip"
FT                   /locus_tag="mCG_15696"
FT                   /product="MAP3K12 binding inhibitory protein 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG15696.1 transcript_id=mCT172854.0
FT                   protein_id=mCP95773.0 isoform=CRA_a"
FT                   /protein_id="EDL36714.1"
FT   CDS             complement(join(31662475..31662579,31664009..31664047,
FT                   31669578..31669675,31671083..31671158))
FT                   /codon_start=1
FT                   /gene="Mbip"
FT                   /locus_tag="mCG_15696"
FT                   /product="MAP3K12 binding inhibitory protein 1, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG15696.1 transcript_id=mCT19236.2
FT                   protein_id=mCP3427.2 isoform=CRA_b"
FT                   /protein_id="EDL36715.1"
FT                   P"
FT   assembly_gap    31680610..31680629
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    31699487..31699506
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    31720517..31720536
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    31737016..31737035
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    31787864..31788021
FT                   /estimated_length=158
FT                   /gap_type="unknown"
FT   assembly_gap    31797430..31797449
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    31815610..31815629
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <31822939..>31863734
FT                   /locus_tag="mCG_1041801"
FT                   /note="gene_id=mCG1041801.0"
FT   mRNA            join(<31822939..31823136,31838032..31838138,
FT                   31839003..31839189,31851919..31851978,31852071..31852102,
FT                   31853561..31853649,31857813..31857945,31860924..31860957,
FT                   31863351..>31863734)
FT                   /locus_tag="mCG_1041801"
FT                   /product="mCG1041801"
FT                   /note="gene_id=mCG1041801.0 transcript_id=mCT159505.0
FT                   created on 24-SEP-2002"
FT   CDS             join(31822939..31823136,31838032..31838138,
FT                   31839003..31839189,31851919..31851978,31852071..31852102,
FT                   31853561..31853649,31857813..31857945,31860924..31860957,
FT                   31863351..31863734)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041801"
FT                   /product="mCG1041801"
FT                   /note="gene_id=mCG1041801.0 transcript_id=mCT159505.0
FT                   protein_id=mCP78511.0"
FT                   /protein_id="EDL36712.1"
FT                   AFRTPALS"
FT   gene            complement(31824166..>31839389)
FT                   /locus_tag="mCG_146097"
FT                   /note="gene_id=mCG146097.0"
FT   mRNA            complement(join(31824166..31824753,31824984..31825119,
FT                   31826896..31827087,31837168..31837341,31837824..>31839389))
FT                   /locus_tag="mCG_146097"
FT                   /product="mCG146097"
FT                   /note="gene_id=mCG146097.0 transcript_id=mCT186200.0
FT                   created on 14-JUL-2003"
FT   CDS             complement(31837899..>31838150)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146097"
FT                   /product="mCG146097"
FT                   /note="gene_id=mCG146097.0 transcript_id=mCT186200.0
FT                   protein_id=mCP107276.0"
FT                   /protein_id="EDL36713.1"
FT   assembly_gap    31859160..31859179
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<31867482..31871388)
FT                   /gene="Titf1"
FT                   /locus_tag="mCG_142469"
FT                   /note="gene_id=mCG142469.0"
FT   mRNA            complement(join(<31867482..31868227,31869135..31869520,
FT                   31870789..31871388))
FT                   /gene="Titf1"
FT                   /locus_tag="mCG_142469"
FT                   /product="thyroid transcription factor 1"
FT                   /note="gene_id=mCG142469.0 transcript_id=mCT180508.0
FT                   created on 13-FEB-2003"
FT   CDS             complement(join(31867482..31868227,31869135..31869507))
FT                   /codon_start=1
FT                   /gene="Titf1"
FT                   /locus_tag="mCG_142469"
FT                   /product="thyroid transcription factor 1"
FT                   /note="gene_id=mCG142469.0 transcript_id=mCT180508.0
FT                   protein_id=mCP103430.0"
FT                   /protein_id="EDL36711.1"
FT   assembly_gap    31888077..31889100
FT                   /estimated_length=1024
FT                   /gap_type="unknown"
FT   assembly_gap    31891411..31891430
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    31917887..31917906
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    31923781..31926036
FT                   /estimated_length=2256
FT                   /gap_type="unknown"
FT   gene            31933274..31936767
FT                   /locus_tag="mCG_124340"
FT                   /note="gene_id=mCG124340.0"
FT   mRNA            join(31933274..31933380,31933775..31933880,
FT                   31934025..31934109,31936094..31936221,31936593..31936767)
FT                   /locus_tag="mCG_124340"
FT                   /product="mCG124340"
FT                   /note="gene_id=mCG124340.0 transcript_id=mCT125581.0
FT                   created on 05-SEP-2002"
FT   CDS             join(31933370..31933380,31933775..31933880,
FT                   31934025..31934048)
FT                   /codon_start=1
FT                   /locus_tag="mCG_124340"
FT                   /product="mCG124340"
FT                   /note="gene_id=mCG124340.0 transcript_id=mCT125581.0
FT                   protein_id=mCP78882.1"
FT                   /protein_id="EDL36710.1"
FT                   L"
FT   assembly_gap    31953590..31953757
FT                   /estimated_length=168
FT                   /gap_type="unknown"
FT   gene            complement(31953823..31955557)
FT                   /gene="Nkx2-9"
FT                   /locus_tag="mCG_15692"
FT                   /note="gene_id=mCG15692.2"
FT   mRNA            complement(join(31953823..31954552,31955185..31955557))
FT                   /gene="Nkx2-9"
FT                   /locus_tag="mCG_15692"
FT                   /product="NK2 transcription factor related, locus 9
FT                   (Drosophila)"
FT                   /note="gene_id=mCG15692.2 transcript_id=mCT19235.2 created
FT                   on 24-FEB-2003"
FT   CDS             complement(join(31953993..31954552,31955185..31955332))
FT                   /codon_start=1
FT                   /gene="Nkx2-9"
FT                   /locus_tag="mCG_15692"
FT                   /product="NK2 transcription factor related, locus 9
FT                   (Drosophila)"
FT                   /note="gene_id=mCG15692.2 transcript_id=mCT19235.2
FT                   protein_id=mCP3411.2"
FT                   /db_xref="GOA:O70584"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017970"
FT                   /db_xref="InterPro:IPR020479"
FT                   /db_xref="MGI:MGI:1270158"
FT                   /db_xref="UniProtKB/Swiss-Prot:O70584"
FT                   /protein_id="EDL36709.1"
FT                   QHLAPPALVSWNW"
FT   assembly_gap    31968419..31970055
FT                   /estimated_length=1637
FT                   /gap_type="unknown"
FT   gene            31970983..31971716
FT                   /locus_tag="mCG_148261"
FT                   /note="gene_id=mCG148261.0"
FT   mRNA            31970983..31971716
FT                   /locus_tag="mCG_148261"
FT                   /product="mCG148261"
FT                   /note="gene_id=mCG148261.0 transcript_id=mCT188524.0
FT                   created on 13-JAN-2004"
FT   CDS             31971063..31971395
FT                   /codon_start=1
FT                   /locus_tag="mCG_148261"
FT                   /product="mCG148261"
FT                   /note="gene_id=mCG148261.0 transcript_id=mCT188524.0
FT                   protein_id=mCP108093.0"
FT                   /protein_id="EDL36708.1"
FT                   ASPIDV"
FT   assembly_gap    31971717..31971736
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    31975423..31975442
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    31977576..31977595
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <32046404..32062167
FT                   /gene="Pax9"
FT                   /locus_tag="mCG_15693"
FT                   /note="gene_id=mCG15693.2"
FT   mRNA            join(<32046404..32046799,32047509..32048135,
FT                   32050949..32051091,32060591..32062167)
FT                   /gene="Pax9"
FT                   /locus_tag="mCG_15693"
FT                   /product="paired box gene 9, transcript variant mCT19237"
FT                   /note="gene_id=mCG15693.2 transcript_id=mCT19237.2 created
FT                   on 29-AUG-2002"
FT   mRNA            join(<32046664..32048135,32050949..32051091,
FT                   32060591..32061272)
FT                   /gene="Pax9"
FT                   /locus_tag="mCG_15693"
FT                   /product="paired box gene 9, transcript variant mCT193493"
FT                   /note="gene_id=mCG15693.2 transcript_id=mCT193493.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<32046730..32046799,32047509..32048135,
FT                   32050949..32051091,32060591..32060845)
FT                   /codon_start=1
FT                   /gene="Pax9"
FT                   /locus_tag="mCG_15693"
FT                   /product="paired box gene 9, isoform CRA_a"
FT                   /note="gene_id=mCG15693.2 transcript_id=mCT19237.2
FT                   protein_id=mCP3412.2 isoform=CRA_a"
FT                   /protein_id="EDL36706.1"
FT   CDS             join(<32047349..32048135,32050949..32051091,
FT                   32060591..32060845)
FT                   /codon_start=1
FT                   /gene="Pax9"
FT                   /locus_tag="mCG_15693"
FT                   /product="paired box gene 9, isoform CRA_b"
FT                   /note="gene_id=mCG15693.2 transcript_id=mCT193493.0
FT                   protein_id=mCP114458.0 isoform=CRA_b"
FT                   /protein_id="EDL36707.1"
FT   gene            complement(32078110..>32209694)
FT                   /gene="Slc25a21"
FT                   /locus_tag="mCG_124335"
FT                   /note="gene_id=mCG124335.1"
FT   mRNA            complement(join(32078110..32078259,32089751..32089915,
FT                   32117240..32117392,32121418..32121477,32126591..32126657,
FT                   32209608..>32209694))
FT                   /gene="Slc25a21"
FT                   /locus_tag="mCG_124335"
FT                   /product="solute carrier family 25 (mitochondrial
FT                   oxodicarboxylate carrier), member 21"
FT                   /note="gene_id=mCG124335.1 transcript_id=mCT125576.1
FT                   created on 05-SEP-2002"
FT   CDS             complement(join(32078239..32078259,32089751..32089915,
FT                   32117240..32117392,32121418..32121477,32126591..32126657,
FT                   32209608..>32209693))
FT                   /codon_start=1
FT                   /gene="Slc25a21"
FT                   /locus_tag="mCG_124335"
FT                   /product="solute carrier family 25 (mitochondrial
FT                   oxodicarboxylate carrier), member 21"
FT                   /note="gene_id=mCG124335.1 transcript_id=mCT125576.1
FT                   protein_id=mCP78838.1"
FT                   /protein_id="EDL36705.1"
FT   assembly_gap    32086701..32086720
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    32100865..32100884
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    32144903..32144922
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    32146019..32146038
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    32210775..32210934
FT                   /estimated_length=160
FT                   /gap_type="unknown"
FT   assembly_gap    32262051..32262159
FT                   /estimated_length=109
FT                   /gap_type="unknown"
FT   assembly_gap    32283855..32283874
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    32299594..32299982
FT                   /estimated_length=389
FT                   /gap_type="unknown"
FT   assembly_gap    32305516..32305608
FT                   /estimated_length=93
FT                   /gap_type="unknown"
FT   assembly_gap    32311737..32311796
FT                   /estimated_length=60
FT                   /gap_type="unknown"
FT   assembly_gap    32322431..32322929
FT                   /estimated_length=499
FT                   /gap_type="unknown"
FT   assembly_gap    32334278..32334297
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    32375455..32375597
FT                   /estimated_length=143
FT                   /gap_type="unknown"
FT   assembly_gap    32380812..32380831
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    32393084..32393372
FT                   /estimated_length=289
FT                   /gap_type="unknown"
FT   assembly_gap    32400703..32401845
FT                   /estimated_length=1143
FT                   /gap_type="unknown"
FT   assembly_gap    32451288..32451307
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    32474628..32474807
FT                   /estimated_length=180
FT                   /gap_type="unknown"
FT   assembly_gap    32505120..32505211
FT                   /estimated_length=92
FT                   /gap_type="unknown"
FT   assembly_gap    32524383..32524402
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    32535543..32535562
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    32564881..32564900
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            32582375..32862776
FT                   /locus_tag="mCG_1040730"
FT                   /note="gene_id=mCG1040730.1"
FT   mRNA            join(32582375..32582643,32655391..32655597,
FT                   32658347..32658473,32659695..32659800,32677921..32678050,
FT                   32684393..32684426,32684686..32684856,32721403..32721510,
FT                   32773607..32773701,32822569..32822799,32862041..32862776)
FT                   /locus_tag="mCG_1040730"
FT                   /product="mCG1040730"
FT                   /note="gene_id=mCG1040730.1 transcript_id=mCT124850.0
FT                   created on 02-APR-2003"
FT   assembly_gap    32612929..32613278
FT                   /estimated_length=350
FT                   /gap_type="unknown"
FT   assembly_gap    32617756..32618391
FT                   /estimated_length=636
FT                   /gap_type="unknown"
FT   assembly_gap    32622353..32622488
FT                   /estimated_length=136
FT                   /gap_type="unknown"
FT   gene            complement(<32624710..>32629981)
FT                   /locus_tag="mCG_49426"
FT                   /note="gene_id=mCG49426.1"
FT   mRNA            complement(join(<32624710..32625264,32629907..>32629981))
FT                   /locus_tag="mCG_49426"
FT                   /product="mCG49426"
FT                   /note="gene_id=mCG49426.1 transcript_id=mCT49609.0 created
FT                   on 24-SEP-2002"
FT   CDS             complement(join(32624710..32625264,32629907..32629981))
FT                   /codon_start=1
FT                   /locus_tag="mCG_49426"
FT                   /product="mCG49426"
FT                   /note="gene_id=mCG49426.1 transcript_id=mCT49609.0
FT                   protein_id=mCP26462.0"
FT                   /protein_id="EDL36704.1"
FT   assembly_gap    32645949..32645968
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(32655464..32655597,32658347..32658473,
FT                   32659695..32659800,32677921..32678050,32684393..32684426,
FT                   32684686..32684856,32721403..32721510,32773607..32773701,
FT                   32822569..32822799,32862041..32862107)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1040730"
FT                   /product="mCG1040730"
FT                   /note="gene_id=mCG1040730.1 transcript_id=mCT124850.0
FT                   protein_id=mCP78903.1"
FT                   /db_xref="InterPro:IPR026175"
FT                   /db_xref="MGI:MGI:1920740"
FT                   /db_xref="UniProtKB/TrEMBL:G3UVV8"
FT                   /protein_id="EDL36703.1"
FT                   I"
FT   assembly_gap    32695767..32695811
FT                   /estimated_length=45
FT                   /gap_type="unknown"
FT   assembly_gap    32696980..32696999
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    32701662..32701681
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    32729642..32729706
FT                   /estimated_length=65
FT                   /gap_type="unknown"
FT   assembly_gap    32732907..32732926
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    32743557..32743576
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    32746997..32747016
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    32748241..32748260
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    32784942..32785795
FT                   /estimated_length=854
FT                   /gap_type="unknown"
FT   assembly_gap    32792082..32796868
FT                   /estimated_length=4787
FT                   /gap_type="unknown"
FT   assembly_gap    32804548..32804567
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    32808997..32809016
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    32881968..32882017
FT                   /estimated_length=50
FT                   /gap_type="unknown"
FT   gene            complement(<32883847..32885291)
FT                   /locus_tag="mCG_53544"
FT                   /note="gene_id=mCG53544.1"
FT   mRNA            complement(join(<32883847..32884079,32885014..32885291))
FT                   /locus_tag="mCG_53544"
FT                   /product="mCG53544"
FT                   /note="gene_id=mCG53544.1 transcript_id=mCT53727.1 created
FT                   on 24-SEP-2002"
FT   CDS             complement(join(32883847..32884079,32885014..32885260))
FT                   /codon_start=1
FT                   /locus_tag="mCG_53544"
FT                   /product="mCG53544"
FT                   /note="gene_id=mCG53544.1 transcript_id=mCT53727.1
FT                   protein_id=mCP26437.1"
FT                   /protein_id="EDL36702.1"
FT   assembly_gap    32886986..32887026
FT                   /estimated_length=41
FT                   /gap_type="unknown"
FT   assembly_gap    32900432..32900451
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(32906531..>32911674)
FT                   /gene="Foxa1"
FT                   /locus_tag="mCG_22881"
FT                   /note="gene_id=mCG22881.1"
FT   mRNA            complement(join(32906531..32909263,32911569..>32911674))
FT                   /gene="Foxa1"
FT                   /locus_tag="mCG_22881"
FT                   /product="forkhead box A1"
FT                   /note="gene_id=mCG22881.1 transcript_id=mCT21627.1 created
FT                   on 29-AUG-2002"
FT   CDS             complement(join(32907929..32909263,32911569..>32911673))
FT                   /codon_start=1
FT                   /gene="Foxa1"
FT                   /locus_tag="mCG_22881"
FT                   /product="forkhead box A1"
FT                   /note="gene_id=mCG22881.1 transcript_id=mCT21627.1
FT                   protein_id=mCP3399.0"
FT                   /protein_id="EDL36701.1"
FT   assembly_gap    32911675..32912055
FT                   /estimated_length=381
FT                   /gap_type="unknown"
FT   assembly_gap    32919784..32921736
FT                   /estimated_length=1953
FT                   /gap_type="unknown"
FT   assembly_gap    32928275..32928731
FT                   /estimated_length=457
FT                   /gap_type="unknown"
FT   gene            <32930440..32987825
FT                   /gene="4921506M07Rik"
FT                   /locus_tag="mCG_22880"
FT                   /note="gene_id=mCG22880.1"
FT   mRNA            join(<32930440..32930560,32942243..32943127,
FT                   32982018..32982131,32983167..32983379,32987683..32987825)
FT                   /gene="4921506M07Rik"
FT                   /locus_tag="mCG_22880"
FT                   /product="RIKEN cDNA 4921506M07"
FT                   /note="gene_id=mCG22880.1 transcript_id=mCT21626.1 created
FT                   on 05-SEP-2002"
FT   CDS             join(<32930552..32930560,32942243..32943127,
FT                   32982018..32982131,32983167..32983379,32987683..32987811)
FT                   /codon_start=1
FT                   /gene="4921506M07Rik"
FT                   /locus_tag="mCG_22880"
FT                   /product="RIKEN cDNA 4921506M07"
FT                   /note="gene_id=mCG22880.1 transcript_id=mCT21626.1
FT                   protein_id=mCP3414.1"
FT                   /protein_id="EDL36699.1"
FT   assembly_gap    32930890..32931087
FT                   /estimated_length=198
FT                   /gap_type="unknown"
FT   gene            complement(32952175..>32984324)
FT                   /locus_tag="mCG_146313"
FT                   /note="gene_id=mCG146313.0"
FT   mRNA            complement(join(32952175..32952397,32953546..32956139,
FT                   32959082..32959332,32983079..32983230,32984159..>32984324))
FT                   /locus_tag="mCG_146313"
FT                   /product="mCG146313"
FT                   /note="gene_id=mCG146313.0 transcript_id=mCT186416.0
FT                   created on 14-JUL-2003"
FT   CDS             complement(32955065..>32955409)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146313"
FT                   /product="mCG146313"
FT                   /note="gene_id=mCG146313.0 transcript_id=mCT186416.0
FT                   protein_id=mCP107278.0"
FT                   /protein_id="EDL36700.1"
FT                   RHVPDLMILD"
FT   assembly_gap    32967785..32972296
FT                   /estimated_length=4512
FT                   /gap_type="unknown"
FT   assembly_gap    32980444..32980463
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(32998228..32998731)
FT                   /locus_tag="mCG_50296"
FT                   /note="gene_id=mCG50296.1"
FT   mRNA            complement(32998228..32998731)
FT                   /locus_tag="mCG_50296"
FT                   /product="mCG50296"
FT                   /note="gene_id=mCG50296.1 transcript_id=mCT50479.1 created
FT                   on 17-SEP-2002"
FT   CDS             complement(32998268..32998705)
FT                   /codon_start=1
FT                   /locus_tag="mCG_50296"
FT                   /product="mCG50296"
FT                   /note="gene_id=mCG50296.1 transcript_id=mCT50479.1
FT                   protein_id=mCP26467.0"
FT                   /protein_id="EDL36698.1"
FT   gene            complement(33027120..33028573)
FT                   /locus_tag="mCG_1041796"
FT                   /note="gene_id=mCG1041796.0"
FT   mRNA            complement(join(33027120..33027238,33027917..33028045,
FT                   33028182..33028573))
FT                   /locus_tag="mCG_1041796"
FT                   /product="mCG1041796"
FT                   /note="gene_id=mCG1041796.0 transcript_id=mCT159500.0
FT                   created on 24-SEP-2002"
FT   CDS             complement(join(33027134..33027238,33027917..33028045,
FT                   33028182..33028259))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041796"
FT                   /product="mCG1041796"
FT                   /note="gene_id=mCG1041796.0 transcript_id=mCT159500.0
FT                   protein_id=mCP78459.1"
FT                   /protein_id="EDL36697.1"
FT   assembly_gap    33029345..33029364
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    33042536..33042870
FT                   /estimated_length=335
FT                   /gap_type="unknown"
FT   assembly_gap    33049042..33049061
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(33064146..33064493)
FT                   /locus_tag="mCG_1041542"
FT                   /note="gene_id=mCG1041542.1"
FT   mRNA            complement(33064146..33064493)
FT                   /locus_tag="mCG_1041542"
FT                   /product="mCG1041542"
FT                   /note="gene_id=mCG1041542.1 transcript_id=mCT159246.1
FT                   created on 17-SEP-2002"
FT   CDS             complement(33064238..33064390)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041542"
FT                   /product="mCG1041542"
FT                   /note="gene_id=mCG1041542.1 transcript_id=mCT159246.1
FT                   protein_id=mCP78392.1"
FT                   /protein_id="EDL36696.1"
FT                   PKLRK"
FT   gene            <33079570..33108157
FT                   /locus_tag="mCG_22879"
FT                   /note="gene_id=mCG22879.1"
FT   mRNA            join(<33079570..33079647,33084085..33084295,
FT                   33086916..33087068,33107220..33107445,33107836..33108157)
FT                   /locus_tag="mCG_22879"
FT                   /product="mCG22879"
FT                   /note="gene_id=mCG22879.1 transcript_id=mCT21625.1 created
FT                   on 05-SEP-2002"
FT   CDS             join(<33079571..33079647,33084085..33084295,
FT                   33086916..33087068,33107220..33107445,33107836..33107972)
FT                   /codon_start=1
FT                   /locus_tag="mCG_22879"
FT                   /product="mCG22879"
FT                   /note="gene_id=mCG22879.1 transcript_id=mCT21625.1
FT                   protein_id=mCP3410.1"
FT                   /protein_id="EDL36695.1"
FT   assembly_gap    33095775..33095933
FT                   /estimated_length=159
FT                   /gap_type="unknown"
FT   assembly_gap    33098035..33098165
FT                   /estimated_length=131
FT                   /gap_type="unknown"
FT   assembly_gap    33123951..33123970
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    33150217..33153061
FT                   /estimated_length=2845
FT                   /gap_type="unknown"
FT   assembly_gap    33176938..33177577
FT                   /estimated_length=640
FT                   /gap_type="unknown"
FT   assembly_gap    33178833..33179021
FT                   /estimated_length=189
FT                   /gap_type="unknown"
FT   assembly_gap    33186475..33186494
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    33192268..33192287
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    33238589..33238608
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    33240126..33240145
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    33244394..33250600
FT                   /estimated_length=6207
FT                   /gap_type="unknown"
FT   assembly_gap    33252227..33252246
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    33254369..33264870
FT                   /estimated_length=10502
FT                   /gap_type="unknown"
FT   assembly_gap    33265984..33266003
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    33267075..33267094
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    33268416..33268435
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    33276760..33276779
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    33282607..33282626
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    33295855..33295874
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    33327766..33327959
FT                   /estimated_length=194
FT                   /gap_type="unknown"
FT   assembly_gap    33331036..33331055
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    33333117..33333544
FT                   /estimated_length=428
FT                   /gap_type="unknown"
FT   assembly_gap    33337543..33337562
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    33352306..33352325
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    33353794..33353813
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    33370139..33370396
FT                   /estimated_length=258
FT                   /gap_type="unknown"
FT   assembly_gap    33371251..33371310
FT                   /estimated_length=60
FT                   /gap_type="unknown"
FT   assembly_gap    33373712..33374670
FT                   /estimated_length=959
FT                   /gap_type="unknown"
FT   assembly_gap    33388550..33388592
FT                   /estimated_length=43
FT                   /gap_type="unknown"
FT   assembly_gap    33444290..33444309
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    33463919..33463938
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    33472283..33472351
FT                   /estimated_length=69
FT                   /gap_type="unknown"
FT   assembly_gap    33482793..33482812
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    33489334..33489816
FT                   /estimated_length=483
FT                   /gap_type="unknown"
FT   assembly_gap    33523853..33530192
FT                   /estimated_length=6340
FT                   /gap_type="unknown"
FT   gene            33548009..33550681
FT                   /gene="Sstr1"
FT                   /locus_tag="mCG_22882"
FT                   /note="gene_id=mCG22882.2"
FT   mRNA            join(33548009..33548121,33548487..33550130,
FT                   33550388..33550681)
FT                   /gene="Sstr1"
FT                   /locus_tag="mCG_22882"
FT                   /product="somatostatin receptor 1"
FT                   /note="gene_id=mCG22882.2 transcript_id=mCT21628.3 created
FT                   on 17-JUN-2003"
FT   assembly_gap    33548165..33548224
FT                   /estimated_length=60
FT                   /gap_type="unknown"
FT   CDS             33548834..33550009
FT                   /codon_start=1
FT                   /gene="Sstr1"
FT                   /locus_tag="mCG_22882"
FT                   /product="somatostatin receptor 1"
FT                   /note="gene_id=mCG22882.2 transcript_id=mCT21628.3
FT                   protein_id=mCP3401.0"
FT                   /db_xref="GOA:Q543T0"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000586"
FT                   /db_xref="InterPro:IPR001116"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:98327"
FT                   /db_xref="UniProtKB/TrEMBL:Q543T0"
FT                   /protein_id="EDL36694.1"
FT   gene            complement(33550763..33552263)
FT                   /locus_tag="mCG_148269"
FT                   /note="gene_id=mCG148269.0"
FT   mRNA            complement(join(33550763..33551664,33551717..33552263))
FT                   /locus_tag="mCG_148269"
FT                   /product="mCG148269"
FT                   /note="gene_id=mCG148269.0 transcript_id=mCT188532.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(33551243..33551416)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148269"
FT                   /product="mCG148269"
FT                   /note="gene_id=mCG148269.0 transcript_id=mCT188532.0
FT                   protein_id=mCP108103.0"
FT                   /protein_id="EDL36693.1"
FT                   GHKQNQEGLRKG"
FT   assembly_gap    33554545..33554564
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    33557392..33557411
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    33572116..33572240
FT                   /estimated_length=125
FT                   /gap_type="unknown"
FT   assembly_gap    33574463..33574576
FT                   /estimated_length=114
FT                   /gap_type="unknown"
FT   assembly_gap    33580335..33581661
FT                   /estimated_length=1327
FT                   /gap_type="unknown"
FT   gene            complement(33604277..>33608847)
FT                   /gene="Clec14a"
FT                   /locus_tag="mCG_22876"
FT                   /note="gene_id=mCG22876.2"
FT   mRNA            complement(33604277..>33608847)
FT                   /gene="Clec14a"
FT                   /locus_tag="mCG_22876"
FT                   /product="C-type lectin domain family 14, member a"
FT                   /note="gene_id=mCG22876.2 transcript_id=mCT21622.2 created
FT                   on 29-AUG-2002"
FT   CDS             complement(33607012..>33608400)
FT                   /codon_start=1
FT                   /gene="Clec14a"
FT                   /locus_tag="mCG_22876"
FT                   /product="C-type lectin domain family 14, member a"
FT                   /note="gene_id=mCG22876.2 transcript_id=mCT21622.2
FT                   protein_id=mCP3403.1"
FT                   /protein_id="EDL36692.1"
FT                   GTVA"
FT   assembly_gap    33622803..33622822
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    33623889..33623908
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    33625063..33625082
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    33639879..33639898
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    33641003..33641623
FT                   /estimated_length=621
FT                   /gap_type="unknown"
FT   assembly_gap    33643635..33643654
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    33656168..33661466
FT                   /estimated_length=5299
FT                   /gap_type="unknown"
FT   assembly_gap    33689990..33690153
FT                   /estimated_length=164
FT                   /gap_type="unknown"
FT   assembly_gap    33726051..33726070
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    33733776..33733795
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    33735025..33735044
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    33737980..33738723
FT                   /estimated_length=744
FT                   /gap_type="unknown"
FT   assembly_gap    33742886..33742905
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    33791219..33791238
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    33810272..33810291
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    33827100..33827236
FT                   /estimated_length=137
FT                   /gap_type="unknown"
FT   assembly_gap    33834062..33846625
FT                   /estimated_length=12564
FT                   /gap_type="unknown"
FT   assembly_gap    33858318..33858337
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    33863004..33863320
FT                   /estimated_length=317
FT                   /gap_type="unknown"
FT   assembly_gap    33870465..33870484
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    33887460..33887479
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    33890775..33890794
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(33944628..33945339)
FT                   /locus_tag="mCG_1041642"
FT                   /note="gene_id=mCG1041642.1"
FT   mRNA            complement(33944628..33945339)
FT                   /locus_tag="mCG_1041642"
FT                   /product="mCG1041642"
FT                   /note="gene_id=mCG1041642.1 transcript_id=mCT159346.1
FT                   created on 17-SEP-2002"
FT   CDS             complement(33945243..33945293)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041642"
FT                   /product="mCG1041642"
FT                   /note="gene_id=mCG1041642.1 transcript_id=mCT159346.1
FT                   protein_id=mCP78628.1"
FT                   /protein_id="EDL36691.1"
FT                   /translation="MQRTIRKLGDIFARYN"
FT   assembly_gap    33952719..33956100
FT                   /estimated_length=3382
FT                   /gap_type="unknown"
FT   assembly_gap    33965523..33965998
FT                   /estimated_length=476
FT                   /gap_type="unknown"
FT   assembly_gap    34001657..34001964
FT                   /estimated_length=308
FT                   /gap_type="unknown"
FT   assembly_gap    34014008..34014271
FT                   /estimated_length=264
FT                   /gap_type="unknown"
FT   assembly_gap    34024642..34024661
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    34026787..34027065
FT                   /estimated_length=279
FT                   /gap_type="unknown"
FT   assembly_gap    34029064..34030051
FT                   /estimated_length=988
FT                   /gap_type="unknown"
FT   assembly_gap    34030705..34032018
FT                   /estimated_length=1314
FT                   /gap_type="unknown"
FT   assembly_gap    34035532..34035551
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    34036967..34040117
FT                   /estimated_length=3151
FT                   /gap_type="unknown"
FT   assembly_gap    34049328..34049347
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    34069591..34069610
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    34094770..34094985
FT                   /estimated_length=216
FT                   /gap_type="unknown"
FT   gene            34113334..34114139
FT                   /locus_tag="mCG_1041577"
FT                   /note="gene_id=mCG1041577.1"
FT   mRNA            34113334..34114139
FT                   /locus_tag="mCG_1041577"
FT                   /product="mCG1041577"
FT                   /note="gene_id=mCG1041577.1 transcript_id=mCT159281.1
FT                   created on 17-SEP-2002"
FT   CDS             34113653..34113904
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041577"
FT                   /product="mCG1041577"
FT                   /note="gene_id=mCG1041577.1 transcript_id=mCT159281.1
FT                   protein_id=mCP78785.1"
FT                   /protein_id="EDL36690.1"
FT   assembly_gap    34117140..34117184
FT                   /estimated_length=45
FT                   /gap_type="unknown"
FT   assembly_gap    34120084..34121225
FT                   /estimated_length=1142
FT                   /gap_type="unknown"
FT   assembly_gap    34124826..34124994
FT                   /estimated_length=169
FT                   /gap_type="unknown"
FT   assembly_gap    34168676..34168695
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    34215755..34216136
FT                   /estimated_length=382
FT                   /gap_type="unknown"
FT   gene            <34231297..>34292616
FT                   /locus_tag="mCG_53541"
FT                   /note="gene_id=mCG53541.1"
FT   mRNA            join(<34231297..34231445,34235979..34236104,
FT                   34260361..34260421,34266431..34266584,34272306..34272486,
FT                   34292487..>34292616)
FT                   /locus_tag="mCG_53541"
FT                   /product="mCG53541"
FT                   /note="gene_id=mCG53541.1 transcript_id=mCT53724.1 created
FT                   on 17-SEP-2002"
FT   CDS             join(34231297..34231445,34235979..34236104,
FT                   34260361..34260421,34266431..34266584,34272306..34272486,
FT                   34292487..34292616)
FT                   /codon_start=1
FT                   /locus_tag="mCG_53541"
FT                   /product="mCG53541"
FT                   /note="gene_id=mCG53541.1 transcript_id=mCT53724.1
FT                   protein_id=mCP26453.1"
FT                   /protein_id="EDL36689.1"
FT   assembly_gap    34242670..34242689
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    34258315..34259105
FT                   /estimated_length=791
FT                   /gap_type="unknown"
FT   assembly_gap    34263435..34263628
FT                   /estimated_length=194
FT                   /gap_type="unknown"
FT   assembly_gap    34266794..34267373
FT                   /estimated_length=580
FT                   /gap_type="unknown"
FT   gene            complement(34268801..34299308)
FT                   /locus_tag="mCG_59842"
FT                   /note="gene_id=mCG59842.3"
FT   mRNA            complement(join(34268801..34270069,34282033..34282136,
FT                   34299253..34299308))
FT                   /locus_tag="mCG_59842"
FT                   /product="mCG59842"
FT                   /note="gene_id=mCG59842.3 transcript_id=mCT60025.3 created
FT                   on 11-JUN-2003"
FT   CDS             complement(34268900..34269097)
FT                   /codon_start=1
FT                   /locus_tag="mCG_59842"
FT                   /product="mCG59842"
FT                   /note="gene_id=mCG59842.3 transcript_id=mCT60025.3
FT                   protein_id=mCP26435.2"
FT                   /protein_id="EDL36688.1"
FT   assembly_gap    34270249..34270268
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    34293892..34294769
FT                   /estimated_length=878
FT                   /gap_type="unknown"
FT   assembly_gap    34303369..34303388
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    34304483..34304532
FT                   /estimated_length=50
FT                   /gap_type="unknown"
FT   gene            complement(34308003..34360338)
FT                   /gene="Sec23a"
FT                   /locus_tag="mCG_20841"
FT                   /note="gene_id=mCG20841.2"
FT   mRNA            complement(join(34308003..34308389,34315273..34315338,
FT                   34317106..34317261,34319526..34319612,34321167..34321328,
FT                   34322855..34322932,34326756..34326909,34330862..34330968,
FT                   34333426..34333515,34334385..34334465,34337644..34337767,
FT                   34339267..34339382,34340422..34340580,34345482..34345626,
FT                   34346605..34346684,34350177..34350413,34352852..34352938,
FT                   34353621..34353678,34355352..34355597,34360208..34360338))
FT                   /gene="Sec23a"
FT                   /locus_tag="mCG_20841"
FT                   /product="SEC23A (S. cerevisiae)"
FT                   /note="gene_id=mCG20841.2 transcript_id=mCT21828.1 created
FT                   on 29-AUG-2002"
FT   CDS             complement(join(34308300..34308389,34315273..34315338,
FT                   34317106..34317261,34319526..34319612,34321167..34321328,
FT                   34322855..34322932,34326756..34326909,34330862..34330968,
FT                   34333426..34333515,34334385..34334465,34337644..34337767,
FT                   34339267..34339382,34340422..34340580,34345482..34345626,
FT                   34346605..34346684,34350177..34350413,34352852..34352938,
FT                   34353621..34353678,34355352..34355572))
FT                   /codon_start=1
FT                   /gene="Sec23a"
FT                   /locus_tag="mCG_20841"
FT                   /product="SEC23A (S. cerevisiae)"
FT                   /note="gene_id=mCG20841.2 transcript_id=mCT21828.1
FT                   protein_id=mCP3429.1"
FT                   /protein_id="EDL36687.1"
FT                   DHLKKLAVSSAA"
FT   assembly_gap    34321815..34321834
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    34324044..34324063
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    34342720..34342916
FT                   /estimated_length=197
FT                   /gap_type="unknown"
FT   gene            <34361752..34376827
FT                   /gene="Sip1"
FT                   /locus_tag="mCG_20843"
FT                   /note="gene_id=mCG20843.1"
FT   mRNA            join(<34361752..34361975,34362332..34362416,
FT                   34365228..34365323,34365532..34365589,34366373..34366486,
FT                   34368750..34368794,34370029..34370097,34373366..34373476,
FT                   34375214..34375272,34376096..34376827)
FT                   /gene="Sip1"
FT                   /locus_tag="mCG_20843"
FT                   /product="survivor of motor neuron protein interacting
FT                   protein 1, transcript variant mCT21933"
FT                   /note="gene_id=mCG20843.1 transcript_id=mCT21933.0 created
FT                   on 29-AUG-2002"
FT   mRNA            join(<34361816..34362416,34364437..34364570,
FT                   34365228..34365323,34365532..34365589,34366373..34366486,
FT                   34368750..34368794,34370029..34370097,34373366..34373476,
FT                   34375214..34375272,34376096..34376756)
FT                   /gene="Sip1"
FT                   /locus_tag="mCG_20843"
FT                   /product="survivor of motor neuron protein interacting
FT                   protein 1, transcript variant mCT193498"
FT                   /note="gene_id=mCG20843.1 transcript_id=mCT193498.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<34362264..34362416,34364437..34364570,
FT                   34365228..34365323,34365532..34365589,34366373..34366486,
FT                   34368750..34368794,34370029..34370097,34373366..34373476,
FT                   34375214..34375272,34376096..34376135)
FT                   /codon_start=1
FT                   /gene="Sip1"
FT                   /locus_tag="mCG_20843"
FT                   /product="survivor of motor neuron protein interacting
FT                   protein 1, isoform CRA_a"
FT                   /note="gene_id=mCG20843.1 transcript_id=mCT193498.0
FT                   protein_id=mCP114464.0 isoform=CRA_a"
FT                   /protein_id="EDL36685.1"
FT                   FDQRDLADEPS"
FT   CDS             join(<34362409..34362416,34365228..34365323,
FT                   34365532..34365589,34366373..34366486,34368750..34368794,
FT                   34370029..34370097,34373366..34373476,34375214..34375272,
FT                   34376096..34376135)
FT                   /codon_start=1
FT                   /gene="Sip1"
FT                   /locus_tag="mCG_20843"
FT                   /product="survivor of motor neuron protein interacting
FT                   protein 1, isoform CRA_b"
FT                   /note="gene_id=mCG20843.1 transcript_id=mCT21933.0
FT                   protein_id=mCP3402.0 isoform=CRA_b"
FT                   /protein_id="EDL36686.1"
FT   assembly_gap    34382062..34382314
FT                   /estimated_length=253
FT                   /gap_type="unknown"
FT   gene            complement(34388352..>34406648)
FT                   /gene="Trappc6b"
FT                   /locus_tag="mCG_144957"
FT                   /note="gene_id=mCG144957.0"
FT   mRNA            complement(join(34388352..34388895,34389472..34389565,
FT                   34393343..34393426,34395488..34395605,34396862..34396929,
FT                   34406364..>34406648))
FT                   /gene="Trappc6b"
FT                   /locus_tag="mCG_144957"
FT                   /product="trafficking protein particle complex 6B"
FT                   /note="gene_id=mCG144957.0 transcript_id=mCT184381.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(34388864..34388895,34389472..34389565,
FT                   34393343..34393426,34395488..34395605,34396862..34396929,
FT                   34406364..>34406480))
FT                   /codon_start=1
FT                   /gene="Trappc6b"
FT                   /locus_tag="mCG_144957"
FT                   /product="trafficking protein particle complex 6B"
FT                   /note="gene_id=mCG144957.0 transcript_id=mCT184381.0
FT                   protein_id=mCP105137.0"
FT                   /protein_id="EDL36684.1"
FT                   QVMIQKL"
FT   assembly_gap    34399956..34400261
FT                   /estimated_length=306
FT                   /gap_type="unknown"
FT   gene            <34412181..34418614
FT                   /gene="Pnn"
FT                   /locus_tag="mCG_20834"
FT                   /note="gene_id=mCG20834.1"
FT   mRNA            join(<34412181..34412311,34412975..34413046,
FT                   34413483..34413551,34413924..34413996,34414100..34414194,
FT                   34414314..34414389,34415340..34415495,34415577..34415715,
FT                   34416623..34418614)
FT                   /gene="Pnn"
FT                   /locus_tag="mCG_20834"
FT                   /product="pinin"
FT                   /note="gene_id=mCG20834.1 transcript_id=mCT21821.1 created
FT                   on 29-AUG-2002"
FT   CDS             join(<34412181..34412311,34412975..34413046,
FT                   34413483..34413551,34413924..34413996,34414100..34414194,
FT                   34414314..34414389,34415340..34415495,34415577..34415715,
FT                   34416623..34418010)
FT                   /codon_start=1
FT                   /gene="Pnn"
FT                   /locus_tag="mCG_20834"
FT                   /product="pinin"
FT                   /note="gene_id=mCG20834.1 transcript_id=mCT21821.1
FT                   protein_id=mCP3409.0"
FT                   /protein_id="EDL36683.1"
FT   gene            <34426195..34427138
FT                   /locus_tag="mCG_20835"
FT                   /note="gene_id=mCG20835.0"
FT   mRNA            <34426195..34427138
FT                   /locus_tag="mCG_20835"
FT                   /product="mCG20835"
FT                   /note="gene_id=mCG20835.0 transcript_id=mCT21822.0 created
FT                   on 05-SEP-2002"
FT   CDS             <34426196..34427098
FT                   /codon_start=1
FT                   /locus_tag="mCG_20835"
FT                   /product="mCG20835"
FT                   /note="gene_id=mCG20835.0 transcript_id=mCT21822.0
FT                   protein_id=mCP3413.0"
FT                   /protein_id="EDL36682.1"
FT   assembly_gap    34432890..34433303
FT                   /estimated_length=414
FT                   /gap_type="unknown"
FT   gene            complement(34439401..>34439957)
FT                   /locus_tag="mCG_20836"
FT                   /note="gene_id=mCG20836.1"
FT   mRNA            complement(34439401..>34439957)
FT                   /locus_tag="mCG_20836"
FT                   /product="mCG20836"
FT                   /note="gene_id=mCG20836.1 transcript_id=mCT21823.1 created
FT                   on 05-SEP-2002"
FT   CDS             complement(34439440..>34439931)
FT                   /codon_start=1
FT                   /locus_tag="mCG_20836"
FT                   /product="mCG20836"
FT                   /note="gene_id=mCG20836.1 transcript_id=mCT21823.1
FT                   protein_id=mCP3416.1"
FT                   /protein_id="EDL36681.1"
FT                   "
FT   gene            <34441177..>34453820
FT                   /gene="Mia2"
FT                   /locus_tag="mCG_124768"
FT                   /note="gene_id=mCG124768.1"
FT   mRNA            join(<34441177..34441291,34447439..34447572,
FT                   34450441..34450527,34453803..>34453820)
FT                   /gene="Mia2"
FT                   /locus_tag="mCG_124768"
FT                   /product="melanoma inhibitory activity 2"
FT                   /note="gene_id=mCG124768.1 transcript_id=mCT126018.1
FT                   created on 05-SEP-2002"
FT   CDS             join(34441177..34441291,34447439..34447572,
FT                   34450441..34450527,34453803..>34453820)
FT                   /codon_start=1
FT                   /gene="Mia2"
FT                   /locus_tag="mCG_124768"
FT                   /product="melanoma inhibitory activity 2"
FT                   /note="gene_id=mCG124768.1 transcript_id=mCT126018.1
FT                   protein_id=mCP79074.1"
FT                   /protein_id="EDL36680.1"
FT                   EEVEMPTKSDFLCL"
FT   assembly_gap    34442992..34443307
FT                   /estimated_length=316
FT                   /gap_type="unknown"
FT   assembly_gap    34446420..34446439
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    34472331..34472359
FT                   /estimated_length=29
FT                   /gap_type="unknown"
FT   gene            <34476439..34535339
FT                   /gene="Mgea6"
FT                   /locus_tag="mCG_20840"
FT                   /note="gene_id=mCG20840.1"
FT   mRNA            join(<34476439..34476575,34481024..34481155,
FT                   34482546..34482567,34482663..34482751,34491499..34491525,
FT                   34492010..34492120,34493017..34493088,34494629..34494733,
FT                   34499523..34499645,34503421..34503535,34504759..34504805,
FT                   34505344..34505434,34508049..34508187,34514102..34514203,
FT                   34515426..34515486,34516125..34516160,34517687..34517754,
FT                   34519268..34519350,34521493..34521621,34525011..34525169,
FT                   34529348..34529464,34530890..34530948,34533473..34533707,
FT                   34534798..34535339)
FT                   /gene="Mgea6"
FT                   /locus_tag="mCG_20840"
FT                   /product="meningioma expressed antigen 6 (coiled-coil
FT                   proline-rich)"
FT                   /note="gene_id=mCG20840.1 transcript_id=mCT21827.2 created
FT                   on 05-SEP-2002"
FT   CDS             join(<34476441..34476575,34481024..34481155,
FT                   34482546..34482567,34482663..34482751,34491499..34491525,
FT                   34492010..34492120,34493017..34493088,34494629..34494733,
FT                   34499523..34499645,34503421..34503535,34504759..34504805,
FT                   34505344..34505434,34508049..34508187,34514102..34514203,
FT                   34515426..34515486,34516125..34516160,34517687..34517754,
FT                   34519268..34519350,34521493..34521621,34525011..34525169,
FT                   34529348..34529464,34530890..34530948,34533473..34533707,
FT                   34534798..34534961)
FT                   /codon_start=1
FT                   /gene="Mgea6"
FT                   /locus_tag="mCG_20840"
FT                   /product="meningioma expressed antigen 6 (coiled-coil
FT                   proline-rich)"
FT                   /note="gene_id=mCG20840.1 transcript_id=mCT21827.2
FT                   protein_id=mCP3421.2"
FT                   /protein_id="EDL36679.1"
FT   assembly_gap    34486019..34486038
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(34545813..>34564613)
FT                   /locus_tag="mCG_20838"
FT                   /note="gene_id=mCG20838.2"
FT   mRNA            complement(join(34545813..34547835,34549467..34550152,
FT                   34551137..34551247,34564021..34564109,34564212..>34564611))
FT                   /locus_tag="mCG_20838"
FT                   /product="mCG20838, transcript variant mCT21825"
FT                   /note="gene_id=mCG20838.2 transcript_id=mCT21825.1 created
FT                   on 05-SEP-2002"
FT   mRNA            complement(join(34546548..34547835,34549467..34550152,
FT                   34551137..34551247,34564021..>34564613))
FT                   /locus_tag="mCG_20838"
FT                   /product="mCG20838, transcript variant mCT193471"
FT                   /note="gene_id=mCG20838.2 transcript_id=mCT193471.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(34547564..34547835,34549467..34550152,
FT                   34551137..34551247,34564021..>34564613))
FT                   /codon_start=1
FT                   /locus_tag="mCG_20838"
FT                   /product="mCG20838, isoform CRA_a"
FT                   /note="gene_id=mCG20838.2 transcript_id=mCT193471.0
FT                   protein_id=mCP114463.0 isoform=CRA_a"
FT                   /protein_id="EDL36677.1"
FT   CDS             complement(join(34547564..34547835,34549467..34550152,
FT                   34551137..34551247,34564021..34564109,34564212..>34564610))
FT                   /codon_start=1
FT                   /locus_tag="mCG_20838"
FT                   /product="mCG20838, isoform CRA_b"
FT                   /note="gene_id=mCG20838.2 transcript_id=mCT21825.1
FT                   protein_id=mCP3425.1 isoform=CRA_b"
FT                   /protein_id="EDL36678.1"
FT                   I"
FT   gene            complement(34568943..34569786)
FT                   /locus_tag="mCG_1041788"
FT                   /note="gene_id=mCG1041788.1"
FT   mRNA            complement(34568943..34569786)
FT                   /locus_tag="mCG_1041788"
FT                   /product="mCG1041788"
FT                   /note="gene_id=mCG1041788.1 transcript_id=mCT159492.1
FT                   created on 24-SEP-2002"
FT   CDS             complement(34569165..34569437)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041788"
FT                   /product="mCG1041788"
FT                   /note="gene_id=mCG1041788.1 transcript_id=mCT159492.1
FT                   protein_id=mCP78859.1"
FT                   /protein_id="EDL36676.1"
FT   assembly_gap    34573266..34573285
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    34584276..34584295
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    34587675..34587694
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    34611469..34611625
FT                   /estimated_length=157
FT                   /gap_type="unknown"
FT   assembly_gap    34646822..34647535
FT                   /estimated_length=714
FT                   /gap_type="unknown"
FT   assembly_gap    34658827..34658846
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<34662246..>34663292)
FT                   /locus_tag="mCG_1041576"
FT                   /note="gene_id=mCG1041576.0"
FT   mRNA            complement(<34662246..>34663292)
FT                   /locus_tag="mCG_1041576"
FT                   /product="mCG1041576"
FT                   /note="gene_id=mCG1041576.0 transcript_id=mCT159280.0
FT                   created on 17-SEP-2002"
FT   CDS             complement(<34662246..34663292)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041576"
FT                   /product="mCG1041576"
FT                   /note="gene_id=mCG1041576.0 transcript_id=mCT159280.0
FT                   protein_id=mCP78781.0"
FT                   /protein_id="EDL36675.1"
FT                   SSDISELEE"
FT   assembly_gap    34663587..34665390
FT                   /estimated_length=1804
FT                   /gap_type="unknown"
FT   assembly_gap    34666835..34666854
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    34669716..34669794
FT                   /estimated_length=79
FT                   /gap_type="unknown"
FT   assembly_gap    34675398..34675438
FT                   /estimated_length=41
FT                   /gap_type="unknown"
FT   gene            complement(34680609..34681218)
FT                   /locus_tag="mCG_1041640"
FT                   /note="gene_id=mCG1041640.1"
FT   mRNA            complement(34680609..34681218)
FT                   /locus_tag="mCG_1041640"
FT                   /product="mCG1041640"
FT                   /note="gene_id=mCG1041640.1 transcript_id=mCT159344.1
FT                   created on 17-SEP-2002"
FT   CDS             complement(34681017..34681196)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041640"
FT                   /product="mCG1041640"
FT                   /note="gene_id=mCG1041640.1 transcript_id=mCT159344.1
FT                   protein_id=mCP78597.1"
FT                   /protein_id="EDL36674.1"
FT                   LNTSPVCLGGRNFN"
FT   gene            complement(<34698436..>34698957)
FT                   /locus_tag="mCG_49422"
FT                   /note="gene_id=mCG49422.1"
FT   mRNA            complement(<34698436..>34698957)
FT                   /locus_tag="mCG_49422"
FT                   /product="mCG49422"
FT                   /note="gene_id=mCG49422.1 transcript_id=mCT49605.1 created
FT                   on 17-SEP-2002"
FT   CDS             complement(34698436..34698957)
FT                   /codon_start=1
FT                   /locus_tag="mCG_49422"
FT                   /product="mCG49422"
FT                   /note="gene_id=mCG49422.1 transcript_id=mCT49605.1
FT                   protein_id=mCP26440.1"
FT                   /protein_id="EDL36673.1"
FT                   ELVVFLPALC"
FT   assembly_gap    34702086..34704269
FT                   /estimated_length=2184
FT                   /gap_type="unknown"
FT   assembly_gap    34711693..34713247
FT                   /estimated_length=1555
FT                   /gap_type="unknown"
FT   assembly_gap    34740186..34740431
FT                   /estimated_length=246
FT                   /gap_type="unknown"
FT   assembly_gap    34784790..34785112
FT                   /estimated_length=323
FT                   /gap_type="unknown"
FT   assembly_gap    34786125..34786439
FT                   /estimated_length=315
FT                   /gap_type="unknown"
FT   assembly_gap    34790093..34790112
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    34791777..34791796
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    34799842..34799943
FT                   /estimated_length=102
FT                   /gap_type="unknown"
FT   assembly_gap    34805937..34806142
FT                   /estimated_length=206
FT                   /gap_type="unknown"
FT   assembly_gap    34814013..34814135
FT                   /estimated_length=123
FT                   /gap_type="unknown"
FT   assembly_gap    34842548..34842659
FT                   /estimated_length=112
FT                   /gap_type="unknown"
FT   assembly_gap    34851413..34851432
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    34853109..34853675
FT                   /estimated_length=567
FT                   /gap_type="unknown"
FT   assembly_gap    34877467..34877486
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    34883289..34883614
FT                   /estimated_length=326
FT                   /gap_type="unknown"
FT   assembly_gap    34899239..34899485
FT                   /estimated_length=247
FT                   /gap_type="unknown"
FT   assembly_gap    34900347..34903651
FT                   /estimated_length=3305
FT                   /gap_type="unknown"
FT   assembly_gap    34929494..34929513
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    34934986..34935005
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    34938974..34939248
FT                   /estimated_length=275
FT                   /gap_type="unknown"
FT   assembly_gap    34947379..34947398
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<34978450..34979175)
FT                   /locus_tag="mCG_51439"
FT                   /note="gene_id=mCG51439.2"
FT   mRNA            complement(<34978450..34979175)
FT                   /locus_tag="mCG_51439"
FT                   /product="mCG51439"
FT                   /note="gene_id=mCG51439.2 transcript_id=mCT51622.2 created
FT                   on 17-SEP-2002"
FT   CDS             complement(34978450..34978710)
FT                   /codon_start=1
FT                   /locus_tag="mCG_51439"
FT                   /product="mCG51439"
FT                   /note="gene_id=mCG51439.2 transcript_id=mCT51622.2
FT                   protein_id=mCP36109.2"
FT                   /protein_id="EDL36672.1"
FT   assembly_gap    35003642..35003791
FT                   /estimated_length=150
FT                   /gap_type="unknown"
FT   assembly_gap    35021327..35021947
FT                   /estimated_length=621
FT                   /gap_type="unknown"
FT   assembly_gap    35027114..35027398
FT                   /estimated_length=285
FT                   /gap_type="unknown"
FT   assembly_gap    35065711..35066049
FT                   /estimated_length=339
FT                   /gap_type="unknown"
FT   assembly_gap    35081063..35081526
FT                   /estimated_length=464
FT                   /gap_type="unknown"
FT   assembly_gap    35083190..35084511
FT                   /estimated_length=1322
FT                   /gap_type="unknown"
FT   assembly_gap    35101145..35101164
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    35102449..35102483
FT                   /estimated_length=35
FT                   /gap_type="unknown"
FT   assembly_gap    35103876..35103895
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    35106060..35106079
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    35107124..35107143
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    35124676..35125822
FT                   /estimated_length=1147
FT                   /gap_type="unknown"
FT   assembly_gap    35130736..35130755
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    35134701..35134720
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    35137186..35137205
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    35143190..35143209
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    35172115..35172134
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    35182806..35182825
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    35183978..35183997
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    35196324..35196359
FT                   /estimated_length=36
FT                   /gap_type="unknown"
FT   assembly_gap    35226124..35226199
FT                   /estimated_length=76
FT                   /gap_type="unknown"
FT   gene            complement(<35247919..>35314233)
FT                   /locus_tag="mCG_1041574"
FT                   /note="gene_id=mCG1041574.0"
FT   mRNA            complement(join(<35247919..35248023,35267123..35267194,
FT                   35301159..35301260,35303196..35303468,35313925..>35314233))
FT                   /locus_tag="mCG_1041574"
FT                   /product="mCG1041574"
FT                   /note="gene_id=mCG1041574.0 transcript_id=mCT159278.0
FT                   created on 17-SEP-2002"
FT   CDS             complement(join(35247919..35248023,35267123..35267194,
FT                   35301159..35301260,35303196..35303468,35313925..35314233))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041574"
FT                   /product="mCG1041574"
FT                   /note="gene_id=mCG1041574.0 transcript_id=mCT159278.0
FT                   protein_id=mCP78766.0"
FT                   /protein_id="EDL36671.1"
FT                   GCRKT"
FT   assembly_gap    35269869..35269888
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    35287062..35289974
FT                   /estimated_length=2913
FT                   /gap_type="unknown"
FT   assembly_gap    35291060..35291079
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    35292772..35295205
FT                   /estimated_length=2434
FT                   /gap_type="unknown"
FT   assembly_gap    35295849..35297068
FT                   /estimated_length=1220
FT                   /gap_type="unknown"
FT   assembly_gap    35310048..35310067
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    35356358..35356791
FT                   /estimated_length=434
FT                   /gap_type="unknown"
FT   assembly_gap    35360516..35361905
FT                   /estimated_length=1390
FT                   /gap_type="unknown"
FT   assembly_gap    35373558..35373577
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    35380189..35380208
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    35423719..35423738
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    35474168..35474702
FT                   /estimated_length=535
FT                   /gap_type="unknown"
FT   assembly_gap    35506445..35506965
FT                   /estimated_length=521
FT                   /gap_type="unknown"
FT   assembly_gap    35511621..35511674
FT                   /estimated_length=54
FT                   /gap_type="unknown"
FT   assembly_gap    35514145..35514975
FT                   /estimated_length=831
FT                   /gap_type="unknown"
FT   assembly_gap    35539898..35540712
FT                   /estimated_length=815
FT                   /gap_type="unknown"
FT   assembly_gap    35554083..35554102
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    35564850..35565071
FT                   /estimated_length=222
FT                   /gap_type="unknown"
FT   assembly_gap    35610201..35610550
FT                   /estimated_length=350
FT                   /gap_type="unknown"
FT   assembly_gap    35611939..35612110
FT                   /estimated_length=172
FT                   /gap_type="unknown"
FT   assembly_gap    35643852..35643871
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    35686251..35686270
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            35698408..35699654
FT                   /locus_tag="mCG_1041781"
FT                   /note="gene_id=mCG1041781.1"
FT   mRNA            join(35698408..35698903,35698929..35699476,
FT                   35699526..35699654)
FT                   /locus_tag="mCG_1041781"
FT                   /product="mCG1041781"
FT                   /note="gene_id=mCG1041781.1 transcript_id=mCT159485.1
FT                   created on 23-SEP-2002"
FT   CDS             35699067..35699264
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041781"
FT                   /product="mCG1041781"
FT                   /note="gene_id=mCG1041781.1 transcript_id=mCT159485.1
FT                   protein_id=mCP78791.1"
FT                   /protein_id="EDL36670.1"
FT   assembly_gap    35712774..35712793
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    35717171..35717293
FT                   /estimated_length=123
FT                   /gap_type="unknown"
FT   assembly_gap    35721774..35721793
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    35751891..35752077
FT                   /estimated_length=187
FT                   /gap_type="unknown"
FT   assembly_gap    35755343..35755362
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    35768418..35768459
FT                   /estimated_length=42
FT                   /gap_type="unknown"
FT   assembly_gap    35779558..35785719
FT                   /estimated_length=6162
FT                   /gap_type="unknown"
FT   assembly_gap    35790966..35790985
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    35801428..35801447
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    35802928..35806223
FT                   /estimated_length=3296
FT                   /gap_type="unknown"
FT   assembly_gap    35808787..35808806
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    35841860..35841999
FT                   /estimated_length=140
FT                   /gap_type="unknown"
FT   gene            35862997..35864378
FT                   /pseudo
FT                   /locus_tag="mCG_62976"
FT                   /note="gene_id=mCG62976.2"
FT   mRNA            join(35862997..35863741,35863756..35864171,
FT                   35864200..35864378)
FT                   /pseudo
FT                   /locus_tag="mCG_62976"
FT                   /note="gene_id=mCG62976.2 transcript_id=mCT63159.2 created
FT                   on 17-SEP-2002"
FT   gene            complement(35884111..35884654)
FT                   /pseudo
FT                   /locus_tag="mCG_1041638"
FT                   /note="gene_id=mCG1041638.1"
FT   mRNA            complement(join(35884111..35884248,35884508..35884654))
FT                   /pseudo
FT                   /locus_tag="mCG_1041638"
FT                   /note="gene_id=mCG1041638.1 transcript_id=mCT159342.1
FT                   created on 17-SEP-2002"
FT   assembly_gap    35886313..35886332
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    35905660..35905679
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    35912129..35912148
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    35970173..35970233
FT                   /estimated_length=61
FT                   /gap_type="unknown"
FT   assembly_gap    36040097..36041431
FT                   /estimated_length=1335
FT                   /gap_type="unknown"
FT   assembly_gap    36045227..36045887
FT                   /estimated_length=661
FT                   /gap_type="unknown"
FT   assembly_gap    36068798..36068817
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    36087973..36087992
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    36100536..36100555
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    36172284..36172553
FT                   /estimated_length=270
FT                   /gap_type="unknown"
FT   gene            <36192595..>36206393
FT                   /locus_tag="mCG_1041637"
FT                   /note="gene_id=mCG1041637.0"
FT   mRNA            join(<36192595..36192684,36206301..>36206393)
FT                   /locus_tag="mCG_1041637"
FT                   /product="mCG1041637"
FT                   /note="gene_id=mCG1041637.0 transcript_id=mCT159341.0
FT                   created on 17-SEP-2002"
FT   CDS             join(36192595..36192684,36206301..36206393)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041637"
FT                   /product="mCG1041637"
FT                   /note="gene_id=mCG1041637.0 transcript_id=mCT159341.0
FT                   protein_id=mCP78565.0"
FT                   /protein_id="EDL36669.1"
FT                   ITPEFELGTPESRSD"
FT   assembly_gap    36197785..36201286
FT                   /estimated_length=3502
FT                   /gap_type="unknown"
FT   assembly_gap    36206032..36206051
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    36256251..36256270
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    36267101..36267120
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    36269012..36269031
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    36274537..36274556
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    36276531..36276550
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    36277559..36277578
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    36335434..36335453
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    36341343..36341362
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    36351572..36351591
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    36354697..36354716
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    36357775..36358584