Dbfetch

ID   CH466525; SV 1; linear; genomic DNA; CON; MUS; 57380464 BP.
XX
AC   CH466525;
XX
PR   Project:PRJNA11785;
XX
DT   04-AUG-2005 (Rel. 84, Created)
DT   10-JUN-2007 (Rel. 92, Last updated, Version 6)
XX
DE   Mus musculus 232000009761530 genomic scaffold, whole genome shotgun
DE   sequence.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-57380464
RX   DOI; 10.1126/science.1069193.
RX   PUBMED; 12040188.
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Miklos G.L., Wides R.,
RA   Halpern A., Li P.W., Sutton G.G., Nadeau J., Salzberg S.L., Holt R.A.,
RA   Kodira C.D., Lu F., Chen L., Deng Z., Evangelista C.C., Gan W.,
RA   Heiman T.J., Li J., Li Z., Merkulov G.V., Milshina N.V., Naik A.K., Qi R.,
RA   Shue B.C., Wang A., Wang J., Wang X., Yan X., Ye J., Yooseph S., Zhao Q.,
RA   Zheng L., Zhu S.C., Biddick K., Bolanos R., Delcher A.L., Dew I.M.,
RA   Fasulo D., Flanigan M.J., Huson D.H., Kravitz S.A., Miller J.R.,
RA   Mobarry C.M., Reinert K., Remington K.A., Zhang Q., Zheng X.H.,
RA   Nusskern D.R., Lai Z., Lei Y., Zhong W., Yao A., Guan P., Ji R.R., Gu Z.,
RA   Wang Z.Y., Zhong F., Xiao C., Chiang C.C., Yandell M., Wortman J.R.,
RA   Amanatides P.G., Hladun S.L., Pratts E.C., Johnson J.E., Dodson K.L.,
RA   Woodford K.J., Evans C.A., Gropman B., Rusch D.B., Venter E., Wang M.,
RA   Smith T.J., Houck J.T., Tompkins D.E., Haynes C., Jacob D., Chin S.H.,
RA   Allen D.R., Dahlke C.E., Sanders R., Li K., Liu X., Levitsky A.A.,
RA   Majoros W.H., Chen Q., Xia A.C., Lopez J.R., Donnelly M.T., Newman M.H.,
RA   Glodek A., Kraft C.L., Nodell M., Ali F., An H.J., Baldwin-Pitts D.,
RA   Beeson K.Y., Cai S., Carnes M., Carver A., Caulk P.M., Center A.,
RA   Chen Y.H., Cheng M.L., Coyne M.D., Crowder M., Danaher S., Davenport L.B.,
RA   Desilets R., Dietz S.M., Doup L., Dullaghan P., Ferriera S., Fosler C.R.,
RA   Gire H.C., Gluecksmann A., Gocayne J.D., Gray J., Hart B., Haynes J.,
RA   Hoover J., Howland T., Ibegwam C., Jalali M., Johns D., Kline L., Ma D.S.,
RA   MacCawley S., Magoon A., Mann F., May D., McIntosh T.C., Mehta S., Moy L.,
RA   Moy M.C., Murphy B.J., Murphy S.D., Nelson K.A., Nuri Z., Parker K.A.,
RA   Prudhomme A.C., Puri V.N., Qureshi H., Raley J.C., Reardon M.S.,
RA   Regier M.A., Rogers Y.H., Romblad D.L., Schutz J., Scott J.L., Scott R.,
RA   Sitter C.D., Smallwood M., Sprague A.C., Stewart E., Strong R.V., Suh E.,
RA   Sylvester K., Thomas R., Tint N.N., Tsonis C., Wang G., Wang G.,
RA   Williams M.S., Williams S.M., Windsor S.M., Wolfe K., Wu M.M., Zaveri J.,
RA   Chaturvedi K., Gabrielian A.E., Ke Z., Sun J., Subramanian G., Venter J.C.,
RA   Pfannkoch C.M., Barnstead M., Stephenson L.D.;
RT   "A comparison of whole-genome shotgun-derived mouse chromosome 16 and the
RT   human genome";
RL   Science, e1252229 296(5573):1661-1671(2002).
XX
RN   [2]
RP   1-57380464
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (05-JUL-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
DR   MD5; 1c38ba8074693413b85b799f5f19949b.
DR   ENA; AAHY01000000; SET.
DR   ENA; AAHY00000000; SET.
DR   ENA-CON; CM000216.
DR   BioSample; SAMN03004379.
DR   Ensembl-Gn; ENSMUSG00000000303; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000001482; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000001672; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000003033; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000003037; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000003038; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000003316; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000003657; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000003812; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000003813; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000003814; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000003847; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000003848; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000003849; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000004383; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000005410; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000005483; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000005705; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000006276; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000006362; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000006517; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000006519; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000006589; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000008874; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000013158; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000014470; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000014776; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000014786; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000014791; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000015023; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000017478; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000017765; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000019278; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000019464; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000019478; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000019732; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000023336; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025362; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025808; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025809; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025810; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025812; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031620; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031621; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031622; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031654; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031667; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031671; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031682; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031683; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031696; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031706; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031708; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031712; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031714; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031722; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031723; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031727; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031732; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031734; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031740; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031748; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031749; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031753; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031757; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031758; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031770; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031772; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031778; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031779; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031781; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031786; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031788; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031791; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031809; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031812; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031816; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031818; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031824; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031825; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031826; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031841; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031845; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031847; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031876; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031880; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031881; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031883; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031886; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031887; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031889; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031896; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031901; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031902; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031903; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031916; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031930; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031948; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031959; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031982; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031985; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031986; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000033249; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000033282; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000033313; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000033594; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000033658; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000033703; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000033732; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000033931; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000033998; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000034041; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000034424; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000035824; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000036270; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000036442; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000036510; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038000; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038604; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039067; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039079; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000040220; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000040263; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000041515; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000041679; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000044676; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000045333; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000046714; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000046881; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000048371; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000050097; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000050147; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000050930; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000051671; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000051839; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000051952; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000052456; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000052488; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000052837; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000054400; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000055368; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000055730; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000055835; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000058355; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000060098; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000060560; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000061048; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000061410; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000061577; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000061983; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000062181; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000062687; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000063605; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000067038; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000069920; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000069998; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000070713; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000071064; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000074037; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000074063; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000074194; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000074217; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000090862; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000093904; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000097084; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000110430; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017072; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017874; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032890; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0033769; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0033771; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0033773; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0033778; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0033780; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0033781; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0033783; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0033789; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0033790; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0033791; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0033792; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0033796; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0033798; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0033808; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0033809; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0033810; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0033814; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0033817; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0033820; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0033823; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0033834; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0033835; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0033847; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0033853; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0033868; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0033872; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0033873; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0033879; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0033884; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0033887; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0033896; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0033897; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0033898; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0033912; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0033914; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0033930; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0033931; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0033933; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0033936; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0033939; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0033949; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0033954; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0033960; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0033967; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0033974; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0033975; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0033978; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0033996; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034002; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034013; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034014; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034015; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034016; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034018; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034019; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034021; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034027; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034029; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034030; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034031; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034032; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034033; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034034; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034038; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034042; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034050; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034051; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034054; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034057; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034062; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034064; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034067; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034070; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034073; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034075; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034080; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034084; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034085; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034094; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034100; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034101; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034102; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034103; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034105; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034107; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034108; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034116; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034119; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034122; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034128; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034129; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034130; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034131; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034132; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034133; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034137; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034140; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034143; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034152; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034160; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034164; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034168; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034169; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034171; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034178; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034181; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034190; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034195; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034196; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034198; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034205; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034206; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034208; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034209; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034210; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034211; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034213; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034214; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034216; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034221; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034222; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034224; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034225; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034227; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034231; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034236; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034244; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034248; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034254; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034256; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034259; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034261; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034276; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034280; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034282; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034287; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034291; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034294; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034297; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034298; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034299; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034300; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034301; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034304; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0017050; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017849; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032873; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0033752; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0033754; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0033756; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0033760; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0033762; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0033763; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0033765; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0033771; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0033772; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0033773; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0033774; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0033778; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0033780; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0033790; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0033791; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0033792; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0033796; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0033799; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0033803; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0033806; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0033817; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0033818; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0033830; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0033836; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0033851; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0033855; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0033856; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0033862; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0033867; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0033870; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0033879; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0033880; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0033881; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0033895; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0033897; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0033913; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0033914; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0033916; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0033919; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0033922; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0033932; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0033937; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0033943; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0033950; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0033957; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0033958; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0033961; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0033979; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0033983; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0033994; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0033995; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0033996; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0033997; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0033999; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0034000; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0034002; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0034008; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0034010; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0034011; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0034012; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0034013; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0034014; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0034015; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0034019; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0034023; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0034031; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0034032; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0034035; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0034038; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0034043; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0034045; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0034048; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0034051; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0034054; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0034056; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0034061; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0034065; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0034066; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0034074; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0034080; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0034081; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0034082; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0034083; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0034085; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0034087; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0034088; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0034095; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0034098; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0034101; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0034107; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0034108; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0034109; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0034110; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0034111; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0034112; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0034116; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0034120; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0034123; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0034132; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0034140; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0034144; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0034148; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0034149; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0034151; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0034158; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0034161; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0034170; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0034175; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0034176; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0034178; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0034186; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0034188; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0034189; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0034190; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0034191; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0034196; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0034201; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0034202; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0034204; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0034205; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0034207; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0034211; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0034216; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0034224; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0034228; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0034234; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0034236; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0034239; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0034241; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0034256; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0034260; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0034262; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0034267; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0034271; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0034273; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0034276; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0034277; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0034278; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0034279; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0034280; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0017012; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017812; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0032805; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0033679; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0033680; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0033682; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0033687; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0033689; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0033690; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0033692; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0033698; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0033699; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0033700; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0033701; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0033705; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0033707; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0033717; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0033718; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0033719; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0033723; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0033726; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0033729; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0033732; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0033743; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0033744; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0033756; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0033762; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0033777; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0033781; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0033782; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0033788; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0033793; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0033796; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0033805; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0033806; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0033807; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0033821; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0033823; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0033839; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0033840; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0033842; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0033845; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0033848; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0033858; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0033863; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0033869; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0033876; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0033883; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0033884; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0033887; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0033905; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0033910; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0033920; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0033921; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0033922; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0033923; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0033925; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0033926; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0033928; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0033934; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0033936; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0033937; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0033938; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0033939; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0033940; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0033941; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0033949; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0033957; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0033958; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0033961; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0033964; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0033969; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0033971; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0033974; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0033977; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0033980; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0033982; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0033987; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0033991; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0033992; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0034000; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0034006; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0034008; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0034009; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0034011; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0034013; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0034014; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0034022; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0034025; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0034028; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0034034; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0034035; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0034036; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0034037; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0034038; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0034039; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0034043; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0034047; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0034050; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0034059; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0034067; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0034071; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0034075; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0034076; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0034078; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0034085; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0034088; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0034097; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0034102; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0034103; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0034105; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0034113; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0034115; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0034116; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0034117; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0034118; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0034120; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0034121; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0034123; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0034128; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0034129; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0034131; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0034132; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0034134; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0034138; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0034143; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0034151; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0034155; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0034161; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0034163; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0034166; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0034168; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0034183; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0034187; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0034189; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0034194; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0034198; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0034200; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0034203; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0034204; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0034205; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0034206; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0034207; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0034209; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017012; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017813; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032878; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0033748; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0033750; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0033754; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0033756; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0033757; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0033759; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0033765; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0033766; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0033767; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0033768; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0033772; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0033774; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0033784; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0033785; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0033786; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0033790; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0033793; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0033796; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0033799; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0033810; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0033811; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0033823; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0033829; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0033844; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0033848; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0033849; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0033855; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0033860; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0033863; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0033872; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0033873; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0033874; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0033888; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0033890; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0033905; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0033906; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0033908; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0033911; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0033914; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0033924; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0033929; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0033935; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0033942; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0033949; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0033950; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0033953; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0033971; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0033976; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0033987; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0033988; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0033989; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0033990; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0033992; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0033995; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034001; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034003; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034004; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034005; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034006; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034007; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034008; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034012; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034016; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034024; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034025; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034028; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034031; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034036; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034038; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034041; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034044; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034047; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034049; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034054; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034058; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034059; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034067; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034073; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034074; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034075; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034076; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034078; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034080; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034081; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034089; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034092; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034095; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034101; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034102; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034103; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034104; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034105; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034106; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034110; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034114; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034117; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034126; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034134; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034138; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034142; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034143; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034145; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034152; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034155; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034164; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034169; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034170; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034172; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034179; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034180; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034182; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034183; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034184; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034187; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034188; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034190; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034195; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034196; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034198; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034199; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034201; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034205; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034210; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034218; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034221; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034227; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034229; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034232; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034234; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034249; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034253; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034255; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034260; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034264; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034266; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034269; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034270; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034271; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034272; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034273; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034275; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0016832; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017636; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0032588; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033457; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033459; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033463; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033465; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033466; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033468; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033474; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033475; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033476; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033477; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033481; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033483; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033493; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033494; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033495; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033499; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033502; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033505; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033508; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033520; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033521; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033533; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033539; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033554; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033558; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033559; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033565; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033570; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033573; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033582; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033583; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033584; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033585; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033598; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033600; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033615; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033616; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033618; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033621; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033624; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033634; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033639; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033645; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033652; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033659; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033660; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033663; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033681; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033688; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033699; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033700; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033701; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033702; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033704; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033707; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033712; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033713; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033715; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033716; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033717; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033718; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033719; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033720; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033724; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033728; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033736; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033737; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033740; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033743; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033748; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033750; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033753; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033756; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033759; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033761; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033766; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033770; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033771; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033779; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033785; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033787; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033788; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033790; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033792; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033793; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033800; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033803; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033806; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033812; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033813; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033814; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033815; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033816; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033817; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033821; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033825; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033828; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033837; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033845; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033849; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033853; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033854; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033856; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033863; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033866; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033875; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033880; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033881; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033883; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033890; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033891; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033893; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033894; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033895; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033896; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033898; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033899; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033901; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033906; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033907; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033909; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033910; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033912; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033916; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033920; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033928; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033932; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033938; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033940; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033943; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033945; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033960; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033964; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033966; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033971; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033975; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033977; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033980; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033981; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033982; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033983; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033984; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033987; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017470; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018268; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0033384; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034266; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034268; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034270; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034274; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034276; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034277; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034279; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034285; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034286; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034287; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034288; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034292; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034294; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034304; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034305; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034306; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034310; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034313; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034316; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034319; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034330; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034331; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034343; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034349; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034364; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034368; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034369; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034375; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034380; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034383; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034392; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034393; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034394; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034395; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034408; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034410; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034426; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034427; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034429; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034432; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034435; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034445; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034450; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034456; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034463; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034470; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034471; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034474; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034492; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034497; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034507; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034508; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034509; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034510; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034512; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034513; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034515; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034519; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034521; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034523; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034524; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034525; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034526; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034527; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034528; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034532; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034536; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034544; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034545; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034548; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034551; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034556; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034558; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034561; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034564; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034567; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034569; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034574; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034578; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034579; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034587; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034593; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034595; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034596; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034598; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034600; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034601; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034609; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034612; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034615; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034621; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034622; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034623; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034624; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034625; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034626; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034630; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034634; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034637; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034646; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034654; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034658; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034662; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034663; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034665; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034672; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034675; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034684; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034689; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034690; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034692; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034700; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034702; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034703; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034704; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034705; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034708; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034710; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034715; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034716; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034718; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034719; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034721; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034725; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034729; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034737; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034741; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034747; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034749; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034752; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034754; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034769; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034773; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034775; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034780; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034784; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034786; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034789; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034790; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034791; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034792; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034793; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034795; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016413; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017197; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031916; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0032783; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0032785; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0032787; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0032792; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0032794; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0032795; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0032797; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0032803; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0032804; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0032805; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0032806; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0032810; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0032812; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0032824; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0032825; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0032826; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0032830; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0032833; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0032836; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0032839; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0032850; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0032851; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0032863; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0032869; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0032884; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0032888; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0032889; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0032895; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0032900; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0032903; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0032912; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0032913; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0032914; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0032929; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0032931; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0032947; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0032948; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0032950; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0032953; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0032956; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0032966; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0032971; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0032977; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0032984; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0032991; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0032992; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0032995; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033013; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033018; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033026; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033027; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033028; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033029; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033031; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033032; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033034; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033039; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033041; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033042; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033043; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033044; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033045; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033046; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033050; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033054; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033062; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033063; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033066; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033069; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033074; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033076; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033079; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033082; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033085; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033087; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033092; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033096; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033097; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033106; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033112; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033113; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033114; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033115; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033117; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033119; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033120; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033127; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033130; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033133; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033139; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033140; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033141; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033142; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033143; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033148; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033152; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033155; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033164; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033172; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033176; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033180; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033181; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033183; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033190; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033193; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033202; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033207; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033208; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033210; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033218; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033220; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033221; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033222; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033223; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033225; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033226; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033228; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033233; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033234; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033236; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033237; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033239; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033243; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033248; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033256; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033260; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033266; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033268; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033271; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033273; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033287; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033291; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033293; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033298; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033302; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033304; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033307; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033308; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033309; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033310; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033311; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0016805; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017606; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0032561; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033436; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033438; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033442; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033444; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033445; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033447; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033453; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033454; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033455; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033456; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033460; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033462; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033472; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033473; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033474; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033478; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033481; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033484; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033487; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033498; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033499; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033509; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033515; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033530; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033534; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033535; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033541; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033546; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033549; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033558; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033559; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033560; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033574; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033576; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033591; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033592; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033594; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033597; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033600; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033610; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033615; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033621; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033628; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033635; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033636; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033639; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033657; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033662; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033665; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033673; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033674; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033675; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033676; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033679; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033681; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033685; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033686; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033688; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033689; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033690; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033691; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033692; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033693; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033697; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033701; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033709; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033710; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033713; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033716; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033721; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033723; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033726; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033729; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033732; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033734; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033739; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033743; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033744; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033752; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033758; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033759; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033760; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033761; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033763; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033765; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033766; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033774; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033777; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033780; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033786; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033787; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033788; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033789; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033790; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033791; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033795; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033798; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033801; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033810; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033818; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033822; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033826; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033827; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033829; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033836; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033839; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033848; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033853; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033854; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033856; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033863; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033864; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033866; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033867; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033868; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033869; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033871; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033872; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033874; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033879; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033880; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033882; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033883; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033885; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033889; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033893; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033901; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033905; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033911; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033913; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033916; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033918; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033933; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033937; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033939; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033944; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033948; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033951; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033954; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033955; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033956; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033957; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033958; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0016911; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017712; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0032713; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033590; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033592; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033596; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033598; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033599; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033601; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033607; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033608; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033609; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033610; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033614; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033616; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033625; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033626; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033627; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033631; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033634; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033637; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033640; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033651; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033652; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033663; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033669; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033683; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033687; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033688; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033694; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033699; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033702; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033711; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033712; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033713; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033727; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033729; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033745; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033746; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033748; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033751; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033754; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033764; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033769; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033775; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033782; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033789; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033790; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033793; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033811; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033816; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033819; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033827; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033828; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033829; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033830; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033832; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033835; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033840; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033841; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033843; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033844; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033845; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033846; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033847; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033848; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033852; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033856; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033864; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033865; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033868; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033871; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033876; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033878; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033881; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033884; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033887; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033889; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033894; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033898; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033899; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033907; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033913; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033914; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033915; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033916; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033918; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033920; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033921; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033929; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033932; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033935; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033941; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033942; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033943; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033944; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033945; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033946; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033950; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033954; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033957; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033966; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033974; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033978; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033982; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033983; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033985; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033992; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0033995; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0034004; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0034009; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0034010; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0034012; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0034019; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0034020; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0034022; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0034023; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0034024; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0034025; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0034027; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0034028; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0034030; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0034035; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0034036; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0034038; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0034039; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0034041; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0034045; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0034050; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0034058; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0034061; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0034067; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0034069; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0034072; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0034074; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0034089; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0034093; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0034095; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0034100; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0034104; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0034106; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0034109; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0034110; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0034111; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0034112; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0034113; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0016907; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017707; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0032666; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033534; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033535; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033537; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033541; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033543; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033544; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033546; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033552; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033553; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033554; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033555; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033559; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033561; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033570; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033571; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033572; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033576; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033579; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033582; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033585; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033597; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033598; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033610; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033616; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033631; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033635; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033636; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033642; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033647; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033650; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033659; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033660; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033661; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033674; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033676; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033692; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033693; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033695; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033698; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033701; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033711; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033716; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033722; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033729; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033736; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033737; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033740; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033758; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033763; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033766; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033774; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033775; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033776; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033777; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033779; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033780; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033782; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033787; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033789; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033790; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033791; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033792; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033793; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033794; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033798; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033802; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033810; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033811; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033814; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033817; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033822; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033823; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033826; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033829; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033832; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033834; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033839; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033843; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033844; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033852; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033858; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033859; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033860; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033861; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033863; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033865; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033866; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033873; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033876; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033879; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033885; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033886; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033887; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033888; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033889; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033890; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033894; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033897; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033900; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033909; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033917; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033921; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033925; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033926; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033928; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033935; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033938; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033947; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033952; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033953; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033955; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033963; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033965; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033966; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033967; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033968; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033970; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033971; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033973; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033978; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033979; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033981; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033982; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033984; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033988; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0033993; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0034001; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0034005; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0034011; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0034013; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0034016; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0034018; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0034033; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0034037; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0034039; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0034044; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0034048; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0034051; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0034055; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0034056; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0034057; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0034058; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0016987; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017786; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0032807; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0033677; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0033679; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0033681; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0033685; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0033687; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0033688; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0033690; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0033696; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0033697; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0033698; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0033699; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0033703; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0033705; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0033715; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0033716; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0033717; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0033721; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0033724; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0033727; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0033730; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0033741; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0033742; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0033754; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0033760; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0033775; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0033779; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0033780; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0033786; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0033791; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0033794; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0033803; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0033804; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0033805; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0033819; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0033821; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0033837; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0033838; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0033840; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0033843; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0033846; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0033856; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0033861; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0033867; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0033874; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0033881; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0033882; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0033885; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0033903; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0033907; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0033918; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0033919; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0033920; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0033921; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0033923; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0033924; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0033926; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0033932; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0033934; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0033935; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0033936; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0033937; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0033938; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0033939; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0033943; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0033947; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0033955; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0033956; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0033959; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0033962; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0033967; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0033969; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0033972; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0033975; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0033978; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0033980; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0033985; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0033989; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0033990; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0033998; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0034004; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0034005; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0034006; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0034007; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0034009; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0034011; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0034012; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0034019; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0034022; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0034025; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0034031; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0034032; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0034033; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0034034; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0034035; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0034036; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0034040; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0034044; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0034047; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0034055; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0034063; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0034067; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0034071; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0034072; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0034074; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0034081; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0034084; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0034093; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0034098; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0034099; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0034101; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0034109; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0034111; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0034112; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0034113; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0034114; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0034116; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0034117; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0034119; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0034124; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0034125; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0034127; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0034128; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0034130; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0034134; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0034139; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0034147; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0034151; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0034157; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0034159; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0034162; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0034164; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0034178; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0034182; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0034184; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0034189; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0034193; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0034195; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0034198; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0034199; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0034200; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0034201; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0034202; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0016937; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032698; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033579; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033581; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033585; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033587; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033588; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033590; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033596; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033597; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033598; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033602; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033604; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033613; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033614; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033615; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033619; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033622; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033625; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033628; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033639; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033640; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033652; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033658; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033673; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033677; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033678; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033684; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033689; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033692; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033701; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033702; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033703; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033704; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033717; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033719; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033734; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033735; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033737; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033740; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033743; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033753; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033758; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033764; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033771; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033778; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033779; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033782; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033800; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033805; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033816; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033817; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033818; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033819; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033821; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033822; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033824; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033830; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033832; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033833; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033834; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033835; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033836; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033837; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033841; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033845; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033853; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033854; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033857; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033860; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033865; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033867; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033870; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033873; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033876; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033878; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033883; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033887; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033888; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033897; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033903; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033904; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033905; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033906; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033908; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033910; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033911; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033919; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033922; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033925; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033931; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033932; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033933; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033934; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033936; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033940; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033944; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033947; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033956; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033964; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033968; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033972; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033973; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033975; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033982; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033985; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033994; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033999; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0034000; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0034002; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0034009; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0034010; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0034012; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0034013; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0034014; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0034015; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0034017; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0034018; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0034020; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0034025; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0034026; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0034028; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0034029; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0034031; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0034035; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0034040; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0034048; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0034052; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0034058; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0034060; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0034063; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0034065; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0034080; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0034084; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0034086; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0034091; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0034095; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0034097; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0034100; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0034101; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0034102; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0034103; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0034104; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017505; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018308; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0033404; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034283; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034285; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034287; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034291; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034293; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034294; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034296; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034302; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034303; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034304; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034305; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034309; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034311; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034321; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034322; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034323; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034327; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034330; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034333; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034336; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034347; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034348; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034360; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034366; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034381; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034385; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034386; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034392; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034397; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034400; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034409; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034410; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034411; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034412; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034427; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034429; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034444; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034445; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034447; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034450; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034453; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034463; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034468; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034474; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034481; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034488; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034489; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034492; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034510; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034515; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034525; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034526; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034527; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034528; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034530; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034531; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034533; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034539; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034541; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034542; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034543; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034544; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034545; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034546; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034550; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034554; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034562; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034563; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034566; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034569; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034574; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034576; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034579; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034582; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034585; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034587; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034592; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034596; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034597; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034605; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034611; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034612; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034613; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034615; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034617; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034619; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034620; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034628; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034631; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034634; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034640; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034641; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034642; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034643; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034644; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034645; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034649; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034652; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034655; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034664; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034672; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034676; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034680; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034681; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034683; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034690; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034693; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034702; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034707; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034708; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034710; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034717; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034718; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034720; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034721; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034722; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034723; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034725; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034726; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034728; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034733; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034734; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034736; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034737; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034739; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034743; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034748; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034756; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034760; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034766; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034768; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034771; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034773; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034788; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034792; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034794; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034799; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034803; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034805; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034808; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034809; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034810; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034811; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034812; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016198; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016982; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031624; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032491; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032492; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032494; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032498; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032500; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032501; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032503; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032509; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032510; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032511; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032512; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032516; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032518; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032527; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032528; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032529; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032533; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032536; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032539; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032542; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032554; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032555; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032567; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032573; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032588; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032592; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032593; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032599; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032604; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032607; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032615; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032616; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032617; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032618; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032632; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032634; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032649; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032650; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032652; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032655; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032658; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032668; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032673; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032679; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032686; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032693; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032694; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032697; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032715; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032719; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032721; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032728; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032729; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032730; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032731; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032735; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032740; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032742; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032743; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032744; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032745; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032746; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032747; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032751; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032755; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032763; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032764; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032767; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032770; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032775; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032777; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032780; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032783; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032786; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032788; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032793; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032797; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032799; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032807; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032814; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032816; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032817; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032819; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032821; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032822; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032830; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032833; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032836; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032842; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032843; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032844; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032845; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032847; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032851; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032854; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032857; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032866; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032874; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032878; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032882; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032883; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032885; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032892; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032895; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032904; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032909; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032910; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032912; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032922; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032923; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032924; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032925; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032928; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032930; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032935; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032936; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032938; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032939; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032941; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032945; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032949; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032957; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032961; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032967; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032969; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032972; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032974; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032989; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032993; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032995; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0033000; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0033004; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0033007; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0033010; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0033011; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0033012; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0033013; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0033014; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016476; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017256; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0032029; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0032900; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0032902; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0032907; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0032909; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0032910; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0032912; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0032918; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0032919; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0032920; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0032921; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0032925; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0032927; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0032937; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0032938; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0032939; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0032943; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0032946; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0032949; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0032952; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0032963; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0032964; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0032976; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0032982; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0032997; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033001; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033002; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033008; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033013; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033016; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033025; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033026; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033027; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033040; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033042; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033059; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033060; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033062; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033065; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033068; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033078; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033083; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033089; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033096; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033103; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033104; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033107; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033125; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033131; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033141; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033142; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033143; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033144; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033146; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033147; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033149; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033155; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033157; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033158; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033159; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033160; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033161; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033162; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033166; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033170; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033178; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033179; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033182; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033185; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033190; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033192; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033195; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033198; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033201; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033203; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033208; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033212; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033213; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033221; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033227; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033229; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033230; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033232; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033234; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033235; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033243; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033246; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033249; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033255; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033256; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033257; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033258; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033260; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033264; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033268; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033271; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033280; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033288; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033292; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033296; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033297; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033299; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033306; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033309; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033318; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033323; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033324; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033326; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033333; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033334; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033336; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033337; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033338; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033339; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033341; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033342; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033344; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033349; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033350; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033352; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033353; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033355; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033359; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033364; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033372; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033376; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033382; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033384; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033387; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033389; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033404; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033408; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033410; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033415; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033419; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033422; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033425; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033426; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033427; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033428; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033429; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000000312; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000001722; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000003117; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000003121; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000003910; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000003912; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000003946; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000003947; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000004497; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000005600; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000005620; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000005849; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000006692; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000006764; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000009018; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000013302; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000014614; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000014920; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000017604; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000017622; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000019422; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000019608; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000019876; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000024107; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000026420; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000026917; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000034033; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000034034; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000034076; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000034096; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000034109; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000034131; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000034148; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000034150; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000034159; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000034162; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000034187; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000034197; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000034198; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000034203; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000034207; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000034225; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000034230; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000034231; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000034233; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000034265; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000034276; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000034282; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000034308; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000034346; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000034351; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000034355; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000034359; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000034361; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000034368; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000034375; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000034391; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000034463; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000034466; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000034467; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000036127; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000036221; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000037165; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000040241; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000040254; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000040416; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000040445; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000040484; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000041382; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000042012; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000042608; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000043531; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000044106; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000044123; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000045884; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000045994; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000046386; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000046765; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000047737; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000047783; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000050211; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000051430; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000051867; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000053078; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000054691; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000058099; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000058479; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000058804; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000059093; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000059449; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000059588; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000063359; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000064314; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000064922; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000070577; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000070849; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000071592; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000072939; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000073149; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000073926; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000074403; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000074570; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000074898; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000075602; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000075922; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000076896; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000077440; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000077791; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000077955; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000080536; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000080797; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000086764; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000090006; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000093043; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000093120; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000093217; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000093221; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000093312; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000093434; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000095158; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000095517; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000098324; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000098327; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000098550; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102552; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102553; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108747; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108832; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108951; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108972; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108988; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109102; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109308; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109375; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109410; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109609; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109761; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109950; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000116429; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000117160; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000117702; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000118535; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000119254; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000119826; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000120213; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000120349; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000120426; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000121983; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000125257; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000125716; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000125721; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000127984; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000128860; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000130325; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000132583; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000133037; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000136822; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000144458; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000146824; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000151114; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000152420; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000159416; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000160596; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000161289; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000161576; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000162001; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000162309; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000162616; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000162761; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000163643; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000164182; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000164309; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000164470; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000165470; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000165740; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000165770; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000166615; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000166768; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000166802; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000167688; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000169020; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000169353; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000169453; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000169693; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000170953; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000175795; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000178445; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000179721; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000179857; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000181586; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000181609; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000181948; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000190457; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000194091; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000209363; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000209573; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000209675; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000210412; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000211109; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000211617; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000211852; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000211868; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000211903; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000211981; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000212121; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000212206; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000212275; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000212297; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000212426; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000212433; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000212459; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000212704; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000212754; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000212763; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000212811; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000212963; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000212991; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000213068; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000215324; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0024786; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0027525; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0086046; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0089419; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0089421; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0089424; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0089432; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0089438; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0089439; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0089444; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0089459; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0089461; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0089462; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0089465; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0089480; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0089483; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0089514; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0089518; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0089525; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0089536; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0089540; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0089548; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0089562; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0089583; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0089586; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0089631; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0089643; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0089711; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0089720; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0089727; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0089748; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0089779; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0089782; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0089818; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0089819; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0089820; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0089865; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0089868; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0089922; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0089931; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0089942; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0089947; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0089952; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0089977; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0090004; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0090011; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0090034; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0090060; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0090062; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0090070; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0090121; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0090136; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0090165; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0090167; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0090168; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0090169; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0090173; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0090177; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0090182; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0090193; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0090201; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0090207; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0090210; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0090214; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0090216; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0090221; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0090226; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0090237; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0090259; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0090262; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0090272; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0090276; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0090283; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0090285; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0090295; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0090298; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0090309; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0090316; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0090330; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0090340; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0090341; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0090362; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0090392; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0090393; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0090401; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0090402; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0090405; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0090407; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0090409; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0090434; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0090440; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0090443; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0090459; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0090460; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0090473; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0090474; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0090479; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0090482; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0090501; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0090514; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0090534; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0090546; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0090570; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0090583; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0090592; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0090593; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0090598; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0090610; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0090620; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0090646; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0090652; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0090663; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0090673; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0090705; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0090710; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0090718; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0090733; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0090734; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0090735; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0090743; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0090746; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0090754; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0090789; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0090790; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0090802; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0090803; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0090805; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0090828; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0090833; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0090870; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0090876; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0090911; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0090913; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0090930; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0090933; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0090974; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0090979; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0090986; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0091000; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0091016; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0091019; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0091022; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0091024; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0091025; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0091051; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0091052; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0091060; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0024754; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0027496; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0086128; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0089502; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0089504; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0089507; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0089514; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0089520; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0089521; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0089526; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0089541; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0089543; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0089544; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0089547; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0089561; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0089564; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0089594; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0089598; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0089606; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0089617; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0089621; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0089629; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0089643; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0089664; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0089667; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0089712; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0089724; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0089793; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0089802; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0089809; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0089830; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0089867; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0089870; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0089906; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0089907; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0089908; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0089953; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0089956; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0090010; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0090019; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0090031; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0090036; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0090041; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0090066; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0090092; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0090099; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0090123; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0090149; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0090151; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0090159; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0090211; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0090224; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0090250; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0090252; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0090253; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0090254; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0090258; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0090262; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0090267; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0090280; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0090288; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0090294; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0090297; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0090301; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0090303; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0090308; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0090313; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0090324; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0090345; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0090348; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0090358; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0090362; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0090369; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0090371; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0090381; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0090384; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0090395; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0090402; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0090416; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0090426; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0090427; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0090442; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0090471; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0090472; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0090480; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0090481; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0090484; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0090486; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0090488; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0090511; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0090517; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0090520; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0090537; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0090538; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0090551; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0090552; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0090557; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0090561; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0090579; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0090592; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0090612; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0090626; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0090650; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0090663; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0090672; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0090673; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0090679; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0090691; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0090701; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0090726; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0090733; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0090744; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0090754; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0090791; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0090799; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0090814; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0090815; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0090816; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0090834; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0090869; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0090870; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0090882; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0090883; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0090885; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0090908; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0090913; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0090951; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0090958; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0090993; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0090995; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0091012; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0091015; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0091057; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0091062; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0091069; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0091082; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0091098; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0091100; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0091103; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0091104; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0091105; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0091132; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0091134; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0024720; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0027461; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0086066; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0089441; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0089442; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0089445; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0089453; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0089459; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0089460; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0089465; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0089480; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0089482; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0089483; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0089486; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0089500; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0089503; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0089534; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0089538; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0089545; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0089556; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0089560; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0089568; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0089582; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0089603; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0089606; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0089651; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0089663; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0089732; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0089741; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0089748; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0089769; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0089803; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0089806; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0089841; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0089842; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0089843; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0089887; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0089890; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0089945; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0089954; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0089966; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0089971; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0089976; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0089999; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0090026; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0090033; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0090056; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0090083; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0090085; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0090093; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0090146; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0090160; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0090185; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0090187; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0090188; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0090189; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0090193; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0090197; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0090201; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0090211; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0090219; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0090225; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0090228; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0090232; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0090234; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0090239; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0090255; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0090276; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0090279; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0090289; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0090293; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0090300; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0090302; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0090312; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0090315; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0090326; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0090333; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0090347; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0090357; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0090358; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0090377; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0090406; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0090415; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0090416; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0090419; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0090421; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0090423; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0090448; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0090454; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0090457; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0090474; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0090475; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0090488; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0090490; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0090495; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0090498; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0090517; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0090531; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0090551; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0090564; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0090589; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0090602; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0090612; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0090613; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0090619; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0090631; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0090641; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0090666; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0090672; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0090683; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0090693; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0090732; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0090740; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0090755; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0090756; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0090757; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0090765; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0090768; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0090776; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0090811; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0090812; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0090823; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0090824; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0090826; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0090849; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0090854; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0090892; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0090898; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0090933; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0090935; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0090952; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0090955; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0090996; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0091001; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0091008; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0091022; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0091038; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0091040; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0091043; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0091044; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0091045; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0091073; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0091074; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0091079; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0024726; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027474; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0086091; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0089440; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0089443; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0089450; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0089456; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0089457; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0089462; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0089477; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0089479; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0089480; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0089483; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0089497; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0089500; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0089531; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0089535; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0089542; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0089553; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0089557; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0089565; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0089580; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0089601; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0089604; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0089649; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0089661; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0089728; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0089737; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0089744; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0089765; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0089799; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0089802; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0089837; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0089838; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0089839; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0089884; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0089887; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0089941; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0089950; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0089962; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0089967; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0089972; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0089995; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0090022; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0090029; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0090052; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0090078; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0090080; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0090088; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0090139; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0090154; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0090180; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0090182; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0090183; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0090184; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0090188; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0090195; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0090205; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0090213; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0090219; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0090222; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0090226; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0090228; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0090233; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0090238; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0090249; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0090270; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0090273; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0090283; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0090287; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0090294; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0090296; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0090306; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0090309; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0090320; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0090327; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0090341; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0090351; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0090352; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0090367; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0090396; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0090397; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0090405; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0090406; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0090409; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0090411; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0090413; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0090437; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0090443; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0090446; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0090463; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0090464; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0090477; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0090478; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0090483; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0090487; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0090505; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0090518; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0090538; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0090551; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0090575; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0090588; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0090598; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0090599; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0090605; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0090618; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0090628; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0090653; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0090659; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0090670; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0090680; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0090712; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0090717; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0090725; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0090740; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0090741; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0090750; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0090753; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0090761; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0090796; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0090797; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0090808; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0090809; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0090811; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0090834; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0090839; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0090880; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0090885; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0090921; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0090923; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0090940; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0090943; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0090985; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0090990; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0090997; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0091010; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0091026; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0091028; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0091032; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0091033; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0091034; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0091062; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0091063; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0091068; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0024530; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0027282; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0085652; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0089005; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0089008; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0089015; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0089021; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0089022; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0089027; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0089042; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0089044; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0089045; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0089048; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0089062; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0089065; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0089096; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0089100; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0089107; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0089118; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0089122; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0089130; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0089144; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0089166; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0089169; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0089215; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0089227; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0089297; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0089306; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0089313; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0089334; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0089370; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0089373; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0089409; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0089410; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0089411; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0089412; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0089454; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0089457; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0089509; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0089518; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0089530; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0089535; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0089540; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0089563; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0089590; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0089597; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0089620; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0089646; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0089648; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0089656; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0089708; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0089726; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0089754; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0089756; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0089757; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0089758; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0089762; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0089768; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0089775; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0089778; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0089786; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0089792; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0089795; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0089799; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0089801; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0089806; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0089811; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0089822; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0089844; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0089847; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0089857; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0089861; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0089868; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0089870; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0089880; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0089883; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0089894; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0089901; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0089914; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0089924; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0089925; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0089944; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0089973; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0089982; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0089983; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0089986; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0089988; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0089990; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0090013; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0090019; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0090022; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0090039; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0090040; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0090053; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0090054; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0090059; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0090062; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0090081; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0090095; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0090115; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0090128; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0090152; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0090165; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0090174; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0090175; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0090181; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0090193; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0090203; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0090228; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0090234; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0090245; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0090255; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0090288; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0090293; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0090301; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0090316; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0090317; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0090318; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0090326; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0090328; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0090336; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0090371; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0090372; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0090383; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0090384; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0090386; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0090409; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0090413; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0090453; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0090459; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0090495; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0090497; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0090514; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0090517; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0090557; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0090562; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0090569; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0090582; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0090598; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0090600; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0090603; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0090604; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0090605; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0090633; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0090634; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0090640; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0025234; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0027982; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0086587; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0089957; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0089959; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0089963; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0089970; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0089976; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0089977; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0089982; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0089997; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0089999; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0090000; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0090003; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0090017; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0090020; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0090051; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0090055; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0090062; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0090073; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0090077; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0090085; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0090099; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0090120; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0090123; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0090169; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0090181; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0090249; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0090259; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0090266; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0090287; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0090321; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0090324; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0090361; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0090362; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0090363; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0090364; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0090407; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0090410; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0090462; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0090471; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0090483; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0090488; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0090493; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0090517; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0090543; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0090550; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0090575; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0090602; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0090604; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0090612; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0090664; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0090679; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0090703; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0090705; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0090706; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0090707; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0090711; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0090714; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0090719; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0090724; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0090728; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0090736; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0090742; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0090745; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0090749; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0090751; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0090756; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0090761; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0090772; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0090794; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0090797; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0090807; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0090811; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0090818; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0090820; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0090830; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0090833; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0090844; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0090851; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0090864; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0090874; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0090875; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0090890; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0090919; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0090928; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0090929; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0090932; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0090934; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0090936; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0090961; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0090967; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0090970; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0090987; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0090988; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0091001; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0091002; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0091007; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0091010; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0091028; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0091041; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0091061; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0091073; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0091097; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0091110; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0091119; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0091120; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0091126; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0091138; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0091148; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0091173; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0091179; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0091190; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0091200; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0091237; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0091245; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0091260; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0091261; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0091262; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0091273; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0091281; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0091316; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0091317; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0091328; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0091329; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0091331; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0091354; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0091358; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0091398; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0091405; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0091440; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0091442; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0091459; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0091462; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0091503; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0091508; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0091515; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0091528; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0091544; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0091546; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0091549; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0091550; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0091551; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0091577; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0091579; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0091584; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0024074; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0026877; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0086170; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0089550; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0089552; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0089555; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0089563; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0089569; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0089570; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0089575; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0089590; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0089592; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0089593; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0089596; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0089611; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0089614; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0089645; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0089649; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0089656; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0089667; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0089671; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0089679; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0089693; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0089714; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0089717; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0089763; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0089775; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0089845; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0089855; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0089862; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0089883; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0089918; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0089921; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0089958; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0089959; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0089960; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0090004; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0090007; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0090059; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0090068; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0090079; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0090084; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0090089; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0090115; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0090142; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0090149; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0090173; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0090200; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0090202; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0090210; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0090261; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0090274; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0090297; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0090299; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0090300; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0090301; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0090305; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0090307; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0090314; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0090322; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0090330; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0090336; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0090339; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0090343; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0090345; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0090350; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0090355; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0090367; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0090388; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0090391; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0090401; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0090405; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0090413; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0090416; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0090426; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0090429; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0090440; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0090447; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0090460; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0090470; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0090471; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0090489; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0090518; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0090519; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0090527; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0090528; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0090531; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0090534; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0090536; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0090561; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0090569; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0090572; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0090589; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0090590; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0090603; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0090604; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0090609; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0090632; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0090645; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0090666; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0090679; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0090702; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0090715; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0090726; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0090727; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0090733; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0090745; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0090755; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0090783; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0090789; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0090800; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0090810; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0090849; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0090858; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0090873; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0090874; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0090875; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0090883; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0090886; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0090895; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0090931; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0090932; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0090943; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0090944; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0090946; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0090971; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0090976; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0091010; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0091017; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0091056; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0091058; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0091075; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0091078; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0091122; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0091127; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0091134; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0091148; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0091166; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0091168; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0091171; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0091172; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0091174; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0091200; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0091203; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0024466; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0027210; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0085591; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0088955; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0088958; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0088965; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0088971; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0088972; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0088977; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0088992; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0088994; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0088995; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0088998; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0089010; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0089013; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0089044; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0089048; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0089055; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0089066; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0089070; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0089078; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0089092; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0089113; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0089116; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0089149; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0089161; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0089230; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0089239; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0089246; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0089268; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0089306; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0089309; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0089344; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0089345; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0089346; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0089389; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0089392; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0089445; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0089454; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0089466; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0089471; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0089476; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0089500; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0089527; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0089534; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0089557; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0089584; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0089586; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0089594; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0089645; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0089661; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0089665; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0089688; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0089690; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0089691; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0089692; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0089697; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0089701; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0089706; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0089708; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0089716; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0089722; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0089725; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0089729; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0089731; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0089736; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0089741; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0089752; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0089774; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0089777; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0089787; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0089791; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0089798; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0089800; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0089810; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0089813; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0089824; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0089831; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0089845; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0089855; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0089856; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0089875; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0089904; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0089905; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0089913; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0089914; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0089917; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0089919; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0089921; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0089945; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0089951; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0089954; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0089971; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0089972; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0089984; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0089985; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0089990; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0089993; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0090011; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0090024; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0090044; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0090057; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0090081; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0090094; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0090103; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0090104; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0090110; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0090122; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0090132; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0090157; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0090163; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0090174; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0090184; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0090217; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0090222; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0090230; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0090245; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0090246; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0090247; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0090253; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0090256; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0090264; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0090299; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0090300; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0090311; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0090312; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0090314; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0090337; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0090341; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0090382; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0090388; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0090424; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0090426; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0090443; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0090446; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0090487; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0090492; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0090499; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0090512; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0090528; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0090531; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0090534; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0090535; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0090536; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0090564; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0090565; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0024584; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0027334; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0085787; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0089149; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0089152; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0089159; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0089165; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0089166; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0089170; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0089185; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0089187; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0089188; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0089191; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0089205; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0089208; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0089238; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0089242; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0089249; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0089260; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0089264; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0089272; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0089286; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0089308; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0089311; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0089355; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0089367; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0089435; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0089444; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0089451; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0089472; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0089509; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0089512; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0089548; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0089549; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0089550; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0089593; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0089596; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0089651; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0089660; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0089672; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0089677; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0089682; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0089705; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0089732; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0089739; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0089762; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0089789; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0089791; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0089799; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0089850; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0089865; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0089869; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0089892; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0089894; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0089895; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0089896; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0089900; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0089907; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0089913; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0089916; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0089924; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0089930; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0089933; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0089937; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0089939; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0089944; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0089949; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0089960; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0089981; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0089984; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0089994; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0089998; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0090005; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0090007; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0090017; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0090020; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0090031; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0090038; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0090052; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0090062; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0090063; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0090082; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0090112; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0090113; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0090121; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0090122; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0090125; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0090127; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0090129; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0090154; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0090160; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0090163; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0090180; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0090181; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0090194; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0090195; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0090200; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0090203; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0090222; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0090235; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0090255; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0090268; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0090292; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0090305; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0090314; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0090315; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0090321; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0090333; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0090343; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0090368; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0090374; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0090385; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0090395; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0090428; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0090433; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0090441; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0090456; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0090457; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0090458; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0090466; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0090469; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0090477; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0090512; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0090513; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0090524; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0090525; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0090527; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0090550; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0090555; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0090595; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0090600; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0090636; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0090638; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0090655; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0090658; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0090701; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0090706; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0090713; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0090726; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0090742; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0090744; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0090747; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0090748; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0090749; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0090777; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0090778; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0024585; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0027319; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0085631; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0088991; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0088992; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0088995; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0089002; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0089008; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0089009; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0089014; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0089029; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0089031; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0089032; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0089035; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0089049; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0089052; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0089083; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0089087; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0089094; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0089105; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0089109; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0089118; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0089132; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0089154; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0089155; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0089201; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0089213; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0089281; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0089290; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0089297; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0089318; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0089355; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0089358; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0089393; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0089394; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0089395; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0089437; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0089440; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0089494; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0089503; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0089514; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0089519; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0089524; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0089547; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0089574; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0089581; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0089604; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0089630; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0089632; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0089640; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0089691; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0089706; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0089710; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0089733; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0089735; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0089736; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0089737; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0089741; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0089744; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0089748; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0089757; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0089765; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0089771; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0089774; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0089778; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0089780; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0089785; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0089790; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0089801; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0089822; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0089824; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0089834; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0089838; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0089845; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0089846; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0089856; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0089859; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0089870; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0089877; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0089891; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0089901; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0089902; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0089921; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0089950; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0089951; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0089959; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0089960; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0089963; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0089965; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0089967; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0089990; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0089996; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0089999; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0090016; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0090017; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0090030; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0090031; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0090036; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0090039; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0090057; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0090069; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0090089; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0090101; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0090125; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0090138; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0090147; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0090148; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0090154; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0090166; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0090176; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0090201; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0090207; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0090218; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0090228; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0090265; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0090273; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0090288; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0090289; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0090290; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0090298; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0090301; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0090309; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0090344; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0090345; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0090357; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0090358; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0090360; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0090383; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0090388; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0090429; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0090435; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0090470; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0090472; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0090489; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0090492; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0090533; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0090538; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0090545; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0090558; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0090574; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0090577; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0090581; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0090582; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0090608; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0090609; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0024701; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0027449; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0085827; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0089174; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0089176; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0089179; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0089186; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0089192; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0089193; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0089198; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0089213; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0089215; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0089216; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0089219; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0089234; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0089237; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0089270; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0089274; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0089281; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0089292; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0089296; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0089306; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0089321; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0089342; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0089345; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0089390; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0089402; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0089470; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0089479; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0089486; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0089507; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0089543; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0089546; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0089582; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0089583; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0089584; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0089628; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0089631; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0089686; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0089695; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0089706; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0089711; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0089716; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0089739; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0089767; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0089774; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0089797; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0089824; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0089826; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0089834; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0089886; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0089900; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0089925; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0089927; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0089928; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0089929; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0089933; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0089937; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0089942; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0089950; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0089959; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0089965; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0089968; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0089972; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0089974; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0089979; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0089984; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0089995; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0090017; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0090020; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0090031; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0090035; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0090042; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0090044; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0090054; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0090057; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0090068; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0090075; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0090089; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0090099; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0090100; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0090116; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0090146; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0090147; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0090155; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0090156; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0090159; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0090161; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0090163; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0090186; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0090192; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0090195; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0090212; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0090213; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0090225; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0090226; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0090231; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0090234; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0090253; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0090267; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0090287; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0090298; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0090322; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0090335; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0090344; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0090345; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0090350; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0090362; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0090372; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0090397; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0090403; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0090414; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0090424; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0090461; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0090469; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0090484; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0090485; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0090486; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0090494; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0090497; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0090505; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0090540; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0090541; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0090552; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0090553; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0090555; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0090578; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0090583; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0090620; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0090627; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0090662; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0090664; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0090681; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0090684; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0090725; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0090730; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0090737; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0090750; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0090766; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0090768; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0090771; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0090772; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0090773; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0090799; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0090800; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0024578; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0085672; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0089018; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0089021; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0089028; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0089034; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0089035; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0089040; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0089055; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0089057; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0089060; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0089074; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0089077; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0089106; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0089110; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0089117; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0089128; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0089132; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0089139; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0089152; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0089173; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0089176; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0089221; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0089233; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0089302; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0089311; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0089318; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0089339; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0089374; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0089377; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0089413; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0089414; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0089415; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0089416; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0089458; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0089461; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0089514; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0089523; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0089534; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0089539; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0089544; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0089567; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0089594; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0089601; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0089625; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0089651; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0089653; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0089661; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0089713; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0089727; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0089753; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0089755; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0089756; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0089757; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0089761; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0089766; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0089771; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0089778; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0089786; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0089792; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0089795; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0089799; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0089801; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0089806; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0089811; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0089823; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0089844; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0089847; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0089857; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0089861; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0089868; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0089870; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0089880; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0089883; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0089894; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0089901; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0089915; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0089925; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0089926; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0089946; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0089976; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0089977; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0089985; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0089986; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0089989; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0089991; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0089993; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0090018; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0090024; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0090027; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0090044; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0090045; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0090058; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0090059; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0090067; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0090086; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0090099; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0090119; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0090131; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0090155; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0090168; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0090177; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0090178; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0090184; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0090196; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0090206; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0090231; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0090237; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0090248; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0090258; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0090290; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0090295; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0090303; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0090318; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0090319; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0090320; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0090328; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0090331; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0090339; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0090374; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0090375; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0090386; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0090387; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0090389; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0090412; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0090417; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0090457; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0090463; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0090498; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0090500; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0090517; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0090520; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0090562; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0090567; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0090574; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0090587; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0090603; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0090605; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0090608; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0090609; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0090610; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0090636; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0090637; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0025269; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0028005; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0086880; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0090261; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0090263; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0090266; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0090273; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0090279; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0090280; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0090285; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0090300; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0090302; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0090303; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0090306; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0090320; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0090323; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0090353; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0090357; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0090364; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0090375; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0090379; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0090387; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0090402; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0090423; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0090426; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0090472; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0090484; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0090553; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0090562; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0090569; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0090590; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0090624; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0090627; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0090663; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0090664; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0090665; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0090666; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0090711; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0090714; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0090768; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0090777; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0090788; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0090793; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0090798; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0090822; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0090849; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0090856; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0090879; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0090905; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0090907; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0090915; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0090966; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0090981; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091008; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091010; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091011; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091012; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091016; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091019; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091024; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091036; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091044; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091050; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091053; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091057; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091059; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091064; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091069; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091081; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091102; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091105; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091115; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091119; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091127; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091129; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091139; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091142; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091154; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091161; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091175; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091185; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091186; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091202; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091232; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091233; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091241; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091243; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091246; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091248; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091250; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091276; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091282; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091285; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091302; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091303; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091316; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091317; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091322; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091325; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091344; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091356; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091376; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091390; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091414; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091427; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091436; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091437; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091443; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091455; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091465; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091490; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091496; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091507; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091517; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091549; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091554; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091562; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091577; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091578; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091579; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091587; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091590; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091598; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091633; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091634; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091645; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091646; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091648; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091672; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091677; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091717; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091723; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091758; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091760; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091777; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091780; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091821; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091826; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091833; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091847; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091863; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091865; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091868; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091869; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091870; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091896; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091897; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0023794; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0026584; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0085580; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0088969; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0088970; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0088973; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0088980; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0088987; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0088988; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0088993; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0089008; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0089010; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0089011; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0089015; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0089027; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0089030; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0089063; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0089067; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0089073; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0089085; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0089089; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0089099; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0089113; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0089135; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0089139; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0089186; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0089198; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0089269; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0089280; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0089287; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0089308; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0089342; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0089346; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0089380; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0089381; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0089382; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0089383; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0089431; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0089435; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0089494; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0089503; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0089516; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0089523; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0089528; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0089553; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0089582; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0089589; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0089611; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0089637; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0089639; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0089647; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0089700; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0089712; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0089714; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0089735; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0089737; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0089738; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0089739; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0089746; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0089753; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0089761; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0089767; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0089770; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0089774; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0089776; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0089781; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0089786; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0089798; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0089819; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0089822; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0089832; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0089836; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0089845; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0089847; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0089857; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0089860; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0089871; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0089878; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0089891; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0089901; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0089903; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0089920; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0089951; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0089960; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0089961; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0089964; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0089966; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0089968; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0089996; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0090004; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0090007; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0090024; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0090025; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0090039; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0090040; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0090048; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0090067; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0090080; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0090101; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0090113; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0090139; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0090153; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0090164; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0090165; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0090171; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0090184; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0090194; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0090220; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0090227; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0090238; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0090248; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0090294; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0090309; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0090310; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0090311; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0090321; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0090330; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0090365; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0090366; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0090377; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0090378; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0090380; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0090403; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0090407; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0090446; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0090452; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0090488; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0090490; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0090507; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0090510; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0090555; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0090560; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0090567; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0090582; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0090600; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0090603; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0090608; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0090609; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0090611; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0090637; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0090640; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0024088; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0026801; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0084695; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0088050; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0088053; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0088061; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0088067; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0088068; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0088073; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0088088; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0088090; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0088091; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0088094; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0088109; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0088112; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0088143; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0088147; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0088154; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0088165; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0088169; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0088177; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0088192; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0088213; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0088216; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0088261; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0088273; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0088342; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0088352; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0088359; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0088380; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0088414; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0088417; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0088454; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0088455; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0088456; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0088500; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0088503; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0088557; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0088566; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0088577; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0088582; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0088587; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0088610; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0088637; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0088644; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0088667; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0088694; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0088696; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0088704; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0088754; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0088770; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0088794; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0088796; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0088797; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0088798; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0088802; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0088803; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0088808; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0088816; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0088824; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0088830; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0088833; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0088837; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0088839; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0088844; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0088849; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0088860; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0088881; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0088884; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0088894; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0088898; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0088905; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0088907; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0088917; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0088920; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0088931; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0088938; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0088952; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0088962; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0088963; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0088982; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0089012; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0089021; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0089022; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0089025; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0089027; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0089029; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0089054; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0089060; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0089063; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0089080; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0089081; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0089093; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0089094; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0089101; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0089120; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0089134; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0089154; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0089166; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0089190; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0089203; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0089212; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0089213; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0089219; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0089231; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0089241; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0089266; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0089272; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0089283; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0089293; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0089325; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0089330; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0089338; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0089353; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0089354; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0089355; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0089363; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0089366; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0089374; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0089409; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0089410; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0089421; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0089422; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0089424; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0089447; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0089452; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0089489; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0089496; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0089531; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0089533; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0089550; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0089553; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0089594; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0089599; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0089606; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0089619; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0089635; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0089638; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0089641; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0089642; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0089643; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0089669; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0089671; mus_musculus_wsbeij.
DR   PubMed; 12040188.
XX
CC   This is the July 2001 combined whole genome shotgun assembly of Mus
CC   musculus. It contains 27 million Celera reads on four Mus musculus
CC   strains (129X1/SvJ, 129S1/SvImJ, DBA/2J and A/J), 13 million reads
CC   on C57BL/6J from the NCBI Trace Archive, 0.4 million BAC end
CC   sequences from TIGR, and unfinished and finished BACs pulled from
CC   NCBI (Nature 2002. 420:520-562). The assembly process relied on
CC   Celera's paired reads and BAC end reads for long range order and
CC   orientation. Its scaffolds were mapped to chromosomes using STS
CC   maps. For more detailed information about whole genome sequencing
CC   and Celera's assembly process, please refer to Venter, J.C. et al.
CC   Science 2001. 291:1304-1351.
CC   This version of genes, transcripts, and proteins was
CC   computationally created in November 2001 from the whole-genome
CC   mapping of transcript and protein sequences on the Celera mouse
CC   genome assembly by Celera Chromosome Team and Content Systems.  The
CC   data sets used by this annotation process were collected in 2001
CC   and include RefSeq (NM_ from mouse and human) sequences, GenBank
CC   mRNA and dbEST sequences, mammalian SwissProt sequences,  and NRAA
CC   sequences (all mouse unless noted otherwise).  The initial gene set
CC   was manually curated between 2002 and 2003. Subsequently, automated
CC   annotation updates were performed.  The CDS of each transcript was
CC   manually or computationally defined by either the longest
CC   ATG-to-Stop or the longest open reading frame. All CDSs
CC   corresponding to the longest open reading frames with no starting
CC   ATG were flagged as partial.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..57380464
FT                   /organism="Mus musculus"
FT                   /chromosome="8"
FT                   /strain="mixed"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   gene            <14813..>23440
FT                   /locus_tag="mCG_141471"
FT                   /note="gene_id=mCG141471.0"
FT   mRNA            join(<14813..14901,19957..20083,20294..20354,21613..>23440)
FT                   /locus_tag="mCG_141471"
FT                   /product="mCG141471"
FT                   /note="gene_id=mCG141471.0 transcript_id=mCT175530.0
FT                   created on 05-NOV-2002"
FT   CDS             join(<14815..14901,19957..20083,20294..20354,21613..>23440)
FT                   /codon_start=1
FT                   /locus_tag="mCG_141471"
FT                   /product="mCG141471"
FT                   /note="gene_id=mCG141471.0 transcript_id=mCT175530.0
FT                   protein_id=mCP98455.0"
FT                   /protein_id="EDL10771.1"
FT                   /translation="EVTDRSSVARRRASPGAAAGPLEALGADMGSVSFQDVAVTFTVEE
FT                   WALLDPSQKKLHKDVMEETFRNLAAIGKTQEGQNIDEDHRYSRRNQRNEVVERLLEHSK
FT                   GTESKEIFRQIPNTIVNRKSSHRTMLSENHVYKDNVLISQSSLTVSVPLQTPHKPHEYE
FT                   LHGENLYKFGECEKAFIYPECFLKHKDSGTRQRSYELNQCEEIFKSNDYIQIRVNDETR
FT                   EEICIDKQHYAFNYPDFLQYVEKVHTGKKPYACKQCGKTFSFLSNIKRHERIHSGEKPY
FT                   RCNICDKAFTCSTNFQEHERTHTGEKPYLCTQCGKSFSFLSNIRRHERTHTGEKPYRCN
FT                   ACGKAFSYLTNFQDHERTHTGEKPYVCTQCGKAFTYYYSFQTHKRCHTGEKPYVCKQCG
FT                   KAFSYYNSIQTHKRCHTGEKPYVCKLCAKAFTTLSSLRYHERIHSGEKPHVCLQCGKGF
FT                   NSSSTLRIHERTHTGEKPYKCKKCGKVFSVDSSLRCHERIHSGEKPYVCKQCGKAFTRH
FT                   TSLRCHERIHCGEKPYICKQCGKGFISSSNFRKHEWTHSGEKFCVCKLCGKAFTGHSSL
FT                   QRHERIHSGEKPYVCKHCGKDFSSLSGCQRHEQIHTGEKPYVCKNCGKAFTNPSALRNH
FT                   ERIHSGEKPYVCGQCGKGFISFSKFRIHERIHTGEKPYKCKQCGKAFTGHSSLRRHERI
FT                   HSGEKPF"
FT   gene            41343..66633
FT                   /gene="Zfp617"
FT                   /locus_tag="mCG_141473"
FT                   /note="gene_id=mCG141473.0"
FT   mRNA            join(41343..41425,45809..45935,60834..60960,61770..61830,
FT                   64651..65334)
FT                   /gene="Zfp617"
FT                   /locus_tag="mCG_141473"
FT                   /product="zinc finger protein 617, transcript variant
FT                   mCT175532"
FT                   /note="gene_id=mCG141473.0 transcript_id=mCT175532.0
FT                   created on 05-NOV-2002"
FT   gene            complement(49201..>51770)
FT                   /locus_tag="mCG_53597"
FT                   /note="gene_id=mCG53597.2"
FT   mRNA            complement(join(49201..49613,51710..>51770))
FT                   /locus_tag="mCG_53597"
FT                   /product="mCG53597"
FT                   /note="gene_id=mCG53597.2 transcript_id=mCT53780.2 created
FT                   on 05-FEB-2003"
FT   CDS             complement(join(49513..49613,51710..>51770))
FT                   /codon_start=1
FT                   /locus_tag="mCG_53597"
FT                   /product="mCG53597"
FT                   /note="gene_id=mCG53597.2 transcript_id=mCT53780.2
FT                   protein_id=mCP27882.2"
FT                   /protein_id="EDL10774.1"
FT                   /translation="NSLCRPGWPQTQKSTCLCLPMSSRTARATQRKPVSNNQKKKKKKS
FT                   FVLNIYIP"
FT   mRNA            join(55568..55676,60834..60960,61770..61830,64651..66633)
FT                   /gene="Zfp617"
FT                   /locus_tag="mCG_141473"
FT                   /product="zinc finger protein 617, transcript variant
FT                   mCT175533"
FT                   /note="gene_id=mCG141473.0 transcript_id=mCT175533.0
FT                   created on 05-NOV-2002"
FT   CDS             join(55674..55676,60834..60960,61770..61830,64651..65137)
FT                   /codon_start=1
FT                   /gene="Zfp617"
FT                   /locus_tag="mCG_141473"
FT                   /product="zinc finger protein 617, isoform CRA_a"
FT                   /note="gene_id=mCG141473.0 transcript_id=mCT175533.0
FT                   protein_id=mCP98452.0 isoform=CRA_a"
FT                   /protein_id="EDL10772.1"
FT                   /translation="MESVTFEDVAVNFTLEEWTLLNPSQENLYRAVMRETIRNLHDIGQ
FT                   KLGEQNTENAYKNPGGNLRYQVVEKLCEYEEDSQWEEIFSEIPDPVVSQKTGEKPCESH
FT                   VYGEDITGHSSLNVSLRGQTRCKTHEYKEHGEKPCKCKDSGVAFGSPQSFLKHEQIYTQ
FT                   EKPYACKQCDKAFKYLSSLQNHKRIHNRERNHACKQCGKSFKRQSNVQAHERNHTGRET
FT                   LCV"
FT   CDS             join(60927..60960,61770..61830,64651..65137)
FT                   /codon_start=1
FT                   /gene="Zfp617"
FT                   /locus_tag="mCG_141473"
FT                   /product="zinc finger protein 617, isoform CRA_b"
FT                   /note="gene_id=mCG141473.0 transcript_id=mCT175532.0
FT                   protein_id=mCP98453.0 isoform=CRA_b"
FT                   /protein_id="EDL10773.1"
FT                   /translation="MRETIRNLHDIGQKLGEQNTENAYKNPGGNLRYQVVEKLCEYEED
FT                   SQWEEIFSEIPDPVVSQKTGEKPCESHVYGEDITGHSSLNVSLRGQTRCKTHEYKEHGE
FT                   KPCKCKDSGVAFGSPQSFLKHEQIYTQEKPYACKQCDKAFKYLSSLQNHKRIHNRERNH
FT                   ACKQCGKSFKRQSNVQAHERNHTGRETLCV"
FT   assembly_gap    76028..76177
FT                   /estimated_length=150
FT                   /gap_type="unknown"
FT   gene            83743..102602
FT                   /locus_tag="mCG_141472"
FT                   /note="gene_id=mCG141472.0"
FT   mRNA            join(83743..83789,98386..98532,98713..98773,100397..102602)
FT                   /locus_tag="mCG_141472"
FT                   /product="mCG141472"
FT                   /note="gene_id=mCG141472.0 transcript_id=mCT175531.0
FT                   created on 05-NOV-2002"
FT   CDS             100828..101592
FT                   /codon_start=1
FT                   /locus_tag="mCG_141472"
FT                   /product="mCG141472"
FT                   /note="gene_id=mCG141472.0 transcript_id=mCT175531.0
FT                   protein_id=mCP98454.0"
FT                   /protein_id="EDL10775.1"
FT                   /translation="MLTHSVDRHKCVVCREAFPNAVALREHKTIHSGEIPECKECGRMF
FT                   WTASSLDMHKRLHTTEKLYECKHCGKAFMRYCSFQLHKRTHTGEKPFECKQCGKTFRHS
FT                   SHVQAHKRIHTGEKPYECMQCGKTFTSGHCARRHLGTHSGAWPYKCEVCGKAYPYVYSL
FT                   RNHKKSHNEEKLYECKQCGKAFKYISSLRNHETTHTGEKPYECKECGKAFSCSSYIQNH
FT                   MRTHKRQSYECKECGKVFSYSKSLRRHMTTHS"
FT   gene            complement(121078..>135116)
FT                   /gene="Cyp4f18"
FT                   /locus_tag="mCG_20439"
FT                   /note="gene_id=mCG20439.1"
FT   mRNA            complement(join(121078..121333,121657..121739,
FT                   122304..122368,122458..122591,125428..125557,
FT                   125761..125827,128482..128752,130770..130891,
FT                   133453..133580,133666..133719,134966..>135116))
FT                   /gene="Cyp4f18"
FT                   /locus_tag="mCG_20439"
FT                   /product="cytochrome P450, family 4, subfamily f,
FT                   polypeptide 18"
FT                   /note="gene_id=mCG20439.1 transcript_id=mCT21853.1 created
FT                   on 26-MAR-2003"
FT   CDS             complement(join(121156..121333,121657..121739,
FT                   122304..122368,122458..122591,125428..125557,
FT                   125761..125827,128482..128752,130770..130891,
FT                   133453..133580,133666..133719,134966..>135116))
FT                   /codon_start=1
FT                   /gene="Cyp4f18"
FT                   /locus_tag="mCG_20439"
FT                   /product="cytochrome P450, family 4, subfamily f,
FT                   polypeptide 18"
FT                   /note="gene_id=mCG20439.1 transcript_id=mCT21853.1
FT                   protein_id=mCP5010.1"
FT                   /protein_id="EDL10776.1"
FT                   /translation="LQIQSSEEGLLYIQSLVRTFRDACCWWVGPLHPVIRIFHPAFIKP
FT                   VVLAPALVAPKDTVFYRFLKPWLGDGLLMSTGDKWSRHRRMLTPAFHFNILKPYVKVFN
FT                   DSTNIMHAKWQRLASKGSAYLNMFEHISLMTLDSLQKCVFSFDSNCQEKPSEYITAILE
FT                   LSTLVARRHQRLLLHVDLFYYLTHDGMRFRKACRLVHDFTDAVIRERRRTLLDQGGVDV
FT                   LKAKAKAKTLDFIDVLLLSKDEHGKALSDEDIRAEADTFMFGGHDTTASGLSWILYNLA
FT                   RHPEYQERCRQEVRELLRDREPEEIEWDDLAQLPFLTMCIKESLRLHPPVTAISRCCTQ
FT                   DIVLPDGRVIPKGVISRISIFGTHHNPAVWPDPEVYDPFRFDADNVKGRSPLAFIPFSA
FT                   GPRNCIGQTFAMSEMKVALALTLLRFRVLPDDKEPRRKPELILRAEGGLWLKVEPLSAG
FT                   AQ"
FT   assembly_gap    136192..138317
FT                   /estimated_length=2126
FT                   /gap_type="unknown"
FT   assembly_gap    143244..143263
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    158191..159596
FT                   /estimated_length=1406
FT                   /gap_type="unknown"
FT   assembly_gap    163179..163198
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(165585..166787)
FT                   /locus_tag="mCG_118298"
FT                   /note="gene_id=mCG118298.0"
FT   mRNA            complement(165585..166787)
FT                   /locus_tag="mCG_118298"
FT                   /product="mCG118298"
FT                   /note="gene_id=mCG118298.0 transcript_id=mCT119451.0
FT                   created on 05-NOV-2002"
FT   CDS             complement(165680..166015)
FT                   /codon_start=1
FT                   /locus_tag="mCG_118298"
FT                   /product="mCG118298"
FT                   /note="gene_id=mCG118298.0 transcript_id=mCT119451.0
FT                   protein_id=mCP74161.1"
FT                   /protein_id="EDL10777.1"
FT                   /translation="MAETEWCERLRALKKENVHKEKSPSRDLESEEVKNLRINPQGEKK
FT                   EKEKVQKKKSLYPVKELEALKLDSLKADELSSSEEEESHYEAAHYKKKIPSRGKASEEI
FT                   REKIKSY"
FT   gene            169076..169872
FT                   /locus_tag="mCG_118302"
FT                   /note="gene_id=mCG118302.0"
FT   mRNA            169076..169872
FT                   /locus_tag="mCG_118302"
FT                   /product="mCG118302"
FT                   /note="gene_id=mCG118302.0 transcript_id=mCT119455.0
FT                   created on 10-OCT-2002"
FT   CDS             169157..169375
FT                   /codon_start=1
FT                   /locus_tag="mCG_118302"
FT                   /product="mCG118302"
FT                   /note="gene_id=mCG118302.0 transcript_id=mCT119455.0
FT                   protein_id=mCP74256.1"
FT                   /protein_id="EDL10778.1"
FT                   /translation="MARTKQTARKSTGGKATRKQLATKATRKSAPSTGGVKKPHRYRPG
FT                   TVALREIRRYQKSTELLIRKLPFQRLV"
FT   gene            <191522..>192466
FT                   /locus_tag="mCG_1035773"
FT                   /note="gene_id=mCG1035773.1"
FT   mRNA            <191522..>192466
FT                   /locus_tag="mCG_1035773"
FT                   /product="mCG1035773"
FT                   /note="gene_id=mCG1035773.1 transcript_id=mCT153477.1
FT                   created on 19-SEP-2002"
FT   CDS             191522..192466
FT                   /codon_start=1
FT                   /locus_tag="mCG_1035773"
FT                   /product="mCG1035773"
FT                   /note="gene_id=mCG1035773.1 transcript_id=mCT153477.1
FT                   protein_id=mCP73707.1"
FT                   /db_xref="GOA:Q7TRY2"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3030206"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TRY2"
FT                   /protein_id="EDL10779.1"
FT                   /translation="MGTSNVSSNSDFILMGLFSYTGPHLVLFFLMATVFIIGLLGNTTL
FT                   LFLIATDSRLHTPMYFLLSQLSLLDVGFPLVTIPKVVAEFLQGQNVISFGGCATQMFFL
FT                   MLMGVSEGVLLSLMSYDRYVAVCHPLHYQVLMRNQVCLVMVGASWFSGALVASIQTSIT
FT                   LQFPYCASHTVDHFFCELPALLKLSCADTSAYELALSISGVLILLLPLSLIFISYGHVL
FT                   GAVLHMRSAEARHKAFTTCSSHVTVVGLFYGAAVFMYMVPGSYHSPKQDNVVSLFYSLI
FT                   TPTLNPLIYSLRNREVRMSLVKVMGRSDFRVKR"
FT   assembly_gap    229056..231569
FT                   /estimated_length=2514
FT                   /gap_type="unknown"
FT   gene            <231728..>232630
FT                   /locus_tag="mCG_1035774"
FT                   /note="gene_id=mCG1035774.0"
FT   mRNA            <231728..>232630
FT                   /locus_tag="mCG_1035774"
FT                   /product="mCG1035774"
FT                   /note="gene_id=mCG1035774.0 transcript_id=mCT153478.0
FT                   created on 10-OCT-2002"
FT   CDS             231728..232630
FT                   /codon_start=1
FT                   /locus_tag="mCG_1035774"
FT                   /product="mCG1035774"
FT                   /note="gene_id=mCG1035774.0 transcript_id=mCT153478.0
FT                   protein_id=mCP73712.0"
FT                   /protein_id="EDL10780.1"
FT                   /translation="MGLLSYTGPHLVLFFLMATVFIIGLLGNTTLLFLIATDSRLHTPM
FT                   YFLLSQLSLLDVGFPLVTIPKVVAEFLQGQNVISFGGCATQMFFLMLMGVSEGVLLSLM
FT                   SYDRYVAVCHPLHYQVLMRNQVCLVMVGASWFSGALVASILTSITLQFPYCASHTVDHF
FT                   FCEMPALLKLSCADTSAYELALSISGVLILLLPLSLIFISYGHVLGAVLLMRSAEARHK
FT                   AFTTCSSHVTVVGLFFGAAVFIYMVPGSYHSPKQDNVVSLFYSLITPTLNPLIYSLRNR
FT                   EVRMSLVKFMGRSDFKVKG"
FT   gene            <241490..>242431
FT                   /locus_tag="mCG_1035775"
FT                   /note="gene_id=mCG1035775.0"
FT   mRNA            <241490..>242431
FT                   /locus_tag="mCG_1035775"
FT                   /product="mCG1035775"
FT                   /note="gene_id=mCG1035775.0 transcript_id=mCT153479.0
FT                   created on 10-OCT-2002"
FT   CDS             241490..242431
FT                   /codon_start=1
FT                   /locus_tag="mCG_1035775"
FT                   /product="mCG1035775"
FT                   /note="gene_id=mCG1035775.0 transcript_id=mCT153479.0
FT                   protein_id=mCP73724.0"
FT                   /db_xref="GOA:Q7TRY0"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3030208"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TRY0"
FT                   /protein_id="EDL10781.1"
FT                   /translation="MEGANLSGVSEFLLLGLSQDPRQQQLLFSAFLSMYLLTGLGNLLI
FT                   ILAIAADPRLHTPMYFFLANLAFVDVCFTSTTIPKMLANHVSGHKGISYSGCLTQMFFF
FT                   IWFAGIDSFLLTAMAYDRFVAICHPLHYTTSITPRLCGFLVTASWASAFANALTHTVLL
FT                   TRLLFCGHNQVPHFFCDLSPLLKLACSDTSLNDIMVYTVGALPIITPFVGILTSYTRIF
FT                   TAVLRIPSTGGKWKAFSTCGSHLSVVSLFYGTLIGVYFSPTSSHTAQKDTAAAVMYTVV
FT                   TPMMNPFIYTLRNKDMKGALMTFVRRTAVLVR"
FT   gene            267198..284834
FT                   /gene="Tpm4"
FT                   /locus_tag="mCG_17158"
FT                   /note="gene_id=mCG17158.1"
FT   mRNA            join(267198..267373,270512..270645,275378..275495,
FT                   276606..276676,278336..278411,278941..279003,
FT                   279082..279151,283443..284834)
FT                   /gene="Tpm4"
FT                   /locus_tag="mCG_17158"
FT                   /product="tropomyosin 4"
FT                   /note="gene_id=mCG17158.1 transcript_id=mCT16471.1 created
FT                   on 09-OCT-2002"
FT   CDS             join(267242..267373,270512..270645,275378..275495,
FT                   276606..276676,278336..278411,278941..279003,
FT                   279082..279151,283443..283525)
FT                   /codon_start=1
FT                   /gene="Tpm4"
FT                   /locus_tag="mCG_17158"
FT                   /product="tropomyosin 4"
FT                   /note="gene_id=mCG17158.1 transcript_id=mCT16471.1
FT                   protein_id=mCP14572.2"
FT                   /protein_id="EDL10782.1"
FT                   /translation="MAGLNSLEAVKRKIQALQQQADDAEDRAQGLQRELDGERERREKA
FT                   EGDAAALNRRIQLLEEELDRAQEQLATALQNLEEAEKAADESERGMKVIENRAMKDEEK
FT                   MEILEMQLKEAKHITDEADRKYEEVARKLVILEGELKRAEERAEVSELKCGDLEEELKN
FT                   VTNNLKSLEAASEKYSEKEDKYEEEIKLLSDKLKEAETRAEFAERTVSKLEKTIDDLEE
FT                   KLAQAKEENVGLHQTLDQTLNELNCI"
FT   gene            complement(279485..292576)
FT                   /locus_tag="mCG_147381"
FT                   /note="gene_id=mCG147381.0"
FT   mRNA            complement(join(279485..280208,292331..292576))
FT                   /locus_tag="mCG_147381"
FT                   /product="mCG147381"
FT                   /note="gene_id=mCG147381.0 transcript_id=mCT187644.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(join(280173..280208,292331..292486))
FT                   /codon_start=1
FT                   /locus_tag="mCG_147381"
FT                   /product="mCG147381"
FT                   /note="gene_id=mCG147381.0 transcript_id=mCT187644.0
FT                   protein_id=mCP109272.0"
FT                   /protein_id="EDL10783.1"
FT                   /translation="MLLRRIFGGGKVARVKMCCRLAPRSWRPPLDLLRCCTGKPAIAVG
FT                   YPRASAPKRAMWTSFFHW"
FT   gene            292985..313310
FT                   /gene="Rab8a"
FT                   /locus_tag="mCG_17157"
FT                   /note="gene_id=mCG17157.2"
FT   mRNA            join(292985..293201,300324..300384,303137..303197,
FT                   306413..306490,311958..313310)
FT                   /gene="Rab8a"
FT                   /locus_tag="mCG_17157"
FT                   /product="RAB8A, member RAS oncogene family, transcript
FT                   variant mCT174280"
FT                   /note="gene_id=mCG17157.2 transcript_id=mCT174280.0 created
FT                   on 09-OCT-2002"
FT   mRNA            join(292985..293201,300324..300384,303137..303197,
FT                   306413..306490,307727..307816,309507..309557,
FT                   311958..312508)
FT                   /gene="Rab8a"
FT                   /locus_tag="mCG_17157"
FT                   /product="RAB8A, member RAS oncogene family, transcript
FT                   variant mCT174282"
FT                   /note="gene_id=mCG17157.2 transcript_id=mCT174282.0 created
FT                   on 09-OCT-2002"
FT   mRNA            join(293034..293201,300324..300384,303137..303176,
FT                   312376..312580)
FT                   /gene="Rab8a"
FT                   /locus_tag="mCG_17157"
FT                   /product="RAB8A, member RAS oncogene family, transcript
FT                   variant mCT174281"
FT                   /note="gene_id=mCG17157.2 transcript_id=mCT174281.0 created
FT                   on 09-OCT-2002"
FT   mRNA            join(293039..293201,300324..300384,303137..303197,
FT                   306413..306490,307727..307816,308210..308275,
FT                   309507..309557,311958..313273)
FT                   /gene="Rab8a"
FT                   /locus_tag="mCG_17157"
FT                   /product="RAB8A, member RAS oncogene family, transcript
FT                   variant mCT16470"
FT                   /note="gene_id=mCG17157.2 transcript_id=mCT16470.1 created
FT                   on 09-OCT-2002"
FT   CDS             join(293078..293201,300324..300384,303137..303176,
FT                   312376..312420)
FT                   /codon_start=1
FT                   /gene="Rab8a"
FT                   /locus_tag="mCG_17157"
FT                   /product="RAB8A, member RAS oncogene family, isoform CRA_c"
FT                   /note="gene_id=mCG17157.2 transcript_id=mCT174281.0
FT                   protein_id=mCP97199.0 isoform=CRA_c"
FT                   /protein_id="EDL10786.1"
FT                   /translation="MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDF
FT                   KIRTIELDGKRIKLQIWDTAGQERFRTITTPAWPPYSKHHHRGH"
FT   CDS             join(293078..293201,300324..300384,303137..303197,
FT                   306413..306490,307727..307816,308210..308275,
FT                   309507..309557,311958..312050)
FT                   /codon_start=1
FT                   /gene="Rab8a"
FT                   /locus_tag="mCG_17157"
FT                   /product="RAB8A, member RAS oncogene family, isoform CRA_a"
FT                   /note="gene_id=mCG17157.2 transcript_id=mCT16470.1
FT                   protein_id=mCP14571.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q0PD50"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:96960"
FT                   /db_xref="UniProtKB/TrEMBL:Q0PD50"
FT                   /protein_id="EDL10784.1"
FT                   /translation="MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDF
FT                   KIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIR
FT                   NIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFF
FT                   TLARDIKAKMDKKLEGNSPQGSSHGVKITVEQQKRTSFFRCSLL"
FT   CDS             join(293078..293201,300324..300384,303137..303197,
FT                   306413..306490,307727..307816,309507..309557,
FT                   311958..312050)
FT                   /codon_start=1
FT                   /gene="Rab8a"
FT                   /locus_tag="mCG_17157"
FT                   /product="RAB8A, member RAS oncogene family, isoform CRA_d"
FT                   /note="gene_id=mCG17157.2 transcript_id=mCT174282.0
FT                   protein_id=mCP97201.0 isoform=CRA_d"
FT                   /protein_id="EDL10787.1"
FT                   /translation="MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDF
FT                   KIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIR
FT                   NIEEHASADVEKMILGNKCDVNDKRQVSKERGEKAFFTLARDIKAKMDKKLEGNSPQGS
FT                   SHGVKITVEQQKRTSFFRCSLL"
FT   CDS             join(293078..293201,300324..300384,303137..303197,
FT                   306413..306490,311958..312050)
FT                   /codon_start=1
FT                   /gene="Rab8a"
FT                   /locus_tag="mCG_17157"
FT                   /product="RAB8A, member RAS oncogene family, isoform CRA_b"
FT                   /note="gene_id=mCG17157.2 transcript_id=mCT174280.0
FT                   protein_id=mCP97200.0 isoform=CRA_b"
FT                   /protein_id="EDL10785.1"
FT                   /translation="MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDF
FT                   KIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIR
FT                   NIEEEGNSPQGSSHGVKITVEQQKRTSFFRCSLL"
FT   gene            321588..>332689
FT                   /gene="Hsh2d"
FT                   /locus_tag="mCG_17160"
FT                   /note="gene_id=mCG17160.1"
FT   mRNA            join(321588..321608,325356..325502,328713..328802,
FT                   329656..329821,330285..330404,332186..>332689)
FT                   /gene="Hsh2d"
FT                   /locus_tag="mCG_17160"
FT                   /product="hematopoietic SH2 domain containing"
FT                   /note="gene_id=mCG17160.1 transcript_id=mCT16473.1 created
FT                   on 10-OCT-2002"
FT   CDS             join(325378..325502,328713..328802,329656..329821,
FT                   330285..330404,332186..332689)
FT                   /codon_start=1
FT                   /gene="Hsh2d"
FT                   /locus_tag="mCG_17160"
FT                   /product="hematopoietic SH2 domain containing"
FT                   /note="gene_id=mCG17160.1 transcript_id=mCT16473.1
FT                   protein_id=mCP14569.2"
FT                   /protein_id="EDL10788.1"
FT                   /translation="MAEARRLPPPLPPRLDWFVHTQADLLAQSGIPEWFHGTISREAAE
FT                   NMLESQPLGTFLIRVSHSHVGYTLSYKAQTCCRHFMVKLSEDGTCAFAGDHMTHASLHA
FT                   LVTFHQQKPIRPFGELLTQACGQEDPANVDYEDLFLYSNALVQDAESQILRTEVQRSSC
FT                   PPEEASERKPSTTTKGEFASASCSPKALFEDSGQKLWKNLRSLPQTSQRVKQRLTSHLL
FT                   AMNLLGDARQVAQQHHSPVTRAFSWDSTSHSEDSCAATTSLQNPAEPQALRGREATFRD
FT                   SRPASWRKAFSGVKAWRGKVVRALSAQEPVDFPEAQGWLPEEYLPPPPFAPGY"
FT   gene            complement(336243..>343040)
FT                   /locus_tag="mCG_17159"
FT                   /note="gene_id=mCG17159.1"
FT   mRNA            complement(join(336243..336339,337472..337667,
FT                   339036..339183,343002..>343040))
FT                   /locus_tag="mCG_17159"
FT                   /product="mCG17159"
FT                   /note="gene_id=mCG17159.1 transcript_id=mCT16472.1 created
FT                   on 10-OCT-2002"
FT   CDS             complement(join(336318..336339,337472..337667,
FT                   339036..339183,343002..>343040))
FT                   /codon_start=1
FT                   /locus_tag="mCG_17159"
FT                   /product="mCG17159"
FT                   /note="gene_id=mCG17159.1 transcript_id=mCT16472.1
FT                   protein_id=mCP14568.1"
FT                   /protein_id="EDL10789.1"
FT                   /translation="VPYELIGSMPELKDNPFRQRIAQVFSQDGDGHMTLENFLDMFSVM
FT                   SEMAPRDLKAYYAFKIYDFNNDNYICAWDLEQTVTRLTRGELSAEEVTLVCEKVLDEAD
FT                   GDQDGRLSLEDFQNMILRAPDFLSTFHIRI"
FT   assembly_gap    341106..341125
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <352329..356026
FT                   /gene="2510049I19Rik"
FT                   /locus_tag="mCG_17161"
FT                   /note="gene_id=mCG17161.3"
FT   mRNA            join(<352329..352457,352538..352679,354525..354666,
FT                   354778..356025)
FT                   /gene="2510049I19Rik"
FT                   /locus_tag="mCG_17161"
FT                   /product="RIKEN cDNA 2510049I19, transcript variant
FT                   mCT190392"
FT                   /note="gene_id=mCG17161.3 transcript_id=mCT190392.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<352329..352457,352538..352679,354525..354666,
FT                   354778..354883)
FT                   /codon_start=1
FT                   /gene="2510049I19Rik"
FT                   /locus_tag="mCG_17161"
FT                   /product="RIKEN cDNA 2510049I19, isoform CRA_c"
FT                   /note="gene_id=mCG17161.3 transcript_id=mCT190392.0
FT                   protein_id=mCP111364.0 isoform=CRA_c"
FT                   /protein_id="EDL10792.1"
FT                   /translation="TVCKQEVWRSSRGTACERYGGLRASPEGPPEAERRGRARRDKAEE
FT                   EEERQRQGQDAGGHGDEQEERGGEKALPGQAHAGAGSLRKDAGEAANGKNPEEGIKNPQ
FT                   TESGGEPCTCQQTEPWGVARAQTVQLGLLEPTLRTSTDTWIHSLSTMTFPKSAGPSNLP
FT                   LVQKGRRPG"
FT   mRNA            join(352331..352457,352538..352585,355249..355548)
FT                   /gene="2510049I19Rik"
FT                   /locus_tag="mCG_17161"
FT                   /product="RIKEN cDNA 2510049I19, transcript variant
FT                   mCT174283"
FT                   /note="gene_id=mCG17161.3 transcript_id=mCT174283.0 created
FT                   on 09-OCT-2002"
FT   mRNA            join(352341..352457,352538..352679,354525..354578,
FT                   354778..356026)
FT                   /gene="2510049I19Rik"
FT                   /locus_tag="mCG_17161"
FT                   /product="RIKEN cDNA 2510049I19, transcript variant
FT                   mCT16474"
FT                   /note="gene_id=mCG17161.3 transcript_id=mCT16474.1 created
FT                   on 09-OCT-2002"
FT   CDS             join(352384..352457,352538..352585,355249..355327)
FT                   /codon_start=1
FT                   /gene="2510049I19Rik"
FT                   /locus_tag="mCG_17161"
FT                   /product="RIKEN cDNA 2510049I19, isoform CRA_b"
FT                   /note="gene_id=mCG17161.3 transcript_id=mCT174283.0
FT                   protein_id=mCP97202.0 isoform=CRA_b"
FT                   /protein_id="EDL10791.1"
FT                   /translation="MEAYEQVQKGPLKLKGVAELGVTKRKKKKKDKDKAKMLEAIGTQD
FT                   TGLQHIACPTVHPVDCHGRCC"
FT   CDS             join(352384..352457,352538..352679,354525..354578,
FT                   354778..354846)
FT                   /codon_start=1
FT                   /gene="2510049I19Rik"
FT                   /locus_tag="mCG_17161"
FT                   /product="RIKEN cDNA 2510049I19, isoform CRA_a"
FT                   /note="gene_id=mCG17161.3 transcript_id=mCT16474.1
FT                   protein_id=mCP14570.1 isoform=CRA_a"
FT                   /protein_id="EDL10790.1"
FT                   /translation="MEAYEQVQKGPLKLKGVAELGVTKRKKKKKDKDKAKMLEAMGTSK
FT                   KSEEEKRRCLDKRTPAQAAFEKMQEKRQMERILKKASKTHKQRVEDFNRHLDTLTEHYD
FT                   IPKVSWTK"
FT   assembly_gap    357891..357910
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            358968..376401
FT                   /gene="Ap1m1"
FT                   /locus_tag="mCG_118299"
FT                   /note="gene_id=mCG118299.0"
FT   mRNA            join(358968..359082,365485..365641,367959..368026,
FT                   368595..368725,369527..369674,370769..370895,
FT                   371863..372005,372237..372308,372503..372661,
FT                   374753..374878,375163..375238,375758..376401)
FT                   /gene="Ap1m1"
FT                   /locus_tag="mCG_118299"
FT                   /product="adaptor-related protein complex AP-1, mu subunit
FT                   1"
FT                   /note="gene_id=mCG118299.0 transcript_id=mCT119452.0
FT                   created on 10-OCT-2002"
FT   CDS             join(359041..359082,365485..365641,367959..368026,
FT                   368595..368725,369527..369674,370769..370895,
FT                   371863..372005,372237..372308,372503..372661,
FT                   374753..374878,375163..375238,375758..375780)
FT                   /codon_start=1
FT                   /gene="Ap1m1"
FT                   /locus_tag="mCG_118299"
FT                   /product="adaptor-related protein complex AP-1, mu subunit
FT                   1"
FT                   /note="gene_id=mCG118299.0 transcript_id=mCT119452.0
FT                   protein_id=mCP74165.1"
FT                   /db_xref="GOA:Q3UG16"
FT                   /db_xref="InterPro:IPR001392"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="InterPro:IPR018240"
FT                   /db_xref="InterPro:IPR022775"
FT                   /db_xref="InterPro:IPR028565"
FT                   /db_xref="MGI:MGI:102776"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UG16"
FT                   /protein_id="EDL10793.1"
FT