spacer

EBI Dbfetch

ID   CH466524; SV 1; linear; genomic DNA; CON; MUS; 61163717 BP.
XX
AC   CH466524;
XX
PR   Project:PRJNA11785;
XX
DT   04-AUG-2005 (Rel. 84, Created)
DT   10-JUN-2007 (Rel. 92, Last updated, Version 7)
XX
DE   Mus musculus 232000009833416 genomic scaffold, whole genome shotgun
DE   sequence.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-61163717
RX   DOI; 10.1126/science.1069193.
RX   PUBMED; 12040188.
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Miklos G.L., Wides R.,
RA   Halpern A., Li P.W., Sutton G.G., Nadeau J., Salzberg S.L., Holt R.A.,
RA   Kodira C.D., Lu F., Chen L., Deng Z., Evangelista C.C., Gan W.,
RA   Heiman T.J., Li J., Li Z., Merkulov G.V., Milshina N.V., Naik A.K., Qi R.,
RA   Shue B.C., Wang A., Wang J., Wang X., Yan X., Ye J., Yooseph S., Zhao Q.,
RA   Zheng L., Zhu S.C., Biddick K., Bolanos R., Delcher A.L., Dew I.M.,
RA   Fasulo D., Flanigan M.J., Huson D.H., Kravitz S.A., Miller J.R.,
RA   Mobarry C.M., Reinert K., Remington K.A., Zhang Q., Zheng X.H.,
RA   Nusskern D.R., Lai Z., Lei Y., Zhong W., Yao A., Guan P., Ji R.R., Gu Z.,
RA   Wang Z.Y., Zhong F., Xiao C., Chiang C.C., Yandell M., Wortman J.R.,
RA   Amanatides P.G., Hladun S.L., Pratts E.C., Johnson J.E., Dodson K.L.,
RA   Woodford K.J., Evans C.A., Gropman B., Rusch D.B., Venter E., Wang M.,
RA   Smith T.J., Houck J.T., Tompkins D.E., Haynes C., Jacob D., Chin S.H.,
RA   Allen D.R., Dahlke C.E., Sanders R., Li K., Liu X., Levitsky A.A.,
RA   Majoros W.H., Chen Q., Xia A.C., Lopez J.R., Donnelly M.T., Newman M.H.,
RA   Glodek A., Kraft C.L., Nodell M., Ali F., An H.J., Baldwin-Pitts D.,
RA   Beeson K.Y., Cai S., Carnes M., Carver A., Caulk P.M., Center A.,
RA   Chen Y.H., Cheng M.L., Coyne M.D., Crowder M., Danaher S., Davenport L.B.,
RA   Desilets R., Dietz S.M., Doup L., Dullaghan P., Ferriera S., Fosler C.R.,
RA   Gire H.C., Gluecksmann A., Gocayne J.D., Gray J., Hart B., Haynes J.,
RA   Hoover J., Howland T., Ibegwam C., Jalali M., Johns D., Kline L., Ma D.S.,
RA   MacCawley S., Magoon A., Mann F., May D., McIntosh T.C., Mehta S., Moy L.,
RA   Moy M.C., Murphy B.J., Murphy S.D., Nelson K.A., Nuri Z., Parker K.A.,
RA   Prudhomme A.C., Puri V.N., Qureshi H., Raley J.C., Reardon M.S.,
RA   Regier M.A., Rogers Y.H., Romblad D.L., Schutz J., Scott J.L., Scott R.,
RA   Sitter C.D., Smallwood M., Sprague A.C., Stewart E., Strong R.V., Suh E.,
RA   Sylvester K., Thomas R., Tint N.N., Tsonis C., Wang G., Wang G.,
RA   Williams M.S., Williams S.M., Windsor S.M., Wolfe K., Wu M.M., Zaveri J.,
RA   Chaturvedi K., Gabrielian A.E., Ke Z., Sun J., Subramanian G., Venter J.C.,
RA   Pfannkoch C.M., Barnstead M., Stephenson L.D.;
RT   "A comparison of whole-genome shotgun-derived mouse chromosome 16 and the
RT   human genome";
RL   Science 296(5573):1661-1671(2002).
XX
RN   [2]
RP   1-61163717
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (05-JUL-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
DR   MD5; 261a943bcabf22138051af11b4399b9a.
DR   ENA; AAHY010000000; SET.
DR   ENA; AAHY000000000; SET.
DR   ENA-CON; CM000213.
DR   Ensembl-Gn; ENSMUSG00000000560; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000001260; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000001566; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000004642; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000005103; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000005107; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000005220; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000006641; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000013622; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000013629; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000014932; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000023452; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025746; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025747; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029086; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029088; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029093; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029097; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029103; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029104; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029108; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029127; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029130; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029131; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029138; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029141; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029145; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029146; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029167; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029169; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029176; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029177; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029178; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029191; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029192; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029196; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029201; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029203; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029204; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029205; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029211; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029212; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029213; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029219; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029228; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029236; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029246; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029247; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029248; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029253; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029255; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029260; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029272; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000035811; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000035836; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000036435; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000036553; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000036596; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000036693; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000037355; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000037685; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038552; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038676; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039095; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039106; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039156; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039358; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039474; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000044827; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000045302; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000046572; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000047215; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000048450; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000049691; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000051498; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000051674; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000052783; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000053839; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000053856; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000054252; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000054520; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000054630; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000054892; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000054920; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000057425; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000060288; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000060636; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000061535; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000061906; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000062960; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000064037; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000067285; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000067367; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000070704; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000075703; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000085720; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000089992; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000090262; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000093574; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000000572; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000001112; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000005234; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000005238; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000005352; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000006817; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000012734; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000013693; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000013766; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000013773; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000026845; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000026846; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030980; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030986; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031020; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031061; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031072; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031073; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031092; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031097; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031103; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031106; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031108; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031119; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031121; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031122; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031127; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031146; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031160; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031161; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031170; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031181; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031183; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031186; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031201; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000036177; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000036227; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000037370; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000037380; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000038676; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000039744; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000041266; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000041364; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000041646; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000043475; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000043964; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000053876; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000056458; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000057258; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000057551; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000057885; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000059349; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000060820; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000061895; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000062315; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000063116; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000066505; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000066544; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000067150; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000067638; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000067790; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000068110; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000070203; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000072311; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000072818; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000074113; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000074840; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000075858; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000076939; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000076949; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000077693; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000078804; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000080036; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000080431; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000087181; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000087332; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000087395; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000087441; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000087514; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000087820; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000087864; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000088063; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000094649; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000094783; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000101191; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000101215; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000101316; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000101354; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106318; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106321; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113327; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113372; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113516; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114106; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114533; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114603; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114665; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114668; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115075; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115076; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115078; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115079; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000117525; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000117536; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000117661; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000117880; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000118545; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000120094; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000120591; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000120912; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000121872; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000123207; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000124036; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000126267; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000130417; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000130721; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000132190; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000132404; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000132734; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000133316; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000134521; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000134846; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000140076; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000140650; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000141823; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000142407; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000143436; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000144673; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000145858; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000146401; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000147145; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000152066; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000154975; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000155300; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000160383; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000165512; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000165536; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000166409; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000166769; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000166924; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000167460; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000167522; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000168707; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000169212; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000169534; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000172363; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000172435; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000175660; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000176191; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000176978; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000179555; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000179943; mus_musculus.
XX
CC   This is the July 2001 combined whole genome shotgun assembly of Mus
CC   musculus. It contains 27 million Celera reads on four Mus musculus
CC   strains (129X1/SvJ, 129S1/SvImJ, DBA/2J and A/J), 13 million reads
CC   on C57BL/6J from the NCBI Trace Archive, 0.4 million BAC end
CC   sequences from TIGR, and unfinished and finished BACs pulled from
CC   NCBI (Nature 2002. 420:520-562). The assembly process relied on
CC   Celera's paired reads and BAC end reads for long range order and
CC   orientation. Its scaffolds were mapped to chromosomes using STS
CC   maps. For more detailed information about whole genome sequencing
CC   and Celera's assembly process, please refer to Venter, J.C. et al.
CC   Science 2001. 291:1304-1351.
CC   This version of genes, transcripts, and proteins was
CC   computationally created in November 2001 from the whole-genome
CC   mapping of transcript and protein sequences on the Celera mouse
CC   genome assembly by Celera Chromosome Team and Content Systems.  The
CC   data sets used by this annotation process were collected in 2001
CC   and include RefSeq (NM_ from mouse and human) sequences, GenBank
CC   mRNA and dbEST sequences, mammalian SwissProt sequences,  and NRAA
CC   sequences (all mouse unless noted otherwise).  The initial gene set
CC   was manually curated between 2002 and 2003. Subsequently, automated
CC   annotation updates were performed.  The CDS of each transcript was
CC   manually or computationally defined by either the longest
CC   ATG-to-Stop or the longest open reading frame. All CDSs
CC   corresponding to the longest open reading frames with no starting
CC   ATG were flagged as partial.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..61163717
FT                   /organism="Mus musculus"
FT                   /chromosome="5"
FT                   /strain="mixed"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   gene            <1289..3427
FT                   /locus_tag="mCG_113006"
FT                   /note="gene_id=mCG113006.0"
FT   mRNA            join(<1289..1434,2070..2253,2994..3427)
FT                   /locus_tag="mCG_113006"
FT                   /product="mCG113006"
FT                   /note="gene_id=mCG113006.0 transcript_id=mCT114083.0
FT                   created on 01-OCT-2002"
FT   CDS             join(<1289..1434,2070..2253,2994..3170)
FT                   /codon_start=1
FT                   /locus_tag="mCG_113006"
FT                   /product="mCG113006"
FT                   /note="gene_id=mCG113006.0 transcript_id=mCT114083.0
FT                   protein_id=mCP64658.0"
FT                   /protein_id="EDL37212.1"
FT                   /translation="RPYHRQTRHYKELKLKEKEIMTYLHDLEMKNMEARENNQELKKEK
FT                   NFYRNLHTRILLGENLIKKKLAILQQESKEIHADWAIIQQRLVELNLSGKDEQEKTSNL
FT                   EAQENQVSEAARKLGLATAEEDSILQNELPCQEAPAEHHPQHPPSSSDESSSDESSYST
FT                   CPSWE"
FT   gene            145920..151577
FT                   /locus_tag="mCG_113008"
FT                   /note="gene_id=mCG113008.0"
FT   mRNA            join(145920..146135,147123..147282,148553..148684,
FT                   149320..149503,150247..151577)
FT                   /locus_tag="mCG_113008"
FT                   /product="mCG113008, transcript variant mCT114085"
FT                   /note="gene_id=mCG113008.0 transcript_id=mCT114085.0
FT                   created on 01-OCT-2002"
FT   CDS             join(145997..146135,147123..147282,148553..148684,
FT                   149320..149503,150247..150423)
FT                   /codon_start=1
FT                   /locus_tag="mCG_113008"
FT                   /product="mCG113008, isoform CRA_a"
FT                   /note="gene_id=mCG113008.0 transcript_id=mCT114085.0
FT                   protein_id=mCP64674.1 isoform=CRA_a"
FT                   /protein_id="EDL37213.1"
FT                   /translation="MALFARLCRLFQRANVDGRETREGRKDAGLPSERNEGRRRGTWRM
FT                   WMAHRQTTSPVPVTSKKQFEKEEKELIKKIQLTTEETNELRDRLIYVTEGSMNKRQTRH
FT                   YKELKLKEKEIMTFLNDLEMENMEARENNQELKKEKNFYRNLHSRILLEENLIKKKLAI
FT                   LQQESKEIQADWAIIHQLLVELNLSGKDEQEKTSNLETQEHQVSEAARELGLATAEEDS
FT                   ILQKELPCQEAPAEHHPQHPPSSSDESSSDESSYSTCPEWE"
FT   mRNA            join(<148553..148684,150247..151577)
FT                   /locus_tag="mCG_113008"
FT                   /product="mCG113008, transcript variant mCT174525"
FT                   /note="gene_id=mCG113008.0 transcript_id=mCT174525.0
FT                   created on 01-OCT-2002"
FT   CDS             join(<148554..148684,150247..150448)
FT                   /codon_start=1
FT                   /locus_tag="mCG_113008"
FT                   /product="mCG113008, isoform CRA_b"
FT                   /note="gene_id=mCG113008.0 transcript_id=mCT174525.0
FT                   protein_id=mCP97444.0 isoform=CRA_b"
FT                   /protein_id="EDL37214.1"
FT                   /translation="QTRHYKELKLKEKEIMTFLNDLEMENMEARENNQELKKEKNFYRS
FT                   QKLQESWDWPQLKKTASCRRSCHARRPLLSTIPSTHHLPRMNLPQMNLLIAHVLSGNRP
FT                   YRGSHG"
FT   gene            241921..243715
FT                   /pseudo
FT                   /locus_tag="mCG_12038"
FT                   /note="gene_id=mCG12038.1"
FT   mRNA            241921..243715
FT                   /pseudo
FT                   /locus_tag="mCG_12038"
FT                   /note="gene_id=mCG12038.1 transcript_id=mCT12420.1 created
FT                   on 01-OCT-2002"
FT   gene            complement(339298..>372358)
FT                   /locus_tag="mCG_1046109"
FT                   /note="gene_id=mCG1046109.2"
FT   mRNA            complement(join(339298..339592,358762..359132,
FT                   362333..362468,369628..369702,372285..>372358))
FT                   /locus_tag="mCG_1046109"
FT                   /product="mCG1046109, transcript variant mCT180213"
FT                   /note="gene_id=mCG1046109.2 transcript_id=mCT180213.0
FT                   created on 18-FEB-2003"
FT   mRNA            complement(join(339300..339592,358762..358910,
FT                   369424..369702,372285..>372324))
FT                   /locus_tag="mCG_1046109"
FT                   /product="mCG1046109, transcript variant mCT174531"
FT                   /note="gene_id=mCG1046109.2 transcript_id=mCT174531.0
FT                   created on 18-FEB-2003"
FT   CDS             complement(join(339472..339592,358762..358910,
FT                   369424..>369528))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1046109"
FT                   /product="mCG1046109, isoform CRA_a"
FT                   /note="gene_id=mCG1046109.2 transcript_id=mCT174531.0
FT                   protein_id=mCP97450.0 isoform=CRA_a"
FT                   /protein_id="EDL37215.1"
FT                   /translation="EVTVMIMGIPSSEGSRDHCSGLGFKTRRVSRDSFKDEPSKSPKDT
FT                   RMYPETKSPTQNVQTQRFWHQELLELLFMEVQEVPPNNISDLGNHILLLLAVPFSLSSS
FT                   LCRNHPRDCMPRTGESLQVI"
FT   CDS             complement(join(339472..339592,358762..>358916))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1046109"
FT                   /product="mCG1046109, isoform CRA_b"
FT                   /note="gene_id=mCG1046109.2 transcript_id=mCT180213.0
FT                   protein_id=mCP103135.0 isoform=CRA_b"
FT                   /protein_id="EDL37216.1"
FT                   /translation="SQDEPSKSPKDTRMYPETKSPTQNVQTQRFWHQELLELLFMEVQE
FT                   VPPNNISDLGNHILLLLAVPFSLSSSLCRNHPRDCMPRTGESLQVI"
FT   mRNA            complement(join(353970..354370,358762..359132,
FT                   372285..>372334))
FT                   /locus_tag="mCG_1046109"
FT                   /product="mCG1046109, transcript variant mCT163813"
FT                   /note="gene_id=mCG1046109.2 transcript_id=mCT163813.0
FT                   created on 18-FEB-2003"
FT   CDS             complement(354084..>354341)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1046109"
FT                   /product="mCG1046109, isoform CRA_c"
FT                   /note="gene_id=mCG1046109.2 transcript_id=mCT163813.0
FT                   protein_id=mCP65111.0 isoform=CRA_c"
FT                   /protein_id="EDL37217.1"
FT                   /translation="ESRQYFKRKRLKSTHDPNPPITATSSSPLHIELNSVTVTVVCCFE
FT                   RHTSPCPVLAHPPHSQPPQATLLSVPCPLPAMAVSPSSHG"
FT   gene            complement(708921..709340)
FT                   /pseudo
FT                   /locus_tag="mCG_61063"
FT                   /note="gene_id=mCG61063.2"
FT   mRNA            complement(708921..709340)
FT                   /pseudo
FT                   /locus_tag="mCG_61063"
FT                   /note="gene_id=mCG61063.2 transcript_id=mCT61246.2 created
FT                   on 14-OCT-2002"
FT   gene            complement(886973..888600)
FT                   /pseudo
FT                   /locus_tag="mCG_1046046"
FT                   /note="gene_id=mCG1046046.1"
FT   mRNA            complement(join(886973..887343,888265..888600))
FT                   /pseudo
FT                   /locus_tag="mCG_1046046"
FT                   /note="gene_id=mCG1046046.1 transcript_id=mCT163750.1
FT                   created on 14-OCT-2002"
FT   gene            930717..930945
FT                   /pseudo
FT                   /locus_tag="mCG_141313"
FT                   /note="gene_id=mCG141313.0"
FT   mRNA            930717..930945
FT                   /pseudo
FT                   /locus_tag="mCG_141313"
FT                   /note="gene_id=mCG141313.0 transcript_id=mCT174532.0
FT                   created on 14-OCT-2002"
FT   gene            <1141429..1604623
FT                   /gene="Dpp6"
FT                   /locus_tag="mCG_113122"
FT                   /note="gene_id=mCG113122.2"
FT   mRNA            join(<1141429..1141706,1256417..1256531,1272598..1272696,
FT                   1324213..1324307,1346059..1346133,1414871..1414923,
FT                   1434988..1435069,1476210..1476330,1508829..1508983,
FT                   1511959..1512056,1529842..1529965,1531365..1531403,
FT                   1539258..1539365,1541101..1541192,1542386..1542433,
FT                   1544061..1544179,1574495..1574542,1587067..1587165,
FT                   1590225..1590294,1592024..1592218,1596114..1596168,
FT                   1598713..1598824,1600341..1600399,1601040..1601112,
FT                   1601209..1601282,1603276..1604152)
FT                   /gene="Dpp6"
FT                   /locus_tag="mCG_113122"
FT                   /product="dipeptidylpeptidase 6, transcript variant
FT                   mCT193625"
FT                   /note="gene_id=mCG113122.2 transcript_id=mCT193625.0
FT                   created on 09-MAR-2004"
FT   mRNA            join(<1141430..1141706,1256417..1256531,1272598..1272696,
FT                   1324213..1324307,1346059..1346133,1414871..1414923,
FT                   1434988..1435069,1476210..1476330,1508829..1508983,
FT                   1511959..1512056,1529842..1529965,1539258..1539365,
FT                   1541101..1541192,1542386..1542433,1544061..1544179,
FT                   1574495..1574542,1587067..1587165,1590225..1590294,
FT                   1592024..1592218,1596114..1596168,1598713..1598824,
FT                   1600341..1600399,1601040..1601112,1601209..1601282,
FT                   1603276..1604623)
FT                   /gene="Dpp6"
FT                   /locus_tag="mCG_113122"
FT                   /product="dipeptidylpeptidase 6, transcript variant
FT                   mCT114200"
FT                   /note="gene_id=mCG113122.2 transcript_id=mCT114200.1
FT                   created on 01-OCT-2002"
FT   CDS             join(<1141533..1141706,1256417..1256531,1272598..1272696,
FT                   1324213..1324307,1346059..1346133,1414871..1414923,
FT                   1434988..1435069,1476210..1476330,1508829..1508983,
FT                   1511959..1512056,1529842..1529965,1531365..1531403,
FT                   1539258..1539365,1541101..1541192,1542386..1542433,
FT                   1544061..1544179,1574495..1574542,1587067..1587165,
FT                   1590225..1590294,1592024..1592218,1596114..1596168,
FT                   1598713..1598824,1600341..1600399,1601040..1601112,
FT                   1601209..1601282,1603276..1603422)
FT                   /codon_start=1
FT                   /gene="Dpp6"
FT                   /locus_tag="mCG_113122"
FT                   /product="dipeptidylpeptidase 6, isoform CRA_a"
FT                   /note="gene_id=mCG113122.2 transcript_id=mCT193625.0
FT                   protein_id=mCP114557.0 isoform=CRA_a"
FT                   /protein_id="EDL37218.1"
FT                   /translation="FWKYGLESLSSSPYHSDPGASKVSVKPLLSLGWRVPGQTMTTAKE
FT                   PSASGKSVQQQDQELVGSNPPQRNWKGIAIALLVILVICSLIVTSVILLTPAEDTSLSQ
FT                   KKKVTVEDLFSEDFKIHDPEAKWISNKEFIYRERKGSVILRNVETNNSTVLIEGKKIES
FT                   LRAIRYEISPDKEYVLFSYNVEPVYQHSHTGYYVLSKIPHGDPQSLDPPEVSNAKLQYA
FT                   GWGPKGQQLIFIFENNIYYCAHVGKQAIRVVSTGKEGVIYNGLSDWLYEEEILKSHIAH
FT                   WWSPDGTRLAYATINDSRVPLMELPTYTGSVYPTVKPYHYPKAGSENPSISLHVIGLNG
FT                   PTHDLEMMPPDDPRMREYYITMVKWATSTKVAVTWLNRAQNVSILTLCDATTGVCTKKH
FT                   EDESEAWLHRQNEEPVFSKDGRKFFFVRAIPQGGRGKFYHITVSSSQPNSSNDNIQSIT
FT                   SGDWDVTKILSYDEKRNKIYFLSTEDLPRRRHLYSANTVDDFNRQCLSCDLVENCTYVS
FT                   ASFSHNMDFFLLKCEGPGVPTVTVHNTTDKRRMFDLEANEEVQKAINDRQMPKIEYRKI
FT                   EVEDYSLPMQILKPATFTDTAHYPLLLVVDGTPGSQSVTERFEVTWETVLVSSHGAVVV
FT                   KCDGRGSGFQGTKLLQEVRRRLGFLEEKDQMEAVRTMLKEQYIDKTRVAVFGKDYGGYL
FT                   STYILPAKGENQGQTFTCGSALSPITDFKLYASAFSERYLGLHGLDNRAYEMTKLAHRV
FT                   SALEDQQFLIIHATADEKIHFQHTAELITQLIKGKANYSLQIYPDESHYFHSVALKQHL
FT                   SRSIIGFFVECFRVQDKLPTATAKEEEEED"
FT   CDS             join(<1256417..1256531,1272598..1272696,1324213..1324307,
FT                   1346059..1346133,1414871..1414923,1434988..1435069,
FT                   1476210..1476330,1508829..1508983,1511959..1512056,
FT                   1529842..1529965,1539258..1539365,1541101..1541192,
FT                   1542386..1542433,1544061..1544179,1574495..1574542,
FT                   1587067..1587165,1590225..1590294,1592024..1592218,
FT                   1596114..1596168,1598713..1598824,1600341..1600399,
FT                   1601040..1601112,1601209..1601282,1603276..1603422)
FT                   /codon_start=1
FT                   /gene="Dpp6"
FT                   /locus_tag="mCG_113122"
FT                   /product="dipeptidylpeptidase 6, isoform CRA_b"
FT                   /note="gene_id=mCG113122.2 transcript_id=mCT114200.1
FT                   protein_id=mCP65324.1 isoform=CRA_b"
FT                   /protein_id="EDL37219.1"
FT                   /translation="ELVGSNPPQRNWKGIAIALLVILVICSLIVTSVILLTPAEDTSLS
FT                   QKKKVTVEDLFSEDFKIHDPEAKWISNKEFIYRERKGSVILRNVETNNSTVLIEGKKIE
FT                   SLRAIRYEISPDKEYVLFSYNVEPVYQHSHTGYYVLSKIPHGDPQSLDPPEVSNAKLQY
FT                   AGWGPKGQQLIFIFENNIYYCAHVGKQAIRVVSTGKEGVIYNGLSDWLYEEEILKSHIA
FT                   HWWSPDGTRLAYATINDSRVPLMELPTYTGSVYPTVKPYHYPKAGSENPSISLHVIGLN
FT                   GPTHDLEMMPPDDPRMREYYITMVKWATSTKVAVTWLNRAQNVSILTLCDATTGVCTKN
FT                   EEPVFSKDGRKFFFVRAIPQGGRGKFYHITVSSSQPNSSNDNIQSITSGDWDVTKILSY
FT                   DEKRNKIYFLSTEDLPRRRHLYSANTVDDFNRQCLSCDLVENCTYVSASFSHNMDFFLL
FT                   KCEGPGVPTVTVHNTTDKRRMFDLEANEEVQKAINDRQMPKIEYRKIEVEDYSLPMQIL
FT                   KPATFTDTAHYPLLLVVDGTPGSQSVTERFEVTWETVLVSSHGAVVVKCDGRGSGFQGT
FT                   KLLQEVRRRLGFLEEKDQMEAVRTMLKEQYIDKTRVAVFGKDYGGYLSTYILPAKGENQ
FT                   GQTFTCGSALSPITDFKLYASAFSERYLGLHGLDNRAYEMTKLAHRVSALEDQQFLIIH
FT                   ATADEKIHFQHTAELITQLIKGKANYSLQIYPDESHYFHSVALKQHLSRSIIGFFVECF
FT                   RVQDKLPTATAKEEEEED"
FT   mRNA            join(<1256498..1256531,1272598..1272696,1324213..1324307,
FT                   1346059..1346133,1434988..>1435072)
FT                   /gene="Dpp6"
FT                   /locus_tag="mCG_113122"
FT                   /product="dipeptidylpeptidase 6, transcript variant
FT                   mCT173992"
FT                   /note="gene_id=mCG113122.2 transcript_id=mCT173992.0
FT                   created on 01-OCT-2002"
FT   CDS             join(<1256498..1256531,1272598..1272696,1324213..1324307,
FT                   1346059..1346133,1434988..>1435072)
FT                   /codon_start=1
FT                   /gene="Dpp6"
FT                   /locus_tag="mCG_113122"
FT                   /product="dipeptidylpeptidase 6, isoform CRA_c"
FT                   /note="gene_id=mCG113122.2 transcript_id=mCT173992.0
FT                   protein_id=mCP96911.0 isoform=CRA_c"
FT                   /protein_id="EDL37220.1"
FT                   /translation="LIVTSVILLTPAEDTSLSQKKKVTVEDLFSEDFKIHDPEAKWISN
FT                   KEFIYRERKGSVILRNVETNNSTVLIEGKKIESLRAIRYEISPDKEYVLFSYNVEPGPS
FT                   ESGPTRSQQRKASVCRVGPKRPAAG"
FT   gene            complement(1372633..1378590)
FT                   /locus_tag="mCG_56332"
FT                   /note="gene_id=mCG56332.2"
FT   mRNA            complement(join(1372633..1373960,1374705..1374888,
FT                   1375524..1375667,1376902..1377061,1378057..1378590))
FT                   /locus_tag="mCG_56332"
FT                   /product="mCG56332"
FT                   /note="gene_id=mCG56332.2 transcript_id=mCT56515.2 created
FT                   on 01-OCT-2002"
FT   CDS             complement(join(1373784..1373960,1374705..1374888,
FT                   1375524..1375667,1376902..1377061,1378057..1378153))
FT                   /codon_start=1
FT                   /locus_tag="mCG_56332"
FT                   /product="mCG56332"
FT                   /note="gene_id=mCG56332.2 transcript_id=mCT56515.2
FT                   protein_id=mCP24528.2"
FT                   /protein_id="EDL37221.1"
FT                   /translation="MWMGERPERGGRMLAFPSESNEGRRRWNWRMWMAHRQTSSPVPVI
FT                   SKKQFEKEEKELIKKIQLTTEETNELRDRLIYVTEGSMNKRPYHRQNRHYKELKLKEKE
FT                   IMTYLHDLEMKNMEARENKQELKKEINFYRNLHTRILLEENLIKKKLAILQQESKEVLA
FT                   NWAIIHQCLVELNLSGKDKQEKTSNLKTQEHQVSETARELGLATAEEDSILQNELPRQE
FT                   APAEHHPQHPPSSSDESSSDESSYSTCPEWE"
FT   gene            complement(1620546..1671369)
FT                   /gene="Paxip1"
FT                   /locus_tag="mCG_7319"
FT                   /note="gene_id=mCG7319.1"
FT   mRNA            complement(join(1620546..1620999,1622611..1622673,
FT                   1622755..1622830,1622919..1623053,1627845..1627945,
FT                   1629985..1630153,1631517..1631619,1633258..1633328,
FT                   1635726..1635769,1637238..1637422,1638177..1638298,
FT                   1638780..1638917,1640384..1640479,1643945..1644039,
FT                   1644398..1645097,1651823..1652443,1655385..1655498,
FT                   1661241..1661304,1663549..1663592,1668462..1668596,
FT                   1671018..1671369))
FT                   /gene="Paxip1"
FT                   /locus_tag="mCG_7319"
FT                   /product="PAX interacting (with transcription-activation
FT                   domain) protein 1, transcript variant mCT6358"
FT                   /note="gene_id=mCG7319.1 transcript_id=mCT6358.1 created on
FT                   24-DEC-2002"
FT   CDS             complement(join(1620986..1620999,1622611..1622673,
FT                   1622755..1622830,1622919..1623053,1627845..1627945,
FT                   1629985..1630153,1631517..1631619,1633258..1633328,
FT                   1635726..1635769,1637238..1637422,1638177..1638298,
FT                   1638780..1638917,1640384..1640479,1643945..1644039,
FT                   1644398..1645097,1651823..1652443,1655385..1655498,
FT                   1661241..1661304,1663549..1663592,1668462..1668596,
FT                   1671018..1671098))
FT                   /codon_start=1
FT                   /gene="Paxip1"
FT                   /locus_tag="mCG_7319"
FT                   /product="PAX interacting (with transcription-activation
FT                   domain) protein 1, isoform CRA_a"
FT                   /note="gene_id=mCG7319.1 transcript_id=mCT6358.1
FT                   protein_id=mCP1606.2 isoform=CRA_a"
FT                   /protein_id="EDL37222.1"
FT                   /translation="MSEPAPEVPEELFREVKYYAVGDIDPQVIQLLKAGKAKEVSYNAL
FT                   ASHIISEDGDNPEVGEAREVFDLPVVKPSWVTLSVQCGALLPVNGFSPESCQIFFGLTA
FT                   CLSQVSSEDRSALWALVTFHGGSCQLNLNKKCTHLIVPEPKGEKYERAVKRTSIKIVTP
FT                   DWVLDCVSEKRRKDEAFYHPRLIIYEEEEEEEEEGDNEEQDSQNEGSTEKSSVASSAVA
FT                   SPAEQPCSPKPRAEVSKGELMFDDSSDSSPEKQERSLNWAPAEAPPLNTAQRRLPQGKG
FT                   PGLINLCANVPPVPGDILPPDMRGNLMAPGQNLQNSERSEILGTWSPAVRTLRNITNNA
FT                   DIQQINRPSNVAHILQSLSAPTKSLEQQVARGQQGHPNASAVLFGQAKGAPETHVLQQH
FT                   HPPQQPQQQHPALHLQPQIMQLQQQQQQQQQQQQQPQPYPQPPSHQFPQQVHQHQFSQQ
FT                   QLQFPQQPLHPQQQLHRPQQQLQPFQQQHALQQQLHQLQQQQLQHHQLAQLQQQQQQQH
FT                   NLLQQQQQQQQLQRLQQQQQMQNQAAHLSQASQALQHQVLPQQPLQLSLQPPPQQQQQQ
FT                   QLFGHDPAVEIPEESFLLGCVFAIADYPEQMSDKQLLATWKRIIQAHGGTVDPTFTSRC
FT                   THLLCASQVSSMYTQALRERKRCVTAHWLNTVLKKKKLMPPHRALHFPVAFPPGGKPCS
FT                   QHIISVTGFVDNDRDDLKLMAYLAGAKYTGYLCRSNTVLICKEPSGLKYEKAKEWRIPC
FT                   VNAQWLGDILLGNFEALRQVQYSRYTAFNMPDPFVPTPHLVLGLLDAWRTPVKVTAELL
FT                   MGVRLPPKLKPNEVANIQPSSKRARIEDLPPPTKKLTPELTPLVLFTGFEPVQVQQYIK
FT                   KLYILGGEVAECTKKCTHLIASKVTRTVKFLTAISVVKHIVTPDWLEECFKRQTFIDEQ
FT                   NYILRDAEAEVLFSFSLEESLKRAHVSPLFKTKYFYITPGICPSLATMKAIVECAGGKV
FT                   LAKQPSFRKLMEHKQNKSLSEIILISCENDLHLCREYFARGIDVHNAEFVLTGVLTQTL
FT                   DYESYKFN"
FT   mRNA            complement(join(1652310..1652443,1655385..1655498,
FT                   1660085..1660145,1663549..1663592,1668462..1668596,
FT                   1671018..1671369))
FT                   /gene="Paxip1"
FT                   /locus_tag="mCG_7319"
FT                   /product="PAX interacting (with transcription-activation
FT                   domain) protein 1, transcript variant mCT173439"
FT                   /note="gene_id=mCG7319.1 transcript_id=mCT173439.0 created
FT                   on 24-DEC-2002"
FT   CDS             complement(join(1660112..1660145,1663549..1663592,
FT                   1668462..1668596,1671018..1671098))
FT                   /codon_start=1
FT                   /gene="Paxip1"
FT                   /locus_tag="mCG_7319"
FT                   /product="PAX interacting (with transcription-activation
FT                   domain) protein 1, isoform CRA_b"
FT                   /note="gene_id=mCG7319.1 transcript_id=mCT173439.0
FT                   protein_id=mCP96358.0 isoform=CRA_b"
FT                   /protein_id="EDL37223.1"
FT                   /translation="MSEPAPEVPEELFREVKYYAVGDIDPQVIQLLKAGKAKEVSYNAL
FT                   ASHIISEDGDNPEVGEAREVFDLPVVKPSWVTLSVQCGALLPLNLYHMMLPI"
FT   gene            1696849..1697771
FT                   /pseudo
FT                   /locus_tag="mCG_51587"
FT                   /note="gene_id=mCG51587.2"
FT   mRNA            1696849..1697771
FT                   /pseudo
FT                   /locus_tag="mCG_51587"
FT                   /note="gene_id=mCG51587.2 transcript_id=mCT51770.2 created
FT                   on 14-OCT-2002"
FT   gene            1701025..1701942
FT                   /pseudo
FT                   /locus_tag="mCG_1046048"
FT                   /note="gene_id=mCG1046048.1"
FT   mRNA            1701025..1701942
FT                   /pseudo
FT                   /locus_tag="mCG_1046048"
FT                   /note="gene_id=mCG1046048.1 transcript_id=mCT163752.1
FT                   created on 14-OCT-2002"
FT   gene            1721866..1731464
FT                   /gene="Htr5a"
FT                   /locus_tag="mCG_7318"
FT                   /note="gene_id=mCG7318.1"
FT   mRNA            join(1721866..1723108,1731029..1731464)
FT                   /gene="Htr5a"
FT                   /locus_tag="mCG_7318"
FT                   /product="5-hydroxytryptamine (serotonin) receptor 5A"
FT                   /note="gene_id=mCG7318.1 transcript_id=mCT6360.0 created on
FT                   23-SEP-2002"
FT   CDS             join(1722368..1723108,1731029..1731361)
FT                   /codon_start=1
FT                   /gene="Htr5a"
FT                   /locus_tag="mCG_7318"
FT                   /product="5-hydroxytryptamine (serotonin) receptor 5A"
FT                   /note="gene_id=mCG7318.1 transcript_id=mCT6360.0
FT                   protein_id=mCP1605.1"
FT                   /db_xref="GOA:P30966"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR001397"
FT                   /db_xref="InterPro:IPR002231"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:96283"
FT                   /db_xref="UniProtKB/Swiss-Prot:P30966"
FT                   /protein_id="EDL37224.1"
FT                   /translation="MDLPVNLTSFSLSTPSSLEPNRSLDTEVLRPSRPFLSAFRVLVLT
FT                   LLGFLAAATFTWNLLVLATILKVRTFHRVPHNLVASMAISDVLVAVLVMPLSLVHELSG
FT                   RRWQLGRRLCQLWIACDVLCCTASIWNVTAIALDRYWSITRHLEYTLRTRKRVSNVMIL
FT                   LTWALSTVISLAPLLFGWGETYSEPSEECQVSREPSYTVFSTVGAFYLPLCVVLFVYWK
FT                   IYRAAKFRMGSRKTNSVSPVPEAVEVKNATQHPQMVFTVRHATVTFQTEGDTWREQKEQ
FT                   RAALMVGILIGVFVLCWFPFFVTELISPLCSWDVPAIWKSIFLWLGYSNSFFNPLIYTA
FT                   FNRSYSSAFKVFFSKQQ"
FT   gene            complement(1746214..1747149)
FT                   /pseudo
FT                   /locus_tag="mCG_113121"
FT                   /note="gene_id=mCG113121.0"
FT   mRNA            complement(1746214..1747149)
FT                   /pseudo
FT                   /locus_tag="mCG_113121"
FT                   /note="gene_id=mCG113121.0 transcript_id=mCT114199.0
FT                   created on 01-OCT-2002"
FT   gene            1747149..1747857
FT                   /pseudo
FT                   /locus_tag="mCG_1046020"
FT                   /note="gene_id=mCG1046020.1"
FT   mRNA            1747149..1747857
FT                   /pseudo
FT                   /locus_tag="mCG_1046020"
FT                   /note="gene_id=mCG1046020.1 transcript_id=mCT163724.1
FT                   created on 18-OCT-2002"
FT   gene            1858105..1860529
FT                   /pseudo
FT                   /locus_tag="mCG_1046049"
FT                   /note="gene_id=mCG1046049.1"
FT   mRNA            1858105..1860529
FT                   /pseudo
FT                   /locus_tag="mCG_1046049"
FT                   /note="gene_id=mCG1046049.1 transcript_id=mCT163753.1
FT                   created on 14-OCT-2002"
FT   gene            complement(1881235..1882909)
FT                   /pseudo
FT                   /locus_tag="mCG_49883"
FT                   /note="gene_id=mCG49883.2"
FT   mRNA            complement(1881235..1882909)
FT                   /pseudo
FT                   /locus_tag="mCG_49883"
FT                   /note="gene_id=mCG49883.2 transcript_id=mCT50066.2 created
FT                   on 01-OCT-2002"
FT   gene            complement(1935362..1936870)
FT                   /locus_tag="mCG_148309"
FT                   /note="gene_id=mCG148309.0"
FT   mRNA            complement(join(1935362..1936526,1936673..1936870))
FT                   /locus_tag="mCG_148309"
FT                   /product="mCG148309"
FT                   /note="gene_id=mCG148309.0 transcript_id=mCT188572.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(1936185..1936307)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148309"
FT                   /product="mCG148309"
FT                   /note="gene_id=mCG148309.0 transcript_id=mCT188572.0
FT                   protein_id=mCP109223.0"
FT                   /protein_id="EDL37225.1"
FT                   /translation="MVCKDPPPSKKRTFQKWGLGLWASVGYPAIEPMPSPTPEL"
FT   gene            1952782..1960081
FT                   /gene="Insig1"
FT                   /locus_tag="mCG_7565"
FT                   /note="gene_id=mCG7565.2"
FT   mRNA            join(1952782..1953214,1954966..1955090,1955901..1956067,
FT                   1956481..1956580,1958210..1960081)
FT                   /gene="Insig1"
FT                   /locus_tag="mCG_7565"
FT                   /product="insulin induced gene 1"
FT                   /note="gene_id=mCG7565.2 transcript_id=mCT6465.2 created on
FT                   24-SEP-2002"
FT   CDS             join(1952857..1953214,1954966..1955090,1955901..1956067,
FT                   1956481..1956580,1958210..1958239)
FT                   /codon_start=1
FT                   /gene="Insig1"
FT                   /locus_tag="mCG_7565"
FT                   /product="insulin induced gene 1"
FT                   /note="gene_id=mCG7565.2 transcript_id=mCT6465.2
FT                   protein_id=mCP3948.1"
FT                   /protein_id="EDL37226.1"
FT                   /translation="MPRLHDHVWNYPSAGAARPYSLPRGMIAAAACPQGPGVPEPEHAP
FT                   RGQRAGTTGCSARPGSWHHDLVQRSLVLFSFGVVLALVLNLLQIQRNVTLFPDEVIATI
FT                   FSSAWWVPPCCGTAAAVVGLLYPCIDSHLGEPHKFKREWASVMRCIAVFVGINHASAKL
FT                   DFANNVQLSLTLAALSLGLWWTFDRSRSGLGLGITIAFLATLITQFLVYNGVYQYTSPD
FT                   FLYIRSWLPCIFFSGGVTVGNIGRQLAMGVPEKPHSD"
FT   gene            2045852..2051511
FT                   /gene="En2"
FT                   /locus_tag="mCG_7563"
FT                   /note="gene_id=mCG7563.1"
FT   mRNA            join(2045852..2046556,2049461..2051511)
FT                   /gene="En2"
FT                   /locus_tag="mCG_7563"
FT                   /product="engrailed 2"
FT                   /note="gene_id=mCG7563.1 transcript_id=mCT6463.1 created on
FT                   16-SEP-2002"
FT   CDS             join(2045899..2046556,2049461..2049777)
FT                   /codon_start=1
FT                   /gene="En2"
FT                   /locus_tag="mCG_7563"
FT                   /product="engrailed 2"
FT                   /note="gene_id=mCG7563.1 transcript_id=mCT6463.1
FT                   protein_id=mCP3913.1"
FT                   /db_xref="GOA:Q3TZM2"
FT                   /db_xref="InterPro:IPR000747"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017970"
FT                   /db_xref="InterPro:IPR019549"
FT                   /db_xref="InterPro:IPR019737"
FT                   /db_xref="InterPro:IPR020479"
FT                   /db_xref="MGI:MGI:95390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TZM2"
FT                   /protein_id="EDL37227.1"
FT                   /translation="MEEKDSKPSETAAEAQRQPEPSSGGGSGGGSSPSDSDTGRRRALM
FT                   LPEVLQAPGNHQHPHRITNFFIDNILRPEFGRRKDAGTCCAGAGGARGGEGGAGTTEGG
FT                   GGGAGGAEQLLGARESRPNPACAPSAGGTLSAAAGDPAVDGEGGSKTLSLHGGAKKPGD
FT                   PGGSLDGVLKARGLGGGDLSVSSDSDSSQASATLGAQPMLWPAWVYCTRYSDRPSSGPR
FT                   SRKPKKKNPNKEDKRPRTAFTAEQLQRLKAEFQTNRYLTEQRRQSLAQELSLNESQIKI
FT                   WFQNKRAKIKKATGNKNTLAVHLMAQGLYNHSTTAKEGKSDSE"
FT   gene            complement(2080178..2125269)
FT                   /gene="9630008K15Rik"
FT                   /locus_tag="mCG_56335"
FT                   /note="gene_id=mCG56335.2"
FT   mRNA            complement(join(2080178..2082779,2086630..2086726,
FT                   2088440..2088643,2125156..2125269))
FT                   /gene="9630008K15Rik"
FT                   /locus_tag="mCG_56335"
FT                   /product="RIKEN cDNA 9630008K15"
FT                   /note="gene_id=mCG56335.2 transcript_id=mCT56518.2 created
FT                   on 14-OCT-2002"
FT   CDS             complement(join(2082742..2082779,2086630..2086726,
FT                   2088440..2088643,2125156..2125254))
FT                   /codon_start=1
FT                   /gene="9630008K15Rik"
FT                   /locus_tag="mCG_56335"
FT                   /product="RIKEN cDNA 9630008K15"
FT                   /note="gene_id=mCG56335.2 transcript_id=mCT56518.2
FT                   protein_id=mCP26978.2"
FT                   /protein_id="EDL37228.1"
FT                   /translation="MDEVEYDITKARQKKTKVGSYRIRPDGTQERKKVPLAQSEAFLID
FT                   LLDKVCMRMNDYQLEDDPVTKQKYFRRYAPRKGDKIYKEYKKFFFYSDAFRPLKFACEA
FT                   IIEKYEDEIFELIAQEANHLADMLCNEKSDLCGTPTNSPEP"
FT   gene            2197203..2295653
FT                   /locus_tag="mCG_141193"
FT                   /note="gene_id=mCG141193.0"
FT   mRNA            join(2197203..2197420,2211136..2211214,2215848..2215896,
FT                   2217000..2217076,2219022..2219334,2222421..2222540,
FT                   2232452..2232623,2238243..2238451,2242001..2242147,
FT                   2270127..2270207,2271274..2271423,2274392..2275042,
FT                   2288628..2288834,2290944..2291132,2293661..2293749,
FT                   2293942..2295653)
FT                   /locus_tag="mCG_141193"
FT                   /product="mCG141193, transcript variant mCT173724"
FT                   /note="gene_id=mCG141193.0 transcript_id=mCT173724.0
FT                   created on 24-SEP-2002"
FT   CDS             join(2197378..2197420,2211136..2211214,2215848..2215896,
FT                   2217000..2217076,2219022..2219334,2222421..2222540,
FT                   2232452..2232623,2238243..2238451,2242001..2242147,
FT                   2270127..2270207,2271274..2271423,2274392..2275042,
FT                   2288628..2288834,2290944..2291132,2293661..2293749,
FT                   2293942..2293990)
FT                   /codon_start=1
FT                   /locus_tag="mCG_141193"
FT                   /product="mCG141193, isoform CRA_a"
FT                   /note="gene_id=mCG141193.0 transcript_id=mCT173724.0
FT                   protein_id=mCP96644.0 isoform=CRA_a"
FT                   /protein_id="EDL37229.1"
FT                   /translation="MAAALGAGGGAGAGDDDFDQFDKPGAERSWRRRAADEDWDSELED
FT                   DLLGEDLLSGKKNQSDLSDEELNDDLLQSDNEEEENFSSQGVTISLNTTSGIVTSFELS
FT                   DNTNDQSGEQESEYEQGDDELAYHKPEEQELYTQEYPEEGQYEGHDAELTEDQIEYGDE
FT                   PEEEQLYSDEVLDIEINEPLDEFTDEEYLQAYGGQQGLQVREDCEAEDDLDEITDSQVA
FT                   SETHEGGMETLELQKDIKEESDEEDDDDEESGRLRFKTERKEGTIIRLSDVTRERRNIP
FT                   ETLELSAEAKAALLEFEERERQHKQGRYGSRRGGRRGGSLMCRGMGDQRRDNSERGRMK
FT                   EHRPALLPTQPSVVGVHMPPQIETPRMMLTPPPVTPQQPKNIHINPHFKGTVVTPVQGT
FT                   CSFLFRPHVQTAQPQPSSSRMQCTPHQGLRHNAASQNISKRPMQQMQPTAPRNSNLREL
FT                   PIAPSHVLEMSGNRCSSTPVAQFPDEDEETRLYRLKIEEQKRLREEILKQKELRRQQQA
FT                   GARKKELLERLAQQQQQQHQPQQQQPQQIYGSQTSMEQEELAATPSPTNGNPLLPFPGA
FT                   QCRQNVKTRLLVKNQDITTASVQPKAVNFVPPGANVQHQGQHLRPLKHLRQLPHKVLQV
FT                   KPMDMEETPHSPQAARVTSLQGRPQDTKPGVKRTVMHRANSGGGGDGPHVSSKVRVIKL
FT                   SGGGGESDGFSHTEGQPQRLPQPPDMRQQPTRKVTLTKGVPQQPQHLPVGPHMYPAIPP
FT                   GIKSIQGIHPAKKAIMHGRGRGVAGPMGRGRLMPNKQNLRVVECKPQPCVVSVEGLSSS
FT                   TTDVQLKSLLMSVGPIQSLQMLPQQRKAIAKFKEPAHALAFQQKFHRHMIDLSHINVAL
FT                   IVE"
FT   mRNA            join(<2219096..2219334,2232452..2232623,2238243..2238451,
FT                   2241842..>2241991)
FT                   /locus_tag="mCG_141193"
FT                   /product="mCG141193, transcript variant mCT173725"
FT                   /note="gene_id=mCG141193.0 transcript_id=mCT173725.0
FT                   created on 24-SEP-2002"
FT   CDS             join(<2219098..2219334,2232452..2232623,2238243..2238451,
FT                   2241842..>2241991)
FT                   /codon_start=1
FT                   /locus_tag="mCG_141193"
FT                   /product="mCG141193, isoform CRA_b"
FT                   /note="gene_id=mCG141193.0 transcript_id=mCT173725.0
FT                   protein_id=mCP96643.0 isoform=CRA_b"
FT                   /protein_id="EDL37230.1"
FT                   /translation="DQSGEQESEYEQGDDELAYHKPEEQELYTQEYPEEGQYEGHDAEL
FT                   TEDQIEYGDEPEEEQLYSDEVLDIEINEPLDEFTGGMETLELQKDIKEESDEEDDDDEE
FT                   SGRLRFKTERKEGTIIRLSDVTRERRNIPETLELSAEAKAALLEFEERERQHKQGRYGS
FT                   RRGGRRGGSLMCRGMGDQRRDNSERGRMKEHRPALLPTQPSVVAHSPRLIPPPQPQPPP
FT                   PPPPPPPQQQPIRSLFQQQQLQPLLPLQHPHHPS"
FT   gene            complement(2330206..2339606)
FT                   /gene="Shh"
FT                   /locus_tag="mCG_7564"
FT                   /note="gene_id=mCG7564.2"
FT   mRNA            complement(join(2330206..2330957,2333676..2333937,
FT                   2338815..2339606))
FT                   /gene="Shh"
FT                   /locus_tag="mCG_7564"
FT                   /product="sonic hedgehog"
FT                   /note="gene_id=mCG7564.2 transcript_id=mCT6464.2 created on
FT                   01-OCT-2002"
FT   CDS             complement(join(2330209..2330957,2333676..2333937,
FT                   2338815..2339117))
FT                   /codon_start=1
FT                   /gene="Shh"
FT                   /locus_tag="mCG_7564"
FT                   /product="sonic hedgehog"
FT                   /note="gene_id=mCG7564.2 transcript_id=mCT6464.2
FT                   protein_id=mCP3918.2"
FT                   /protein_id="EDL37231.1"
FT                   /translation="MLLLLARCFLVILASSLLVCPGLACGPGRGFGKRRHPKKLTPLAY
FT                   KQFIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCK
FT                   DKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLA
FT                   RLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGGCFPGSATVHLEQGGTKLVKDLRPG
FT                   DRVLAADDQGRLLYSDFLTFLDRDEGAKKVFYVIETLEPRERLLLTAAHLLFVAPHNDS
FT                   GPTPGPSALFASRVRPGQRVYVVAERGGDRRLLPAAVHSVTLREEEAGAYAPLTAHGTI
FT                   LINRVLASCYAVIEEHSWAHRAFAPFRLAHALLAALAPARTDGGGGGSIPAAQSATEAR
FT                   GAEPTAGIHWYSQLLYHIGTWLLDSETMHPLGMAVKSS"
FT   gene            <2339338..2573756
FT                   /locus_tag="mCG_146320"
FT                   /note="gene_id=mCG146320.0"
FT   mRNA            join(<2339338..2339702,2434849..2434985,2523374..2523654,
FT                   2526926..2528514,2565481..2565568,2565669..2565740,
FT                   2573363..2573756)
FT                   /locus_tag="mCG_146320"
FT                   /product="mCG146320"
FT                   /note="gene_id=mCG146320.0 transcript_id=mCT186423.0
FT                   created on 14-JUL-2003"
FT   gene            2409604..2410877
FT                   /pseudo
FT                   /locus_tag="mCG_119764"
FT                   /note="gene_id=mCG119764.1"
FT   mRNA            2409604..2410877
FT                   /pseudo
FT                   /locus_tag="mCG_119764"
FT                   /note="gene_id=mCG119764.1 transcript_id=mCT120941.1
FT                   created on 01-OCT-2002"
FT   CDS             <2527105..2527428
FT                   /codon_start=1
FT                   /locus_tag="mCG_146320"
FT                   /product="mCG146320"
FT                   /note="gene_id=mCG146320.0 transcript_id=mCT186423.0
FT                   protein_id=mCP107488.0"
FT                   /protein_id="EDL37232.1"
FT                   /translation="TLPRYLERGTLSEVAPCLNLGSLHPTWSPLPHRALLFCSSYRILF
FT                   LSSSSAGFCPQKDQSIRVAPLGAGSTPVSLWVSKDEHTAYHIFSMEEMAEPEKIRLRCH
FT                   HPM"
FT   gene            3043778..3073203
FT                   /gene="Rnf32"
FT                   /locus_tag="mCG_7344"
FT                   /note="gene_id=mCG7344.2"
FT   mRNA            join(3043778..3043897,3044365..3044430,3045711..3045805,
FT                   3046359..3046623,3053454..3053486,3054481..3054589,
FT                   3071802..3071969,3072728..3073166)
FT                   /gene="Rnf32"
FT                   /locus_tag="mCG_7344"
FT                   /product="ring finger protein 32, transcript variant
FT                   mCT173438"
FT                   /note="gene_id=mCG7344.2 transcript_id=mCT173438.0 created
FT                   on 18-FEB-2003"
FT   mRNA            join(3043782..3043897,3044365..3044430,3045711..3045805,
FT                   3046359..3046623,3050840..3050982,3053454..3053486,
FT                   3053959..3054083,3054481..3054589,3071802..3071969,
FT                   3072728..3073203)
FT                   /gene="Rnf32"
FT                   /locus_tag="mCG_7344"
FT                   /product="ring finger protein 32, transcript variant
FT                   mCT6327"
FT                   /note="gene_id=mCG7344.2 transcript_id=mCT6327.2 created on
FT                   18-FEB-2003"
FT   mRNA            join(3043822..3043869,3044365..3044430,3045711..3045805,
FT                   3046359..3046623,3050840..3050982,3053454..3053486,
FT                   3053959..3054083,3054481..3054589,3071802..3071969,
FT                   3072728..3073124)
FT                   /gene="Rnf32"
FT                   /locus_tag="mCG_7344"
FT                   /product="ring finger protein 32, transcript variant
FT                   mCT180246"
FT                   /note="gene_id=mCG7344.2 transcript_id=mCT180246.0 created
FT                   on 18-FEB-2003"
FT   CDS             join(3045791..3045805,3046359..3046623,3050840..3050982,
FT                   3053454..3053486,3053959..3054083,3054481..3054589,
FT                   3071802..3071969,3072728..3072976)
FT                   /codon_start=1
FT                   /gene="Rnf32"
FT                   /locus_tag="mCG_7344"
FT                   /product="ring finger protein 32, isoform CRA_b"
FT                   /note="gene_id=mCG7344.2 transcript_id=mCT180246.0
FT                   protein_id=mCP103168.0 isoform=CRA_b"
FT                   /protein_id="EDL37234.1"
FT                   /translation="MLRNKDRSSNKGNLAVTAVALQDHLLHDLQLGHLSVADPCKIKAR
FT                   KKEKKSKSLKRDATAIIDTGLRKSTEGPNMEDPEKEYVLDPTPPPLTLAQKLGLLPPPP
FT                   LPLSSDEWERVKQRSLLQGDSIQPCPICKEEFELHPQVLLSCSHVFHRACLQAFEKFTN
FT                   KKTCPLCRKNQYQTRVIHDGARLFRVKCATRIQAYWRGYIVRKWYRNLRKIIPPSDAKL
FT                   RRKFFEEKFTEISHRILCSYNTNIDELFSEIDVCLAVNRSILQQLDERCGQIITKEDWE
FT                   KIQAQAAHHEIYECSICLTPLSFHGDGRQAAIGTSSQRPRETVLLSCAHLFHNACLLAL
FT                   EEFSLGDNAPFHVCPLCRSCYQKKIVEC"
FT   CDS             join(3045791..3045805,3046359..3046623,3050840..3050982,
FT                   3053454..3053486,3053959..3054083,3054481..3054589,
FT                   3071802..3071969,3072728..3072976)
FT                   /codon_start=1
FT                   /gene="Rnf32"
FT                   /locus_tag="mCG_7344"
FT                   /product="ring finger protein 32, isoform CRA_b"
FT                   /note="gene_id=mCG7344.2 transcript_id=mCT6327.2
FT                   protein_id=mCP3961.1 isoform=CRA_b"
FT                   /protein_id="EDL37235.1"
FT                   /translation="MLRNKDRSSNKGNLAVTAVALQDHLLHDLQLGHLSVADPCKIKAR
FT                   KKEKKSKSLKRDATAIIDTGLRKSTEGPNMEDPEKEYVLDPTPPPLTLAQKLGLLPPPP
FT                   LPLSSDEWERVKQRSLLQGDSIQPCPICKEEFELHPQVLLSCSHVFHRACLQAFEKFTN
FT                   KKTCPLCRKNQYQTRVIHDGARLFRVKCATRIQAYWRGYIVRKWYRNLRKIIPPSDAKL
FT                   RRKFFEEKFTEISHRILCSYNTNIDELFSEIDVCLAVNRSILQQLDERCGQIITKEDWE
FT                   KIQAQAAHHEIYECSICLTPLSFHGDGRQAAIGTSSQRPRETVLLSCAHLFHNACLLAL
FT                   EEFSLGDNAPFHVCPLCRSCYQKKIVEC"
FT   CDS             join(3045791..3045805,3046359..3046623,3053454..3053485)
FT                   /codon_start=1
FT                   /gene="Rnf32"
FT                   /locus_tag="mCG_7344"
FT                   /product="ring finger protein 32, isoform CRA_a"
FT                   /note="gene_id=mCG7344.2 transcript_id=mCT173438.0
FT                   protein_id=mCP96357.0 isoform=CRA_a"
FT                   /db_xref="GOA:E0CZC4"
FT                   /db_xref="MGI:MGI:1861747"
FT                   /db_xref="UniProtKB/TrEMBL:E0CZC4"
FT                   /protein_id="EDL37233.1"
FT                   /translation="MLRNKDRSSNKGNLAVTAVALQDHLLHDLQLGHLSVADPCKIKAR
FT                   KKEKKSKSLKRDATAIIDTGLRKSTEGPNMEDPEKEYVLDPTPPPLTLGAAFLLTCIP"
FT   gene            3065339..3066966
FT                   /pseudo
FT                   /locus_tag="mCG_7346"
FT                   /note="gene_id=mCG7346.2"
FT   mRNA            3065339..3066966
FT                   /pseudo
FT                   /locus_tag="mCG_7346"
FT                   /note="gene_id=mCG7346.2 transcript_id=mCT6337.2 created on
FT                   01-OCT-2002"
FT   gene            complement(3077489..3077877)
FT                   /gene="1110048D14Rik"
FT                   /locus_tag="mCG_148289"
FT                   /note="gene_id=mCG148289.0"
FT   mRNA            complement(3077489..3077877)
FT                   /gene="1110048D14Rik"
FT                   /locus_tag="mCG_148289"
FT                   /product="RIKEN cDNA 1110048D14"
FT                   /note="gene_id=mCG148289.0 transcript_id=mCT188552.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(3077543..3077734)
FT                   /codon_start=1
FT                   /gene="1110048D14Rik"
FT                   /locus_tag="mCG_148289"
FT                   /product="RIKEN cDNA 1110048D14"
FT                   /note="gene_id=mCG148289.0 transcript_id=mCT188552.0
FT                   protein_id=mCP109203.0"
FT                   /db_xref="GOA:Q8BMZ2"
FT                   /db_xref="MGI:MGI:1861746"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BMZ2"
FT                   /protein_id="EDL37236.1"
FT                   /translation="MYLLMVGTIFNVYRQKYYRVFKYVNICSTAFKLKTDMIFFICQDT
FT                   LVNFCYILFSSFLLVLFL"
FT   gene            complement(3079015..>3225458)
FT                   /gene="Lmbr1"
FT                   /locus_tag="mCG_7345"
FT                   /note="gene_id=mCG7345.2"
FT   mRNA            complement(join(3079015..3080833,3082663..3082824,
FT                   3100429..3100495,3101928..3102018,3102232..3102305,
FT                   3105744..3105821,3106365..3106441,3111081..3111161,
FT                   3135119..3135191,3139001..3139065,3139880..3139948,
FT                   3140551..3140677,3171384..3171487,3194333..3194472,
FT                   3208176..3208215,3211011..3211083,3225344..>3225457))
FT                   /gene="Lmbr1"
FT                   /locus_tag="mCG_7345"
FT                   /product="limb region 1, transcript variant mCT6325"
FT                   /note="gene_id=mCG7345.2 transcript_id=mCT6325.2 created on
FT                   01-OCT-2002"
FT   mRNA            complement(join(3079804..3080833,3082663..3082824,
FT                   3100429..3100495,3101928..3102018,3102232..3102305,
FT                   3105744..3105821,3106365..3106441,3111081..3111161,
FT                   3135119..3135191,3139001..3139065,3139880..3139948,
FT                   3140551..3140677,3171384..3171487,3194333..3194472,
FT                   3208176..3208215,3211011..3211083,3212049..3212943,
FT                   3225265..>3225440))
FT                   /gene="Lmbr1"
FT                   /locus_tag="mCG_7345"
FT                   /product="limb region 1, transcript variant mCT193633"
FT                   /note="gene_id=mCG7345.2 transcript_id=mCT193633.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(3080066..3080833,3082663..3082824,
FT                   3100429..3100495,3101928..3102018,3102232..3102305,
FT                   3105744..3105821,3106365..3106441,3111081..3111161,
FT                   3135119..3135191,3139001..3139065,3139880..3139948,
FT                   3140551..3140677,3171384..3171406,3194333..3194472,
FT                   3208176..3208215,3211011..3211083,3225265..>3225368))
FT                   /gene="Lmbr1"
FT                   /locus_tag="mCG_7345"
FT                   /product="limb region 1, transcript variant mCT193634"
FT                   /note="gene_id=mCG7345.2 transcript_id=mCT193634.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(3080748..3080833,3082663..3082824,
FT                   3100429..3100495,3101928..3102018,3102232..3102305,
FT                   3105744..3105821,3106365..3106441,3111081..3111161,
FT                   3135119..3135191,3139001..3139065,3139880..3139948,
FT                   3140551..3140677,3171384..3171406,3194333..3194472,
FT                   3208176..3208215,3211011..3211083,3225265..>3225366))
FT                   /codon_start=1
FT                   /gene="Lmbr1"
FT                   /locus_tag="mCG_7345"
FT                   /product="limb region 1, isoform CRA_c"
FT                   /note="gene_id=mCG7345.2 transcript_id=mCT193634.0
FT                   protein_id=mCP114606.0 isoform=CRA_c"
FT                   /protein_id="EDL37239.1"
FT                   /translation="RRGRPCGGYERRMEGQDEVSAREQHFHSQVRESTICFLLFAILYI
FT                   VSYFIIIRYKRKSDEQEDEDAVVNRISLFLSTFTLAVSAGAVLLLPFSIISNEILLAFP
FT                   HNYYIQWLNGSLIHEGFAGLKKGIRARILETLVMLLLLALLILGMVWVASALIDSDAAS
FT                   MESLYDLWEFYLPYLYSCISLMGCLLLLLCTPVGLSRMFTVMGQLLVKPAILEDLDEQI
FT                   YMITLEEEALQRRLHGLSSSVEYNVMELEQELENVKILKTKLERRKKASAWERNLVYPA
FT                   VMVLLLIETSISVLLVACNILCLLVDETAMPKGTRGPGIGSASLSTFGFVGAALEIILI
FT                   FYLMVSSVVGFYSLRFFGNFTPKKDDTTMTKIIGNCVSILVLSSALPVMSRTLGITRFD
FT                   LLGDFGRFNWLGNFYIVLSYNLLFAIMTTLCLIRKFTSAVREELFKALGLHKLHLSDTS
FT                   RDSETTKPSANGHQKAL"
FT   CDS             complement(join(3080748..3080833,3082663..3082824,
FT                   3100429..3100495,3101928..3102018,3102232..3102305,
FT                   3105744..3105821,3106365..3106441,3111081..3111161,
FT                   3135119..3135191,3139001..3139065,3139880..3139948,
FT                   3140551..3140677,3171384..3171487,3194333..3194472,
FT                   3208176..3208215,3211011..>3211083))
FT                   /codon_start=1
FT                   /gene="Lmbr1"
FT                   /locus_tag="mCG_7345"
FT                   /product="limb region 1, isoform CRA_b"
FT                   /note="gene_id=mCG7345.2 transcript_id=mCT193633.0
FT                   protein_id=mCP114605.0 isoform=CRA_b"
FT                   /protein_id="EDL37238.1"
FT                   /translation="ICFLLFAILYIVSYFIIIRYKRKSDEQEDEDAVVNRISLFLSTFT
FT                   LAVSAGAVLLLPFSIISNEILLAFPHNYYIQWLNGSLIHGLWNLASLFSNLCLFVLMPF
FT                   AFFFLESEGFAGLKKGIRARILETLVMLLLLALLILGMVWVASALIDSDAASMESLYDL
FT                   WEFYLPYLYSCISLMGCLLLLLCTPVGLSRMFTVMGQLLVKPAILEDLDEQIYMITLEE
FT                   EALQRRLHGLSSSVEYNVMELEQELENVKILKTKLERRKKASAWERNLVYPAVMVLLLI
FT                   ETSISVLLVACNILCLLVDETAMPKGTRGPGIGSASLSTFGFVGAALEIILIFYLMVSS
FT                   VVGFYSLRFFGNFTPKKDDTTMTKIIGNCVSILVLSSALPVMSRTLGITRFDLLGDFGR
FT                   FNWLGNFYIVLSYNLLFAIMTTLCLIRKFTSAVREELFKALGLHKLHLSDTSRDSETTK
FT                   PSANGHQKAL"
FT   CDS             complement(join(3080748..3080833,3082663..3082824,
FT                   3100429..3100495,3101928..3102018,3102232..3102305,
FT                   3105744..3105821,3106365..3106441,3111081..3111161,
FT                   3135119..3135191,3139001..3139065,3139880..3139948,
FT                   3140551..3140677,3171384..3171487,3194333..3194472,
FT                   3208176..3208215,3211011..>3211083))
FT                   /codon_start=1
FT                   /gene="Lmbr1"
FT                   /locus_tag="mCG_7345"
FT                   /product="limb region 1, isoform CRA_b"
FT                   /note="gene_id=mCG7345.2 transcript_id=mCT6325.2
FT                   protein_id=mCP4000.2 isoform=CRA_b"
FT                   /protein_id="EDL37240.1"
FT                   /translation="ICFLLFAILYIVSYFIIIRYKRKSDEQEDEDAVVNRISLFLSTFT
FT                   LAVSAGAVLLLPFSIISNEILLAFPHNYYIQWLNGSLIHGLWNLASLFSNLCLFVLMPF
FT                   AFFFLESEGFAGLKKGIRARILETLVMLLLLALLILGMVWVASALIDSDAASMESLYDL
FT                   WEFYLPYLYSCISLMGCLLLLLCTPVGLSRMFTVMGQLLVKPAILEDLDEQIYMITLEE
FT                   EALQRRLHGLSSSVEYNVMELEQELENVKILKTKLERRKKASAWERNLVYPAVMVLLLI
FT                   ETSISVLLVACNILCLLVDETAMPKGTRGPGIGSASLSTFGFVGAALEIILIFYLMVSS
FT                   VVGFYSLRFFGNFTPKKDDTTMTKIIGNCVSILVLSSALPVMSRTLGITRFDLLGDFGR
FT                   FNWLGNFYIVLSYNLLFAIMTTLCLIRKFTSAVREELFKALGLHKLHLSDTSRDSETTK
FT                   PSANGHQKAL"
FT   mRNA            complement(join(3135115..3135191,3139001..3139065,
FT                   3139880..3139948,3140551..3140708,3194333..3194472,
FT                   3208176..3208215,3211011..3211083,3225265..>3225458))
FT                   /gene="Lmbr1"
FT                   /locus_tag="mCG_7345"
FT                   /product="limb region 1, transcript variant mCT174006"
FT                   /note="gene_id=mCG7345.2 transcript_id=mCT174006.0 created
FT                   on 01-OCT-2002"
FT   CDS             complement(join(3140620..3140708,3194333..3194472,
FT                   3208176..3208215,3211011..3211083,3225265..>3225438))
FT                   /codon_start=1
FT                   /gene="Lmbr1"
FT                   /locus_tag="mCG_7345"
FT                   /product="limb region 1, isoform CRA_a"
FT                   /note="gene_id=mCG7345.2 transcript_id=mCT174006.0
FT                   protein_id=mCP96925.0 isoform=CRA_a"
FT                   /protein_id="EDL37237.1"
FT                   /translation="VAFLSGHERLYSPAARGQWCGGARRRGRPCGGYERRMEGQDEVSA
FT                   REQHFHSQVRESTICFLLFAILYIVSYFIIIRYKRKSDEQEDEDAVVNRISLFLSTFTL
FT                   AVSAGAVLLLPFSIISNEILLAFPHNYYIQWLNGSLIHVLKCCCCCVLRESEPAFWKLW
FT                   LCCCFLRC"
FT   gene            <3225836..3237627
FT                   /locus_tag="mCG_1046201"
FT                   /note="gene_id=mCG1046201.0"
FT   mRNA            join(<3225836..3227349,3235904..3237627)
FT                   /locus_tag="mCG_1046201"
FT                   /product="mCG1046201"
FT                   /note="gene_id=mCG1046201.0 transcript_id=mCT163905.0
FT                   created on 30-SEP-2002"
FT   CDS             <3236287..3236571
FT                   /codon_start=1
FT                   /locus_tag="mCG_1046201"
FT                   /product="mCG1046201"
FT                   /note="gene_id=mCG1046201.0 transcript_id=mCT163905.0
FT                   protein_id=mCP65044.0"
FT                   /protein_id="EDL37241.1"
FT                   /translation="WKDLCLLCVHMLWRSNTPCHSQPSSPVPICKLTLLGVCYKPCVQA
FT                   VPEPCPSHTDFKMKMPDATELALHASQKTSLPNGLQIMYKCRQRADIRD"
FT   gene            complement(3267414..3271388)
FT                   /locus_tag="mCG_66329"
FT                   /note="gene_id=mCG66329.2"
FT   mRNA            complement(join(3267414..3267558,3268727..3268984,
FT                   3269650..3269761,3271112..3271388))
FT                   /locus_tag="mCG_66329"
FT                   /product="mCG66329"
FT                   /note="gene_id=mCG66329.2 transcript_id=mCT66512.2 created
FT                   on 14-OCT-2002"
FT   CDS             complement(join(3267417..3267558,3268727..3268984,
FT                   3269650..3269761,3271112..3271385))
FT                   /codon_start=1
FT                   /locus_tag="mCG_66329"
FT                   /product="mCG66329"
FT                   /note="gene_id=mCG66329.2 transcript_id=mCT66512.2
FT                   protein_id=mCP26985.1"
FT                   /protein_id="EDL37242.1"
FT                   /translation="MGFYPPRARPYHWPNPFHEKVQLEHQRVMSDIQWLELENTQYSEN
FT                   FQDLKKEIGFHLSQSPPEVEWPFLPFFVSGLKILQLWLYSFCVLAIITLEIHTPSQPPT
FT                   SCTVIVHFSVYAQAYLVALLEAVVQVSYIRRRLLEKLCLAWLSTKLWGSSVSGCSGMKA
FT                   CACLCPTKSSKEQDLERPEEMLQYIQKQKELAIQEKDLEEKLQHQIAVLLMRFEKLRHE
FT                   LEVATTQEERVLQNELLPQEPPAEPHPQQPLNSVDESSS"
FT   gene            3281856..3300598
FT                   /locus_tag="mCG_122632"
FT                   /note="gene_id=mCG122632.1"
FT   mRNA            join(3281856..3282777,3283064..3283191,3284731..3284926,
FT                   3286960..3287283,3288464..3288574,3289627..3289794,
FT                   3290483..3290604,3293371..3293503,3296714..3296823,
FT                   3298159..3300598)
FT                   /locus_tag="mCG_122632"
FT                   /product="mCG122632"
FT                   /note="gene_id=mCG122632.1 transcript_id=mCT123854.1
FT                   created on 01-OCT-2002"
FT   CDS             join(3281881..3282777,3283064..3283191,3284731..3284926,
FT                   3286960..3287283,3288464..3288574,3289627..3289794,
FT                   3290483..3290604,3293371..3293503,3296714..3296823,
FT                   3298159..3298333)
FT                   /codon_start=1
FT                   /locus_tag="mCG_122632"
FT                   /product="mCG122632"
FT                   /note="gene_id=mCG122632.1 transcript_id=mCT123854.1
FT                   protein_id=mCP64743.1"
FT                   /protein_id="EDL37243.1"
FT                   /translation="MAHALLKRSGVRRGLGGREGPLKRLRLAVEDFVRTTSESEACESR
FT                   SAVARSRPGGRKSRKELRKEKRHLRKARRLQRTVGSGSGDQGGNVGLNDGPETRRPPTE
FT                   VRPTPAKATATPAKASAPSTNTKASAAQPKAKAKGAPGKPGPATATARKRALLAANEEE
FT                   DREIRKLERCLGLHKRKKKGDGSSVPLSFARDGLDYILGALECGSGGGLYESSEEEEEE
FT                   KLETGQTVLESDLESNSKESEEDPDWQVLQEDQEDVNSKRRGEAESGTRGNKGTKKVRF
FT                   AEVVEKSRSSSEDDIEQQESHSVESGEKYIPPRLRNEEVIDVHKKEELDRLKKHVKGLI
FT                   NRLSEPNMASISGQLEELYMAHSRKDMNDTLTTALMDACVTASAMPSRLMMEHVFLVSI
FT                   LHHTVGIEVGACFLEAVVKKFDAIYRDGGEGKELDNLFTMIAHLYNFHVVQSILIFDIL
FT                   KKLVGTFTEKDIELILLMLKNVGFALRKDDALSLKELITEAQTQASGAGNKFQDQNRVR
FT                   FMLETMLALKNNDLRKIPGYNPEPVEKLKKLQRTLVRNAGSGSETRLRISWDGILNAEQ
FT                   TGRWWIVGSAWSGTPMIDNSHHIQLQKPLAGMASSKMLELARKQRMNTDVRRIIFCTLM
FT                   TSEDFLDAFEKLLKLGLKDQQEREIVHILMDCCLQEKTYNPFYAFLASKFCDYERRFQV
FT                   VEFSELDKPRVHFLRRVLTALLMETEDDDLAVIFSRVSDNPKLGMLREGLKLFIGHFLL
FT                   KHTQAHQSAEEASLLREKAGLASKSLQGKAILRM"
FT   gene            complement(3320391..3325600)
FT                   /gene="Hlxb9"
FT                   /locus_tag="mCG_7342"
FT                   /note="gene_id=mCG7342.1"
FT   mRNA            complement(join(3320391..3321361,3321886..3322046,
FT                   3324715..3325600))
FT                   /gene="Hlxb9"
FT                   /locus_tag="mCG_7342"
FT                   /product="homeobox gene HB9"
FT                   /note="gene_id=mCG7342.1 transcript_id=mCT6326.1 created on
FT                   16-SEP-2002"
FT   CDS             complement(join(3320999..3321361,3321886..3322046,
FT                   3324715..3325405))
FT                   /codon_start=1
FT                   /gene="Hlxb9"
FT                   /locus_tag="mCG_7342"
FT                   /product="homeobox gene HB9"
FT                   /note="gene_id=mCG7342.1 transcript_id=mCT6326.1
FT                   protein_id=mCP3942.1"
FT                   /db_xref="GOA:A2RSX2"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017970"
FT                   /db_xref="InterPro:IPR020479"
FT                   /db_xref="MGI:MGI:109160"
FT                   /db_xref="UniProtKB/TrEMBL:A2RSX2"
FT                   /protein_id="EDL37244.1"
FT                   /translation="MEKSKNFRIDALLAVDPPRAASTQSAPLALVTSLATTVSGPGRGG
FT                   SGGGGTSSGASRSCSPASSEATAAPGDRLRAESPSPPRLLAAHCALLPKPGFLGAGGGG
FT                   GAAGGPGTPHHHAHPGAAAAAAAAAAAAAAGGLALGLHPGGAQGGAGLPAQAALYGHPV
FT                   YSYSAAAAAAALAGQHPALSYSYPQVQGAHPAHPADPIKLGASTFQLDQWLRASTAGMI
FT                   LPKMPDFSSQAQSNLLGKCRRPRTAFTSQQLLELEHQFKLNKYLSRPKRFEVATSLMLT
FT                   ETQVKIWFQNRRMKWKRSKKAKEQAAQEAEKQKGGGGGTGKGGSEEKTEEELMGPPVSG
FT                   DKASGRRLRDLRDSDPDEDEDDEEEDNFPYSNGAGAHAASSDCSSEDDSPPPRLGGPGH
FT                   QPLPQ"
FT   gene            3385023..3385789
FT                   /locus_tag="mCG_11640"
FT                   /note="gene_id=mCG11640.1"
FT   mRNA            3385023..3385789
FT                   /locus_tag="mCG_11640"
FT                   /product="mCG11640"
FT                   /note="gene_id=mCG11640.1 transcript_id=mCT12255.1 created
FT                   on 24-SEP-2002"
FT   CDS             3385237..3385590
FT                   /codon_start=1
FT                   /locus_tag="mCG_11640"
FT                   /product="mCG11640"
FT                   /note="gene_id=mCG11640.1 transcript_id=mCT12255.1
FT                   protein_id=mCP3889.1"
FT                   /protein_id="EDL37245.1"
FT                   /translation="MVTLMTRKDIPPWVKVPEDLKDPEVFQVQSLVLKSLFGPQGSRMS
FT                   HIEQVSQAMFELKNLESPEELIEVFLYGSQNNKVLAKWILQSMAERYRLRQQKGVLKLE
FT                   ESMKTLELGQCIE"
FT   gene            <3416323..3523154
FT                   /gene="Ube3c"
FT                   /locus_tag="mCG_11645"
FT                   /note="gene_id=mCG11645.3"
FT   mRNA            join(<3416323..3416662,3434357..3434410,3436970..3437044,
FT                   3437892..3438038,3444151..3444266,3445941..3446098,
FT                   3447723..3447876,3448214..3448434,3449278..3449429,
FT                   3453979..3454166,3461986..3462072,3466306..3466463,
FT                   3466633..3466865,3478270..3478374,3479828..3479915,
FT                   3482709..3482806,3484716..3484848,3493488..3493735,
FT                   3505287..3505499,3510540..3510728,3510853..3510919,
FT                   3514991..3515121,3521476..3523154)
FT                   /gene="Ube3c"
FT                   /locus_tag="mCG_11645"
FT                   /product="ubiquitin protein ligase E3C, transcript variant
FT                   mCT193576"
FT                   /note="gene_id=mCG11645.3 transcript_id=mCT193576.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(3416327..3416662,3434357..3434410,3436970..3437044,
FT                   3437892..3438038,3444151..3444266,3445941..3446098,
FT                   3447723..3447876,3448214..3448434,3449278..3449429,
FT                   3453979..3454166,3461986..3462072,3466306..3466463,
FT                   3466639..3466865,3478270..3478374,3479828..3479915,
FT                   3482709..3482806,3484716..3484848,3493488..3493735,
FT                   3505287..3505499,3510540..3510728,3510853..3510919,
FT                   3514991..3515121,3521476..3523154)
FT                   /gene="Ube3c"
FT                   /locus_tag="mCG_11645"
FT                   /product="ubiquitin protein ligase E3C, transcript variant
FT                   mCT12260"
FT                   /note="gene_id=mCG11645.3 transcript_id=mCT12260.2 created
FT                   on 01-OCT-2002"
FT   CDS             join(<3416588..3416662,3434357..3434410,3436970..3437044,
FT                   3437892..3438038,3444151..3444266,3445941..3446098,
FT                   3447723..3447876,3448214..3448434,3449278..3449429,
FT                   3453979..3454166,3461986..3462072,3466306..3466463,
FT                   3466633..3466865,3478270..3478374,3479828..3479915,
FT                   3482709..3482806,3484716..3484848,3493488..3493735,
FT                   3505287..3505499,3510540..3510728,3510853..3510919,
FT                   3514991..3515121,3521476..3521646)
FT                   /codon_start=1
FT                   /gene="Ube3c"
FT                   /locus_tag="mCG_11645"
FT                   /product="ubiquitin protein ligase E3C, isoform CRA_a"
FT                   /note="gene_id=mCG11645.3 transcript_id=mCT193576.0
FT                   protein_id=mCP114513.0 isoform=CRA_a"
FT                   /protein_id="EDL37246.1"
FT                   /translation="AAKMFSFEGDFKTRPKVSLGGASRKEEKASLLHRTQEERRKREEE
FT                   RRRLKNAVIIQSFIRGYRDRKQQYFIQRSAFDQCTDSAQPGGTFCLADGPNLTLLVRQL
FT                   LFFYKQSEDSKRLIWLYQNLIKHSSLFVKQLDGSERLTCLFQIKRLMSLCCRLLQNCSD
FT                   DSLNVALPMRMLEVFTSENTYLPVLQDSSYVVSVIEQILHYMVHSGYYRSLYLLINSKL
FT                   PSSIEYSDLSRVPIAKILLENVLKPLHFTYSSCPEASRHQVFSAFTEEFLGAPFTDQIF
FT                   HFVIPAFADAQTVFPYEPFLNALLLLESQSSKRCSGVPWLFYFVLTVGENYLGALSEDG
FT                   LLVYLRVLQTFLSQLPASPTGTGCPDSTSDSEDDNEETDQPNSPEDGRVSAPYITEECL
FT                   RKLDTKQQTNTLLNLVWRDSASEEVFTRMASICHTLMVQHRMMVPKVRLLYSLAFNARF
FT                   LRHLWFLISSMTTQMITGSMVPLLQLISRGSPMSFEDSSRIIPLFYLFSSLFSHSLISI
FT                   HDNEFFGDPIEVVGQRQSSMMPFTLEELILLSRCLRDACLGIIKLAYPETKPEVREEYV
FT                   TAFQSIGVTTNSEMQQCIQMEQKRWVQLFKVITNLVKMLKSRDTRRNFCPPNHWLSEQE
FT                   DIKADKVTQLYVPASRHVWRFRRMGRIGPLQSTLEVGLESLPLSVSEERQLAILTELPF
FT                   VVPFEERVKIFQRLIYADKQEVQGDGPFLDGINVTIRRNYIYEDAYDKLSPENEPDLKK
FT                   RIRVHLLNAHGLDEAGIDGGGIFREFLNELLKSGFNPNQGFFKTTNEGLLYPNPAAQML
FT                   VGDSFARHYYFLGRMLGKALYENMLVELPFAGFFLSKLLGTSADVDIHHLASLDPEVYR
FT                   NLLFLKSYEEDVEELGLNFTVVNNDLGEAQVVELKFGGKDIPVTGANRIAYIHLVADYR
FT                   LNKQIRPHCLAFRQGLANVVSLEWLRMFDQQEIQVLISGAQVPVSLEDLKSFTNYSGGY
FT                   SADHPVIKIFWRVVEGFTDEEKRKLLKFVTSCSRPPLLGFKELYPAFCIHNGGSDLERL
FT                   PTASTCMNLLKLPEFYDEALLRSKLLYAIECAAGFELS"
FT   CDS             join(3416597..3416662,3434357..3434410,3436970..3437044,
FT                   3437892..3438038,3444151..3444266,3445941..3446098,
FT                   3447723..3447876,3448214..3448434,3449278..3449429,
FT                   3453979..3454166,3461986..3462072,3466306..3466463,
FT                   3466639..3466865,3478270..3478374,3479828..3479915,
FT                   3482709..3482806,3484716..3484848,3493488..3493735,
FT                   3505287..3505499,3510540..3510728,3510853..3510919,
FT                   3514991..3515121,3521476..3521646)
FT                   /codon_start=1
FT                   /gene="Ube3c"
FT                   /locus_tag="mCG_11645"
FT                   /product="ubiquitin protein ligase E3C, isoform CRA_b"
FT                   /note="gene_id=mCG11645.3 transcript_id=mCT12260.2
FT                   protein_id=mCP3892.2 isoform=CRA_b"
FT                   /protein_id="EDL37247.1"
FT                   /translation="MFSFEGDFKTRPKVSLGGASRKEEKASLLHRTQEERRKREEERRR
FT                   LKNAVIIQSFIRGYRDRKQQYFIQRSAFDQCTDSAQPGGTFCLADGPNLTLLVRQLLFF
FT                   YKQSEDSKRLIWLYQNLIKHSSLFVKQLDGSERLTCLFQIKRLMSLCCRLLQNCSDDSL
FT                   NVALPMRMLEVFTSENTYLPVLQDSSYVVSVIEQILHYMVHSGYYRSLYLLINSKLPSS
FT                   IEYSDLSRVPIAKILLENVLKPLHFTYSSCPEASRHQVFSAFTEEFLGAPFTDQIFHFV
FT                   IPAFADAQTVFPYEPFLNALLLLESQSSKRCSGVPWLFYFVLTVGENYLGALSEDGLLV
FT                   YLRVLQTFLSQLPASPTGTGCPDSTSDSEDDNEETDQPNSPEDGRVSAPYITEECLRKL
FT                   DTKQQTNTLLNLVWRDSASEEVFTRMASICHTLMVQHRMMVPKVRLLYSLAFNARFLRH
FT                   LWFLISSMTTQMITGSMVPLLQLISRGSPMSFEDSSRIIPLFYLFSSLFSHSLISIHDN
FT                   EFFGDPIEGQRQSSMMPFTLEELILLSRCLRDACLGIIKLAYPETKPEVREEYVTAFQS
FT                   IGVTTNSEMQQCIQMEQKRWVQLFKVITNLVKMLKSRDTRRNFCPPNHWLSEQEDIKAD
FT                   KVTQLYVPASRHVWRFRRMGRIGPLQSTLEVGLESLPLSVSEERQLAILTELPFVVPFE
FT                   ERVKIFQRLIYADKQEVQGDGPFLDGINVTIRRNYIYEDAYDKLSPENEPDLKKRIRVH
FT                   LLNAHGLDEAGIDGGGIFREFLNELLKSGFNPNQGFFKTTNEGLLYPNPAAQMLVGDSF
FT                   ARHYYFLGRMLGKALYENMLVELPFAGFFLSKLLGTSADVDIHHLASLDPEVYRNLLFL
FT                   KSYEEDVEELGLNFTVVNNDLGEAQVVELKFGGKDIPVTGANRIAYIHLVADYRLNKQI
FT                   RPHCLAFRQGLANVVSLEWLRMFDQQEIQVLISGAQVPVSLEDLKSFTNYSGGYSADHP
FT                   VIKIFWRVVEGFTDEEKRKLLKFVTSCSRPPLLGFKELYPAFCIHNGGSDLERLPTAST
FT                   CMNLLKLPEFYDEALLRSKLLYAIECAAGFELS"
FT   gene            complement(3567069..3567600)
FT                   /pseudo
FT                   /locus_tag="mCG_49601"
FT                   /note="gene_id=mCG49601.1"
FT   mRNA            complement(3567069..3567600)
FT                   /pseudo
FT                   /locus_tag="mCG_49601"
FT                   /note="gene_id=mCG49601.1 transcript_id=mCT49784.1 created
FT                   on 18-OCT-2002"
FT   gene            complement(3583157..3614818)
FT                   /locus_tag="mCG_148304"
FT                   /note="gene_id=mCG148304.1"
FT   mRNA            complement(join(3583157..3583841,3614326..3614818))
FT                   /locus_tag="mCG_148304"
FT                   /product="mCG148304"
FT                   /note="gene_id=mCG148304.1 transcript_id=mCT188567.1
FT                   created on 19-MAR-2004"
FT   gene            3583766..3634245
FT                   /locus_tag="mCG_11633"
FT                   /note="gene_id=mCG11633.2"
FT   mRNA            join(3583766..3583905,3596135..3596225,3598728..3598837,
FT                   3600187..3600249,3601332..3601442,3612186..3612317,
FT                   3613293..3613434,3614112..3614182,3628917..3629237,
FT                   3632818..3634245)
FT                   /locus_tag="mCG_11633"
FT                   /product="mCG11633, transcript variant mCT173394"
FT                   /note="gene_id=mCG11633.2 transcript_id=mCT173394.1 created
FT                   on 19-MAR-2004"
FT   mRNA            join(3583766..3583905,3596135..3596225,3598728..3598837,
FT                   3600187..3600249,3601332..3601442,3612186..3612317,
FT                   3613293..3613434,3614112..3614182,3628917..3629474)
FT                   /locus_tag="mCG_11633"
FT                   /product="mCG11633, transcript variant mCT180106"
FT                   /note="gene_id=mCG11633.2 transcript_id=mCT180106.1 created
FT                   on 19-MAR-2004"
FT   mRNA            join(3583766..3583905,3596135..3596225,3598728..3598837,
FT                   3600187..3600249,3601332..3601442,3612186..3612317,
FT                   3613293..3613434,3614112..3614875)
FT                   /locus_tag="mCG_11633"
FT                   /product="mCG11633, transcript variant mCT12247"
FT                   /note="gene_id=mCG11633.2 transcript_id=mCT12247.3 created
FT                   on 19-MAR-2004"
FT   mRNA            join(3583766..3583905,3596135..3596225,3598728..3598837,
FT                   3600187..3600249,3601332..3601442,3604024..3604128,
FT                   3605338..3605758)
FT                   /locus_tag="mCG_11633"
FT                   /product="mCG11633, transcript variant mCT12248"
FT                   /note="gene_id=mCG11633.2 transcript_id=mCT12248.2 created
FT                   on 19-MAR-2004"
FT   CDS             join(3596161..3596225,3598728..3598837,3600187..3600249,
FT                   3601332..3601442,3612186..3612317,3613293..3613434,
FT                   3614112..3614182,3628917..3629237,3632818..3632900)
FT                   /codon_start=1
FT                   /locus_tag="mCG_11633"
FT                   /product="mCG11633, isoform CRA_f"
FT                   /note="gene_id=mCG11633.2 transcript_id=mCT173394.1
FT                   protein_id=mCP96313.1 isoform=CRA_f"
FT                   /protein_id="EDL37254.1"
FT                   /translation="MVDYYEVLGVQRHASPEDIKKAYRKQALKWHPDKNPENKEEAERK
FT                   FKQVAEAYEVLSDAKKRDIYDKYGKEGLNGGGGGGGIHFDSPFEFGFTFRNPDDVFREF
FT                   FGGRDPFSFDFFEDPFDDFFGNRRGPRGNRSRGAGSFFSTFSGFPSFGSGFPAFDTGFT
FT                   PFGSLGHGGLTSFSSTSFGGSGMGNFKSISTSTKIVNGKKITTKRIVENGQERVEVEED
FT                   GQLKSLTINGVADENALAEECQRRGQPTPALAPGPAPAPVRVPSQARPLAPTPAPTPAP
FT                   TPAPAPAQTPAPSVSTRPQKPPRPAPTAKLGSKSNWEDDEQDRQRVPGNWDAPMTSAGL
FT                   KEGGKRKKQKQKEDLKKKKSTKGNH"
FT   CDS             join(3596161..3596225,3598728..3598837,3600187..3600249,
FT                   3601332..3601442,3612186..3612317,3613293..3613434,
FT                   3614112..3614182,3628917..3629341)
FT                   /codon_start=1
FT                   /locus_tag="mCG_11633"
FT                   /product="mCG11633, isoform CRA_b"
FT                   /note="gene_id=mCG11633.2 transcript_id=mCT180106.1
FT                   protein_id=mCP103030.1 isoform=CRA_b"
FT                   /protein_id="EDL37250.1"
FT                   /translation="MVDYYEVLGVQRHASPEDIKKAYRKQALKWHPDKNPENKEEAERK
FT                   FKQVAEAYEVLSDAKKRDIYDKYGKEGLNGGGGGGGIHFDSPFEFGFTFRNPDDVFREF
FT                   FGGRDPFSFDFFEDPFDDFFGNRRGPRGNRSRGAGSFFSTFSGFPSFGSGFPAFDTGFT
FT                   PFGSLGHGGLTSFSSTSFGGSGMGNFKSISTSTKIVNGKKITTKRIVENGQERVEVEED
FT                   GQLKSLTINGVADENALAEECQRRGQPTPALAPGPAPAPVRVPSQARPLAPTPAPTPAP
FT                   TPAPAPAQTPAPSVSTRPQKPPRPAPTAKLGSKSNWEDDEQDRQRVPGNWDAPMTSAGV
FT                   QKGDGVEHPQSVLPPGPGQQTQESGLCCCILT"
FT   CDS             join(3596161..3596225,3598728..3598837,3600187..3600249,
FT                   3601332..3601442,3612186..3612317,3613293..3613434,
FT                   3614112..3614217)
FT                   /codon_start=1
FT                   /locus_tag="mCG_11633"
FT                   /product="mCG11633, isoform CRA_a"
FT                   /note="gene_id=mCG11633.2 transcript_id=mCT12247.3
FT                   protein_id=mCP4025.3 isoform=CRA_a"
FT                   /protein_id="EDL37249.1"
FT                   /translation="MVDYYEVLGVQRHASPEDIKKAYRKQALKWHPDKNPENKEEAERK
FT                   FKQVAEAYEVLSDAKKRDIYDKYGKEGLNGGGGGGGIHFDSPFEFGFTFRNPDDVFREF
FT                   FGGRDPFSFDFFEDPFDDFFGNRRGPRGNRSRGAGSFFSTFSGFPSFGSGFPAFDTGFT
FT                   PFGSLGHGGLTSFSSTSFGGSGMGNFKSISTSTKIVNGKKITTKRIVENGQERVEVEED
FT                   GQLKSLTINGKEHLLRLDNK"
FT   CDS             join(3596161..3596225,3598728..3598837,3600187..3600249,
FT                   3601332..3601442,3604024..3604128,3605338..3605669)
FT                   /codon_start=1
FT                   /locus_tag="mCG_11633"
FT                   /product="mCG11633, isoform CRA_e"
FT                   /note="gene_id=mCG11633.2 transcript_id=mCT12248.2
FT                   protein_id=mCP3977.2 isoform=CRA_e"
FT                   /db_xref="GOA:G3X8S5"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="MGI:MGI:1344381"
FT                   /db_xref="UniProtKB/TrEMBL:G3X8S5"
FT                   /protein_id="EDL37253.1"
FT                   /translation="MVDYYEVLGVQRHASPEDIKKAYRKQALKWHPDKNPENKEEAERK
FT                   FKQVAEAYEVLSDAKKRDIYDKYGKEGLNGGGGGGGIHFDSPFEFGFTFRNPDDVFREF
FT                   FGGRDPFSFDFFGLLGDFHFQAVRIFAQEKKLLHGYYVYEVTVQPTGGFEEVASEDLEP
FT                   SEELDQPCFEESVEDALSDEHSEVLDVISSEELDLSEDESSEGCSWGQGGLLSEDLDLV
FT                   SSEEEASLGDAEELSEEYEELLSEEEHSGPDPEALLVQQ"
FT   mRNA            join(3598512..3598837,3600187..3600249,3601332..3601442,
FT                   3612186..3612317,3613293..3613434,3614112..3614182,
FT                   3628917..3629237,3632818..3634245)
FT                   /locus_tag="mCG_11633"
FT                   /product="mCG11633, transcript variant mCT180107"
FT                   /note="gene_id=mCG11633.2 transcript_id=mCT180107.1 created
FT                   on 19-MAR-2004"
FT   mRNA            join(<3602222..3602381,3604024..3604128,3605338..3605758)
FT                   /locus_tag="mCG_11633"
FT                   /product="mCG11633, transcript variant mCT180108"
FT                   /note="gene_id=mCG11633.2 transcript_id=mCT180108.1 created
FT                   on 19-MAR-2004"
FT   CDS             join(<3602357..3602381,3604024..3604128,3605338..3605669)
FT                   /codon_start=1
FT                   /locus_tag="mCG_11633"
FT                   /product="mCG11633, isoform CRA_d"
FT                   /note="gene_id=mCG11633.2 transcript_id=mCT180108.1
FT                   protein_id=mCP103029.1 isoform=CRA_d"
FT                   /protein_id="EDL37252.1"
FT                   /translation="RGTSHPGSGLLGDFHFQAVRIFAQEKKLLHGYYVYEVTVQPTGGF
FT                   EEVASEDLEPSEELDQPCFEESVEDALSDEHSEVLDVISSEELDLSEDESSEGCSWGQG
FT                   GLLSEDLDLVSSEEEASLGDAEELSEEYEELLSEEEHSGPDPEALLVQQ"
FT   CDS             join(3613367..3613434,3614112..3614182,3628917..3629237,
FT                   3632818..3632900)
FT                   /codon_start=1
FT                   /locus_tag="mCG_11633"
FT                   /product="mCG11633, isoform CRA_c"
FT                   /note="gene_id=mCG11633.2 transcript_id=mCT180107.1
FT                   protein_id=mCP103028.1 isoform=CRA_c"
FT                   /protein_id="EDL37251.1"
FT                   /translation="MGNFKSISTSTKIVNGKKITTKRIVENGQERVEVEEDGQLKSLTI
FT                   NGVADENALAEECQRRGQPTPALAPGPAPAPVRVPSQARPLAPTPAPTPAPTPAPAPAQ
FT                   TPAPSVSTRPQKPPRPAPTAKLGSKSNWEDDEQDRQRVPGNWDAPMTSAGLKEGGKRKK
FT                   QKQKEDLKKKKSTKGNH"
FT   CDS             complement(3614520..3614612)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148304"
FT                   /product="mCG148304"
FT                   /note="gene_id=mCG148304.1 transcript_id=mCT188567.1
FT                   protein_id=mCP109218.1"
FT                   /protein_id="EDL37248.1"
FT                   /translation="MLSPQQADTTHSQFTTMGSRSMLVLQTVSS"
FT   gene            3635670..3637172
FT                   /locus_tag="mCG_148308"
FT                   /note="gene_id=mCG148308.0"
FT   mRNA            join(3635670..3636860,3637104..3637172)
FT                   /locus_tag="mCG_148308"
FT                   /product="mCG148308"
FT                   /note="gene_id=mCG148308.0 transcript_id=mCT188571.0
FT                   created on 13-JAN-2004"
FT   CDS             3635718..3635858
FT                   /codon_start=1
FT                   /locus_tag="mCG_148308"
FT                   /product="mCG148308"
FT                   /note="gene_id=mCG148308.0 transcript_id=mCT188571.0
FT                   protein_id=mCP109222.0"
FT                   /protein_id="EDL37255.1"
FT                   /translation="MSKGDSWSIKKLLPDMSLSTDLPSVVPPYLRAMMKIVGLKRLSNM
FT                   W"
FT   gene            complement(3641913..3642967)
FT                   /pseudo
FT                   /locus_tag="mCG_11639"
FT                   /note="gene_id=mCG11639.1"
FT   mRNA            complement(3641913..3642967)
FT                   /pseudo
FT                   /locus_tag="mCG_11639"
FT                   /note="gene_id=mCG11639.1 transcript_id=mCT12254.1 created
FT                   on 01-OCT-2002"
FT   gene            complement(3654525..3656232)
FT                   /pseudo
FT                   /locus_tag="mCG_51660"
FT                   /note="gene_id=mCG51660.2"
FT   mRNA            complement(3654525..3656232)
FT                   /pseudo
FT                   /locus_tag="mCG_51660"
FT                   /note="gene_id=mCG51660.2 transcript_id=mCT51843.2 created
FT                   on 18-OCT-2002"
FT   gene            complement(3679048..3681469)
FT                   /pseudo
FT                   /locus_tag="mCG_52324"
FT                   /note="gene_id=mCG52324.2"
FT   mRNA            complement(3679048..3681469)
FT                   /pseudo
FT                   /locus_tag="mCG_52324"
FT                   /note="gene_id=mCG52324.2 transcript_id=mCT52507.2 created
FT                   on 14-OCT-2002"
FT   gene            complement(3844545..>3857202)
FT                   /locus_tag="mCG_1046205"
FT                   /note="gene_id=mCG1046205.0"
FT   mRNA            complement(join(3844545..3844778,3852879..3852968,
FT                   3857171..>3857202))
FT                   /locus_tag="mCG_1046205"
FT                   /product="mCG1046205"
FT                   /note="gene_id=mCG1046205.0 transcript_id=mCT163909.0
FT                   created on 14-OCT-2002"
FT   CDS             complement(3844558..>3844761)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1046205"
FT                   /product="mCG1046205"
FT                   /note="gene_id=mCG1046205.0 transcript_id=mCT163909.0
FT                   protein_id=mCP65090.0"
FT                   /protein_id="EDL37256.1"
FT                   /translation="SLTPSFGEPWLTSEEGLLLSSVPSTHIRHHSRLPVTTASEGLTPF
FT                   SGLSVRLHSHSCAHIYTHIHII"
FT   gene            <3861546..3868382
FT                   /gene="Il6"
FT                   /locus_tag="mCG_11634"
FT                   /note="gene_id=mCG11634.2"
FT   mRNA            join(<3861546..3861614,3861780..3861964,3863223..3863336,
FT                   3866404..3868382)
FT                   /gene="Il6"
FT                   /locus_tag="mCG_11634"
FT                   /product="interleukin 6, transcript variant mCT193535"
FT                   /note="gene_id=mCG11634.2 transcript_id=mCT193535.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(3861565..3861614,3861780..3861964,3863223..3863336,
FT                   3866404..3866553,3867782..3868369)
FT                   /gene="Il6"
FT                   /locus_tag="mCG_11634"
FT                   /product="interleukin 6, transcript variant mCT12249"
FT                   /note="gene_id=mCG11634.2 transcript_id=mCT12249.1 created
FT                   on 16-SEP-2002"
FT   CDS             join(<3861578..3861614,3861780..3861964,3863223..3863336,
FT                   3866404..3866712)
FT                   /codon_start=1
FT                   /gene="Il6"
FT                   /locus_tag="mCG_11634"
FT                   /product="interleukin 6, isoform CRA_a"
FT                   /note="gene_id=mCG11634.2 transcript_id=mCT193535.0
FT                   protein_id=mCP114512.0 isoform=CRA_a"
FT                   /protein_id="EDL37257.1"
FT                   /translation="SIPETAMKFLSARDFHPVAFLGLMLVTTTAFPTSQVRRGDFTEDT
FT                   TPNRPVYTTSQVGGLITHVLWEIVEMRKELCNGNSDCMNNDDALAENNLKLPEIQRNDG
FT                   CYQTGYNQEICLLKISSGLLEYHSYLEYMKNNLKDNKKDKARVLQRDTETLIHIFNQEV
FT                   SASPSLMQCGKEDTRHLRVAALFPDSCSEGRESEQQFLIIRPCFVLLWGFV"
FT   CDS             join(3861596..3861614,3861780..3861964,3863223..3863336,
FT                   3866404..3866553,3867782..3867949)
FT                   /codon_start=1
FT                   /gene="Il6"
FT                   /locus_tag="mCG_11634"
FT                   /product="interleukin 6, isoform CRA_b"
FT                   /note="gene_id=mCG11634.2 transcript_id=mCT12249.1
FT                   protein_id=mCP3999.2 isoform=CRA_b"
FT                   /db_xref="GOA:A2RTD1"
FT                   /db_xref="InterPro:IPR003573"
FT                   /db_xref="InterPro:IPR003574"
FT                   /db_xref="InterPro:IPR009079"
FT                   /db_xref="InterPro:IPR012351"
FT                   /db_xref="MGI:MGI:96559"
FT                   /db_xref="UniProtKB/TrEMBL:A2RTD1"
FT                   /protein_id="EDL37258.1"
FT                   /translation="MKFLSARDFHPVAFLGLMLVTTTAFPTSQVRRGDFTEDTTPNRPV
FT                   YTTSQVGGLITHVLWEIVEMRKELCNGNSDCMNNDDALAENNLKLPEIQRNDGCYQTGY
FT                   NQEICLLKISSGLLEYHSYLEYMKNNLKDNKKDKARVLQRDTETLIHIFNQEVKDLHKI
FT                   VLPTPISNALLTDKLESQKEWLRTKTIQFILKSLEEFLKVTLRSTRQT"
FT   gene            3887921..3889075
FT                   /pseudo
FT                   /locus_tag="mCG_1046024"
FT                   /note="gene_id=mCG1046024.1"
FT   mRNA            3887921..3889075
FT                   /pseudo
FT                   /locus_tag="mCG_1046024"
FT                   /note="gene_id=mCG1046024.1 transcript_id=mCT163728.1
FT                   created on 18-OCT-2002"
FT   gene            complement(3904549..3922351)
FT                   /gene="Tyms"
FT                   /locus_tag="mCG_11630"
FT                   /note="gene_id=mCG11630.1"
FT   mRNA            complement(join(3904549..3904685,3909675..3909862,
FT                   3910697..3910768,3911965..3912140,3912814..3912915,
FT                   3917168..3917342,3920345..3920418,3922072..3922351))
FT                   /gene="Tyms"
FT                   /locus_tag="mCG_11630"
FT                   /product="thymidylate synthase, transcript variant
FT                   mCT12244"
FT                   /note="gene_id=mCG11630.1 transcript_id=mCT12244.2 created
FT                   on 24-SEP-2002"
FT   mRNA            complement(join(3907556..3909862,3910697..3910768,
FT                   3911965..3912140,3912814..3912915,3917168..3917342,
FT                   3920345..3920418,3922072..>3922293))
FT                   /gene="Tyms"
FT                   /locus_tag="mCG_11630"
FT                   /product="thymidylate synthase, transcript variant
FT                   mCT193533"
FT                   /note="gene_id=mCG11630.1 transcript_id=mCT193533.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(3909725..3909862,3910697..3910768,
FT                   3911965..3912140,3912814..3912915,3917168..3917342,
FT                   3920345..3920418,3922072..>3922291))
FT                   /codon_start=1
FT                   /gene="Tyms"
FT                   /locus_tag="mCG_11630"
FT                   /product="thymidylate synthase, isoform CRA_a"
FT                   /note="gene_id=mCG11630.1 transcript_id=mCT193533.0
FT                   protein_id=mCP114511.0 isoform=CRA_a"
FT                   /protein_id="EDL37259.1"
FT                   /translation="SLTTLLPDCSVMLVVGSELQSDAQQLSAEAPRHGELQYLRQVEHI
FT                   LRCGFKKEDRTGTGTLSVFGMQARYSLRDEFPLLTTKRVFWKGVLEELLWFIKGSTNAK
FT                   ELSSKGVRIWDANGSRDFLDSLGFSARQEGDLGPVYGFQWRHFGAEYKDMDSDYSGQGV
FT                   DQLQKVIDTIKTNPDDRRIIMCAWNPKDLPLMALPPCHALCQFYVVNGELSCQLYQRSG
FT                   DMGLGVPFNIASYALLTYMIAHITGLQPGDFVHTLGDAHIYLNHIEPLKIQLQREPRPF
FT                   PKLKILRKVETIDDFKVEDFQIEGYNPHPTIKMEMAV"
FT   CDS             complement(join(3909725..3909862,3910697..3910768,
FT                   3911965..3912140,3912814..3912915,3917168..3917342,
FT                   3920345..3920418,3922072..3922258))
FT                   /codon_start=1
FT                   /gene="Tyms"
FT                   /locus_tag="mCG_11630"
FT                   /product="thymidylate synthase, isoform CRA_b"
FT                   /note="gene_id=mCG11630.1 transcript_id=mCT12244.2
FT                   protein_id=mCP3932.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q544L2"
FT                   /db_xref="InterPro:IPR000398"
FT                   /db_xref="InterPro:IPR020940"
FT                   /db_xref="InterPro:IPR023451"
FT                   /db_xref="MGI:MGI:98878"
FT                   /db_xref="UniProtKB/TrEMBL:Q544L2"
FT                   /protein_id="EDL37260.1"
FT                   /translation="MLVVGSELQSDAQQLSAEAPRHGELQYLRQVEHILRCGFKKEDRT
FT                   GTGTLSVFGMQARYSLRDEFPLLTTKRVFWKGVLEELLWFIKGSTNAKELSSKGVRIWD
FT                   ANGSRDFLDSLGFSARQEGDLGPVYGFQWRHFGAEYKDMDSDYSGQGVDQLQKVIDTIK
FT                   TNPDDRRIIMCAWNPKDLPLMALPPCHALCQFYVVNGELSCQLYQRSGDMGLGVPFNIA
FT                   SYALLTYMIAHITGLQPGDFVHTLGDAHIYLNHIEPLKIQLQREPRPFPKLKILRKVET
FT                   IDDFKVEDFQIEGYNPHPTIKMEMAV"
FT   gene            complement(3944738..3946393)
FT                   /pseudo
FT                   /locus_tag="mCG_11638"
FT                   /note="gene_id=mCG11638.2"
FT   mRNA            complement(3944738..3946393)
FT                   /pseudo
FT                   /locus_tag="mCG_11638"
FT                   /note="gene_id=mCG11638.2 transcript_id=mCT12253.2 created
FT                   on 01-OCT-2002"
FT   gene            3954035..3967818
FT                   /locus_tag="mCG_11643"
FT                   /note="gene_id=mCG11643.2"
FT   mRNA            join(3954035..3954225,3957074..3957214,3962120..3962250,
FT                   3962762..3963445,3963641..3963823,3964723..3964892,
FT                   3965097..3966103,3966653..3967818)
FT                   /locus_tag="mCG_11643"
FT                   /product="mCG11643"
FT                   /note="gene_id=mCG11643.2 transcript_id=mCT12258.2 created
FT                   on 02-OCT-2002"
FT   CDS             join(3954114..3954225,3957074..3957214,3962120..3962250,
FT                   3962762..3963445,3963641..3963823,3964723..3964892,
FT                   3965097..3966103,3966653..3966933)
FT                   /codon_start=1
FT                   /locus_tag="mCG_11643"
FT                   /product="mCG11643"
FT                   /note="gene_id=mCG11643.2 transcript_id=mCT12258.2
FT                   protein_id=mCP4028.2"
FT                   /protein_id="EDL37261.1"
FT                   /translation="MEKLAAGLAGLRWSMGAFPLDLIVSRCRLPTLACLGPGEYAEGVS
FT                   ERDILLIHSCRQWTTVTAHTLEEGHYVIGPKIDIPLQYPGKFKLLEQARDVREPVRYFS
FT                   SVEEVASVFPDRIFVMEAITFSVKVVSGEFSEDSEVYNFTLHAGDELTLMGQAEILCAK
FT                   TTKERSRFTTLLRKLGRAGALAGIGGPGSMGATGGGGGAARPVKSKMPCLICMNHRTNE
FT                   SLSLPFQCQGRFSTRSPLELQMQEGEHTVRAIIERVRLPVNVLVPSRPPRNPYDLHPVR
FT                   EGHCYKLVSIISKTVVLGLALRREGPAPLHFLLLTDTPRFTLPQGLLAGDPRVERLVRD
FT                   SASYCRERFDPDEYSTPAGGCAEIPYEELWVHQAPESRADARARPLAGPDLISFGIVGP
FT                   PRHEPEAPPPPVPPKSEAVKEECRLLHAPPVPPRGGGSCSKLTGSPPVLPHFPKLQPVH
FT                   SPSSSLSYYSSGLQDGAGSRSGSGSPSPDAYSLYCYPCTWGDCKASESSSRPPPGPLPS
FT                   TTTQPSQASRGLSEPLSGRTPSLLGADTPVVKNYHSCPPLFKSSRPQKSFAPFGALNPF
FT                   SGPAHPSGAPAASSSGSISTSGVLATSSPTHSPGPGPGPQGQGYSAAPSSSLSSSEWQE
FT                   PALEPLDPFELGQASPPELELVRCQEPRAAGAPGSGPCLSPLGQPKAFEPEGLVLRQVP
FT                   ASLSPAALQGPEAGGTLLFLTQGCLEGPPGSPREGATGAGVRDASSWQPPADLSALSLE
FT                   EVSRSLRFIGLSEDVVSFFARERIDGSIFVQLSEDILADDFHLTKLQVKKIMQFIKVDQ
FT                   LQAYVQHQSPCSDIITDSLLFSTEEPDVSQTPPAYQSPAISFGSNGLLVASLVCHWYRT
FT                   ASGSERLLAPELSHLFTWFRADLCTLQTQVW"
FT   gene            complement(3968261..4003950)
FT                   /gene="Hadha"
FT                   /locus_tag="mCG_11632"
FT                   /note="gene_id=mCG11632.2"
FT   mRNA            complement(join(3968261..3968796,3968881..3969026,
FT                   3969524..3969638,3970174..3970369,3970986..3971054,
FT                   3971457..3971597,3972444..3972530,3975401..3975572,
FT                   3977636..3977770,3978657..3978766,3981079..3981135,
FT                   3982897..3983015,3983818..3983940,3989790..3989892,
FT                   3991560..3991679,3993000..3993138,3994076..3994209,
FT                   3996183..3996253,3996817..3996858,4003719..4003950))
FT                   /gene="Hadha"
FT                   /locus_tag="mCG_11632"
FT                   /product="hydroxyacyl-Coenzyme A
FT                   dehydrogenase/3-ketoacyl-Coenzyme A thiolase/enoyl-Coenzyme
FT                   A hydratase (trifunctional protein), alpha subunit,
FT                   transcript variant mCT12246"
FT                   /note="gene_id=mCG11632.2 transcript_id=mCT12246.2 created
FT                   on 02-OCT-2002"
FT   mRNA            complement(join(3968261..3968796,3968881..3969026,
FT                   3972492..3972530,3975401..3975420,3982948..3983015,
FT                   3983818..3983940,3989790..3989885,3991556..>3991591))
FT                   /gene="Hadha"
FT                   /locus_tag="mCG_11632"
FT                   /product="hydroxyacyl-Coenzyme A
FT                   dehydrogenase/3-ketoacyl-Coenzyme A thiolase/enoyl-Coenzyme
FT                   A hydratase (trifunctional protein), alpha subunit,
FT                   transcript variant mCT173994"
FT                   /note="gene_id=mCG11632.2 transcript_id=mCT173994.0 created
FT                   on 02-OCT-2002"
FT   CDS             complement(join(3968651..3968796,3968881..3969026,
FT                   3969524..3969638,3970174..3970369,3970986..3971054,
FT                   3971457..3971597,3972444..3972530,3975401..3975572,
FT                   3977636..3977770,3978657..3978766,3981079..3981135,
FT                   3982897..3983015,3983818..3983940,3989790..3989892,
FT                   3991560..3991679,3993000..3993138,3994076..3994209,
FT                   3996183..3996253,3996817..3996858,4003719..4003785))
FT                   /codon_start=1
FT                   /gene="Hadha"
FT                   /locus_tag="mCG_11632"
FT                   /product="hydroxyacyl-Coenzyme A
FT                   dehydrogenase/3-ketoacyl-Coenzyme A thiolase/enoyl-Coenzyme
FT                   A hydratase (trifunctional protein), alpha subunit, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG11632.2 transcript_id=mCT12246.2
FT                   protein_id=mCP3959.2 isoform=CRA_a"
FT                   /protein_id="EDL37262.1"
FT                   /translation="MVASRAIGSLSRFSAFRILRSRGCICRSFTTSSALLTRTHINYGV
FT                   KGDVAVIRINSPNSKVNTLNKEVQSEFIEVMNEIWANDQIRSAVLISSKPGCFVAGADI
FT                   NMLSSCTTPQEATRISQEGQRMFEKLEKSPKPVVAAISGSCLGGGLELAIACQYRIATK
FT                   DRKTVLGVPEVLLGILPGAGGTQRLPKMVGVPAAFDMMLTGRNIRADRAKKMGLVDQLV
FT                   EPLGPGIKSPEERTIEYLEEVAVNFAKGLADRKVSAKQSKGLVEKLTTYAMTVPFVRQQ
FT                   VYKTVEEKVKKQTKGLYPAPLKIIDAVKAGLEQGSDAGYLAESQKFGELALTKESKALM
FT                   GLYNGQVLCKKNKFGAPQKNVQQLAILGAGLMGAGIAQVSVDKGLKTLLKDTTVTGLGR
FT                   GQQQVFKGLNDKVKKKALTSFERDSIFSNLIGQLDYKGFEKADMVIEAVFEDLGVKHKV
FT                   LKEVESVTPEHCIFASNTSALPINQIAAVSKRPEKVIGMHYFSPVDKMQLLEIITTDKT
FT                   SKDTTASAVAVGLRQGKVIIVVKDGPGFYTTRCLAPMMSEVMRILQEGVDPKKLDALTT
FT                   GFGFPVGAATLADEVGVDVAQHVAEDLGKAFGERFGGGSVELLKQMVSKGFLGRKSGKG
FT                   FYIYQEGSKNKSLNSEMDNILANLRLPAKPEVSSDEDVQYRVITRFVNEAVLCLQEGIL
FT                   ATPAEGDIGAVFGLGFPPCLGGPFRFVDLYGAQKVVDRLRKYESAYGTQFTPCQLLLDH
FT                   ANNSSKKFYQ"
FT   CDS             complement(join(3975415..3975420,3982948..3983015,
FT                   3983818..3983940,3989790..3989885,3991556..>3991589))
FT                   /codon_start=1
FT                   /gene="Hadha"
FT                   /locus_tag="mCG_11632"
FT                   /product="hydroxyacyl-Coenzyme A
FT                   dehydrogenase/3-ketoacyl-Coenzyme A thiolase/enoyl-Coenzyme
FT                   A hydratase (trifunctional protein), alpha subunit, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG11632.2 transcript_id=mCT173994.0
FT                   protein_id=mCP96913.0 isoform=CRA_b"
FT                   /protein_id="EDL37263.1"
FT                   /translation="AGGTQRLPKMVMPAAFDMMLTGRNIRADRAKKMGLVDQLVEPLGP
FT                   GIKSPEERTIEYLEEVAVNFAKGLADRKVSAKQSKGLVEKLTTYAMTVPFVRQQVYKTV
FT                   EEKC"
FT   gene            4004060..4033426
FT                   /locus_tag="mCG_11629"
FT                   /note="gene_id=mCG11629.2"
FT   mRNA            join(4004060..4004223,4012506..4012580,4012863..4012907,
FT                   4015502..4015601,4017361..4017405,4018333..4018432,
FT                   4021463..4021550,4022647..4022834,4023628..4023808,
FT                   4025725..4025846,4027477..4027556,4027634..4027681,
FT                   4028389..4028476,4029152..4029226,4029758..4029922,
FT                   4032890..4033426)
FT                   /locus_tag="mCG_11629"
FT                   /product="mCG11629, transcript variant mCT12243"
FT                   /note="gene_id=mCG11629.2 transcript_id=mCT12243.2 created
FT                   on 13-FEB-2003"
FT   mRNA            join(<4004125..4004219,4012506..4012580,4012863..4012907,
FT                   4015502..4015601,4017361..4017405,4018333..4018432,
FT                   4021463..4021550,4022647..4022834,4023628..4023808,
FT                   4025725..4025846,4027477..4027556,4027634..4027681,
FT                   4028389..4028476,4029152..4029226,4029758..4029922,
FT                   4032890..4033327)
FT                   /locus_tag="mCG_11629"
FT                   /product="mCG11629, transcript variant mCT193632"
FT                   /note="gene_id=mCG11629.2 transcript_id=mCT193632.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(4004126..4004176,4012506..4012580,4012863..4012907,
FT                   4015502..4015601,4017361..4017405,4018333..4018432,
FT                   4021463..4021550,4022647..4022834,4023628..4023808,
FT                   4025725..4025846,4027477..4027556,4027634..4027681,
FT                   4028389..4028476,4029152..4029226,4029758..4029922,
FT                   4032890..4033421)
FT                   /locus_tag="mCG_11629"
FT                   /product="mCG11629, transcript variant mCT180104"
FT                   /note="gene_id=mCG11629.2 transcript_id=mCT180104.0 created
FT                   on 13-FEB-2003"
FT   CDS             join(<4004126..4004219,4012506..4012580,4012863..4012907,
FT                   4015502..4015601,4017361..4017405,4018333..4018432,
FT                   4021463..4021550,4022647..4022834,4023628..4023808,
FT                   4025725..4025846,4027477..4027556,4027634..4027681,
FT                   4028389..4028476,4029152..4029226,4029758..4029922,
FT                   4032890..4032925)
FT                   /codon_start=1
FT                   /locus_tag="mCG_11629"
FT                   /product="mCG11629, isoform CRA_d"
FT                   /note="gene_id=mCG11629.2 transcript_id=mCT193632.0
FT                   protein_id=mCP114558.0 isoform=CRA_d"
FT                   /protein_id="EDL37268.1"
FT                   /translation="VSLDLTLLAAAVFADSKVRQRASRFSSDFPTDFRMTTILTSTFRN
FT                   LSTTSKWALRSSIRPLSCSSQLHSAPAVQTKSKKTLAKPNMKNIVVVEGVRIPFLLSGT
FT                   SYKDLMPHDLARAALSGLLHRTNIPKDVVDYIIFGTVIQEVKTSNVAREAALGAGFSDK
FT                   TPAHTVTMACISSNQAMTTAVGLIASGQCDVVVAGGVELMSDVPIRHSRNMRKMMLDLN
FT                   KAKTLGQRLSLLSKFRLNFLSPELPAVAEFSTNETMGHSADRLAAAFAVSRMEQDEYAL
FT                   RSHSLAKKAQDEGHLSDIVPFKVPGKDTVTKDNGIRPSSLEQMAKLKPAFIKPYGTVTA
FT                   ANSSFLTDGASAMLIMSEDRALAMGYKPKAYLRDFIYVSQDPKDQLLLGPTYATPKVLE
FT                   KAGLTMNDIDAFEFHEAFSGQILANFKAMDSDWFAQNYMGRKTKVGSPPLEKFNIWGGS
FT                   LSLGHPFGATGCRLVMAAANRLRKDGGQYALVAACAAGGQGHAMIVEAYPK"
FT   mRNA            join(4004156..4004219,4012506..4012580,4012863..4012907,
FT                   4015502..4015601,4017361..4017405,4018333..4018366,
FT                   4029875..4029922,4032890..4033011)
FT                   /locus_tag="mCG_11629"
FT                   /product="mCG11629, transcript variant mCT180105"
FT                   /note="gene_id=mCG11629.2 transcript_id=mCT180105.0 created
FT                   on 13-FEB-2003"
FT   mRNA            join(<4012503..4012580,4012863..4012907,4015502..4015601,
FT                   4022690..4022834,4023626..>4023694)
FT                   /locus_tag="mCG_11629"
FT                   /product="mCG11629, transcript variant mCT173680"
FT                   /note="gene_id=mCG11629.2 transcript_id=mCT173680.0 created
FT                   on 13-FEB-2003"
FT   CDS             join(<4012505..4012580,4012863..4012907,4015502..4015601,
FT                   4022690..4022834,4023626..>4023694)
FT                   /codon_start=1
FT                   /locus_tag="mCG_11629"
FT                   /product="mCG11629, isoform CRA_e"
FT                   /note="gene_id=mCG11629.2 transcript_id=mCT173680.0
FT                   protein_id=mCP96599.0 isoform=CRA_e"
FT                   /protein_id="EDL37269.1"
FT                   /translation="DFRMTTILTSTFRNLSTTSKWALRSSIRPLSCSSQLHSAPAVQTK
FT                   SKKTLAKPNMKNIVVVEGVRIPFLLSGTSGGVELMSDVPIRHSRNMRKMMLDLNKAKTL
FT                   GQRLSLLSKFRLNFLSPESSLQWLSSPLMRPWATLQTDWLL"
FT   CDS             join(4012514..4012580,4012863..4012907,4015502..4015601,
FT                   4017361..4017405,4018333..4018432,4021463..4021550,
FT                   4022647..4022834,4023628..4023808,4025725..4025846,
FT                   4027477..4027556,4027634..4027681,4028389..4028476,
FT                   4029152..4029226,4029758..4029922,4032890..4032925)
FT                   /codon_start=1
FT                   /locus_tag="mCG_11629"
FT                   /product="mCG11629, isoform CRA_a"
FT                   /note="gene_id=mCG11629.2 transcript_id=mCT12243.2
FT                   protein_id=mCP3938.2 isoform=CRA_a"
FT                   /protein_id="EDL37264.1"
FT                   /translation="MTTILTSTFRNLSTTSKWALRSSIRPLSCSSQLHSAPAVQTKSKK
FT                   TLAKPNMKNIVVVEGVRIPFLLSGTSYKDLMPHDLARAALSGLLHRTNIPKDVVDYIIF
FT                   GTVIQEVKTSNVAREAALGAGFSDKTPAHTVTMACISSNQAMTTAVGLIASGQCDVVVA
FT                   GGVELMSDVPIRHSRNMRKMMLDLNKAKTLGQRLSLLSKFRLNFLSPELPAVAEFSTNE
FT                   TMGHSADRLAAAFAVSRMEQDEYALRSHSLAKKAQDEGHLSDIVPFKVPGKDTVTKDNG
FT                   IRPSSLEQMAKLKPAFIKPYGTVTAANSSFLTDGASAMLIMSEDRALAMGYKPKAYLRD
FT                   FIYVSQDPKDQLLLGPTYATPKVLEKAGLTMNDIDAFEFHEAFSGQILANFKAMDSDWF
FT                   AQNYMGRKTKVGSPPLEKFNIWGGSLSLGHPFGATGCRLVMAAANRLRKDGGQYALVAA
FT                   CAAGGQGHAMIVEAYPK"
FT   CDS             join(4012514..4012580,4012863..4012907,4015502..4015601,
FT                   4017361..4017405,4018333..4018432,4021463..4021550,
FT                   4022647..4022834,4023628..4023808,4025725..4025846,
FT                   4027477..4027556,4027634..4027681,4028389..4028476,
FT                   4029152..4029226,4029758..4029922,4032890..4032925)
FT                   /codon_start=1
FT                   /locus_tag="mCG_11629"
FT                   /product="mCG11629, isoform CRA_a"
FT                   /note="gene_id=mCG11629.2 transcript_id=mCT180104.0
FT                   protein_id=mCP103026.0 isoform=CRA_a"
FT                   /protein_id="EDL37266.1"
FT                   /translation="MTTILTSTFRNLSTTSKWALRSSIRPLSCSSQLHSAPAVQTKSKK
FT                   TLAKPNMKNIVVVEGVRIPFLLSGTSYKDLMPHDLARAALSGLLHRTNIPKDVVDYIIF
FT                   GTVIQEVKTSNVAREAALGAGFSDKTPAHTVTMACISSNQAMTTAVGLIASGQCDVVVA
FT                   GGVELMSDVPIRHSRNMRKMMLDLNKAKTLGQRLSLLSKFRLNFLSPELPAVAEFSTNE
FT                   TMGHSADRLAAAFAVSRMEQDEYALRSHSLAKKAQDEGHLSDIVPFKVPGKDTVTKDNG
FT                   IRPSSLEQMAKLKPAFIKPYGTVTAANSSFLTDGASAMLIMSEDRALAMGYKPKAYLRD
FT                   FIYVSQDPKDQLLLGPTYATPKVLEKAGLTMNDIDAFEFHEAFSGQILANFKAMDSDWF
FT                   AQNYMGRKTKVGSPPLEKFNIWGGSLSLGHPFGATGCRLVMAAANRLRKDGGQYALVAA
FT                   CAAGGQGHAMIVEAYPK"
FT   CDS             join(4012514..4012580,4012863..4012907,4015502..4015601,
FT                   4017361..4017405,4018333..4018366,4029875..4029922,
FT                   4032890..4032925)
FT                   /codon_start=1
FT                   /locus_tag="mCG_11629"
FT                   /product="mCG11629, isoform CRA_c"
FT                   /note="gene_id=mCG11629.2 transcript_id=mCT180105.0
FT                   protein_id=mCP103027.0 isoform=CRA_c"
FT                   /protein_id="EDL37267.1"
FT                   /translation="MTTILTSTFRNLSTTSKWALRSSIRPLSCSSQLHSAPAVQTKSKK
FT                   TLAKPNMKNIVVVEGVRIPFLLSGTSYKDLMPHDLARAALSGLLHRTNIPKDDGGQYAL
FT                   VAACAAGGQGHAMIVEAYPK"
FT   mRNA            join(<4025741..4025846,4027477..4027556,4027634..4027681,
FT                   4028389..4028476,4029152..4029192,4032890..4033426)
FT                   /locus_tag="mCG_11629"
FT                   /product="mCG11629, transcript variant mCT173679"
FT                   /note="gene_id=mCG11629.2 transcript_id=mCT173679.0 created
FT                   on 13-FEB-2003"
FT   CDS             join(<4025742..4025846,4027477..4027556,4027634..4027681,
FT                   4028389..4028476,4029152..4029192,4032890..4032902)
FT                   /codon_start=1
FT                   /locus_tag="mCG_11629"
FT                   /product="mCG11629, isoform CRA_b"
FT                   /note="gene_id=mCG11629.2 transcript_id=mCT173679.0
FT                   protein_id=mCP96598.0 isoform=CRA_b"
FT                   /protein_id="EDL37265.1"
FT                   /translation="KDNGIRPSSLEQMAKLKPAFIKPYGTVTAANSSFLTDGASAMLIM
FT                   SEDRALAMGYKPKAYLRDFIYVSQDPKDQLLLGPTYATPKVLEKAGLTMNDIDAFEFHE
FT                   AFSGQILANFKAMDSDWVML"
FT   gene            complement(4042272..4053484)
FT                   /gene="Gpr113"
FT                   /locus_tag="mCG_52323"
FT                   /note="gene_id=mCG52323.3"
FT   mRNA            complement(join(4042272..4042398,4043884..4043939,
FT                   4044338..4044400,4045080..4046456,4047204..4047383,
FT                   4047858..4048054,4048239..4048382,4049281..4049487,
FT                   4051080..4051298,4051798..4051974,4052328..4052468,
FT                   4053236..4053484))
FT                   /gene="Gpr113"
FT                   /locus_tag="mCG_52323"
FT                   /product="G protein-coupled receptor 113"
FT                   /note="gene_id=mCG52323.3 transcript_id=mCT52506.3 created
FT                   on 18-APR-2003"
FT   CDS             complement(join(4042374..4042398,4043884..4043939,
FT                   4044338..4044400,4045080..4046456,4047204..4047383,
FT                   4047858..4048054,4048239..4048382,4049281..4049487,
FT                   4051080..4051298,4051798..4051852))
FT                   /codon_start=1
FT                   /gene="Gpr113"
FT                   /locus_tag="mCG_52323"
FT                   /product="G protein-coupled receptor 113"
FT                   /note="gene_id=mCG52323.3 transcript_id=mCT52506.3
FT                   protein_id=mCP26973.3"
FT                   /protein_id="EDL37270.1"
FT                   /translation="MCRSFHGPVTGYCQLLPPVPANLILDSQLQMHGNTLNLILLKKEE
FT                   ATNLRWFLRHSKNHTPISLWPGTNVLQTSSEGQSGLRVARMSRHWAGEYESIFEAQGFR
FT                   WRLRQLVKVPLQEEEVVRLPDALSISCTASTGFQLSCCIPLTTDYTATWSPGEDSQASL
FT                   QKMSDSQCFVLAVPHCPATNTTYTCTLQSQNLPPLVAPVSITIIQDGDTTCPEDFSVVS
FT                   WNVTKAGFVAQAPCPVNKKGVVKRLCGTDGIWRPVQNTCTEAKILTLCLKAKLLLEGQG
FT                   KPYEEVPWILSELQEQVGVASTPSDLWEMLHTVTLLAKVVAETSTELTGSALKDLLTTT
FT                   DKILDANISALWTLAQAQEPSMGSDFLKAVETLVHSLRPQQHPFSFSSANVLLQSQLLR
FT                   HSSPPGYQMSFSTWPLLQARIPWHSLAPLVHSGTNVSITSLVLQKLDYRLPSNYTQGLW
FT                   NTPYTTPGLILVVSITADGQAFTQAEVIMDYEDMNGTLHCVFWDHRVFQGQGGWSDEGC
FT                   EVHAANASITQCICQHLTAFSILMSQHTVPENPTLDLLSQVGTGASVLALLVCLAIYGL
FT                   VWRVVVRNKVAFFRHTTLFNMVICLLVADTCFLGSPFLPSGYHSLICLVTAFLCHFFYL
FT                   ATFFWMLAQALVLAHQLLFVFHQLSKHVVLSLMVMLGYLCPLGFAGVTLGLYLPQRKYL
FT                   WEGKCFLNGGGVMLYSFSEPVLAIVGVNGLVLVIAVLKLLRPSLSEGPTVEKRQALVGV
FT                   LKALLILTPIFGLTWGLGVATLFDGSIVSHYAFSILNSLQVLEALRKRLRGSRSSNSAI
FT                   SMVTNETYTSEHSKERSEPASYEERMTD"
FT   gene            complement(4070467..4070829)
FT                   /pseudo
FT                   /locus_tag="mCG_11636"
FT                   /note="gene_id=mCG11636.1"
FT   mRNA            complement(4070467..4070829)
FT                   /pseudo
FT                   /locus_tag="mCG_11636"
FT                   /note="gene_id=mCG11636.1 transcript_id=mCT12251.1 created
FT                   on 02-OCT-2002"
FT   gene            4082303..4122765
FT                   /gene="D5Wsu178e"
FT                   /locus_tag="mCG_11644"
FT                   /note="gene_id=mCG11644.2"
FT   mRNA            join(4082303..4082468,4097116..4097184,4102363..4102437,
FT                   4105731..4105993,4107365..4107408)
FT                   /gene="D5Wsu178e"
FT                   /locus_tag="mCG_11644"
FT                   /product="DNA segment, Chr 5, Wayne State University 178,
FT                   expressed, transcript variant mCT173681"
FT                   /note="gene_id=mCG11644.2 transcript_id=mCT173681.0 created
FT                   on 18-FEB-2003"
FT   mRNA            join(4082318..4082468,4097116..4097184,4098065..4098173,
FT                   4102363..4102437,4105731..4105993,4107365..4107473,
FT                   4113406..4113454,4114610..4114790,4115673..4115858,
FT                   4117236..4122765)
FT                   /gene="D5Wsu178e"
FT                   /locus_tag="mCG_11644"
FT                   /product="DNA segment, Chr 5, Wayne State University 178,
FT                   expressed, transcript variant mCT12259"
FT                   /note="gene_id=mCG11644.2 transcript_id=mCT12259.2 created
FT                   on 18-FEB-2003"
FT   mRNA            join(4082324..4082468,4097116..4097184,4098065..4098173,
FT                   4105731..4105993,4107365..4107414,4113406..4113454,
FT                   4114610..4114790,4115673..4115858,4117236..4119308)
FT                   /gene="D5Wsu178e"
FT                   /locus_tag="mCG_11644"
FT                   /product="DNA segment, Chr 5, Wayne State University 178,
FT                   expressed, transcript variant mCT180247"
FT                   /note="gene_id=mCG11644.2 transcript_id=mCT180247.0 created
FT                   on 18-FEB-2003"
FT   CDS             join(4082412..4082468,4097116..4097184,4098065..4098173,
FT                   4102363..4102437,4105731..4105993,4107365..4107473,
FT                   4113406..4113454,4114610..4114790,4115673..4115858,
FT                   4117236..4117301)
FT                   /codon_start=1
FT                   /gene="D5Wsu178e"
FT                   /locus_tag="mCG_11644"
FT                   /product="DNA segment, Chr 5, Wayne State University 178,
FT                   expressed, isoform CRA_a"
FT                   /note="gene_id=mCG11644.2 transcript_id=mCT12259.2
FT                   protein_id=mCP3893.2 isoform=CRA_a"
FT                   /protein_id="EDL37271.1"
FT                   /translation="MAGYEYVSPEQLSGFDKYKYSALDTNPLSLYIMHPFWNTIVKVFP
FT                   TWLAPNLITFSGFMLLVFNFLLLTYFDPDFYASAPGHKHVPDWVWIVVGILNFAAYTLD
FT                   GVDGKQARRTNSSTPLGELFDHGLDSWSCVYFVVTVYSIFGRGPTGVSVFVLYLLLWVV
FT                   LFSFILSHWEKYNTGVLFLPWGYDISQVTISFVYIVTAVVGVEAWYEPFLFNFLYRDLF
FT                   TAMIIGCALCVTLPMSLLNFFRSYKSNTLKHKSVYEAMVPFFSPCLLFTLCTVWILWSP
FT                   SDILEIHPRIFYFMVGTAFANITCQLIVCQMSSTRCPTLNWLLLPLLLVVAAVIVGAAT
FT                   SRLESALLYTLTAAFTLAHIHYGVQVVKQLSRHFQIYPFSLRKPNSD"
FT   CDS             join(4082412..4082468,4097116..4097184,4098065..4098173,
FT                   4105731..4105993,4107365..4107414,4113406..4113454)
FT                   /codon_start=1
FT                   /gene="D5Wsu178e"
FT                   /locus_tag="mCG_11644"
FT                   /product="DNA segment, Chr 5, Wayne State University 178,
FT                   expressed, isoform CRA_c"
FT                   /note="gene_id=mCG11644.2 transcript_id=mCT180247.0
FT                   protein_id=mCP103169.0 isoform=CRA_c"
FT                   /db_xref="GOA:Q8CET7"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR014472"
FT                   /db_xref="MGI:MGI:107898"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CET7"
FT                   /protein_id="EDL37273.1"
FT                   /translation="MAGYEYVSPEQLSGFDKYKYSALDTNPLSLYIMHPFWNTIVKVFP
FT                   TWLAPNLITFSGFMLLVFNFLLLTYFDPDFYASDGVDGKQARRTNSSTPLGELFDHGLD
FT                   SWSCVYFVVTVYSIFGRGPTGVSVFVLYLLLWVVLFSFILSHWEKYNTGVLFLPWGYDI
FT                   SQVTISFVYIVTAVVGVEAWVCIMCDSSNEFIKLF"
FT   CDS             join(4082412..4082468,4097116..4097184,4102363..4102437)
FT                   /codon_start=1
FT                   /gene="D5Wsu178e"
FT                   /locus_tag="mCG_11644"
FT                   /product="DNA segment, Chr 5, Wayne State University 178,
FT                   expressed, isoform CRA_b"
FT                   /note="gene_id=mCG11644.2 transcript_id=mCT173681.0
FT                   protein_id=mCP96600.0 isoform=CRA_b"
FT                   /db_xref="GOA:D6RE20"
FT                   /db_xref="InterPro:IPR014472"
FT                   /db_xref="MGI:MGI:107898"
FT                   /db_xref="UniProtKB/TrEMBL:D6RE20"
FT                   /protein_id="EDL37272.1"
FT                   /translation="MAGYEYVSPEQLSGFDKYKYSALDTNPLSLYIMHPFWNTIVKPLV
FT                   ISMCLTGFGLSWASSTLLPTL"
FT   gene            4131784..4174051
FT                   /locus_tag="mCG_11631"
FT                   /note="gene_id=mCG11631.1"
FT   mRNA            join(4131784..4131997,4149581..4149724,4152511..4152637,
FT                   4154186..4154323,4155793..4155879,4157531..4157653,
FT                   4162328..4162467,4162801..4162935,4163713..4163846,
FT                   4165812..4165924,4166917..4167006,4167350..4167436,
FT                   4170343..4170624,4171266..4171438,4171728..4171830,
FT                   4173838..4174051)
FT                   /locus_tag="mCG_11631"
FT                   /product="mCG11631"
FT                   /note="gene_id=mCG11631.1 transcript_id=mCT12245.1 created
FT                   on 02-OCT-2002"
FT   CDS             join(4131843..4131997,4149581..4149724,4152511..4152637,
FT                   4154186..4154323,4155793..4155879,4157531..4157653,
FT                   4162328..4162467,4162801..4162935,4163713..4163846,
FT                   4165812..4165924,4166917..4167006,4167350..4167436,
FT                   4170343..4170624,4171266..4171438,4171728..4171830,
FT                   4173838..4173894)
FT                   /codon_start=1
FT                   /locus_tag="mCG_11631"
FT                   /product="mCG11631"
FT                   /note="gene_id=mCG11631.1 transcript_id=mCT12245.1
FT                   protein_id=mCP3962.2"
FT                   /protein_id="EDL37274.1"
FT                   /translation="MNPSGTIGVLEQNGEEHLATPILGPSVHSDNPQERIQARRLRIAA
FT                   RQEARRRFTACRLSVFQKLTKLLLCGTELVTNIQVAADVREIHRRVEEEETKRQRLEKL
FT                   ENEVKTSQDKFDEITAKWEEGRRKRIPQELWEMLNSQQELKIKDDQYVKDLKKQSEDIT
FT                   LILERMEEQVKNVMKNFRQELIHIEKAFESERQELLSSNKKKWERALQAHNAKELEYLT
FT                   NRMKKVEDYEKQLNKQRVWDCEEYNTIKIKLEQDVQILEQQLQQMKATYQLNQEKLEYN
FT                   FQVLKKRDEESTVIKSQQKRKLNRLHDVVNNLRTKYTKQIRQFQDDNQSLTSDYKRLVT
FT                   QFKDLQKALRIIHSQHLGLPWNMPDLWFLNNVGPISLQQQKSVTQILEELLLQTEDEAT
FT                   EAAMSEDEDYMDLPNQISAKTTTKVLMLLCDESGFLIESKLLSLLHPLEKSECYLLRLD
FT                   AIFSALAIEDEDDLYKLVNFFLRYRAHRLSSAQASSSIHSNVERTSLMSALERLSLMSQ
FT                   TDKGSMVSKSDQEPTEQEDEQEGDNASLSSRELEEQEDLSSPRFIHPNDVLKILEAFVT
FT                   GLKKPKYAGVETGTTLTSRDAQPVLKLKKETRDNSKDTEYWESLAAVIPFFKQNLWDAL
FT                   YKALEKYYLVLTERAKLLMENESLEQQNAEMQSLLQQYLQAKVNTELQIPPTQGFRMPS
FT                   K"
FT   gene            complement(4174414..4271383)
FT                   /gene="Otof"
FT                   /locus_tag="mCG_11635"
FT                   /note="gene_id=mCG11635.1"
FT   mRNA            complement(join(4174414..4175108,4177623..4177825,
FT                   4178247..4178347,4178448..4178626,4179077..4179318,
FT                   4179440..4179538,4181171..4181259,4181555..4181697,
FT                   4182422..4182582,4183179..4183349,4183452..4183579,
FT                   4183855..4183992,4184191..4184325,4184422..4184558,
FT                   4186573..4186639,4187024..4187155,4187445..4187474,
FT                   4188069..4188199,4188490..4188652,4188778..4188939,
FT                   4189434..4189553,4189705..4189866,4190311..4190445,
FT                   4190769..4190893,4190997..4191186,4191487..4191639,
FT                   4191901..4192017,4192137..4192227,4192329..4192429,
FT                   4192867..4192987,4193079..4193259,4193720..4193828,
FT                   4194240..4194463,4196200..4196406,4196602..4196768,
FT                   4197735..4197894,4202086..4202170,4202607..4202669,
FT                   4207162..4207293,4214518..4214572,4215086..4215212,
FT                   4216534..4216607,4228696..4228874,4230271..4230370,
FT                   4236866..4236954,4250668..4250726,4271201..4271383))
FT                   /gene="Otof"
FT                   /locus_tag="mCG_11635"
FT                   /product="otoferlin, transcript variant mCT12250"
FT                   /note="gene_id=mCG11635.1 transcript_id=mCT12250.1 created
FT                   on 16-SEP-2002"
FT   mRNA            complement(join(4174414..4175108,4178247..4178347,
FT                   4178448..4178626,4179077..4179318,4179440..4179538,
FT                   4181171..4181259,4181555..4181697,4182422..4182582,
FT                   4183179..4183349,4183452..4183579,4183855..4183992,
FT                   4184191..4184325,4184422..4184558,4186573..4186639,
FT                   4187024..4187155,4187445..4187474,4188069..4188139,
FT                   4188490..4188652,4188778..4188939,4189434..4189553,
FT                   4189705..4189866,4190311..4190445,4190769..4190893,
FT                   4190997..4191186,4191487..4191639,4191901..4192017,
FT                   4192137..4192227,4192329..4192429,4192867..4192987,
FT                   4193079..4193259,4193720..4193828,4194240..4194463,
FT                   4196200..4196406,4196602..4196768,4197735..4197894,
FT                   4202086..4202170,4202607..4202669,4207162..4207293,
FT                   4214518..4214572,4215086..4215212,4216534..4216607,
FT                   4223842..4223886,4228696..4228874,4230271..4230370,
FT                   4236866..4236954,4250668..4250726,4271201..4271383))
FT                   /gene="Otof"
FT                   /locus_tag="mCG_11635"
FT                   /product="otoferlin, transcript variant mCT173395"
FT                   /note="gene_id=mCG11635.1 transcript_id=mCT173395.0 created
FT                   on 16-SEP-2002"
FT   CDS             complement(join(4174607..4175108,4178247..4178347,
FT                   4178448..4178626,4179077..4179318,4179440..4179538,
FT                   4181171..4181259,4181555..4181697,4182422..4182582,
FT                   4183179..4183349,4183452..4183579,4183855..4183992,
FT                   4184191..4184325,4184422..4184558,4186573..4186639,
FT                   4187024..4187155,4187445..4187474,4188069..4188139,
FT                   4188490..4188652,4188778..4188939,4189434..4189553,
FT                   4189705..4189866,4190311..4190445,4190769..4190893,
FT                   4190997..4191186,4191487..4191639,4191901..4192017,
FT                   4192137..4192227,4192329..4192429,4192867..4192987,
FT                   4193079..4193259,4193720..4193828,4194240..4194463,
FT                   4196200..4196406,4196602..4196768,4197735..4197894,
FT                   4202086..4202170,4202607..4202669,4207162..4207293,
FT                   4214518..4214572,4215086..4215212,4216534..4216607,
FT                   4223842..4223886,4228696..4228874,4230271..4230370,
FT                   4236866..4236954,4250668..4250726,4271201..4271279))
FT                   /codon_start=1
FT                   /gene="Otof"
FT                   /locus_tag="mCG_11635"
FT                   /product="otoferlin, isoform CRA_a"
FT                   /note="gene_id=mCG11635.1 transcript_id=mCT173395.0
FT                   protein_id=mCP96314.0 isoform=CRA_a"
FT                   /protein_id="EDL37275.1"
FT                   /translation="MALIVHLKTVSELRGKGDRIAKVTFRGQSFYSRVLENCEGVADFD
FT                   ETFRWPVASSIDRNEVLEIQIFNYSKVFSNKLIGTFCMVLQKVVEENRVEVTDTLMDDS
FT                   NAIIKTSLSMEVRYQATDGTVGPWDDGDFLGDESLQEEKDSQETDGLLPGSRPSTRISG
FT                   EKSFRSKGREKTKGGRDGEHKAGRSVFSAMKLGKTRSHKEEPQRQDEPAVLEMEDLDHL
FT                   AIQLGDGLDPDSVSLASVTALTSNVSNKRSKPDIKMEPSAGRPMDYQVSITVIEARQLV
FT                   GLNMDPVVCVEVGDDKKYTSMKESTNCPYYNEYFVFDFHVSPDVMFDKIIKISVIHSKN
FT                   LLRSGTLVGSFKMDVGTVYSQPEHQFHHKWAILSDPDDISAGLKGYVKCDVAVVGKGDN
FT                   IKTPHKANETDEDDIEGNLLLPEGVPPERQWARFYVKIYRAEGLPRMNTSLMANVKKAF
FT                   IGENKPLVDPYVQVWLFSHQGKTSVQKSSYEPLWNEQVVFTDLFPPLCKRMKVQIRDSD
FT                   KVNDVAIGTHFIDLRKISNDGDKGFLPTLGPAWVNMYGSTRNYTLLDEHQDLNEGLGEG
FT                   VSFRARLMLGLAVEILDTSNPELTSSTEVQVEQATPVSESCTGRMEEFFLFGAFLEASM
FT                   IDRKNGDKPITFEVTIGNYGNEVDGMSRPLRPRPRKEPGDEEEVDLIQNSSDDEGDEAG
FT                   DLASVSSTPPMRPQITDRNYFHLPYLERKPCIYIKSWWPDQRRRLYNANIMDHIADKLE
FT                   EGLNDVQEMIKTEKSYPERRLRGVLEELSCGCHRFLSLSDKDQGRSSRTRLDRERLKSC
FT                   MRELESMGQQAKSLRAQVKRHTVRDKLRSCQNFLQKLRFLADEPQHSIPDVFIWMMSNN
FT                   KRIAYARVPSKDLLFSIVEEELGKDCAKVKTLFLKLPGKRGFGSAGWTVQAKLELYLWL
FT                   GLSKQRKDFLCGLPCGFEEVKAAQGLGLHSFPPISLVYTKKQAFQLRAHMYQARSLFAA
FT                   DSSGLSDPFARVFFINQSQCTEVLNETLCPTWDQMLVFDNLELYGEAHELRDDPPIIVI
FT                   EIYDQDSMGKADFMGRTFAKPLVKMADEAYCPPRFPPQLEYYQIYRGSATAGDLLAAFE
FT                   LLQIGPSGKADLPPINGPVDMDRGPIMPVPVGIRPVLSKYRVEVLFWGLRDLKRVNLAQ
FT                   VDRPRVDIECAGKGVQSSLIHNYKKNPNFNTLVKWFEVDLPENELLHPPLNIRVVDCRA
FT                   FGRYTLVGSHAVSSLRRFIYRPPDRSAPNWNTTGEVVVSMEPEEPVKKLETMVKLDATS
FT                   DAVVKVDVAEDEKERKKKKKKGPSEEPEEEEPDESMLDWWSKYFASIDTMKEQLRQHET
FT                   SGTDLEEKEEMESAEGLKGPMKSKEKSRAAKEEKKKKNQSPGPGQGSEAPEKKKAKIDE
FT                   LKVYPKELESEFDSFEDWLHTFNLLRGKTGDDEDGSTEEERIVGRFKGSLCVYKVPLPE
FT                   DVSREAGYDPTYGMFQGIPSNDPINVLVRIYVVRATDLHPADINGKADPYIAIKLGKTD
FT                   IRDKENYISKQLNPVFGKSFDIEASFPMESMLTVAVYDWDLVGTDDLIGETKIDLENRF
FT                   YSKHRATCGIAQTYSIHGYNIWRDPMKPSQILTRLCKEGKVDGPHFGPHGRVRVANRVF
FT                   TGPSEIEDENGQRKPTDEHVALSALRHWEDIPRVGCRLVPEHVETRPLLNPDKPGIEQG
FT                   RLELWVDMFPMDMPAPGTPLDISPRKPKKYELRVIVWNTDEVVLEDDDFFTGEKSSDIF
FT                   VRGWLKGQQEDKQDTDVHYHSLTGEGNFNWRYLFPFDYLAAEEKIVMSKKESMFSWDET
FT                   EYKIPARLTLQIWDADHFSADDFLGAIELDLNRFPRGAKTAKQCTMEMATGEVDVPLVS
FT                   IFKQKRVKGWWPLLARNENDEFELTGKVEAELHLLTAEEAEKNPVGLARNEPDPLEKPN
FT                   PPTPASLEQDTCLLDFIPTPHPNCCLPDLVPGLPGVWGTVGLQNQIPSCLKYQVPLPNP
FT                   KSGSGPTLPVLSKSCLKAPVKLTKKRGAMPKALMSRNTWKAPGMPAEARRHTSLQSIQA
FT                   ERRAAASCFCACSPLGSASFSQSQSLHSLALGFPSLPGVPLPWPVCVS"
FT   CDS             complement(join(4177645..4177825,4178247..4178347,
FT                   4178448..4178626,4179077..4179318,4179440..4179538,
FT                   4181171..4181259,4181555..4181697,4182422..4182582,
FT                   4183179..4183349,4183452..4183579,4183855..4183992,
FT                   4184191..4184325,4184422..4184558,4186573..4186639,
FT                   4187024..4187155,4187445..4187474,4188069..4188199,
FT                   4188490..4188652,4188778..4188939,4189434..4189553,
FT                   4189705..4189866,4190311..4190445,4190769..4190893,
FT                   4190997..4191186,4191487..4191639,4191901..4192017,
FT                   4192137..4192227,4192329..4192429,4192867..4192987,
FT                   4193079..4193259,4193720..4193828,4194240..4194463,
FT                   4196200..4196406,4196602..4196768,4197735..4197894,
FT                   4202086..4202170,4202607..4202669,4207162..4207293,
FT                   4214518..4214572,4215086..4215212,4216534..4216607,
FT                   4228696..4228874,4230271..4230370,4236866..4236954,
FT                   4250668..4250726,4271201..4271279))
FT                   /codon_start=1
FT                   /gene="Otof"
FT                   /locus_tag="mCG_11635"
FT                   /product="otoferlin, isoform CRA_b"
FT                   /note="gene_id=mCG11635.1 transcript_id=mCT12250.1
FT                   protein_id=mCP3992.2 isoform=CRA_b"
FT                   /protein_id="EDL37276.1"
FT                   /translation="MALIVHLKTVSELRGKGDRIAKVTFRGQSFYSRVLENCEGVADFD
FT                   ETFRWPVASSIDRNEVLEIQIFNYSKVFSNKLIGTFCMVLQKVVEENRVEVTDTLMDDS
FT                   NAIIKTSLSMEVRYQATDGTVGPWDDGDFLGDESLQEEKDSQETDGLLPGSRPSTRISG
FT                   EKSFRRAGRSVFSAMKLGKTRSHKEEPQRQDEPAVLEMEDLDHLAIQLGDGLDPDSVSL
FT                   ASVTALTSNVSNKRSKPDIKMEPSAGRPMDYQVSITVIEARQLVGLNMDPVVCVEVGDD
FT                   KKYTSMKESTNCPYYNEYFVFDFHVSPDVMFDKIIKISVIHSKNLLRSGTLVGSFKMDV
FT                   GTVYSQPEHQFHHKWAILSDPDDISAGLKGYVKCDVAVVGKGDNIKTPHKANETDEDDI
FT                   EGNLLLPEGVPPERQWARFYVKIYRAEGLPRMNTSLMANVKKAFIGENKPLVDPYVQVW
FT                   LFSHQGKTSVQKSSYEPLWNEQVVFTDLFPPLCKRMKVQIRDSDKVNDVAIGTHFIDLR
FT                   KISNDGDKGFLPTLGPAWVNMYGSTRNYTLLDEHQDLNEGLGEGVSFRARLMLGLAVEI
FT                   LDTSNPELTSSTEVQVEQATPVSESCTGRMEEFFLFGAFLEASMIDRKNGDKPITFEVT
FT                   IGNYGNEVDGMSRPLRPRPRKEPGDEEEVDLIQNSSDDEGDEAGDLASVSSTPPMRPQI
FT                   TDRNYFHLPYLERKPCIYIKSWWPDQRRRLYNANIMDHIADKLEEGLNDVQEMIKTEKS
FT                   YPERRLRGVLEELSCGCHRFLSLSDKDQGRSSRTRLDRERLKSCMRELESMGQQAKSLR
FT                   AQVKRHTVRDKLRSCQNFLQKLRFLADEPQHSIPDVFIWMMSNNKRIAYARVPSKDLLF
FT                   SIVEEELGKDCAKVKTLFLKLPGKRGFGSAGWTVQAKLELYLWLGLSKQRKDFLCGLPC
FT                   GFEEVKAAQGLGLHSFPPISLVYTKKQAFQLRAHMYQARSLFAADSSGLSDPFARVFFI
FT                   NQSQCTEVLNETLCPTWDQMLVFDNLELYGEAHELRDDPPIIVIEIYDQDSMGKADFMG
FT                   RTFAKPLVKMADEAYCPPRFPPQLEYYQIYRGSATAGDLLAAFELLQIGPSGKADLPPI
FT                   NGPVDMDRGPIMPVPVGIRPVLSKYRVEVLFWGLRDLKRVNLAQVDRPRVDIECAGKGV
FT                   QSSLIHNYKKNPNFNTLVKWFEVDLPENELLHPPLNIRVVDCRAFGRYTLVGSHAVSSL
FT                   RRFIYRPPDRSAPNWNTTVRLLRGCHRLRNGGPSSRPTGEVVVSMEPEEPVKKLETMVK
FT                   LDATSDAVVKVDVAEDEKERKKKKKKGPSEEPEEEEPDESMLDWWSKYFASIDTMKEQL
FT                   RQHETSGTDLEEKEEMESAEGLKGPMKSKEKSRAAKEEKKKKNQSPGPGQGSEAPEKKK
FT                   AKIDELKVYPKELESEFDSFEDWLHTFNLLRGKTGDDEDGSTEEERIVGRFKGSLCVYK
FT                   VPLPEDVSREAGYDPTYGMFQGIPSNDPINVLVRIYVVRATDLHPADINGKADPYIAIK
FT                   LGKTDIRDKENYISKQLNPVFGKSFDIEASFPMESMLTVAVYDWDLVGTDDLIGETKID
FT                   LENRFYSKHRATCGIAQTYSIHGYNIWRDPMKPSQILTRLCKEGKVDGPHFGPHGRVRV
FT                   ANRVFTGPSEIEDENGQRKPTDEHVALSALRHWEDIPRVGCRLVPEHVETRPLLNPDKP
FT                   GIEQGRLELWVDMFPMDMPAPGTPLDISPRKPKKYELRVIVWNTDEVVLEDDDFFTGEK
FT                   SSDIFVRGWLKGQQEDKQDTDVHYHSLTGEGNFNWRYLFPFDYLAAEEKIVMSKKESMF
FT                   SWDETEYKIPARLTLQIWDADHFSADDFLGAIELDLNRFPRGAKTAKQCTMEMATGEVD
FT                   VPLVSIFKQKRVKGWWPLLARNENDEFELTGKVEAELHLLTAEEAEKNPVGLARNEPDP
FT                   LEKPNRPDTSFIWFLNPLKSARYFLWHTYRWLLLKFLLLFLLLLLFALFLYSLPGYLAK
FT                   KILGA"
FT   gene            4275525..4293569
FT                   /gene="1700001C02Rik"
FT                   /locus_tag="mCG_11646"
FT                   /note="gene_id=mCG11646.1"
FT   mRNA            join(4275525..4275666,4289867..4290137,4291558..4291670,
FT                   4293350..4293569)
FT                   /gene="1700001C02Rik"
FT                   /locus_tag="mCG_11646"
FT                   /product="RIKEN cDNA 1700001C02"
FT                   /note="gene_id=mCG11646.1 transcript_id=mCT12261.1 created
FT                   on 24-SEP-2002"
FT   CDS             join(4275593..4275666,4289867..4290137,4291558..4291670,
FT                   4293350..4293494)
FT                   /codon_start=1
FT                   /gene="1700001C02Rik"
FT                   /locus_tag="mCG_11646"
FT                   /product="RIKEN cDNA 1700001C02"
FT                   /note="gene_id=mCG11646.1 transcript_id=mCT12261.1
FT                   protein_id=mCP3911.1"
FT                   /protein_id="EDL37277.1"
FT                   /translation="MAFRSAGTLMTEFNAAFVPPALMPGYKGHVPGVASSFGSSYGNTT
FT                   FKYFQDLRNTGLEKSYALLSGGCFPTIFSPNSPLVLTDNSQNWDRWLHQPTYSRSNQDN
FT                   GRTTELTNFYKTVQQQRKYYQDKTGILSRVPYFVLPVKEPDRYPLPTDLPPLSEKSKWN
FT                   LLRLSPDYKRTYQTFPSGKRVSSQERQRRDLYFEFRA"
FT   gene            complement(4295066..>4355652)
FT                   /locus_tag="mCG_11642"
FT                   /note="gene_id=mCG11642.1"
FT   mRNA            complement(join(4295066..4295250,4296928..4297016,
FT                   4297967..4298076,4307487..4307628,4344022..4344118,
FT                   4354482..4354516,4355542..>4355652))
FT                   /locus_tag="mCG_11642"
FT                   /product="mCG11642"
FT                   /note="gene_id=mCG11642.1 transcript_id=mCT12257.2 created
FT                   on 25-SEP-2002"
FT   CDS             complement(join(4295220..4295250,4296928..4297016,
FT                   4297967..4298076,4307487..4307628,4344022..4344118,
FT                   4354482..4354516,4355542..>4355643))
FT                   /codon_start=1
FT                   /locus_tag="mCG_11642"
FT                   /product="mCG11642"
FT                   /note="gene_id=mCG11642.1 transcript_id=mCT12257.2
FT                   protein_id=mCP3891.1"
FT                   /protein_id="EDL37278.1"
FT                   /translation="ALGAEVLLLAGGGWFSMGQCLRYQMQWEDLEEYQALTFLTRNEIL
FT                   CIHDTFLKLCPSGKHYKEATLTMDQVSSLPALRVNPFRDRICRVFSHDNVFSFEDVLGM
FT                   ASVFSEQACPSLKIEYAFRIYDFNENGFIDEEDLEEIVLRLLKSDDASEDLLMDVMHHV
FT                   LSESDLDNDSMLSFSEFEHAMAKSPDFMNSFRIHFWGC"
FT   gene            4338957..4353646
FT                   /locus_tag="mCG_148294"
FT                   /note="gene_id=mCG148294.0"
FT   mRNA            join(4338957..4339186,4350746..4353646)
FT                   /locus_tag="mCG_148294"
FT                   /product="mCG148294"
FT                   /note="gene_id=mCG148294.0 transcript_id=mCT188557.0
FT                   created on 13-JAN-2004"
FT   CDS             4351273..4351515
FT                   /codon_start=1
FT                   /locus_tag="mCG_148294"
FT                   /product="mCG148294"
FT                   /note="gene_id=mCG148294.0 transcript_id=mCT188557.0
FT                   protein_id=mCP109208.0"
FT                   /protein_id="EDL37279.1"
FT                   /translation="MSSLGMVSNTPYLTYSTSPWSQRSLLAGATQSEVWLLVLRNGAIS
FT                   QGGSERASREACETGLISCTAFPSHIWTTEVAPFP"
FT   gene            complement(4387101..>4398132)
FT                   /locus_tag="mCG_146317"
FT                   /note="gene_id=mCG146317.0"
FT   mRNA            complement(join(4387101..4388198,4389266..4389368,
FT                   4392499..4392575,4398027..>4398132))
FT                   /locus_tag="mCG_146317"
FT                   /product="mCG146317"
FT                   /note="gene_id=mCG146317.0 transcript_id=mCT186420.0
FT                   created on 14-JUL-2003"
FT   CDS             complement(4387460..>4387888)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146317"
FT                   /product="mCG146317"
FT                   /note="gene_id=mCG146317.0 transcript_id=mCT186420.0
FT                   protein_id=mCP107483.0"
FT                   /protein_id="EDL37280.1"
FT                   /translation="TEGTGQVQESASAFPMAGQMLSFRWKTGPRCEQGLVTIAHTGAQG
FT                   QNHQGTALDPLKVEMRKGGRAILAQSSGTQPRQGLRRSPCLCGAKGYCWGFELVPEEER
FT                   LSRGPQRPEGDGTILPIWTRVATGRGPRWGWDIQAMST"
FT   gene            4397742..4433229
FT                   /gene="Kcnk3"
FT                   /locus_tag="mCG_23503"
FT                   /note="gene_id=mCG23503.2"
FT   mRNA            join(4397742..4398255,4431636..4433229)
FT                   /gene="Kcnk3"
FT                   /locus_tag="mCG_23503"
FT                   /product="potassium channel, subfamily K, member 3"
FT                   /note="gene_id=mCG23503.2 transcript_id=mCT23412.2 created
FT                   on 02-OCT-2002"
FT   CDS             join(4397973..4398255,4431636..4432582)
FT                   /codon_start=1
FT                   /gene="Kcnk3"
FT                   /locus_tag="mCG_23503"
FT                   /product="potassium channel, subfamily K, member 3"
FT                   /note="gene_id=mCG23503.2 transcript_id=mCT23412.2
FT                   protein_id=mCP3968.2"
FT                   /protein_id="EDL37281.1"
FT                   /translation="MKRQNVRTLALIVCTFTYLLVGAAVFDALESEPEMIERQRLELRQ
FT                   LELRARYNLSEGGYEELERVVLRLKPHKAGVQWRFAGSFYFAITVITTIGYGHAAPSTD
FT                   GGKVFCMFYALLGIPLTLVMFQSLGERINTFVRYLLHRAKRGLGMRHAEVSMANMVLIG
FT                   FVSCISTLCIGAAAFSYYERWTFFQAYYYCFITLTTIGFGDYVALQKDQALQTQPQYVA
FT                   FSFVYILTGLTVIGAFLNLVVLRFMTMNAEDEKRDAEHRALLTHNGQAVGLGGLSCLSG
FT                   SLGDGVRPRDPVTCAAAAGGVGVGVGGSGFRNVYAEVLHFQSMCSCLWYKSREKLQYSI
FT                   PMIIPRDLSTSDTCVEHSHSSPGGGGRYSDTPSHPCLCSGTQRSAISSVSTGLHSLAAF
FT                   RGLMKRRSSV"
FT   gene            4457734..4469521
FT                   /gene="4930471M23Rik"
FT                   /locus_tag="mCG_23502"
FT                   /note="gene_id=mCG23502.1"
FT   mRNA            join(4457734..4457890,4464540..4464612,4465287..4465458,
FT                   4465680..4465892,4466539..4466649,4467169..4469521)
FT                   /gene="4930471M23Rik"
FT                   /locus_tag="mCG_23502"
FT                   /product="RIKEN cDNA 4930471M23"
FT                   /note="gene_id=mCG23502.1 transcript_id=mCT23411.1 created
FT                   on 25-SEP-2002"
FT   CDS             join(4457814..4457890,4464540..4464612,4465287..4465458,
FT                   4465680..4465892,4466539..4466649,4467169..4467641)
FT                   /codon_start=1
FT                   /gene="4930471M23Rik"
FT                   /locus_tag="mCG_23502"
FT                   /product="RIKEN cDNA 4930471M23"
FT                   /note="gene_id=mCG23502.1 transcript_id=mCT23411.1
FT                   protein_id=mCP3965.1"
FT                   /protein_id="EDL37282.1"
FT                   /translation="MAWTKYQLFLAGLMLVTGSINTLSAKWADNFVAEGCGGSQEHSFK
FT                   HPFVQAVGMFLGEFSCLAAFYLLKCQGRRQSASSVEPQQPFNTLLFLPPALCDMTGTSI
FT                   MYVALNMTSASSFQMLRGAVIIFTGLFSVAFLDRRLAPSQWLGILITIAGLVVVGLADL
FT                   LSKHDSQHKLSEVITGDLLIIMAQIIIAIQMVLEEKFVYKHNIHPLQAVGIEGFFGFVI
FT                   LSLLLVPMFYIPTASFSGNPRGVLEDALDAFCQVGRQPLIALALLGNISSIAFFNFSGI
FT                   SVTKELSATTRMVLDTLRTIVIWAFTLALGWEIFYPLQILGFLILLMGTALYNGLHRPL
FT                   LAFLSRRWRLPTQEGEQERLLGDSRTPINEAS"
FT   gene            4476940..4484871
FT                   /gene="Cenpa"
FT                   /locus_tag="mCG_23505"
FT                   /note="gene_id=mCG23505.2"
FT   mRNA            join(4476940..4477158,4482509..4482615,4483027..4483104,
FT                   4483338..4483488,4484083..4484871)
FT                   /gene="Cenpa"
FT                   /locus_tag="mCG_23505"
FT                   /product="centromere protein A, transcript variant
FT                   mCT23414"
FT                   /note="gene_id=mCG23505.2 transcript_id=mCT23414.2 created
FT                   on 18-FEB-2003"
FT   mRNA            join(4476940..4477158,4479044..4479097,4479737..4479873,
FT                   4482509..4482615,4483027..4483104,4483338..4483488,
FT                   4484083..4484304)
FT                   /gene="Cenpa"
FT                   /locus_tag="mCG_23505"
FT                   /product="centromere protein A, transcript variant
FT                   mCT173428"
FT                   /note="gene_id=mCG23505.2 transcript_id=mCT173428.0 created
FT                   on 18-FEB-2003"
FT   mRNA            join(4476940..4477158,4479737..4479873,4482509..4482615,
FT                   4483027..4483104,4483338..4483488,4484083..4484258)
FT                   /gene="Cenpa"
FT                   /locus_tag="mCG_23505"
FT                   /product="centromere protein A, transcript variant
FT                   mCT173430"
FT                   /note="gene_id=mCG23505.2 transcript_id=mCT173430.0 created
FT                   on 18-FEB-2003"
FT   mRNA            join(4476940..4477158,4482509..4482615,4483027..4483104,
FT                   4484083..>4484153)
FT                   /gene="Cenpa"
FT                   /locus_tag="mCG_23505"
FT                   /product="centromere protein A, transcript variant
FT                   mCT173429"
FT                   /note="gene_id=mCG23505.2 transcript_id=mCT173429.0 created
FT                   on 18-FEB-2003"
FT   mRNA            join(<4477019..4477158,4479044..4479097,4479783..4479873,
FT                   4482509..4482615,4483027..4483104,4483338..4483488,
FT                   4484083..4484453)
FT                   /gene="Cenpa"
FT                   /locus_tag="mCG_23505"
FT                   /product="centromere protein A, transcript variant
FT                   mCT193542"
FT                   /note="gene_id=mCG23505.2 transcript_id=mCT193542.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(4477043..4477158,4482509..4482615,4483027..4483104,
FT                   4483312..4483488,4484083..4484425)
FT                   /gene="Cenpa"
FT                   /locus_tag="mCG_23505"
FT                   /product="centromere protein A, transcript variant
FT                   mCT180245"
FT                   /note="gene_id=mCG23505.2 transcript_id=mCT180245.0 created
FT                   on 18-FEB-2003"
FT   CDS             join(4477074..4477158,4482509..4482615,4483027..4483104,
FT                   4484083..>4484153)
FT                   /codon_start=1
FT                   /gene="Cenpa"
FT                   /locus_tag="mCG_23505"
FT                   /product="centromere protein A, isoform CRA_b"
FT                   /note="gene_id=mCG23505.2 transcript_id=mCT173429.0
FT                   protein_id=mCP96348.0 isoform=CRA_b"
FT                   /protein_id="EDL37284.1"
FT                   /translation="MGPRRKPQTPRRRPSSPAPGPSRQSSSVGSQTLRRRQKFMWLKEI
FT                   KTLQKSTDLLFRKKPFSMVVREICEKFSRGVDFWWQAQALLALQETLPGSFWSCSLTVV
FT                   SEELAGFCC"
FT   CDS             join(4477074..4477158,4482509..4482615,4483027..4483104,
FT                   4483338..4483472)
FT                   /codon_start=1
FT                   /gene="Cenpa"
FT                   /locus_tag="mCG_23505"
FT                   /product="centromere protein A, isoform CRA_e"
FT                   /note="gene_id=mCG23505.2 transcript_id=mCT23414.2
FT                   protein_id=mCP3954.2 isoform=CRA_e"
FT                   /protein_id="EDL37287.1"
FT                   /translation="MGPRRKPQTPRRRPSSPAPGPSRQSSSVGSQTLRRRQKFMWLKEI
FT                   KTLQKSTDLLFRKKPFSMVVREICEKFSRGVDFWWQAQALLALQEAAEAFLIHLFEDAY
FT                   LLSLHAGRVTLFPKDIQLTRRIRGFEGGLP"
FT   CDS             join(4477074..4477158,4482509..4482615,4483027..4483104,
FT                   4483312..4483434)
FT                   /codon_start=1
FT                   /gene="Cenpa"
FT                   /locus_tag="mCG_23505"
FT                   /product="centromere protein A, isoform CRA_f"
FT                   /note="gene_id=mCG23505.2 transcript_id=mCT180245.0
FT                   protein_id=mCP103167.0 isoform=CRA_f"
FT                   /protein_id="EDL37288.1"
FT                   /translation="MGPRRKPQTPRRRPSSPAPGPSRQSSSVGSQTLRRRQKFMWLKEI
FT                   KTLQKSTDLLFRKKPFSMVVREICEKFSRGVDFWWQAQALLALQEPRQCSLLPRQQKLS
FT                   SSTSLRTPTSSPYMLVGSRFSPKTFS"
FT   CDS             join(4477074..4477158,4479737..4479780)
FT                   /codon_start=1
FT                   /gene="Cenpa"
FT                   /locus_tag="mCG_23505"
FT                   /product="centromere protein A, isoform CRA_c"
FT                   /note="gene_id=mCG23505.2 transcript_id=mCT173430.0
FT                   protein_id=mCP96349.0 isoform=CRA_c"
FT                   /db_xref="GOA:D6RCV6"
FT                   /db_xref="MGI:MGI:88375"
FT                   /db_xref="UniProtKB/TrEMBL:D6RCV6"
FT                   /protein_id="EDL37285.1"
FT                   /translation="MGPRRKPQTPRRRPSSPAPGPSRQSSSVEGQVHCSPPPPIWI"
FT   CDS             join(4477074..4477158,4479044..4479078)
FT                   /codon_start=1
FT                   /gene="Cenpa"
FT                   /locus_tag="mCG_23505"
FT                   /product="centromere protein A, isoform CRA_a"
FT                   /note="gene_id=mCG23505.2 transcript_id=mCT173428.0
FT                   protein_id=mCP96347.0 isoform=CRA_a"
FT                   /db_xref="GOA:D6RJ71"
FT                   /db_xref="MGI:MGI:88375"
FT                   /db_xref="UniProtKB/TrEMBL:D6RJ71"
FT                   /protein_id="EDL37283.1"
FT                   /translation="MGPRRKPQTPRRRPSSPAPGPSRQSSSVGVGTVGEGLWA"
FT   CDS             join(<4479095..4479097,4479783..4479873,4482509..4482615,
FT                   4483027..4483104,4483338..4483472)
FT                   /codon_start=1
FT                   /gene="Cenpa"
FT                   /locus_tag="mCG_23505"
FT                   /product="centromere protein A, isoform CRA_d"
FT                   /note="gene_id=mCG23505.2 transcript_id=mCT193542.0
FT                   protein_id=mCP114546.0 isoform=CRA_d"
FT                   /protein_id="EDL37286.1"
FT                   /translation="CIGEQAVSSIPPRILPPDSCLELLPWLLLMDGSQTLRRRQKFMWL
FT                   KEIKTLQKSTDLLFRKKPFSMVVREICEKFSRGVDFWWQAQALLALQEAAEAFLIHLFE
FT                   DAYLLSLHAGRVTLFPKDIQLTRRIRGFEGGLP"
FT   gene            4497634..4498061
FT                   /pseudo
FT                   /locus_tag="mCG_1046209"
FT                   /note="gene_id=mCG1046209.1"
FT   mRNA            4497634..4498061
FT                   /pseudo
FT                   /locus_tag="mCG_1046209"
FT                   /note="gene_id=mCG1046209.1 transcript_id=mCT163913.1
FT                   created on 14-OCT-2002"
FT   gene            4521739..4609845
FT                   /gene="Dpysl5"
FT                   /locus_tag="mCG_23504"
FT                   /note="gene_id=mCG23504.2"
FT   mRNA            join(4521739..4522177,4555531..4555795,4587663..4587821,
FT                   4588318..4588501,4589211..4589279,4591822..4591866,
FT                   4593538..4593613,4594654..4594810,4599042..4599183,
FT                   4601975..4602117,4602603..4602810,4604410..4604578,
FT                   4606713..4609445)
FT                   /gene="Dpysl5"
FT                   /locus_tag="mCG_23504"
FT                   /product="dihydropyrimidinase-like 5, transcript variant
FT                   mCT23413"
FT                   /note="gene_id=mCG23504.2 transcript_id=mCT23413.1 created
FT                   on 07-FEB-2003"
FT   mRNA            join(4521739..4522177,4555531..4555795,4587663..4587821,
FT                   4588318..4588497,4589211..4589279,4591822..4591866,
FT                   4593538..4593613,4594654..4594810,4599042..4599183,
FT                   4601975..4602117,4602603..4602810,4604410..4604578,
FT                   4606713..4609445)
FT                   /gene="Dpysl5"
FT                   /locus_tag="mCG_23504"
FT                   /product="dihydropyrimidinase-like 5, transcript variant
FT                   mCT179720"
FT                   /note="gene_id=mCG23504.2 transcript_id=mCT179720.0 created
FT                   on 07-FEB-2003"
FT   mRNA            join(4522027..4522177,4555531..4555795,4587663..4587821,
FT                   4589211..4589324,4593538..4593613,4594654..4594810,
FT                   4599042..4599187,4602496..4602810,4606713..4608804)
FT                   /gene="Dpysl5"
FT                   /locus_tag="mCG_23504"
FT                   /product="dihydropyrimidinase-like 5, transcript variant
FT                   mCT173427"
FT                   /note="gene_id=mCG23504.2 transcript_id=mCT173427.0 created
FT                   on 07-FEB-2003"
FT   mRNA            join(4522027..4522177,4555531..4555795,4587663..4587821,
FT                   4589119..4589324,4593538..4593613,4594654..4594810,
FT                   4602561..4602810,4604410..4604578,4606713..4608803)
FT                   /gene="Dpysl5"
FT                   /locus_tag="mCG_23504"
FT                   /product="dihydropyrimidinase-like 5, transcript variant
FT                   mCT173426"
FT                   /note="gene_id=mCG23504.2 transcript_id=mCT173426.0 created
FT                   on 07-FEB-2003"
FT   mRNA            join(<4522070..4522344,4555531..4555795,4587663..4587821,
FT                   4588318..4588497,4589211..4589279,4591822..4591866,
FT                   4593538..4593613,4594654..4594810,4599042..4599183,
FT                   4601975..4602117,4602603..4602810,4604410..4604578,
FT                   4606713..4609845)
FT                   /gene="Dpysl5"
FT                   /locus_tag="mCG_23504"
FT                   /product="dihydropyrimidinase-like 5, transcript variant
FT                   mCT193539"
FT                   /note="gene_id=mCG23504.2 transcript_id=mCT193539.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<4522292..4522344,4555531..4555795,4587663..4587821,
FT                   4588318..4588497,4589211..4589279,4591822..4591866,
FT                   4593538..4593613,4594654..4594810,4599042..4599183,
FT                   4601975..4602117,4602603..4602810,4604410..4604578,
FT                   4606713..4606798)
FT                   /codon_start=1
FT                   /gene="Dpysl5"
FT                   /locus_tag="mCG_23504"
FT                   /product="dihydropyrimidinase-like 5, isoform CRA_c"
FT                   /note="gene_id=mCG23504.2 transcript_id=mCT193539.0
FT                   protein_id=mCP114545.0 isoform=CRA_c"
FT                   /protein_id="EDL37291.1"
FT                   /translation="APPADERDVEDSGRSGLRNMLANSASVRILIKGGKVVNDDCTHEA
FT                   DVYIESGIIQQVGRELMIPGGAKVIDATGKLVIPGGIDTSTHFHQTFMNATCVDDFYHG
FT                   TKAALVGGTTMIIGHVLPDKETSLVEAYEKCRALADPKVCCDYALHVGITWWAPKVKAE
FT                   METLVREKGVNSFQMFMTYKDLYMLRDSELYQVFHACRDIGAIPRVHAENGELVAEGAK
FT                   EALDLGITGPEGIEISHPEELEAEATHRVITIANRTHCPIYLVNVSSISAGDVIAAAKM
FT                   QGKVVLAETTNAHATLTGLHYYHQDWSHAAAYVTVPPLRLDTNTSTYLMSLLANDTLNI
FT                   VASDHRPFTTKQKAMGKEDFTKIPHGVSGVQDRMSVVWERGVVGGKMDENRFVAVTSSN
FT                   AAKILNLYPRKGRIIPGADADVVVWDPEATKTISASTQVQGGDFNLYENMRCHGVPLVT
FT                   ISRGRVVYENGVFMCAEGTGKFCPLRSFPDIVYKKLVQREKTLKVRGVDRTPYLGDVAI
FT                   VVHPGKKEMGTPLADTPTRPVTRHGGMRDLHESSFSLSGSQIDDHVPKRASARILAPPG
FT                   GRSSGIW"
FT   CDS             join(4555535..4555795,4587663..4587821,4588318..4588497,
FT                   4589211..4589279,4591822..4591866,4593538..4593613,
FT                   4594654..4594810,4599042..4599183,4601975..4602117,
FT                   4602603..4602810,4604410..4604578,4606713..4606798)
FT                   /codon_start=1
FT                   /gene="Dpysl5"
FT                   /locus_tag="mCG_23504"
FT                   /product="dihydropyrimidinase-like 5, isoform CRA_b"
FT                   /note="gene_id=mCG23504.2 transcript_id=mCT179720.0
FT                   protein_id=mCP102642.0 isoform=CRA_b"
FT                   /protein_id="EDL37290.1"
FT                   /translation="MLANSASVRILIKGGKVVNDDCTHEADVYIESGIIQQVGRELMIP
FT                   GGAKVIDATGKLVIPGGIDTSTHFHQTFMNATCVDDFYHGTKAALVGGTTMIIGHVLPD
FT                   KETSLVEAYEKCRALADPKVCCDYALHVGITWWAPKVKAEMETLVREKGVNSFQMFMTY
FT                   KDLYMLRDSELYQVFHACRDIGAIPRVHAENGELVAEGAKEALDLGITGPEGIEISHPE
FT                   ELEAEATHRVITIANRTHCPIYLVNVSSISAGDVIAAAKMQGKVVLAETTNAHATLTGL
FT                   HYYHQDWSHAAAYVTVPPLRLDTNTSTYLMSLLANDTLNIVASDHRPFTTKQKAMGKED
FT                   FTKIPHGVSGVQDRMSVVWERGVVGGKMDENRFVAVTSSNAAKILNLYPRKGRIIPGAD
FT                   ADVVVWDPEATKTISASTQVQGGDFNLYENMRCHGVPLVTISRGRVVYENGVFMCAEGT
FT                   GKFCPLRSFPDIVYKKLVQREKTLKVRGVDRTPYLGDVAIVVHPGKKEMGTPLADTPTR
FT                   PVTRHGGMRDLHESSFSLSGSQIDDHVPKRASARILAPPGGRSSGIW"
FT   CDS             join(4555535..4555795,4587663..4587821,4589211..4589324,
FT                   4593538..4593613,4594654..4594810,4599042..4599187,
FT                   4602496..4602560)
FT                   /codon_start=1
FT                   /gene="Dpysl5"
FT                   /locus_tag="mCG_23504"
FT                   /product="dihydropyrimidinase-like 5, isoform CRA_a"
FT                   /note="gene_id=mCG23504.2 transcript_id=mCT173427.0
FT                   protein_id=mCP96345.0 isoform=CRA_a"
FT                   /protein_id="EDL37289.1"
FT                   /translation="MLANSASVRILIKGGKVVNDDCTHEADVYIESGIIQQVGRELMIP
FT                   GGAKVIDATGKLVIPGGIDTSTHFHQTFMNATCVDDFYHGTKAALVGGTTMIIGHVLPD
FT                   KETSLVEAYEKCRALADPKVCCDYALHVGITWWAPKGAKEALDLGITGPEGIEISHPEE
FT                   VGETSCVHGQLLYSQTHCPIYLVNVSSISAGDVIAAAKMQGKVVLAETTNAHATLTGLH
FT                   YYHQDWSHAAAYVTVPPLRLDTNTSTYLMSLLANDTLNIVASDHRPFTTKQKAMGKEDF
FT                   TKIPHGVSGVQDRMSVVWERGVVVLGTIPSCWVASLCHDVLCCL"
FT   CDS             join(4555535..4555795,4587663..4587821,4588318..4588501,
FT                   4589211..4589218)
FT                   /codon_start=1
FT                   /gene="Dpysl5"
FT                   /locus_tag="mCG_23504"
FT                   /product="dihydropyrimidinase-like 5, isoform CRA_d"
FT                   /note="gene_id=mCG23504.2 transcript_id=mCT23413.1
FT                   protein_id=mCP3985.2 isoform=CRA_d"
FT                   /protein_id="EDL37292.1"
FT                   /translation="MLANSASVRILIKGGKVVNDDCTHEADVYIESGIIQQVGRELMIP
FT                   GGAKVIDATGKLVIPGGIDTSTHFHQTFMNATCVDDFYHGTKAALVGGTTMIIGHVLPD
FT                   KETSLVEAYEKCRALADPKVCCDYALHVGITWWAPKVKAEMETLVREKGVNSFQMFMTY
FT                   KDLYMLRDSELYQVFHACRDIGAIPRVHAENGELVAEARC"
FT   CDS             join(4555535..4555795,4587663..4587821,4589119..4589130)
FT                   /codon_start=1
FT                   /gene="Dpysl5"
FT                   /locus_tag="mCG_23504"
FT                   /product="dihydropyrimidinase-like 5, isoform CRA_e"
FT                   /note="gene_id=mCG23504.2 transcript_id=mCT173426.0
FT                   protein_id=mCP96346.0 isoform=CRA_e"
FT                   /protein_id="EDL37293.1"
FT                   /translation="MLANSASVRILIKGGKVVNDDCTHEADVYIESGIIQQVGRELMIP
FT                   GGAKVIDATGKLVIPGGIDTSTHFHQTFMNATCVDDFYHGTKAALVGGTTMIIGHVLPD
FT                   KETSLVEAYEKCRALADPKVCCDYALHVGITWWAPKKEA"
FT   gene            <4625231..4676788
FT                   /gene="Mapre3"
FT                   /locus_tag="mCG_145577"
FT                   /note="gene_id=mCG145577.1"
FT   mRNA            join(<4625231..4625375,4672490..4672617,4673181..4674088,
FT                   4675257..4675411,4675498..4675650,4675811..4676740)
FT                   /gene="Mapre3"
FT                   /locus_tag="mCG_145577"
FT                   /product="microtubule-associated protein, RP/EB family,
FT                   member 3, transcript variant mCT185001"
FT                   /note="gene_id=mCG145577.1 transcript_id=mCT185001.0
FT                   created on 05-JUN-2003"
FT   mRNA            join(<4625233..4625375,4672490..4672617,4673181..4673326,
FT                   4673887..4674088,4675257..4675411,4675498..4675650,
FT                   4675811..4676788)
FT                   /gene="Mapre3"
FT                   /locus_tag="mCG_145577"
FT                   /product="microtubule-associated protein, RP/EB family,
FT                   member 3, transcript variant mCT193635"
FT                   /note="gene_id=mCG145577.1 transcript_id=mCT193635.0
FT                   created on 09-MAR-2004"
FT   CDS             join(<4625272..4625375,4672490..4672617,4673181..4673326,
FT                   4673887..4674088,4675257..4675411,4675498..4675650,
FT                   4675811..4675879)
FT                   /codon_start=1
FT                   /gene="Mapre3"
FT                   /locus_tag="mCG_145577"
FT                   /product="microtubule-associated protein, RP/EB family,
FT                   member 3, isoform CRA_b"
FT                   /note="gene_id=mCG145577.1 transcript_id=mCT193635.0
FT                   protein_id=mCP114614.0 isoform=CRA_b"
FT                   /protein_id="EDL37295.1"
FT                   /translation="DPPPRSRRPEPQPLPQRPRLPSPPLPSQPEPPPALWGMAVNVYST
FT                   SVTSENLSRHDMLAWVNDSLHLNYTKIEQLCSGAAYCQFMDMLFPGCVHLRKVKFQAKL
FT                   EHEYIHNFKVLQAAFKKMGVDKIIPVEKLVKGKFQDNFEFIQWFKKFFDANYDGKDYNP
FT                   LLARQGQDVAPPPNPGDQIFNKSKKLIGTAVPQRTSPTGPKNMQTSGRLSNVAPPCILR
FT                   KNPPSARNGGHEADAQILELNQQLLDLKLTVDGLEKERDFYFSKLRDIELICQEHESEN
FT                   SPVISGIIGILYATEEGFAPPEDDEIEEHQQEDQDEY"
FT   CDS             join(<4673797..4674088,4675257..4675411,4675498..4675650,
FT                   4675811..4675879)
FT                   /codon_start=1
FT                   /gene="Mapre3"
FT                   /locus_tag="mCG_145577"
FT                   /product="microtubule-associated protein, RP/EB family,
FT                   member 3, isoform CRA_a"
FT                   /note="gene_id=mCG145577.1 transcript_id=mCT185001.0
FT                   protein_id=mCP105608.0 isoform=CRA_a"
FT                   /protein_id="EDL37294.1"
FT                   /translation="GPGADFAVLTAEGSPTQQVGKMVCLCGLFQIIPVEKLVKGKFQDN
FT                   FEFIQWFKKFFDANYDGKDYNPLLARQGQDVAPPPNPGDQIFNKSKKLIGTAVPQRTSP
FT                   TGPKNMQTSGRLSNVAPPCILRKNPPSARNGGHEADAQILELNQQLLDLKLTVDGLEKE
FT                   RDFYFSKLRDIELICQEHESENSPVISGIIGILYATEEGFAPPEDDEIEEHQQEDQDEY
FT                   "
FT   gene            4680017..4689047
FT                   /gene="1110039B18Rik"
FT                   /locus_tag="mCG_23493"
FT                   /note="gene_id=mCG23493.2"
FT   mRNA            join(4680017..4680501,4681272..4681471,4682103..4682253,
FT                   4682404..4682538,4682755..4682837,4683184..4683289,
FT                   4683370..4683451,4683726..4683827,4684178..4684319,
FT                   4684639..4684730,4684996..4685044,4685220..4685333,
FT                   4685534..4685651,4686473..4686569,4686730..4686898,
FT                   4687046..4687191,4687347..4688144)
FT                   /gene="1110039B18Rik"
FT                   /locus_tag="mCG_23493"
FT                   /product="RIKEN cDNA 1110039B18, transcript variant
FT                   mCT23403"
FT                   /note="gene_id=mCG23493.2 transcript_id=mCT23403.1 created
FT                   on 25-SEP-2002"
FT   mRNA            join(<4680313..4680501,4681272..4681471,4682103..4682253,
FT                   4682404..4682538,4682755..4682837,4683184..4683289,
FT                   4683370..4683827,4684178..4684319,4684639..4684730,
FT                   4684996..4685044,4685220..4685333,4685534..4685651,
FT                   4686473..4686569,4686730..4686898,4687046..4687191,
FT                   4687347..4689047)
FT                   /gene="1110039B18Rik"
FT                   /locus_tag="mCG_23493"
FT                   /product="RIKEN cDNA 1110039B18, transcript variant
FT                   mCT193620"
FT                   /note="gene_id=mCG23493.2 transcript_id=mCT193620.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(<4680322..4680420,4683749..4683827,4684178..4684319,
FT                   4684639..4684730,4684996..4685044,4685220..4685333,
FT                   4685534..4685651,4686473..4686569,4686730..4686898,
FT                   4687046..4687191,4687347..4688145)
FT                   /gene="1110039B18Rik"
FT                   /locus_tag="mCG_23493"
FT                   /product="RIKEN cDNA 1110039B18, transcript variant
FT                   mCT193621"
FT                   /note="gene_id=mCG23493.2 transcript_id=mCT193621.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<4680324..4680420,4683749..4683827,4684178..4684319,
FT                   4684639..4684730,4684996..4685044,4685220..4685333,
FT                   4685534..4685651,4686473..4686569,4686730..4686898,
FT                   4687046..4687191,4687347..4687473)
FT                   /codon_start=1
FT                   /gene="1110039B18Rik"
FT                   /locus_tag="mCG_23493"
FT                   /product="RIKEN cDNA 1110039B18, isoform CRA_b"
FT                   /note="gene_id=mCG23493.2 transcript_id=mCT193621.0
FT                   protein_id=mCP114591.0 isoform=CRA_b"
FT                   /protein_id="EDL37297.1"
FT                   /translation="KPGGGGAEVMAARSAGSGGWEVVKRGRRPGASSFGMIGPKDFFPL
FT                   LDFAYMPNNSLSPSLQEQLCQLFPRLKVLAFGAKPESSLHTYFPSFLSRATPSCPAAMK
FT                   KELLASLTQCLTVDPLSTSVWRQLYPKHLSQSSLLLEHLLKSWEHIPKKARKSLQETIQ
FT                   SLKVTNQELLKKGSGGSEHVLTCDTACKGLLQRARGPRPPWARLFLLLLVFAVGFLCHD
FT                   LRSNSSLQASLTGRLLRSSGLLPVGQQVCARLSSYSLQSYNWLQETLPACGSHLLAVVQ
FT                   PSLQLAWTHIYAIFSFLSAHCASYLACFSDSLAGFFQRVQLPEALQQLFHALKELLLLF
FT                   CHSVLLPTWHLLLAALAQVQEHCHEACRGDVTWDCIKTQLSRAAQWTWLCLQDVTVAFL
FT                   DWALTMISQQ"
FT   CDS             join(4680351..4680501,4681272..4681471,4682103..4682253,
FT                   4682404..4682538,4682755..4682837,4683184..4683289,
FT                   4683370..4683451,4683726..4683827,4684178..4684319,
FT                   4684639..4684730,4684996..4685044,4685220..4685333,
FT                   4685534..4685651,4686473..4686569,4686730..4686898,
FT                   4687046..4687191,4687347..4687473)
FT                   /codon_start=1
FT                   /gene="1110039B18Rik"
FT                   /locus_tag="mCG_23493"
FT                   /product="RIKEN cDNA 1110039B18, isoform CRA_c"
FT                   /note="gene_id=mCG23493.2 transcript_id=mCT23403.1
FT                   protein_id=mCP4002.1 isoform=CRA_c"
FT                   /protein_id="EDL37298.1"
FT                   /translation="MAARSAGSGGWEVVKRGRRPGASSGGRGGGGGSDRRALGEANGVL
FT                   KYDLSSPIQTTSTLYERGFEKIMKRQNKEQVPPPAAESKKPINKKQPKKVTAVPSQNQK
FT                   QGPFRRLEDALKALDVAALQKELDKSQSVFTGNPSVWLKDLASYLNYKLQTPRMEPTLS
FT                   QYPHDYPYSLVSRELRGIIRGLLTKAAGSVELFFDHCLFTMLQELDKTPGESLHGYRIC
FT                   IQAVLQDKPKIVTSNLDKFLELLRSHQSRPAKCLTIMWALGQAGFTNLTEGLKVWLGIM
FT                   LPVLGIKALSPFAIAYLDRLLLMHPNLTKGFGMIGPKDFFPLLDFAYMPNNSLSPSLQE
FT                   QLCQLFPRLKVLAFGAKPESSLHTYFPSFLSRATPSCPAAMKKELLASLTQCLTVDPLS
FT                   TSVWRQLYPKHLSQSSLLLEHLLKSWEHIPKKARKSLQETIQSLKVTNQELLKKGSGGS
FT                   EHVLTCDTACKGLLQRARGPRPPWARLFLLLLVFAVGFLCHDLRSNSSLQASLTGRLLR
FT                   SSGLLPVGQQVCARLSSYSLQSYNWLQETLPACGSHLLAVVQPSLQLAWTHIYAIFSFL
FT                   SAHCASYLACFSDSLAGFFQRVQLPEALQQLFHALKELLLLFCHSVLLPTWHLLLAALA
FT                   QVQEHCHEACRGDVTWDCIKTQLSRAAQWTWLCLQDVTVAFLDWALTMISQQ"
FT   CDS             join(<4683670..4683827,4684178..4684319,4684639..4684730,
FT                   4684996..4685044,4685220..4685333,4685534..4685651,
FT                   4686473..4686569,4686730..4686898,4687046..4687191,
FT                   4687347..4687473)
FT                   /codon_start=1
FT                   /gene="1110039B18Rik"
FT                   /locus_tag="mCG_23493"
FT                   /product="RIKEN cDNA 1110039B18, isoform CRA_a"
FT                   /note="gene_id=mCG23493.2 transcript_id=mCT193620.0
FT                   protein_id=mCP114590.0 isoform=CRA_a"
FT                   /protein_id="EDL37296.1"
FT                   /translation="VHGWNTIVVSNKPAPSLSRMHPNLTKGFGMIGPKDFFPLLDFAYM
FT                   PNNSLSPSLQEQLCQLFPRLKVLAFGAKPESSLHTYFPSFLSRATPSCPAAMKKELLAS
FT                   LTQCLTVDPLSTSVWRQLYPKHLSQSSLLLEHLLKSWEHIPKKARKSLQETIQSLKVTN
FT                   QELLKKGSGGSEHVLTCDTACKGLLQRARGPRPPWARLFLLLLVFAVGFLCHDLRSNSS
FT                   LQASLTGRLLRSSGLLPVGQQVCARLSSYSLQSYNWLQETLPACGSHLLAVVQPSLQLA
FT                   WTHIYAIFSFLSAHCASYLACFSDSLAGFFQRVQLPEALQQLFHALKELLLLFCHSVLL
FT                   PTWHLLLAALAQVQEHCHEACRGDVTWDCIKTQLSRAAQWTWLCLQDVTVAFLDWALTM
FT                   ISQQ"
FT   gene            4699815..4717899
FT                   /gene="9430057O19Rik"
FT                   /locus_tag="mCG_23501"
FT                   /note="gene_id=mCG23501.3"
FT   mRNA            join(4699815..4699994,4701045..4701305,4701524..4701695,
FT                   4701985..4702148,4702738..4702915,4703363..4703541,
FT                   4703930..4704386,4704826..4704995,4705300..4705435,
FT                   4705922..4706124,4706691..4706905,4713987..4714142,
FT                   4715637..4715749,4716043..4716089,4716570..4716695,
FT                   4717050..4717898)
FT                   /gene="9430057O19Rik"
FT                   /locus_tag="mCG_23501"
FT                   /product="RIKEN cDNA 9430057O19, transcript variant
FT                   mCT23408"
FT                   /note="gene_id=mCG23501.3 transcript_id=mCT23408.2 created
FT                   on 25-SEP-2002"
FT   mRNA            join(<4699879..4700006,4701045..4701305,4701524..4701695,
FT                   4702083..4702148,4702738..4702915,4703363..4703541,
FT                   4703930..4704386,4704826..4705435,4705922..4706124,
FT                   4706691..4706905,4713987..4714142,4715637..4715749,
FT                   4716043..4716089,4716565..4716695,4717050..4717601)
FT                   /gene="9430057O19Rik"
FT                   /locus_tag="mCG_23501"
FT                   /product="RIKEN cDNA 9430057O19, transcript variant
FT                   mCT193536"
FT                   /note="gene_id=mCG23501.3 transcript_id=mCT193536.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(<4699926..4700006,4701045..4701305,4701524..4701695,
FT                   4701985..4702148,4702738..4702915,4703363..4703541,
FT                   4703930..4704386,4704826..4704995,4705300..4705435,
FT                   4705922..4706124,4706691..4706905,4713987..4714142,
FT                   4715637..4715749,4715952..4716089,4716565..4716695,
FT                   4717050..4717593)
FT                   /gene="9430057O19Rik"
FT                   /locus_tag="mCG_23501"
FT                   /product="RIKEN cDNA 9430057O19, transcript variant
FT                   mCT193537"
FT                   /note="gene_id=mCG23501.3 transcript_id=mCT193537.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<4699972..4700006,4701045..4701305,4701524..4701695,
FT                   4701985..4702148,4702738..4702915,4703363..4703541,
FT                   4703930..4704386,4704826..4704995,4705300..4705435,
FT                   4705922..4706124,4706691..4706905,4713987..4714142,
FT                   4715637..4715749,4715952..4716020)
FT                   /codon_start=1
FT                   /gene="9430057O19Rik"
FT                   /locus_tag="mCG_23501"
FT                   /product="RIKEN cDNA 9430057O19, isoform CRA_b"
FT                   /note="gene_id=mCG23501.3 transcript_id=mCT193537.0
FT                   protein_id=mCP114543.0 isoform=CRA_b"
FT                   /protein_id="EDL37300.1"
FT                   /translation="REREREQRPGESSQGLCGARGCFPSPTMELRCGGLLFSSRFDSGN
FT                   LAHVEKVETVSSDGEGVGGVATAPASGSAASPDYEFNVWTRPDCAETEYENGNRSWFYF
FT                   SVRGGTPGKLIKINIMNMNKQSKLYSQGMAPFVRTLPSRPRWERIRERPTFEMTETQFV
FT                   LSFVHRFVEGRGATTFFAFCYPFSYSDCQDLLSQLDQRFSENYSTHSSPLDSIYYHREL
FT                   LCYSLDGLRVDLLTITSCHGLRDDREPRLEQLFPDLGTPRPFRFTGKRIFFLSSRVHPG
FT                   ETPSSFVFNGFLDFILRPDDPRAQTLRRLFVFKLIPMLNPDGVVRGHYRTDSRGVNLNR
FT                   QYLKPDAVLHPAIYGAKAVLLYHHVHSRLNAKSPTNQQPTLHLPPEAPLSDLEKANNLH
FT                   NEAHLGQSPDGENPATWPETEPAEEKTDPVWLMPQPIPELEEPAPDTIPPKESGVAYYV
FT                   DLHGHASKRGCFMYGNSFSDESTQVENMLYPKLISLNSAHFDFQGCNFSEKNMYARDRR
FT                   DGQSKEGSGRVAIYKASGIIHSYTLECNYNTGRSVNSIPAACHDNGRASPPPPPAFPSR
FT                   YTVELFEQVGRAMAIAALDMAECNPWPRIVLSEHSSLTNLRAWMLRHVRNSRGLTSAGN
FT                   MGASKKRGARTPPKSNNSLPVSCSENALSRVRSFSTGTSTGGSSSSQQNSPQMKNSPSF
FT                   PFHGSRTAGLPGLGSSTQKVSHRVLGPVREPRCSDRRRRQQPLNHRSTTSSLAPSPTLA
FT                   SSGPTSSRNMGSCLLPNSLSLSGSSCSFSSSGDKPEAVMVIGKSLLGAGARIPCIRTRL
FT                   QTPLSLPDAPQPQPTSFGFPTRP"
FT   CDS             join(4701091..4701305,4701524..4701695,4701985..4702148,
FT                   4702738..4702915,4703363..4703541,4703930..4704386,
FT                   4704826..4704995,4705300..4705435,4705922..4706124,
FT                   4706691..4706905,4713987..4714142,4715637..4715749,
FT                   4716043..4716089,4716570..4716695,4717050..4717221)
FT                   /codon_start=1
FT                   /gene="9430057O19Rik"
FT                   /locus_tag="mCG_23501"
FT                   /product="RIKEN cDNA 9430057O19, isoform CRA_d"
FT                   /note="gene_id=mCG23501.3 transcript_id=mCT23408.2
FT                   protein_id=mCP3902.2 isoform=CRA_d"
FT                   /protein_id="EDL37302.1"
FT                   /translation="MELRCGGLLFSSRFDSGNLAHVEKVETVSSDGEGVGGVATAPASG
FT                   SAASPDYEFNVWTRPDCAETEYENGNRSWFYFSVRGGTPGKLIKINIMNMNKQSKLYSQ
FT                   GMAPFVRTLPSRPRWERIRERPTFEMTETQFVLSFVHRFVEGRGATTFFAFCYPFSYSD
FT                   CQDLLSQLDQRFSENYSTHSSPLDSIYYHRELLCYSLDGLRVDLLTITSCHGLRDDREP
FT                   RLEQLFPDLGTPRPFRFTGKRIFFLSSRVHPGETPSSFVFNGFLDFILRPDDPRAQTLR
FT                   RLFVFKLIPMLNPDGVVRGHYRTDSRGVNLNRQYLKPDAVLHPAIYGAKAVLLYHHVHS
FT                   RLNAKSPTNQQPTLHLPPEAPLSDLEKANNLHNEAHLGQSPDGENPATWPETEPAEEKT
FT                   DPVWLMPQPIPELEEPAPDTIPPKESGVAYYVDLHGHASKRGCFMYGNSFSDESTQVEN
FT                   MLYPKLISLNSAHFDFQGCNFSEKNMYARDRRDGQSKEGSGRVAIYKASGIIHSYTLEC
FT                   NYNTGRSVNSIPAACHDNGRASPPPPPAFPSRYTVELFEQVGRAMAIAALDMAECNPWP
FT                   RIVLSEHSSLTNLRAWMLRHVRNSRGLTSAGNMGASKKRGARTPPKSNNSLPVSCSENA
FT                   LSRVRSFSTGTSTGGSSSSQQNSPQMKNSPSFPFHGSRTAGLPGLGSSTQKVSHRVLGP
FT                   VREPRCSDRRRRQQPLNHRSTTSSLAPSPTLASSGPTSSRNMGSCLLPNSLSLSGSSCS
FT                   FSSSGDKPEAVMVIGKSLLGAGARIPCIRTRLQTCQRRVSARRGPGFPRPRLGRSSPPT
FT                   RRGMRGSSPTSPIPQTRESSELEPGPHSATPGLPQAGPPRPRSAPAFSPISCTLSDSPS
FT                   RICYSRGLLNQCEVCFVPKSPPLTISPRV"
FT   CDS             join(<4701595..4701695,4702083..4702148,4702738..4702915,
FT                   4703363..4703541,4703930..4704386,4704826..4705299)
FT                   /codon_start=1
FT                   /gene="9430057O19Rik"
FT                   /locus_tag="mCG_23501"
FT                   /product="RIKEN cDNA 9430057O19, isoform CRA_a"
FT                   /note="gene_id=mCG23501.3 transcript_id=mCT193536.0
FT                   protein_id=mCP114542.0 isoform=CRA_a"
FT                   /protein_id="EDL37299.1"
FT                   /translation="TSKANCIPRAWPPLCAHCLPGHAGNALESGPPLSDCQDLLSQLDQ
FT                   RFSENYSTHSSPLDSIYYHRELLCYSLDGLRVDLLTITSCHGLRDDREPRLEQLFPDLG
FT                   TPRPFRFTGKRIFFLSSRVHPGETPSSFVFNGFLDFILRPDDPRAQTLRRLFVFKLIPM
FT                   LNPDGVVRGHYRTDSRGVNLNRQYLKPDAVLHPAIYGAKAVLLYHHVHSRLNAKSPTNQ
FT                   QPTLHLPPEAPLSDLEKANNLHNEAHLGQSPDGENPATWPETEPAEEKTDPVWLMPQPI
FT                   PELEEPAPDTIPPKESGVAYYVDLHGHASKRGCFMYGNSFSDESTQVENMLYPKLISLN
FT                   SAHFDFQGCNFSEKNMYARDRRDGQSKEGSGRVAIYKASGIIHRLGGNWHSREITSLKE
FT                   KILIPGCLRGLNHANLLKREPQLARLALFWEFFTFGGLPGHMVSCYLGITAFSLGLYLF
FT                   QSDDYLRPSWCPSVFCCKTLTKISVS"
FT   mRNA            join(<4701615..4701695,4701985..4702148,4702738..4702915,
FT                   4703363..4703541,4703930..4704386,4704826..4704995,
FT                   4705300..4705435,4705922..4706124,4706691..4706905,
FT                   4713987..4714142,4715637..4715749,4716043..4716089,
FT                   4716565..4716695,4717050..4717899)
FT                   /gene="9430057O19Rik"
FT                   /locus_tag="mCG_23501"
FT                   /product="RIKEN cDNA 9430057O19, transcript variant
FT                   mCT193538"
FT                   /note="gene_id=mCG23501.3 transcript_id=mCT193538.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<4701615..4701695,4701985..4702148,4702738..4702915,
FT                   4703363..4703541,4703930..4704386,4704826..4704995,
FT                   4705300..4705435,4705922..4706124,4706691..4706905,
FT                   4713987..4714142,4715637..4715749,4716043..4716089,
FT                   4716565..4716613)
FT                   /codon_start=1
FT                   /gene="9430057O19Rik"
FT                   /locus_tag="mCG_23501"
FT                   /product="RIKEN cDNA 9430057O19, isoform CRA_c"
FT                   /note="gene_id=mCG23501.3 transcript_id=mCT193538.0
FT                   protein_id=mCP114544.0 isoform=CRA_c"
FT                   /protein_id="EDL37301.1"
FT                   /translation="SQGMAPFVRTLPSRPRWERIRERPTFEMTETQFVLSFVHRFVEGR
FT                   GATTFFAFCYPFSYSDCQDLLSQLDQRFSENYSTHSSPLDSIYYHRELLCYSLDGLRVD
FT                   LLTITSCHGLRDDREPRLEQLFPDLGTPRPFRFTGKRIFFLSSRVHPGETPSSFVFNGF
FT                   LDFILRPDDPRAQTLRRLFVFKLIPMLNPDGVVRGHYRTDSRGVNLNRQYLKPDAVLHP
FT                   AIYGAKAVLLYHHVHSRLNAKSPTNQQPTLHLPPEAPLSDLEKANNLHNEAHLGQSPDG
FT                   ENPATWPETEPAEEKTDPVWLMPQPIPELEEPAPDTIPPKESGVAYYVDLHGHASKRGC
FT                   FMYGNSFSDESTQVENMLYPKLISLNSAHFDFQGCNFSEKNMYARDRRDGQSKEGSGRV
FT                   AIYKASGIIHSYTLECNYNTGRSVNSIPAACHDNGRASPPPPPAFPSRYTVELFEQVGR
FT                   AMAIAALDMAECNPWPRIVLSEHSSLTNLRAWMLRHVRNSRGLTSAGNMGASKKRGART
FT                   PPKSNNSLPVSCSENALSRVRSFSTGTSTGGSSSSQQNSPQMKNSPSFPFHGSRTAGLP
FT                   GLGSSTQKVSHRVLGPVREPRCSDRRRRQQPLNHRSTTSSLAPSPTLASSGPTSSRNMG
FT                   SCLLPNSLSLSGSSCSFSSSGDKPEAVMVIGKSLLGAGARIPCIRTRLQTCQRRVSARR
FT                   GPGFPRLGPGWAGAHRRLAEG"
FT   gene            complement(4716818..4718724)
FT                   /gene="2310016E02Rik"
FT                   /locus_tag="mCG_23494"
FT                   /note="gene_id=mCG23494.1"
FT   mRNA            complement(join(4716818..4717700,4718333..4718470,
FT                   4718599..4718724))
FT                   /gene="2310016E02Rik"
FT                   /locus_tag="mCG_23494"
FT                   /product="RIKEN cDNA 2310016E02, transcript variant
FT                   mCT23404"
FT                   /note="gene_id=mCG23494.1 transcript_id=mCT23404.1 created
FT                   on 25-SEP-2002"
FT   mRNA            complement(join(4716841..4717700,4718333..4718651))
FT                   /gene="2310016E02Rik"
FT                   /locus_tag="mCG_23494"
FT                   /product="RIKEN cDNA 2310016E02, transcript variant
FT                   mCT173721"
FT                   /note="gene_id=mCG23494.1 transcript_id=mCT173721.0 created
FT                   on 25-SEP-2002"
FT   CDS             complement(4718356..4718469)
FT                   /codon_start=1
FT                   /gene="2310016E02Rik"
FT                   /locus_tag="mCG_23494"
FT                   /product="RIKEN cDNA 2310016E02, isoform CRA_a"
FT                   /note="gene_id=mCG23494.1 transcript_id=mCT173721.0
FT                   protein_id=mCP96640.0 isoform=CRA_a"
FT                   /protein_id="EDL37303.1"
FT                   /translation="MITDVQLAIFANMLGVSLFLLVVLYHYVAVNNPKKQE"
FT   CDS             complement(4718356..4718469)
FT                   /codon_start=1
FT                   /gene="2310016E02Rik"
FT                   /locus_tag="mCG_23494"
FT                   /product="RIKEN cDNA 2310016E02, isoform CRA_a"
FT                   /note="gene_id=mCG23494.1 transcript_id=mCT23404.1
FT                   protein_id=mCP3914.2 isoform=CRA_a"
FT                   /protein_id="EDL37304.1"
FT                   /translation="MITDVQLAIFANMLGVSLFLLVVLYHYVAVNNPKKQE"
FT   gene            4724511..4732363
FT                   /gene="Emilin1"
FT                   /locus_tag="mCG_23500"
FT                   /note="gene_id=mCG23500.1"
FT   mRNA            join(4724511..4725123,4726063..4726188,4726598..4726818,
FT                   4728027..4729952,4730349..4730465,4731024..4731041,
FT                   4731173..4731310,4731708..4732363)
FT                   /gene="Emilin1"
FT                   /locus_tag="mCG_23500"
FT                   /product="elastin microfibril interfacer 1, transcript
FT                   variant mCT23410"
FT                   /note="gene_id=mCG23500.1 transcript_id=mCT23410.1 created
FT                   on 16-SEP-2002"
FT   CDS             join(4724954..4725123,4726063..4726188,4726598..4726818,
FT                   4728027..4729952,4730349..4730465,4731024..4731041,
FT                   4731173..4731310,4731708..4732045)
FT                   /codon_start=1
FT                   /gene="Emilin1"
FT                   /locus_tag="mCG_23500"
FT                   /product="elastin microfibril interfacer 1, isoform CRA_b"
FT                   /note="gene_id=mCG23500.1 transcript_id=mCT23410.1
FT                   protein_id=mCP4009.2 isoform=CRA_b"
FT                   /protein_id="EDL37306.1"
FT                   /translation="MAPRALWSCYLCCLLTIATEAASYPPRGYSLYTGGTGALSPGGPQ
FT                   AQNSPRPASRHRNWCAYVVTRTVSCVLEDGVETIVKPDYQPCGWGQPHCSRSIMYRSFL
FT                   RPRYRVAYKTVTDMEWRCCQGYGGDDCGEGPASVLGPAPSTPLPRPRPVRPNLSGSSAG
FT                   SHLSGLGGEGPVESEKVQQLERQVKSLTKELQGLRGVLQGMNGRLAEDVQRAVDTVFNG
FT                   RQQPADAAARPGVHETLSEIQQQLQLLDNRVSTHDQELGHLNNHHNGGPGGGGRASGPV
FT                   PVPSGPSEELLRQLERQLQESCSVCLTGLDGFRQQQQEDRERLRTLEKLMSSMEERQQQ
FT                   LVGPAMARRPPQECCPPELGRRVSELERRLDVVTGSLTVLSGRRGSELGGAAGQGGHPP
FT                   GYTSLASRLSRLEDRFNSTLGPSEEQEKNWPGGPGRLGHWLPAAPGRLEKLEGLLANVS
FT                   RELGGRMDLLEEQVAGAVRTCGQICSGAPGEQDSRVNEILSALERRVLDSEGRLQLVGS
FT                   GLHEAEAAGEAQQAVLEGLQGLLSRLRERMDAQEETAAEILLRLNLTAAQLSQLEGLLQ
FT                   ARGDEGCGACGGVQEELGRLRDGVERCSCPLLPPRGPGAGPGVGGPSRGPLDGFSVFGG
FT                   SSGSALQALQGELSEVILTFSSLNDSLHELQTTVEGQGADLADLGATKDSIISEINRLQ
FT                   QEATEHVTESEERFRGLEEGQAQAGQCPSLEGRLGRLEGVCERLDTVAGGLQGLREGLS
FT                   RHVAGLWAAVRESNSTSLTQAALLEKLLGGQAGLGRRLGALNNSLLLLEDRLQQLSLKD
FT                   FTGPSGKAGPPGPPGLQGPSGPAGPPGPPGKDGQQGAIGPPGPQGEQGAEGAPAAPVPR
FT                   VAFSAALSLPRSEPGTVPFDRVLLNDGGYYDPETGVFTAPLAGRYLLSAVLTGHRHEKV
FT                   EAVLSRSNLGVARIDSGGYEPEGLENKPVAESQPSPGALGVFSLILPLQVGDTVCIDLV
FT                   MGQLAHSEEPLTIFSGALLYEDTELEQV"
FT   mRNA            join(<4729330..4729952,4731173..4731310,4731708..4732349)
FT                   /gene="Emilin1"
FT                   /locus_tag="mCG_23500"
FT                   /product="elastin microfibril interfacer 1, transcript
FT                   variant mCT173425"
FT                   /note="gene_id=mCG23500.1 transcript_id=mCT173425.0 created
FT                   on 16-SEP-2002"
FT   CDS             join(<4729331..4729952,4731173..4731310,4731708..4732045)
FT                   /codon_start=1
FT                   /gene="Emilin1"
FT                   /locus_tag="mCG_23500"
FT                   /product="elastin microfibril interfacer 1, isoform CRA_a"
FT                   /note="gene_id=mCG23500.1 transcript_id=mCT173425.0
FT                   protein_id=mCP96344.0 isoform=CRA_a"
FT                   /protein_id="EDL37305.1"
FT                   /translation="LPPRGPGAGPGVGGPSRGPLDGFSVFGGSSGSALQALQGELSEVI
FT                   LTFSSLNDSLHELQTTVEGQGADLADLGATKDSIISEINRLQQEATEHVTESEERFRGL
FT                   EEGQAQAGQCPSLEGRLGRLEGVCERLDTVAGGLQGLREGLSRHVAGLWAAVRESNSTS
FT                   LTQAALLEKLLGGQAGLGRRLGALNNSLLLLEDRLQQLSLKDFTGAEGAPAAPVPRVAF
FT                   SAALSLPRSEPGTVPFDRVLLNDGGYYDPETGVFTAPLAGRYLLSAVLTGHRHEKVEAV
FT                   LSRSNLGVARIDSGGYEPEGLENKPVAESQPSPGALGVFSLILPLQVGDTVCIDLVMGQ
FT                   LAHSEEPLTIFSGALLYEDTELEQV"
FT   gene            4732633..4742341
FT                   /gene="Khk"
FT                   /locus_tag="mCG_23498"
FT                   /note="gene_id=mCG23498.2"
FT   mRNA            join(4732633..4733100,4735832..4735948,4737781..4737915,
FT                   4739536..4739608,4740614..>4740761)
FT                   /gene="Khk"
FT                   /locus_tag="mCG_23498"
FT                   /product="ketohexokinase, transcript variant mCT181686"
FT                   /note="gene_id=mCG23498.2 transcript_id=mCT181686.0 created
FT                   on 03-APR-2003"
FT   mRNA            join(4732691..4733100,4735832..4735948,4738115..4738249,
FT                   4739536..4739608,4740614..4740760,4741642..4741730,
FT                   4741810..4741967,4742056..4742341)
FT                   /gene="Khk"
FT                   /locus_tag="mCG_23498"
FT                   /product="ketohexokinase, transcript variant mCT23407"
FT                   /note="gene_id=mCG23498.2 transcript_id=mCT23407.1 created
FT                   on 03-APR-2003"
FT   mRNA            join(4732713..4733100,4735832..4735948,4737781..4737915,
FT                   4738115..4738249,4739536..4739608,4740614..>4740638)
FT                   /gene="Khk"
FT                   /locus_tag="mCG_23498"
FT                   /product="ketohexokinase, transcript variant mCT181685"
FT                   /note="gene_id=mCG23498.2 transcript_id=mCT181685.0 created
FT                   on 03-APR-2003"
FT   mRNA            join(4732724..4733100,4735832..4735948,4738115..4738249,
FT                   4739536..4739608,4740614..4740760,4741642..4741719,
FT                   4741802..>4741899)
FT                   /gene="Khk"
FT                   /locus_tag="mCG_23498"
FT                   /product="ketohexokinase, transcript variant mCT181688"
FT                   /note="gene_id=mCG23498.2 transcript_id=mCT181688.0 created
FT                   on 03-APR-2003"
FT   mRNA            join(4732735..4733100,4735832..4735948,4739536..4739608,
FT                   4740614..4740760,4741642..4741730,4741810..4741967,
FT                   4742056..4742341)
FT                   /gene="Khk"
FT                   /locus_tag="mCG_23498"
FT                   /product="ketohexokinase, transcript variant mCT181687"
FT                   /note="gene_id=mCG23498.2 transcript_id=mCT181687.0 created
FT                   on 03-APR-2003"
FT   CDS             join(4733009..4733100,4735832..4735948,4738115..4738249,
FT                   4739536..4739608,4740614..4740760,4741642..4741730,
FT                   4741810..4741967,4742056..4742141)
FT                   /codon_start=1
FT                   /gene="Khk"
FT                   /locus_tag="mCG_23498"
FT                   /product="ketohexokinase, isoform CRA_d"
FT                   /note="gene_id=mCG23498.2 transcript_id=mCT23407.1
FT                   protein_id=mCP3947.0 isoform=CRA_d"
FT                   /protein_id="EDL37310.1"
FT                   /translation="MEEKQILCVGLVVLDIINVVDKYPEEDTDRRCLSQRWQRGGNASN
FT                   SCTVLSLLGARCAFMGSLAPGHVADFLVADFRQRGVDVSQVTWQSQGDTPCSCCIVNNS
FT                   NGSRTIILYDTNLPDVSAKDFEKVDLTRFKWIHIEGRNASEQVKMLQRIEEHNAKQPLP
FT                   QKVRVSVEIEKPREELFQLFSYGEVVFVSKDVAKHLGFQSAVEALRGLYSRVKKGATLV
FT                   CAWAEEGADALGPDGQLLHSDAFPPPRVVDTLGAGDTFNASVIFSLSKGNSMQEALRFG
FT                   CQVAGKKCGLQGFDGIV"
FT   CDS             join(4733009..4733100,4735832..4735948,4739536..4739608,
FT                   4740614..4740760,4741642..4741730,4741810..4741967,
FT                   4742056..4742141)
FT                   /codon_start=1
FT                   /gene="Khk"
FT                   /locus_tag="mCG_23498"
FT                   /product="ketohexokinase, isoform CRA_e"
FT                   /note="gene_id=mCG23498.2 transcript_id=mCT181687.0
FT                   protein_id=mCP104607.0 isoform=CRA_e"
FT                   /protein_id="EDL37311.1"
FT                   /translation="MEEKQILCVGLVVLDIINVVDKYPEEDTDRRCLSQRWQRGGNASN
FT                   SCTVLSLLGARCAFMGSLAPGHVAENLPDVSAKDFEKVDLTRFKWIHIEGRNASEQVKM
FT                   LQRIEEHNAKQPLPQKVRVSVEIEKPREELFQLFSYGEVVFVSKDVAKHLGFQSAVEAL
FT                   RGLYSRVKKGATLVCAWAEEGADALGPDGQLLHSDAFPPPRVVDTLGAGDTFNASVIFS
FT                   LSKGNSMQEALRFGCQVAGKKCGLQGFDGIV"
FT   CDS             join(4733009..4733100,4735832..4735948,4738115..4738249,
FT                   4739536..4739608,4740614..4740760,4741642..4741719,
FT                   4741802..>4741899)
FT                   /codon_start=1
FT                   /gene="Khk"
FT                   /locus_tag="mCG_23498"
FT                   /product="ketohexokinase, isoform CRA_c"
FT                   /note="gene_id=mCG23498.2 transcript_id=mCT181688.0
FT                   protein_id=mCP104610.0 isoform=CRA_c"
FT                   /protein_id="EDL37309.1"
FT                   /translation="MEEKQILCVGLVVLDIINVVDKYPEEDTDRRCLSQRWQRGGNASN
FT                   SCTVLSLLGARCAFMGSLAPGHVADFLVADFRQRGVDVSQVTWQSQGDTPCSCCIVNNS
FT                   NGSRTIILYDTNLPDVSAKDFEKVDLTRFKWIHIEGRNASEQVKMLQRIEEHNAKQPLP
FT                   QKVRVSVEIEKPREELFQLFSYGEVVFVSKDVAKHLGFQSAVEALRGLYSRSYRATLVC
FT                   AWAEEGADALGPDGQLLHSDAFPPP"
FT   CDS             join(4733009..4733100,4735832..4735948,4737781..4737915,
FT                   4739536..4739608,4740614..>4740761)
FT                   /codon_start=1
FT                   /gene="Khk"
FT                   /locus_tag="mCG_23498"
FT                   /product="ketohexokinase, isoform CRA_b"
FT                   /note="gene_id=mCG23498.2 transcript_id=mCT181686.0
FT                   protein_id=mCP104609.0 isoform=CRA_b"
FT                   /protein_id="EDL37308.1"
FT                   /translation="MEEKQILCVGLVVLDIINVVDKYPEEDTDRRCLSQRWQRGGNASN
FT                   SCTVLSLLGARCAFMGSLAPGHVADFVLDDLRQHSVDLRYVVLQTEGSIPTSTVIINEA
FT                   SGSRTILHAYRNLPDVSAKDFEKVDLTRFKWIHIEGRNASEQVKMLQRIEEHNAKQPLP
FT                   QKVRVSVEIEKPREELFQLFSYGEV"
FT   CDS             join(4733009..4733100,4735832..4735948,4737781..4737915,
FT                   4738115..4738249,4739536..4739608,4740614..>4740638)
FT                   /codon_start=1
FT                   /gene="Khk"
FT                   /locus_tag="mCG_23498"
FT                   /product="ketohexokinase, isoform CRA_a"
FT                   /note="gene_id=mCG23498.2 transcript_id=mCT181685.0
FT                   protein_id=mCP104608.0 isoform=CRA_a"
FT                   /protein_id="EDL37307.1"
FT                   /translation="MEEKQILCVGLVVLDIINVVDKYPEEDTDRRCLSQRWQRGGNASN
FT                   SCTVLSLLGARCAFMGSLAPGHVADFVLDDLRQHSVDLRYVVLQTEGSIPTSTVIINEA
FT                   SGSRTILHAYSFLVADFRQRGVDVSQVTWQSQGDTPCSCCIVNNSNGSRTIILYDTNLP
FT                   DVSAKDFEKVDLTRFKWIHIEGRNASEQV"
FT   gene            complement(4744239..4756578)
FT                   /locus_tag="mCG_23492"
FT                   /note="gene_id=mCG23492.1"
FT   mRNA            complement(join(4744239..4745088,4745260..4745381,
FT                   4745456..4745526,4745620..4745685,4746955..4747057,
FT                   4756387..4756578))
FT                   /locus_tag="mCG_23492"
FT                   /product="mCG23492, transcript variant mCT23402"
FT                   /note="gene_id=mCG23492.1 transcript_id=mCT23402.2 created
FT                   on 18-FEB-2003"
FT   mRNA            complement(join(4744243..4745088,4745260..4745381,
FT                   4745456..4745526,4745620..4745685,4746955..4747057,
FT                   4756450..4756500))
FT                   /locus_tag="mCG_23492"
FT                   /product="mCG23492, transcript variant mCT180313"
FT                   /note="gene_id=mCG23492.1 transcript_id=mCT180313.0 created
FT                   on 18-FEB-2003"
FT   CDS             complement(join(4744588..4745088,4745260..4745381,
FT                   4745456..4745526,4745620..4745685,4746955..4747040))
FT                   /codon_start=1
FT                   /locus_tag="mCG_23492"
FT                   /product="mCG23492, isoform CRA_a"
FT                   /note="gene_id=mCG23492.1 transcript_id=mCT180313.0
FT                   protein_id=mCP103235.0 isoform=CRA_a"
FT                   /protein_id="EDL37312.1"
FT                   /translation="MFQWLMQALMLPLLLLPLGRAAPKDGVARLDPEVQQQLTPNPFQP
FT                   GPEQLRHLQNYLKGLEKMEEDPEHMDREQVLLSLFALHDYDQNGQLDGLELLSMLTAAL
FT                   APGAAHFPINPVILVVDSVLETQDLDGDGLMTPAELINFPEVPKHTESLPPALQEPQPA
FT                   GSQPLLANSPLQSETQQSLGTKEEIRGQVEAKRASLEPEQEAGHQTEGKVDTLSPEEEA
FT                   RGQAESEGDVPGPREGAEEQVEIKDNEGEAKELLVETLESLNTPNEAEAHSIQLENDEI
FT                   "
FT   CDS             complement(join(4744588..4745088,4745260..4745381,
FT                   4745456..4745526,4745620..4745685,4746955..4747040))
FT                   /codon_start=1
FT                   /locus_tag="mCG_23492"
FT                   /product="mCG23492, isoform CRA_a"
FT                   /note="gene_id=mCG23492.1 transcript_id=mCT23402.2
FT                   protein_id=mCP3982.2 isoform=CRA_a"
FT                   /protein_id="EDL37313.1"
FT                   /translation="MFQWLMQALMLPLLLLPLGRAAPKDGVARLDPEVQQQLTPNPFQP
FT                   GPEQLRHLQNYLKGLEKMEEDPEHMDREQVLLSLFALHDYDQNGQLDGLELLSMLTAAL
FT                   APGAAHFPINPVILVVDSVLETQDLDGDGLMTPAELINFPEVPKHTESLPPALQEPQPA
FT                   GSQPLLANSPLQSETQQSLGTKEEIRGQVEAKRASLEPEQEAGHQTEGKVDTLSPEEEA
FT                   RGQAESEGDVPGPREGAEEQVEIKDNEGEAKELLVETLESLNTPNEAEAHSIQLENDEI
FT                   "
FT   gene            4761164..4766187
FT                   /gene="Abhd1"
FT                   /locus_tag="mCG_23497"
FT                   /note="gene_id=mCG23497.1"
FT   mRNA            join(4761164..4761340,4763981..4764141,4764441..4764623,
FT                   4764765..4764810,4764977..4765089,4765189..4765363,
FT                   4765503..4765551,4765632..4765797,4765914..4766187)
FT                   /gene="Abhd1"
FT                   /locus_tag="mCG_23497"
FT                   /product="abhydrolase domain containing 1, transcript
FT                   variant mCT23406"
FT                   /note="gene_id=mCG23497.1 transcript_id=mCT23406.1 created
FT                   on 16-SEP-2002"
FT   mRNA            join(4761184..4761340,4764441..4764623,4764765..4764810,
FT                   4764977..4765089,4765189..4765363,4765503..4765551,
FT                   4765632..4765798)
FT                   /gene="Abhd1"
FT                   /locus_tag="mCG_23497"
FT                   /product="abhydrolase domain containing 1, transcript
FT                   variant mCT173424"
FT                   /note="gene_id=mCG23497.1 transcript_id=mCT173424.0 created
FT                   on 16-SEP-2002"
FT   CDS             join(4761203..4761340,4763981..4764141,4764441..4764623,
FT                   4764765..4764810,4764977..4765089,4765189..4765279)
FT                   /codon_start=1
FT                   /gene="Abhd1"
FT                   /locus_tag="mCG_23497"
FT                   /product="abhydrolase domain containing 1, isoform CRA_b"
FT                   /note="gene_id=mCG23497.1 transcript_id=mCT23406.1
FT                   protein_id=mCP3923.2 isoform=CRA_b"
FT                   /protein_id="EDL37315.1"
FT                   /translation="MEYPYTTKMLSSSLSPQNGTWSDTISLLLALGVALYLGYYWACVP
FT                   QRPRLVAGPQFLAFLEQHCPVTVETFYPTLWCFEGRLQTIFRVLLQSQPVVPYRSEVLQ
FT                   TPDGGQFLLDWAEQPNSTHYPDPTTQPIVLLLPGISGSSQEPYILHLVNQALKDGYRAV
FT                   VFNNRGCRGEELLTHRAYCASNTEDLETVVKHIKRRYSQAPLLAVGISFGGILVLNYLA
FT                   QTGKAGGLVAGLTIVCMLGFL"
FT   CDS             join(4761203..4761340,4764441..4764443)
FT                   /codon_start=1
FT                   /gene="Abhd1"
FT                   /locus_tag="mCG_23497"
FT                   /product="abhydrolase domain containing 1, isoform CRA_a"
FT                   /note="gene_id=mCG23497.1 transcript_id=mCT173424.0
FT                   protein_id=mCP96343.0 isoform=CRA_a"
FT                   /protein_id="EDL37314.1"
FT                   /translation="MEYPYTTKMLSSSLSPQNGTWSDTISLLLALGVALYLGYYWACVP
FT                   Q"
FT   gene            complement(4766141..4770973)
FT                   /gene="Preb"
FT                   /locus_tag="mCG_23495"
FT                   /note="gene_id=mCG23495.2"
FT   mRNA            complement(join(4766141..4766835,4767360..4767432,
FT                   4768580..4768753,4768925..4769049,4769163..4769243,
FT                   4769408..4769628,4769915..4770104,4770663..4770973))
FT                   /gene="Preb"
FT                   /locus_tag="mCG_23495"
FT                   /product="prolactin regulatory element binding, transcript
FT                   variant mCT180314"
FT                   /note="gene_id=mCG23495.2 transcript_id=mCT180314.0 created
FT                   on 18-FEB-2003"
FT   mRNA            complement(join(4766148..4766835,4767028..4767187,
FT                   4767360..4767432,4768580..4768753,4768925..4769049,
FT                   4769163..4769243,4769408..4769628,4769915..4770104,
FT                   4770663..4770932))
FT                   /gene="Preb"
FT                   /locus_tag="mCG_23495"
FT                   /product="prolactin regulatory element binding, transcript
FT                   variant mCT23405"
FT                   /note="gene_id=mCG23495.2 transcript_id=mCT23405.1 created
FT                   on 18-FEB-2003"
FT   CDS             complement(join(4766741..4766835,4767028..4767187,
FT                   4767360..4767432,4768580..4768753,4768925..4769049,
FT                   4769163..4769243,4769408..4769628,4769915..4770104,
FT                   4770663..4770797))
FT                   /codon_start=1
FT                   /gene="Preb"
FT                   /locus_tag="mCG_23495"
FT                   /product="prolactin regulatory element binding, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG23495.2 transcript_id=mCT23405.1
FT                   protein_id=mCP3904.1 isoform=CRA_c"
FT                   /db_xref="GOA:Q3UAP1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="MGI:MGI:1355326"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UAP1"
FT                   /protein_id="EDL37318.1"
FT                   /translation="MGRRRGVELYRAPFPLYALRIDPKTGLLIAAGGGGAAKTGIKNGV
FT                   HFLQLELINGCLSASLLHSHDTETRATMNLALAGDILAAGQDAQCQLLRFQVHQQKGSK
FT                   AEKSGSKEQGPRQRKGAPPAEKKSGAQVHPEGVELKVKNLEAVQTDFSNEPLQKVVCFN
FT                   HDNTLLATGGTDGHVRVWKVPSLEKVLEFKAHEGEIGDLTLGPDGKLVTVGWDFKASVW
FT                   QKDQLVTQLQWQENGPASSNTPYRYQACRFGQVPDQLGGLRLFTVQIPHKRLRQPPPCY
FT                   LTAWDSSTFLPLRTRSCGHEVISCLSVSDSGTFLGLGTVTGSVAIYIAFSLQRLYYVKE
FT                   AHGIVVTDVTFLPEKGCGPKLLGPHETALFSVAVDSRCQLHLLPSRRSVPVWLLLLLCV
FT                   GLIIVTILLLQTAFPGFL"
FT   mRNA            complement(join(<4766781..4766835,4768580..4768753,
FT                   4768925..4769049,4769163..>4769243))
FT                   /gene="Preb"
FT                   /locus_tag="mCG_23495"
FT                   /product="prolactin regulatory element binding, transcript
FT                   variant mCT173423"
FT                   /note="gene_id=mCG23495.2 transcript_id=mCT173423.0 created
FT                   on 18-FEB-2003"
FT   CDS             complement(join(<4766781..4766835,4768580..4768753,
FT                   4768925..4769049,4769163..>4769243))
FT                   /codon_start=1
FT                   /gene="Preb"
FT                   /locus_tag="mCG_23495"
FT                   /product="prolactin regulatory element binding, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG23495.2 transcript_id=mCT173423.0
FT                   protein_id=mCP96342.0 isoform=CRA_a"
FT                   /protein_id="EDL37316.1"
FT                   /translation="VPSLEKVLEFKAHEGEIGDLTLGPDGKLVTVGWDFKASVWQKDQL
FT                   VTQLQWQENGPASSNTPYRYQACRFGQVPDQLGGLRLFTVQIPHKRLRQPPPCYLTAWD
FT                   SSTFLPLRTRSCGHEVISCLSVRECSCMASAPAVCRPYYCD"
FT   CDS             complement(join(4766782..4766835,4767360..4767432,
FT                   4768580..4768753,4768925..4769049,4769163..4769243,
FT                   4769408..4769628,4769915..4770104,4770663..4770797))
FT                   /codon_start=1
FT                   /gene="Preb"
FT                   /locus_tag="mCG_23495"
FT                   /product="prolactin regulatory element binding, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG23495.2 transcript_id=mCT180314.0
FT                   protein_id=mCP103236.0 isoform=CRA_b"
FT                   /db_xref="GOA:D3Z3S1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="MGI:MGI:1355326"
FT                   /db_xref="UniProtKB/TrEMBL:D3Z3S1"
FT                   /protein_id="EDL37317.1"
FT                   /translation="MGRRRGVELYRAPFPLYALRIDPKTGLLIAAGGGGAAKTGIKNGV
FT                   HFLQLELINGCLSASLLHSHDTETRATMNLALAGDILAAGQDAQCQLLRFQVHQQKGSK
FT                   AEKSGSKEQGPRQRKGAPPAEKKSGAQVHPEGVELKVKNLEAVQTDFSNEPLQKVVCFN
FT                   HDNTLLATGGTDGHVRVWKVPSLEKVLEFKAHEGEIGDLTLGPDGKLVTVGWDFKASVW
FT                   QKDQLVTQLQWQENGPASSNTPYRYQACRFGQVPDQLGGLRLFTVQIPHKRLRQPPPCY
FT                   LTAWDSSTFLPLRTRSCGHEVISCLSVSDSGTFLGLGTVTGSVAIYIAFSLQGVFLYGF
FT                   CSCCVSALLL"
FT   gene            4779350..4787692
FT                   /gene="Tcf23"
FT                   /locus_tag="mCG_63988"
FT                   /note="gene_id=mCG63988.2"
FT   mRNA            join(4779350..4779671,4780749..4780991,4784156..4787692)
FT                   /gene="Tcf23"
FT                   /locus_tag="mCG_63988"
FT                   /product="transcription factor 23"
FT                   /note="gene_id=mCG63988.2 transcript_id=mCT64171.2 created
FT                   on 16-SEP-2002"
FT   CDS             join(4779453..4779671,4780749..4780991,4784156..4784323)
FT                   /codon_start=1
FT                   /gene="Tcf23"
FT                   /locus_tag="mCG_63988"
FT                   /product="transcription factor 23"
FT                   /note="gene_id=mCG63988.2 transcript_id=mCT64171.2
FT                   protein_id=mCP27017.2"
FT                   /protein_id="EDL37319.1"
FT                   /translation="MSQEATEAPAMPGEGHGHNKAKARWLLGTDRKRSRINRTRQDLWE
FT                   DTSWSNHRLSRATSAPRGTRARGTAHGRSEASPENAARERTRVKTLRQAFLALQAALPA
FT                   VPPDTKLSKLDVLVLATSYIAHLTRTLGHELPGPAWPPFVRGLRYLHPLKKWPMRSRLY
FT                   AGGLGCSDLDSTTAITTGQRCKDAELGSQDSVAAESLLTSPAFGNK"
FT   gene            complement(4839283..4852256)
FT                   /locus_tag="mCG_23491"
FT                   /note="gene_id=mCG23491.2"
FT   mRNA            complement(join(4839283..4840204,4840354..4840469,
FT                   4840660..4840763,4840965..4841143,4841265..4841351,
FT                   4842273..4842340,4842635..4842747,4843085..4843173,
FT                   4843693..4843822,4843989..4844129,4844475..4844629,
FT                   4844875..4844942,4845469..4845520,4845910..4845975,
FT                   4846281..4846763,4847844..4847922,4851039..4851201,
FT                   4852082..4852256))
FT                   /locus_tag="mCG_23491"
FT                   /product="mCG23491, transcript variant mCT23400"
FT                   /note="gene_id=mCG23491.2 transcript_id=mCT23400.2 created
FT                   on 02-OCT-2002"
FT   mRNA            complement(join(4839287..4840204,4840354..4840469,
FT                   4840660..4840763,4840965..4841143,4841265..4841351,
FT                   4842273..4842340,4842635..4842747,4843085..4843173,
FT                   4843693..4843822,4843989..4844129,4844475..4844629,
FT                   4844875..4844942,4845469..4845520,4845910..4845975,
FT                   4846281..4846790,4847844..4847922,4850960..4851129,
FT                   4852082..>4852254))
FT                   /locus_tag="mCG_23491"
FT                   /product="mCG23491, transcript variant mCT193617"
FT                   /note="gene_id=mCG23491.2 transcript_id=mCT193617.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(4839287..4840204,4840354..4840469,
FT                   4840660..4840763,4840965..4841143,4841265..4841351,
FT                   4842273..4842340,4842635..4842747,4843085..4843173,
FT                   4843693..4843822,4843989..4844129,4844475..4844629,
FT                   4844875..4844942,4845469..4845520,4845910..4845975,
FT                   4846281..4846790,4847844..4847922,4850960..4851129,
FT                   4851502..>4851580))
FT                   /locus_tag="mCG_23491"
FT                   /product="mCG23491, transcript variant mCT193616"
FT                   /note="gene_id=mCG23491.2 transcript_id=mCT193616.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(4840058..4840204,4840354..4840469,
FT                   4840660..4840763,4840965..4841143,4841265..4841351,
FT                   4842273..4842340,4842635..4842747,4843085..4843173,
FT                   4843693..4843822,4843989..4844129,4844475..4844629,
FT                   4844875..4844942,4845469..4845520,4845910..4845975,
FT                   4846281..>4846763))
FT                   /codon_start=1
FT                   /locus_tag="mCG_23491"
FT                   /product="mCG23491, isoform CRA_a"
FT                   /note="gene_id=mCG23491.2 transcript_id=mCT193616.0
FT                   protein_id=mCP114588.0 isoform=CRA_a"
FT                   /protein_id="EDL37320.1"
FT                   /translation="KRNAVRLNEEPSRDSSEPRSTKSLQSISTVRMSVASTAAPFHTTS
FT                   GSSGAISTFSVVDYVVFGLLLVLSLVIGLYHACRGWGHHTVGELLMADRKMGCLPVALS
FT                   LLATFQSAVAILGAPAEIFRFGTQYWFLGCSYFLGLLIPAHIFIPVFYRLHLTSAYEYL
FT                   ELRFNKAVRICGTVTFIFQMVIYMGVALYAPSLALNAVTGFDLWLSVLALGIVCNIYTA
FT                   LGGLKAVIWTDVFQTLVMFLGQLVVIIVGAARVGGLGHVWNVTSQHGLISGINLDPDPF
FT                   VRHTFWTLAFGGVFMMLSLYGVNQAQVQRYLSSHSERAAVLSCYAVFPCQQVALCMSCL
FT                   IGLVMFAYYNMYSMSPELKQAAPDQLVLYFVMDLLKDMPGLPGLFVACLFSGSLSTISS
FT                   AFNSLATVTMEDLIQPWFPQLTETRAIMLSRGLAFAYGLVCLGMAYISSHLGSVLQAAL
FT                   SIFGMVGGPLLGLFCLGLFFPCANPLGAIVGLLTGLTMAFWIGIGSIVSRMSSAVAPPP
FT                   LNGSSSFLPANVTVAAVTTVMPSTLSKPTGLQHFYSLSYLWYSAHNSTTVIVVGLIVSL
FT                   LTGGMRGRSLNPGTIYPVLPKLLALLPLSCQKRLCWRSHSQDIPVIPNLFPEKMRNGVL
FT                   QDSTDKERMAEDGLVHQPCSPTYVVQETSL"
FT   CDS             complement(join(4840058..4840204,4840354..4840469,
FT                   4840660..4840763,4840965..4841143,4841265..4841351,
FT                   4842273..4842340,4842635..4842747,4843085..4843173,
FT                   4843693..4843822,4843989..4844129,4844475..4844629,
FT                   4844875..4844942,4845469..4845520,4845910..4845975,
FT                   4846281..>4846763))
FT                   /codon_start=1
FT                   /locus_tag="mCG_23491"
FT                   /product="mCG23491, isoform CRA_a"
FT                   /note="gene_id=mCG23491.2 transcript_id=mCT193617.0
FT                   protein_id=mCP114589.0 isoform=CRA_a"
FT                   /protein_id="EDL37321.1"
FT                   /translation="KRNAVRLNEEPSRDSSEPRSTKSLQSISTVRMSVASTAAPFHTTS
FT                   GSSGAISTFSVVDYVVFGLLLVLSLVIGLYHACRGWGHHTVGELLMADRKMGCLPVALS
FT                   LLATFQSAVAILGAPAEIFRFGTQYWFLGCSYFLGLLIPAHIFIPVFYRLHLTSAYEYL
FT                   ELRFNKAVRICGTVTFIFQMVIYMGVALYAPSLALNAVTGFDLWLSVLALGIVCNIYTA
FT                   LGGLKAVIWTDVFQTLVMFLGQLVVIIVGAARVGGLGHVWNVTSQHGLISGINLDPDPF
FT                   VRHTFWTLAFGGVFMMLSLYGVNQAQVQRYLSSHSERAAVLSCYAVFPCQQVALCMSCL
FT                   IGLVMFAYYNMYSMSPELKQAAPDQLVLYFVMDLLKDMPGLPGLFVACLFSGSLSTISS
FT                   AFNSLATVTMEDLIQPWFPQLTETRAIMLSRGLAFAYGLVCLGMAYISSHLGSVLQAAL
FT                   SIFGMVGGPLLGLFCLGLFFPCANPLGAIVGLLTGLTMAFWIGIGSIVSRMSSAVAPPP
FT                   LNGSSSFLPANVTVAAVTTVMPSTLSKPTGLQHFYSLSYLWYSAHNSTTVIVVGLIVSL
FT                   LTGGMRGRSLNPGTIYPVLPKLLALLPLSCQKRLCWRSHSQDIPVIPNLFPEKMRNGVL
FT                   QDSTDKERMAEDGLVHQPCSPTYVVQETSL"
FT   CDS             complement(join(4840058..4840204,4840354..4840469,
FT                   4840660..4840763,4840965..4841143,4841265..4841351,
FT                   4842273..4842340,4842635..4842747,4843085..4843173,
FT                   4843693..4843822,4843989..4844129,4844475..4844629,
FT                   4844875..4844942,4845469..4845520,4845910..4845975,
FT                   4846281..4846670))
FT                   /codon_start=1
FT                   /locus_tag="mCG_23491"
FT                   /product="mCG23491, isoform CRA_b"
FT                   /note="gene_id=mCG23491.2 transcript_id=mCT23400.2
FT                   protein_id=mCP3971.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q5U4D8"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR018212"
FT                   /db_xref="InterPro:IPR019900"
FT                   /db_xref="MGI:MGI:2660847"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5U4D8"
FT                   /protein_id="EDL37322.1"
FT                   /translation="MSVASTAAPFHTTSGSSGAISTFSVVDYVVFGLLLVLSLVIGLYH
FT                   ACRGWGHHTVGELLMADRKMGCLPVALSLLATFQSAVAILGAPAEIFRFGTQYWFLGCS
FT                   YFLGLLIPAHIFIPVFYRLHLTSAYEYLELRFNKAVRICGTVTFIFQMVIYMGVALYAP
FT                   SLALNAVTGFDLWLSVLALGIVCNIYTALGGLKAVIWTDVFQTLVMFLGQLVVIIVGAA
FT                   RVGGLGHVWNVTSQHGLISGINLDPDPFVRHTFWTLAFGGVFMMLSLYGVNQAQVQRYL
FT                   SSHSERAAVLSCYAVFPCQQVALCMSCLIGLVMFAYYNMYSMSPELKQAAPDQLVLYFV
FT                   MDLLKDMPGLPGLFVACLFSGSLSTISSAFNSLATVTMEDLIQPWFPQLTETRAIMLSR
FT                   GLAFAYGLVCLGMAYISSHLGSVLQAALSIFGMVGGPLLGLFCLGLFFPCANPLGAIVG
FT                   LLTGLTMAFWIGIGSIVSRMSSAVAPPPLNGSSSFLPANVTVAAVTTVMPSTLSKPTGL
FT                   QHFYSLSYLWYSAHNSTTVIVVGLIVSLLTGGMRGRSLNPGTIYPVLPKLLALLPLSCQ
FT                   KRLCWRSHSQDIPVIPNLFPEKMRNGVLQDSTDKERMAEDGLVHQPCSPTYVVQETSL"
FT   gene            4851550..4857944
FT                   /gene="0610007C21Rik"
FT                   /locus_tag="mCG_23484"
FT                   /note="gene_id=mCG23484.1"
FT   mRNA            join(4851550..4852086,4852790..4852908,4855525..4855596,
FT                   4856091..4856212,4857283..4857380,4857585..4857944)
FT                   /gene="0610007C21Rik"
FT                   /locus_tag="mCG_23484"
FT                   /product="RIKEN cDNA 0610007C21, transcript variant
FT                   mCT23339"
FT                   /note="gene_id=mCG23484.1 transcript_id=mCT23339.1 created
FT                   on 13-FEB-2003"
FT   mRNA            join(4851565..4852086,4852790..4852908,4855525..4855596,
FT                   4855790..4855861,4856091..4856212,4857283..4857380,
FT                   4857585..4857944)
FT                   /gene="0610007C21Rik"
FT                   /locus_tag="mCG_23484"
FT                   /product="RIKEN cDNA 0610007C21, transcript variant
FT                   mCT173714"
FT                   /note="gene_id=mCG23484.1 transcript_id=mCT173714.0 created
FT                   on 13-FEB-2003"
FT   mRNA            join(4851969..4852086,4852790..4852908,4855525..4855596,
FT                   4855790..4855861,4856091..4856212,4857283..4857380,
FT                   4857637..>4857666)
FT                   /gene="0610007C21Rik"
FT                   /locus_tag="mCG_23484"
FT                   /product="RIKEN cDNA 0610007C21, transcript variant
FT                   mCT180256"
FT                   /note="gene_id=mCG23484.1 transcript_id=mCT180256.0 created
FT                   on 13-FEB-2003"
FT   mRNA            join(4851985..4852086,4852790..4852811,4855525..4855596,
FT                   4855790..4855861,4856091..4856212,4857283..4857380,
FT                   4857585..4857827)
FT                   /gene="0610007C21Rik"
FT                   /locus_tag="mCG_23484"
FT                   /product="RIKEN cDNA 0610007C21, transcript variant
FT                   mCT180257"
FT                   /note="gene_id=mCG23484.1 transcript_id=mCT180257.0 created
FT                   on 13-FEB-2003"
FT   CDS             join(4852003..4852086,4852790..4852908,4855525..4855596,
FT                   4855790..4855861,4856091..4856212,4857283..4857380,
FT                   4857585..4857689)
FT                   /codon_start=1
FT                   /gene="0610007C21Rik"
FT                   /locus_tag="mCG_23484"
FT                   /product="RIKEN cDNA 0610007C21, isoform CRA_a"
FT                   /note="gene_id=mCG23484.1 transcript_id=mCT173714.0
FT                   protein_id=mCP96633.0 isoform=CRA_a"
FT                   /db_xref="GOA:A8C1S6"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR013032"
FT                   /db_xref="MGI:MGI:1918918"
FT                   /db_xref="UniProtKB/TrEMBL:A8C1S6"
FT                   /protein_id="EDL37323.1"
FT                   /translation="MASRESGGSRAAALLLVLGVERALALPEICTLCPGGMHNLSRVAA
FT                   YCEDTSKLMQARCCLNQKGTILGLDLQNCSLKDPGPNFLQAYTAIIIDLQANPLKDDLA
FT                   NTFRGFTQLQTLILPQDVPCPGGSNAWDNVTSFKDKQICQGQRDLCNSTGSPEMCPENG
FT                   SCASDGPGLLQCVCADGFHGYKCMRQGSFSLLMFFGILGSTTLAISILLWGTQRRKAKA
FT                   S"
FT   CDS             join(4852003..4852086,4852790..4852908,4855525..4855596,
FT                   4856091..4856212,4857283..4857380,4857585..4857689)
FT                   /codon_start=1
FT                   /gene="0610007C21Rik"
FT                   /locus_tag="mCG_23484"
FT                   /product="RIKEN cDNA 0610007C21, isoform CRA_d"
FT                   /note="gene_id=mCG23484.1 transcript_id=mCT23339.1
FT                   protein_id=mCP3898.2 isoform=CRA_d"
FT                   /protein_id="EDL37326.1"
FT                   /translation="MASRESGGSRAAALLLVLGVERALALPEICTLCPGGMHNLSRVAA
FT                   YCEDTSKLMQARCCLNQKGTILGLDLQNCSLKDPGPNFLQAYTAIIMILPQDVPCPGGS
FT                   NAWDNVTSFKDKQICQGQRDLCNSTGSPEMCPENGSCASDGPGLLQCVCADGFHGYKCM
FT                   RQGSFSLLMFFGILGSTTLAISILLWGTQRRKAKAS"
FT   CDS             join(4852003..4852086,4852790..4852908,4855525..4855596,
FT                   4855790..4855861,4856091..4856212,4857283..4857380,
FT                   4857637..>4857666)
FT                   /codon_start=1
FT                   /gene="0610007C21Rik"
FT                   /locus_tag="mCG_23484"
FT                   /product="RIKEN cDNA 0610007C21, isoform CRA_b"
FT                   /note="gene_id=mCG23484.1 transcript_id=mCT180256.0
FT                   protein_id=mCP103179.0 isoform=CRA_b"
FT                   /protein_id="EDL37324.1"
FT                   /translation="MASRESGGSRAAALLLVLGVERALALPEICTLCPGGMHNLSRVAA
FT                   YCEDTSKLMQARCCLNQKGTILGLDLQNCSLKDPGPNFLQAYTAIIIDLQANPLKDDLA
FT                   NTFRGFTQLQTLILPQDVPCPGGSNAWDNVTSFKDKQICQGQRDLCNSTGSPEMCPENG
FT                   SCASDGPGLLQCVCADGFHGYKCMRQPSPFYFGEPS"
FT   CDS             join(4852003..4852086,4852790..4852811,4855525..4855529)
FT                   /codon_start=1
FT                   /gene="0610007C21Rik"
FT                   /locus_tag="mCG_23484"
FT                   /product="RIKEN cDNA 0610007C21, isoform CRA_c"
FT                   /note="gene_id=mCG23484.1 transcript_id=mCT180257.0
FT                   protein_id=mCP103178.0 isoform=CRA_c"
FT                   /protein_id="EDL37325.1"
FT                   /translation="MASRESGGSRAAALLLVLGVERALALPEICTLCPGG"
FT   gene            4858040..4883226
FT                   /gene="Cad"
FT                   /locus_tag="mCG_23490"
FT                   /note="gene_id=mCG23490.2"
FT   mRNA            join(4858040..4858358,4858565..4858707,4861395..4861524,
FT                   4862003..4862145,4862307..4862448,4862759..4862930,
FT                   4863105..4863290,4863425..4863537,4863807..4863952,
FT                   4864154..4864285,4864443..4864676,4864783..4865004,
FT                   4865104..4865292,4865527..4865651,4865788..4865918,
FT                   4870129..4870241,4870422..4870666,4870841..4871087,
FT                   4871547..4871645,4871804..4872028,4872115..4872297,
FT                   4872456..4872674,4872960..4873127,4873736..4873918,
FT                   4874009..4874113,4876610..4876849,4877047..4877128,
FT                   4877302..4877468,4877563..4877727,4877887..4878018,
FT                   4878236..4878437,4878743..4878933,4879015..4879155,
FT                   4879339..4879464,4879834..4879930,4880554..4880598,
FT                   4880700..4880869,4880963..4881037,4881420..4881632,
FT                   4881840..4881965,4882098..4882253,4882342..4882443,
FT                   4882636..4882730,4882840..4883226)
FT                   /gene="Cad"
FT                   /locus_tag="mCG_23490"
FT                   /product="carbamoyl-phosphate synthetase 2, aspartate
FT                   transcarbamylase, and dihydroorotase, transcript variant
FT                   mCT173719"
FT                   /note="gene_id=mCG23490.2 transcript_id=mCT173719.0 created
FT                   on 25-SEP-2002"
FT   mRNA            join(4858040..4858358,4858565..4858704,4861395..4861524,
FT                   4862003..4862191,4862329..4862448,4862759..4862930,
FT                   4863105..4863290,4863425..4863537,4863807..4863952,
FT                   4864154..4864285,4864443..4864676,4864783..4865004,
FT                   4865104..4865292,4865527..4865651,4865788..4865918,
FT                   4870129..4870241,4870422..4870666,4870841..4871087,
FT                   4871547..4871645,4871804..4872028,4872115..4872297,
FT                   4872456..4872674,4872960..4873127,4873736..4873918,
FT                   4874009..4874179,4876672..4876864,4877256..4877468,
FT                   4877563..4877727,4877887..4878018,4878236..4878437,
FT                   4878743..4878940,4879040..4879253,4880931..4881115,
FT                   4881349..4881632,4881840..4881965,4882098..4882253,
FT                   4882342..4882443,4882636..4882730,4882840..4883226)
FT                   /gene="Cad"
FT                   /locus_tag="mCG_23490"
FT                   /product="carbamoyl-phosphate synthetase 2, aspartate
FT                   transcarbamylase, and dihydroorotase, transcript variant
FT                   mCT173717"
FT                   /note="gene_id=mCG23490.2 transcript_id=mCT173717.0 created
FT                   on 25-SEP-2002"
FT   mRNA            join(4858040..4858358,4858565..4858704,4861395..4861524,
FT                   4862003..4862177,4862279..4862448,4862759..4862930,
FT                   4863105..4863290,4863425..4863537,4863807..4863952,
FT                   4864154..4864285,4864443..4864676,4864783..4865004,
FT                   4865104..4865292,4865527..4865651,4865788..4865918,
FT                   4870129..4870241,4870422..4870666,4870841..4871087,
FT                   4871547..4871645,4871804..4872028,4872115..4872297,
FT                   4872456..4872674,4872960..4873127,4873736..4873918,
FT                   4874009..4874117,4876685..4876877,4877069..4877128,
FT                   4877302..4877468,4877563..4877727,4877887..4878018,
FT                   4878236..4878437,4878743..4878933,4879015..4879159,
FT                   4880458..4880598,4880700..4880869,4880963..4881037,
FT                   4881420..4881632,4881840..4881965,4882098..4882253,
FT                   4882348..4882443,4882636..4882730,4882840..4883226)
FT                   /gene="Cad"
FT                   /locus_tag="mCG_23490"
FT                   /product="carbamoyl-phosphate synthetase 2, aspartate
FT                   transcarbamylase, and dihydroorotase, transcript variant
FT                   mCT173718"
FT                   /note="gene_id=mCG23490.2 transcript_id=mCT173718.0 created
FT                   on 25-SEP-2002"
FT   mRNA            join(4858040..4858358,4858565..4858704,4861395..4861524,
FT                   4862003..4862145,4862307..4862448,4862759..4862930,
FT                   4863105..4863290,4863425..4863537,4863807..4863952,
FT                   4864154..4864285,4864443..4864676,4864783..4865004,
FT                   4865104..4865292,4865527..4865651,4865788..4865918,
FT                   4870129..4870241,4870422..4870666,4870841..4871087,
FT                   4871547..4871645,4871804..4872028,4872115..4872297,
FT                   4872456..4872674,4872960..4873127,4873736..4873918,
FT                   4874009..4874113,4876610..4876849,4877047..4877128,
FT                   4877302..4877468,4877563..4877727,4877887..4878018,
FT                   4878236..4878437,4878743..4878933,4879015..4879155,
FT                   4879339..4879440,4879834..4879930,4880554..4880598,
FT                   4880700..4880869,4880963..4881037,4881420..4881632,
FT                   4881840..4881965,4882098..4882253,4882342..4882443,
FT                   4882636..4882730,4882840..4883226)
FT                   /gene="Cad"
FT                   /locus_tag="mCG_23490"
FT                   /product="carbamoyl-phosphate synthetase 2, aspartate
FT                   transcarbamylase, and dihydroorotase, transcript variant
FT                   mCT23399"
FT                   /note="gene_id=mCG23490.2 transcript_id=mCT23399.2 created
FT                   on 25-SEP-2002"
FT   mRNA            join(4858040..4858358,4858565..4858704,4862003..4862145,
FT                   4862307..4862448,4862759..4862930,4863105..4863290,
FT                   4863686..4863952,4864154..4864285,4864443..4864676,
FT                   4864783..4865004,4865104..4865292,4865527..4865651,
FT                   4865788..4865918,4870129..4870241,4870422..4870666,
FT                   4870841..4871087,4871547..4871669,4871825..4872028,
FT                   4872115..4872297,4872456..4872674,4872960..4873127,
FT                   4873736..4873918,4874009..4874113,4876610..4876849,
FT                   4877047..4877128,4877302..4877468,4877563..4877727,
FT                   4877887..4878018,4878236..4878437,4878743..4878933,
FT                   4879015..4879155,4879834..4879930,4880673..4880869,
FT                   4880963..4881037,4881420..4881626,4881809..4881965,
FT                   4882098..4882253,4882342..4882443,4882636..4882730,
FT                   4882840..4883226)
FT                   /gene="Cad"
FT                   /locus_tag="mCG_23490"
FT                   /product="carbamoyl-phosphate synthetase 2, aspartate
FT                   transcarbamylase, and dihydroorotase, transcript variant
FT                   mCT173720"
FT                   /note="gene_id=mCG23490.2 transcript_id=mCT173720.0 created
FT                   on 25-SEP-2002"
FT   CDS             join(4858277..4858358,4858565..4858707,4861395..4861524,
FT                   4862003..4862145,4862307..4862448,4862759..4862930,
FT                   4863105..4863290,4863425..4863537,4863807..4863952,
FT                   4864154..4864285,4864443..4864676,4864783..4865004,
FT                   4865104..4865292,4865527..4865651,4865788..4865918,
FT                   4870129..4870241,4870422..4870666,4870841..4871087,
FT                   4871547..4871645,4871804..4872028,4872115..4872297,
FT                   4872456..4872674,4872960..4873127,4873736..4873918,
FT                   4874009..4874113,4876610..4876849,4877047..4877128,
FT                   4877302..4877468,4877563..4877727,4877887..4878018,
FT                   4878236..4878437,4878743..4878933,4879015..4879155,
FT                   4879339..4879464,4879834..4879930,4880554..4880598,
FT                   4880700..4880869,4880963..4881037,4881420..4881632,
FT                   4881840..4881965,4882098..4882253,4882342..4882443,
FT                   4882636..4882730,4882840..4882942)
FT                   /codon_start=1
FT                   /gene="Cad"
FT                   /locus_tag="mCG_23490"
FT                   /product="carbamoyl-phosphate synthetase 2, aspartate
FT                   transcarbamylase, and dihydroorotase, isoform CRA_d"
FT                   /note="gene_id=mCG23490.2 transcript_id=mCT173719.0
FT                   protein_id=mCP96639.0 isoform=CRA_d"
FT                   /protein_id="EDL37330.1"
FT                   /translation="MAALVLEDGSVLQGRPFGAAVSTAGEVVFQTGMVGYPEALTDPSY
FT                   KAQILVLTYPLIGNYGIPSDEEDEFGLSKVWFESSEIHVAGLVVGECCPTPSHWSANCT
FT                   LHEWLQQRGIPGLQGVDTRELTKKLREQGSLLGKLVQKGTEPSALPFVDPNARPLAPEV
FT                   SIKTPRVFNAGGAPRICALDCGLKYNQIRCLCQLGAEVTVVPWDHELDSQKYDGLFLSN
FT                   GPGDPASYPGVVSTLSRVLSEPNPRPVFGICLGHQLLALAIGAKTYKMRYGNRGHNQPC
FT                   LLVGTGRCFLTSQNHGFAVDADSLPAGWAPLFTNANDCSNEGIVHDSLPFFSVQFHPEH
FT                   RAGPSDMELLFDVFLETVREAAAGNIGGQTVRERLAQRLCPPELPIPGSGLPPPRKVLI
FT                   LGSGGLSIGQAGEFDYSGSQAIKALKEENIQTLLINPNIATVQTSQGLADKVYFLPITL
FT                   HYVTQVIRNERPDGVLLTFGGQTALNCGVELTKAGVLARYGVRVLGTPVETIELTEDRR
FT                   AFAARMAEIGEHVAPSEAANSLEQAQAAAERLGYPVLVRAAFALGGLGSGFASTKEELS
FT                   ALVAPAFAHTSQVLIDKSLKGWKEIEYEVVRDAYGNCVTVCNMENLDPLGIHTGESIVV
FT                   APSQTLNDREYQLLRRTAIKVTQHLGIVGECNVQYALNPESEQYYIIEVNARLSRSSAL
FT                   ASKATGYPLAYVAAKLALGIPLPELRNSVTGGTAAFEPSLDYCVVKIPRWDLSKFLRVS
FT                   TKIGSCMKSVGEVMGIGRSFEEAFQKALRMVDENCVGFDHTVKPVSDMELETPTDKRIF
FT                   VVAAALWAGYSVERLYELTRIDCWFLHRMKRIVTHAQLLEQHRGQALPQDLLHQAKCLG
FT                   FSDKQIALAVLSTELAVRKLRQELGICPAVKQIDTVAAEWPAQTNYLYLTYWGNTHDLD
FT                   FRAPHVLVLGSGVYRIGSSVEFDWCAVGCIQQLRKMGYKTIMVNYNPETVSTDYDMCDR
FT                   LYFDEISFEVVMDIYELENPEGVILSMGGQLPNNMAMALHRQQCRVLGTSPEAIDSAEN
FT                   RFKFSRLLDTIGISQPQWRELSDLESARQFCHTVGYPCVVRPSYVLSGAAMNVAYTDGD
FT                   LERFLSSAAAVSKEHPVVISKFIQEAKEIDVDAVACDGIVSAIAISEHVENAGVHSGDA
FT                   TLVTPPQDITPKTLERIKAIVHAVGQELQVTGPFNLQLIAKDDQLKVIECNVRVSRSFP
FT                   FVSKTLGVDLVALATRIIMGEKVEPVGLMTGSGVVGVKVPQFSFSRLAGADVVLGVEMT
FT                   STGEVAGFGESRCEAYLKAMLSTGFKIPEKNILLTIGSYKNKSELLPTVRLLESLGYSL
FT                   YASLGTADFYTEHGVKVTAVDWHFEEAVDGECPPQRSILDQLAENHFELVINLSMRGAG
FT                   GRRLSSFVTKGYRTRRLAADFSVPLIIDIKCTKLFVEALGQIGPAPPLKVHVDCMTSQK
FT                   LVRLPGLIDVHVHLREPGGTHKEDFASGTAAALAGGVTMVCAMPNTRPPIIDAPALALA
FT                   QKLAEAGARCDFTLFLGASSENAGTLGAVAGSAAGLKLYLNETFSELRLDSVAQWMEHF
FT                   ETWPAHLPIVAHAERQSVAAVLMVAQLTQRPVHICHVARKEEILLIKTAKAQGLPVTCE
FT                   VAPHHLFLNREDLERLGPGKGEVRPELGSREDMEALWENMAVIDCFASDHAPHTLEEKC
FT                   GPKPPPGFPGLETMLPLLLTAVSEGRLSLDDLLQRLHHNPRRIFHLPLQEDTYVEVDLE
FT                   HEWTVPSHMPFSKARWTPFEGQKVKGTVRRVVLRGEVAYIDGQVLVPPGYGQDVRKWPQ
FT                   GVVPQPPPSTPATTEITTVTTLPLGWTPERPRRVIPGLPDGRFHLPPRIHRASDPGLPA
FT                   EEPKEKPPRKVVEPELMGTPDGPCYPAPPVPRQASPQNLGSSGLLHPQMSPLLHSLVGQ
FT                   HILSVKQFTKDQMSHLFNVAHTLRMMVQKERSLDILKGKVMASMFYEVSTRTSSSFAAA
FT                   MARLGGAVLSFSEATSSVQKGESLADSVQTMSCYADVIVLRHPQPGAVELAAKHCRRPV
FT                   INAGDGVGEHPTQALLDIFTIREELGTVNGMTITMVGDLKHGRTVHSLACLLTQYRVSL
FT                   RYVAPPSLRMPPSVRDFVASRGTKQEEFESIEEALPDTDVLYMTRIQKERFGSVQEYEA
FT                   CFGQFILTPHIMTRAKKKMVVMHPMPRVNEISVEVDSDPRAAYFRQAENGMYIRMALLA
FT                   TVLGRF"
FT   CDS             join(4858277..4858358,4858565..4858704,4861395..4861524,
FT                   4862003..4862145,4862307..4862448,4862759..4862930,
FT                   4863105..4863290,4863425..4863537,4863807..4863952,
FT                   4864154..4864285,4864443..4864676,4864783..4865004,
FT                   4865104..4865292,4865527..4865651,4865788..4865918,
FT                   4870129..4870241,4870422..4870666,4870841..4871087,
FT                   4871547..4871645,4871804..4872028,4872115..4872297,
FT                   4872456..4872674,4872960..4873127,4873736..4873918,
FT                   4874009..4874113,4876610..4876849,4877047..4877128,
FT                   4877302..4877468,4877563..4877727,4877887..4878018,
FT                   4878236..4878437,4878743..4878933,4879015..4879155,
FT                   4879339..4879440,4879834..4879930,4880554..4880598,
FT                   4880700..4880869,4880963..4881037,4881420..4881632,
FT                   4881840..4881965,4882098..4882253,4882342..4882443,
FT                   4882636..4882730,4882840..4882942)
FT                   /codon_start=1
FT                   /gene="Cad"
FT                   /locus_tag="mCG_23490"
FT                   /product="carbamoyl-phosphate synthetase 2, aspartate
FT                   transcarbamylase, and dihydroorotase, isoform CRA_c"
FT                   /note="gene_id=mCG23490.2 transcript_id=mCT23399.2
FT                   protein_id=mCP4018.2 isoform=CRA_c"
FT                   /db_xref="GOA:B2RQC6"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="MGI:MGI:1916969"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2RQC6"
FT                   /protein_id="EDL37329.1"
FT                   /translation="MAALVLEDGSVLQGRPFGAAVSTAGEVVFQTGMVGYPEALTDPSY
FT                   KAQILVLTYPLIGNYGIPSDEEDEFGLSKWFESSEIHVAGLVVGECCPTPSHWSANCTL
FT                   HEWLQQRGIPGLQGVDTRELTKKLREQGSLLGKLVQKGTEPSALPFVDPNARPLAPEVS
FT                   IKTPRVFNAGGAPRICALDCGLKYNQIRCLCQLGAEVTVVPWDHELDSQKYDGLFLSNG
FT                   PGDPASYPGVVSTLSRVLSEPNPRPVFGICLGHQLLALAIGAKTYKMRYGNRGHNQPCL
FT                   LVGTGRCFLTSQNHGFAVDADSLPAGWAPLFTNANDCSNEGIVHDSLPFFSVQFHPEHR
FT                   AGPSDMELLFDVFLETVREAAAGNIGGQTVRERLAQRLCPPELPIPGSGLPPPRKVLIL
FT                   GSGGLSIGQAGEFDYSGSQAIKALKEENIQTLLINPNIATVQTSQGLADKVYFLPITLH
FT                   YVTQVIRNERPDGVLLTFGGQTALNCGVELTKAGVLARYGVRVLGTPVETIELTEDRRA
FT                   FAARMAEIGEHVAPSEAANSLEQAQAAAERLGYPVLVRAAFALGGLGSGFASTKEELSA
FT                   LVAPAFAHTSQVLIDKSLKGWKEIEYEVVRDAYGNCVTVCNMENLDPLGIHTGESIVVA
FT                   PSQTLNDREYQLLRRTAIKVTQHLGIVGECNVQYALNPESEQYYIIEVNARLSRSSALA
FT                   SKATGYPLAYVAAKLALGIPLPELRNSVTGGTAAFEPSLDYCVVKIPRWDLSKFLRVST
FT                   KIGSCMKSVGEVMGIGRSFEEAFQKALRMVDENCVGFDHTVKPVSDMELETPTDKRIFV
FT                   VAAALWAGYSVERLYELTRIDCWFLHRMKRIVTHAQLLEQHRGQALPQDLLHQAKCLGF
FT                   SDKQIALAVLSTELAVRKLRQELGICPAVKQIDTVAAEWPAQTNYLYLTYWGNTHDLDF
FT                   RAPHVLVLGSGVYRIGSSVEFDWCAVGCIQQLRKMGYKTIMVNYNPETVSTDYDMCDRL
FT                   YFDEISFEVVMDIYELENPEGVILSMGGQLPNNMAMALHRQQCRVLGTSPEAIDSAENR
FT                   FKFSRLLDTIGISQPQWRELSDLESARQFCHTVGYPCVVRPSYVLSGAAMNVAYTDGDL
FT                   ERFLSSAAAVSKEHPVVISKFIQEAKEIDVDAVACDGIVSAIAISEHVENAGVHSGDAT
FT                   LVTPPQDITPKTLERIKAIVHAVGQELQVTGPFNLQLIAKDDQLKVIECNVRVSRSFPF
FT                   VSKTLGVDLVALATRIIMGEKVEPVGLMTGSGVVGVKVPQFSFSRLAGADVVLGVEMTS
FT                   TGEVAGFGESRCEAYLKAMLSTGFKIPEKNILLTIGSYKNKSELLPTVRLLESLGYSLY
FT                   ASLGTADFYTEHGVKVTAVDWHFEEAVDGECPPQRSILDQLAENHFELVINLSMRGAGG
FT                   RRLSSFVTKGYRTRRLAADFSVPLIIDIKCTKLFVEALGQIGPAPPLKVHVDCMTSQKL
FT                   VRLPGLIDVHVHLREPGGTHKEDFASGTAAALAGGVTMVCAMPNTRPPIIDAPALALAQ
FT                   KLAEAGARCDFTLFLGASSENAGTLGAVAGSAAGLKLYLNETFSELRLDSVAQWMEHFE
FT                   TWPAHLPIVAHAERQSVAAVLMVAQLTQRPVHICHVARKEEILLIKTAKAQGLPVTCEV
FT                   APHHLFLNREDLERLGPGKGEVRPELGSREDMEALWENMAVIDCFASDHAPHTLEEKCG
FT                   PKPPPGFPGLETMLPLLLTAVSEGRLSLDDLLQRLHHNPRRIFHLPLQEDTYVEVDLEH
FT                   EWTVPSHMPFSKARWTPFEGQKVKGTVRRVVLRGEVAYIDGQVLVPPGYGQDVRKWPQG
FT                   VVPQPPPSTPATTEITTTPERPRRVIPGLPDGRFHLPPRIHRASDPGLPAEEPKEKPPR
FT                   KVVEPELMGTPDGPCYPAPPVPRQASPQNLGSSGLLHPQMSPLLHSLVGQHILSVKQFT
FT                   KDQMSHLFNVAHTLRMMVQKERSLDILKGKVMASMFYEVSTRTSSSFAAAMARLGGAVL
FT                   SFSEATSSVQKGESLADSVQTMSCYADVIVLRHPQPGAVELAAKHCRRPVINAGDGVGE
FT                   HPTQALLDIFTIREELGTVNGMTITMVGDLKHGRTVHSLACLLTQYRVSLRYVAPPSLR
FT                   MPPSVRDFVASRGTKQEEFESIEEALPDTDVLYMTRIQKERFGSVQEYEACFGQFILTP
FT                   HIMTRAKKKMVVMHPMPRVNEISVEVDSDPRAAYFRQAENGMYIRMALLATVLGRF"
FT   CDS             join(4858277..4858358,4858565..4858704,4861395..4861524,
FT                   4862003..4862191,4862329..4862448,4862759..4862930,
FT                   4863105..4863290,4863425..4863537,4863807..4863952,
FT                   4864154..4864285,4864443..4864676,4864783..4865004,
FT                   4865104..4865292,4865527..4865651,4865788..4865918,
FT                   4870129..4870241,4870422..4870666,4870841..4871087,
FT                   4871547..4871645,4871804..4872028,4872115..4872297,
FT                   4872456..4872674,4872960..4873127,4873736..4873918,
FT                   4874009..4874179,4876672..4876692)
FT                   /codon_start=1
FT                   /gene="Cad"
FT                   /locus_tag="mCG_23490"
FT                   /product="carbamoyl-phosphate synthetase 2, aspartate
FT                   transcarbamylase, and dihydroorotase, isoform CRA_a"
FT                   /note="gene_id=mCG23490.2 transcript_id=mCT173717.0
FT                   protein_id=mCP96636.0 isoform=CRA_a"
FT                   /protein_id="EDL37327.1"
FT                   /translation="MAALVLEDGSVLQGRPFGAAVSTAGEVVFQTGMVGYPEALTDPSY
FT                   KAQILVLTYPLIGNYGIPSDEEDEFGLSKWFESSEIHVAGLVVGECCPTPSHWSANCTL
FT                   HEWLQQRGIPGLQGVDTRELTKKLREQGSLLGKLVQKGTEPSALPFVDPNARPLAPEVS
FT                   IKVQRKRIGHVCRWKTSGGAPRICALDCGLKYNQIRCLCQLGAEVTVVPWDHELDSQKY
FT                   DGLFLSNGPGDPASYPGVVSTLSRVLSEPNPRPVFGICLGHQLLALAIGAKTYKMRYGN
FT                   RGHNQPCLLVGTGRCFLTSQNHGFAVDADSLPAGWAPLFTNANDCSNEGIVHDSLPFFS
FT                   VQFHPEHRAGPSDMELLFDVFLETVREAAAGNIGGQTVRERLAQRLCPPELPIPGSGLP
FT                   PPRKVLILGSGGLSIGQAGEFDYSGSQAIKALKEENIQTLLINPNIATVQTSQGLADKV
FT                   YFLPITLHYVTQVIRNERPDGVLLTFGGQTALNCGVELTKAGVLARYGVRVLGTPVETI
FT                   ELTEDRRAFAARMAEIGEHVAPSEAANSLEQAQAAAERLGYPVLVRAAFALGGLGSGFA
FT                   STKEELSALVAPAFAHTSQVLIDKSLKGWKEIEYEVVRDAYGNCVTVCNMENLDPLGIH
FT                   TGESIVVAPSQTLNDREYQLLRRTAIKVTQHLGIVGECNVQYALNPESEQYYIIEVNAR
FT                   LSRSSALASKATGYPLAYVAAKLALGIPLPELRNSVTGGTAAFEPSLDYCVVKIPRWDL
FT                   SKFLRVSTKIGSCMKSVGEVMGIGRSFEEAFQKALRMVDENCVGFDHTVKPVSDMELET
FT                   PTDKRIFVVAAALWAGYSVERLYELTRIDCWFLHRMKRIVTHAQLLEQHRGQALPQDLL
FT                   HQAKCLGFSDKQIALAVLSTELAVRKLRQELGICPAVKQIDTVAAEWPAQTNYLYLTYW
FT                   GNTHDLDFRAPHVLVLGSGVYRIGSSVEFDWCAVGCIQQLRKMGYKTIMVNYNPETVST
FT                   DYDMCDRLYFDEISFEVVMDIYELENPEGVILSMGGQLPNNMAMALHRQQCRVLGTSPE
FT                   AIDSAENRFKFSRLLDTIGISQPQWRELSDLESARQFCHTVGYPCVVRPSYVLSGAAMN
FT                   VAYTDGDLERFLSSAAAVSKEHPVVISKFIQEAKEIDVDAVACDGIVSAIAISEHVENA
FT                   GVHSGDATLVTPPQDITPKTLERIKAIVHAVGQELQVTGPFNLQLIAKDDQLKVIECNV
FT                   RVSRSFPFVSKTLGVDLVALATRIIMGEKVEPVGLMTGSGVVGVKVPQFSFSRLAGADV
FT                   VLGVEMTSTGEVAGFGESRCEAYLKAMLSTGFKIPEKNILLTIGSYKNKSELLPTVRLL
FT                   ESLGYSLYASLGTADFYTEHGVKVCGHLPLSPRPQRTLSFSLCPRHLGSAG"
FT   CDS             join(4858277..4858358,4858565..4858704,4861395..4861524,
FT                   4862003..4862177,4862279..4862448,4862759..4862930,
FT                   4863105..4863290,4863425..4863537,4863807..4863952,
FT                   4864154..4864285,4864443..4864676,4864783..4865004,
FT                   4865104..4865292,4865527..4865651,4865788..4865918,
FT                   4870129..4870241,4870422..4870666,4870841..4871087,
FT                   4871547..4871645,4871804..4872028,4872115..4872297,
FT                   4872456..4872674,4872960..4873127,4873736..4873918,
FT                   4874009..4874117,4876685..4876692)
FT                   /codon_start=1
FT                   /gene="Cad"
FT                   /locus_tag="mCG_23490"
FT                   /product="carbamoyl-phosphate synthetase 2, aspartate
FT                   transcarbamylase, and dihydroorotase, isoform CRA_b"
FT                   /note="gene_id=mCG23490.2 transcript_id=mCT173718.0
FT                   protein_id=mCP96637.0 isoform=CRA_b"
FT                   /protein_id="EDL37328.1"
FT                   /translation="MAALVLEDGSVLQGRPFGAAVSTAGEVVFQTGMVGYPEALTDPSY
FT                   KAQILVLTYPLIGNYGIPSDEEDEFGLSKWFESSEIHVAGLVVGECCPTPSHWSANCTL
FT                   HEWLQQRGIPGLQGVDTRELTKKLREQGSLLGKLVQKGTEPSALPFVDPNARPLAPEVS
FT                   IKVQRKRIGHVCSCQLSVLSPQTPRVFNAGGAPRICALDCGLKYNQIRCLCQLGAEVTV
FT                   VPWDHELDSQKYDGLFLSNGPGDPASYPGVVSTLSRVLSEPNPRPVFGICLGHQLLALA
FT                   IGAKTYKMRYGNRGHNQPCLLVGTGRCFLTSQNHGFAVDADSLPAGWAPLFTNANDCSN
FT                   EGIVHDSLPFFSVQFHPEHRAGPSDMELLFDVFLETVREAAAGNIGGQTVRERLAQRLC
FT                   PPELPIPGSGLPPPRKVLILGSGGLSIGQAGEFDYSGSQAIKALKEENIQTLLINPNIA
FT                   TVQTSQGLADKVYFLPITLHYVTQVIRNERPDGVLLTFGGQTALNCGVELTKAGVLARY
FT                   GVRVLGTPVETIELTEDRRAFAARMAEIGEHVAPSEAANSLEQAQAAAERLGYPVLVRA
FT                   AFALGGLGSGFASTKEELSALVAPAFAHTSQVLIDKSLKGWKEIEYEVVRDAYGNCVTV
FT                   CNMENLDPLGIHTGESIVVAPSQTLNDREYQLLRRTAIKVTQHLGIVGECNVQYALNPE
FT                   SEQYYIIEVNARLSRSSALASKATGYPLAYVAAKLALGIPLPELRNSVTGGTAAFEPSL
FT                   DYCVVKIPRWDLSKFLRVSTKIGSCMKSVGEVMGIGRSFEEAFQKALRMVDENCVGFDH
FT                   TVKPVSDMELETPTDKRIFVVAAALWAGYSVERLYELTRIDCWFLHRMKRIVTHAQLLE
FT                   QHRGQALPQDLLHQAKCLGFSDKQIALAVLSTELAVRKLRQELGICPAVKQIDTVAAEW
FT                   PAQTNYLYLTYWGNTHDLDFRAPHVLVLGSGVYRIGSSVEFDWCAVGCIQQLRKMGYKT
FT                   IMVNYNPETVSTDYDMCDRLYFDEISFEVVMDIYELENPEGVILSMGGQLPNNMAMALH
FT                   RQQCRVLGTSPEAIDSAENRFKFSRLLDTIGISQPQWRELSDLESARQFCHTVGYPCVV
FT                   RPSYVLSGAAMNVAYTDGDLERFLSSAAAVSKEHPVVISKFIQEAKEIDVDAVACDGIV
FT                   SAIAISEHVENAGVHSGDATLVTPPQDITPKTLERIKAIVHAVGQELQVTGPFNLQLIA
FT                   KDDQLKVIECNVRVSRSFPFVSKTLGVDLVALATRIIMGEKVEPVGLMTGSGVVGVKVP
FT                   QFSFSRLAGADVVLGVEMTSTGEVAGFGESRCEAYLKAMLSTGFKIPEKNILLTIGSYK
FT                   NKSELLPTVRLLESLGYSLYASLGTADFYTEHGVKVSG"
FT   CDS             join(4858277..4858358,4858565..4858704,4862003..4862023)
FT                   /codon_start=1
FT                   /gene="Cad"
FT                   /locus_tag="mCG_23490"
FT                   /product="carbamoyl-phosphate synthetase 2, aspartate
FT                   transcarbamylase, and dihydroorotase, isoform CRA_e"
FT                   /note="gene_id=mCG23490.2 transcript_id=mCT173720.0
FT                   protein_id=mCP96638.0 isoform=CRA_e"
FT                   /protein_id="EDL37331.1"
FT                   /translation="MAALVLEDGSVLQGRPFGAAVSTAGEVVFQTGMVGYPEALTDPSY
FT                   KAQILVLTYPLIGNYGIPSDEEDEFGLSKEWTLGS"
FT   gene            complement(4895858..>4904207)
FT                   /gene="Slc30a3"
FT                   /locus_tag="mCG_23488"
FT                   /note="gene_id=mCG23488.1"
FT   mRNA            complement(join(4895858..4896670,4897699..4897841,
FT                   4898055..4898160,4898358..4898556,4899067..4899220,
FT                   4899302..4899448,4899804..4899985,4903011..4903246))
FT                   /gene="Slc30a3"
FT                   /locus_tag="mCG_23488"
FT                   /product="solute carrier family 30 (zinc transporter),
FT                   member 3, transcript variant mCT23397"
FT                   /note="gene_id=mCG23488.1 transcript_id=mCT23397.1 created
FT                   on 16-SEP-2002"
FT   mRNA            complement(join(4895858..4896670,4897707..4897841,
FT                   4898055..4898160,4898358..4898556,4899067..4899220,
FT                   4899302..4899448,4899804..4899985,4903011..>4903233))
FT                   /gene="Slc30a3"
FT                   /locus_tag="mCG_23488"
FT                   /product="solute carrier family 30 (zinc transporter),
FT                   member 3, transcript variant mCT193589"
FT                   /note="gene_id=mCG23488.1 transcript_id=mCT193589.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(4896522..4896670,4897707..4897841,
FT                   4898055..4898160,4898358..4898556,4899067..4899220,
FT                   4899302..4899448,4899804..4899985,4903011..>4903231))
FT                   /codon_start=1
FT                   /gene="Slc30a3"
FT                   /locus_tag="mCG_23488"
FT                   /product="solute carrier family 30 (zinc transporter),
FT                   member 3, isoform CRA_b"
FT                   /note="gene_id=mCG23488.1 transcript_id=mCT193589.0
FT                   protein_id=mCP114587.0 isoform=CRA_b"
FT                   /protein_id="EDL37333.1"
FT                   /translation="RSSLHTGGPAGSPSGPWTARIWRKACPASPPLCGLDGLGSGDMEP
FT                   SLATGGSETTRLVSARDRSSAGGGLRLKSLFTEPSEPLPEEPKLEGMAFHHCHKDPVPQ
FT                   SGLSPERVQARRQLYAACAVCFIFMAGEVVGGYLAHSLAIMTDAAHLLADIGSMLASLF
FT                   SLWLSTRPATRTMTFGWHRSETLGALASVVSLWIVTGILLYLAFLRLLHSDYHIEAGAM
FT                   LLTASIAVCANLLMAFVLHQTGAPHSHGSTGAEYAPLEEGHGYPMSLGNTSVRAAFVHV
FT                   LGDLLQSFGVLAASILIYFKPQYKVADPISTFLFSICALGSTAPTLRDVLLVLMEGAPR
FT                   SVEFEPVRDTLLSVPGVRATHDLHLWALTLTYHVASAHLAIDSTADPEAVLAEASSRLY
FT                   SRFGFSSCTLQVEQYQPEMAQCLRCQEPSQA"
FT   CDS             complement(join(4897699..4897841,4898055..4898160,
FT                   4898358..4898556,4899067..4899220,4899302..4899448,
FT                   4899804..4899985,4903011..4903105))
FT                   /codon_start=1
FT                   /gene="Slc30a3"
FT                   /locus_tag="mCG_23488"
FT                   /product="solute carrier family 30 (zinc transporter),
FT                   member 3, isoform CRA_c"
FT                   /note="gene_id=mCG23488.1 transcript_id=mCT23397.1
FT                   protein_id=mCP3967.1 isoform=CRA_c"
FT                   /protein_id="EDL37334.1"
FT                   /translation="MEPSLATGGSETTRLVSARDRSSAGGGLRLKSLFTEPSEPLPEEP
FT                   KLEGMAFHHCHKDPVPQSGLSPERVQARRQLYAACAVCFIFMAGEVVGGYLAHSLAIMT
FT                   DAAHLLADIGSMLASLFSLWLSTRPATRTMTFGWHRSETLGALASVVSLWIVTGILLYL
FT                   AFLRLLHSDYHIEAGAMLLTASIAVCANLLMAFVLHQTGAPHSHGSTGAEYAPLEEGHG
FT                   YPMSLGNTSVRAAFVHVLGDLLQSFGVLAASILIYFKPQYKVADPISTFLFSICALGST
FT                   APTLRDVLLVLMEGAPRSVEFEPVRDTLLSVPGVRATHDLHLWALTLTYHVASAHLAIG
FT                   E"
FT   mRNA            complement(join(<4899070..4899220,4899302..4899448,
FT                   4899804..4899985,4904127..>4904207))
FT                   /gene="Slc30a3"
FT                   /locus_tag="mCG_23488"
FT                   /product="solute carrier family 30 (zinc transporter),
FT                   member 3, transcript variant mCT173422"
FT                   /note="gene_id=mCG23488.1 transcript_id=mCT173422.0 created
FT                   on 16-SEP-2002"
FT   CDS             complement(join(<4899070..4899220,4899302..4899448,
FT                   4899804..4899985,4904127..>4904206))
FT                   /codon_start=1
FT                   /gene="Slc30a3"
FT                   /locus_tag="mCG_23488"
FT                   /product="solute carrier family 30 (zinc transporter),
FT                   member 3, isoform CRA_a"
FT                   /note="gene_id=mCG23488.1 transcript_id=mCT173422.0
FT                   protein_id=mCP96341.0 isoform=CRA_a"
FT                   /protein_id="EDL37332.1"
FT                   /translation="GHRRLVSESFLWAVVFPQTSTALQLSSLFTEPSEPLPEEPKLEGM
FT                   AFHHCHKDPVPQSGLSPERVQARRQLYAACAVCFIFMAGEVVGGYLAHSLAIMTDAAHL
FT                   LADIGSMLASLFSLWLSTRPATRTMTFGWHRSETLGALASVVSLWIVTGILLYLAFLRL
FT                   LHSDYHIEAGAMLLTASIAVCANL"
FT   gene            4904692..4907002
FT                   /locus_tag="mCG_148307"
FT                   /note="gene_id=mCG148307.0"
FT   mRNA            4904692..4907002
FT                   /locus_tag="mCG_148307"
FT                   /product="mCG148307"
FT                   /note="gene_id=mCG148307.0 transcript_id=mCT188570.0
FT                   created on 13-JAN-2004"
FT   CDS             4904716..4905021
FT                   /codon_start=1
FT                   /locus_tag="mCG_148307"
FT                   /product="mCG148307"
FT                   /note="gene_id=mCG148307.0 transcript_id=mCT188570.0
FT                   protein_id=mCP109219.0"
FT                   /db_xref="GOA:Q8C950"
FT                   /db_xref="MGI:MGI:3642216"
FT                   /db_xref="UniProtKB/TrEMBL:Q8C950"
FT                   /protein_id="EDL37335.1"
FT                   /translation="MVLSGEAEQKIQPARPRRRPTPTRAWGHCLPSLCDGVWTNGGALF
FT                   LTSPVVLRASACVSGGQTEESHQARSPCWPTSEPRWKLCPCPAKPASLSCRPPSVF"
FT   gene            4918513..4922716
FT                   /gene="Dnajc5g"
FT                   /locus_tag="mCG_23483"
FT                   /note="gene_id=mCG23483.3"
FT   mRNA            join(4918513..4918613,4919079..4919194,4919687..4919900,
FT                   4920370..4920511,4921305..4921371,4921796..4922716)
FT                   /gene="Dnajc5g"
FT                   /locus_tag="mCG_23483"
FT                   /product="DnaJ (Hsp40) homolog, subfamily C, member 5
FT                   gamma"
FT                   /note="gene_id=mCG23483.3 transcript_id=mCT23338.3 created
FT                   on 13-JUN-2003"
FT   CDS             join(4919082..4919194,4919687..4919900,4920370..4920511,
FT                   4921305..4921333)
FT                   /codon_start=1
FT                   /gene="Dnajc5g"
FT                   /locus_tag="mCG_23483"
FT                   /product="DnaJ (Hsp40) homolog, subfamily C, member 5
FT                   gamma"
FT                   /note="gene_id=mCG23483.3 transcript_id=mCT23338.3
FT                   protein_id=mCP4006.2"
FT                   /db_xref="GOA:Q8C632"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="MGI:MGI:3045263"
FT                   /db_xref="UniProtKB/TrEMBL:Q8C632"
FT                   /protein_id="EDL37336.1"
FT                   /translation="MPLTYDATQRLSRTGKSLYAVLELKKGAETADIKKAYRKLALQYH
FT                   PDKNPDNPLAAEIFKEINTAHAILTDPTKKKIYDRHGSLGLYLYDHFGEEGVRFYFIVN
FT                   SCWFKTLVILCCLLTGCCCCCCCCLCCGRLNPSAEEEEENRQMNVSSQPSRSRTQDIEA
FT                   ED"
FT   gene            4926926..4947833
FT                   /gene="Trim54"
FT                   /locus_tag="mCG_23487"
FT                   /note="gene_id=mCG23487.1"
FT   mRNA            join(4926926..4927291,4941250..4941422,4942196..4942367,
FT                   4944258..4944353,4946251..4946484,4946961..4946983,
FT                   4947096..4947220,4947329..4947421,4947685..4947833)
FT                   /gene="Trim54"
FT                   /locus_tag="mCG_23487"
FT                   /product="tripartite motif-containing 54"
FT                   /note="gene_id=mCG23487.1 transcript_id=mCT23342.1 created
FT                   on 16-SEP-2002"
FT   CDS             join(4927172..4927291,4941250..4941422,4942196..4942367,
FT                   4944258..4944353,4946251..4946484,4946961..4946983,
FT                   4947096..4947220,4947329..4947421,4947685..4947701)
FT                   /codon_start=1
FT                   /gene="Trim54"
FT                   /locus_tag="mCG_23487"
FT                   /product="tripartite motif-containing 54"
FT                   /note="gene_id=mCG23487.1 transcript_id=mCT23342.1
FT                   protein_id=mCP3955.1"
FT                   /protein_id="EDL37337.1"
FT                   /translation="MDNLEKQLICPICLEMFSKPVVILPCQHNLCRKCANDVFQASNPL
FT                   WQSRGSTTVSSGGRFRCPSCRHEVVLDRHGVYGLQRNLLVENIIDIYKQESSRPLHAKA
FT                   EQHLMCEEHEDEKINIYCLSCEVPTCSLCKVFGAHKDCEVAPLPTIYKRQKSELSDGIA
FT                   MLVAGNDRVQAVITQMEEVCQTIEDNSRRQKQLLNQRFETLCAVLEERKGELLQALARE
FT                   QEEKLQRVRGLIRQYGDHLEGSSKLVESAIQSMEEPQMALYLQQAKELINKVGAMSKVE
FT                   LAGRPEPGYESMEQFSVSVEHVAEMLRTIDFQPGAAGDEEDDDMALDGEEGNAGLEEER
FT                   LDVPEGSGLH"
FT   gene            complement(4945965..>4947552)
FT                   /locus_tag="mCG_146109"
FT                   /note="gene_id=mCG146109.0"
FT   mRNA            complement(join(4945965..4946510,4946935..4947254,
FT                   4947462..>4947552))
FT                   /locus_tag="mCG_146109"
FT                   /product="mCG146109"
FT                   /note="gene_id=mCG146109.0 transcript_id=mCT186212.0
FT                   created on 14-JUL-2003"
FT   CDS             complement(join(4946422..4946510,4946935..4947254,
FT                   4947462..>4947466))
FT                   /codon_start=1
FT                   /locus_tag="mCG_146109"
FT                   /product="mCG146109"
FT                   /note="gene_id=mCG146109.0 transcript_id=mCT186212.0
FT                   protein_id=mCP107474.0"
FT                   /protein_id="EDL37338.1"
FT                   /translation="VCRSKQSLSRLPHPAGSRWFATFRPRAPRSQRIAPCSHSLAPAVL
FT                   PAPPSTLPRPCDGHKGSAEGPRSLKPLPGQKERIHRVPSFPTAQSTHLLISSFACCRGE
FT                   KEGQGPPPSLSANLEVESHLRLLHGLDGGLHQL"
FT   gene            complement(4948197..4949103)
FT                   /gene="Ucn"
FT                   /locus_tag="mCG_23486"
FT                   /note="gene_id=mCG23486.0"
FT   mRNA            complement(join(4948197..4948741,4949005..4949103))
FT                   /gene="Ucn"
FT                   /locus_tag="mCG_23486"
FT                   /product="urocortin"
FT                   /note="gene_id=mCG23486.0 transcript_id=mCT23341.0 created
FT                   on 16-SEP-2002"
FT   CDS             complement(4948360..4948728)
FT                   /codon_start=1
FT                   /gene="Ucn"
FT                   /locus_tag="mCG_23486"
FT                   /product="urocortin"
FT                   /note="gene_id=mCG23486.0 transcript_id=mCT23341.0
FT                   protein_id=mCP3936.1"
FT                   /db_xref="GOA:Q14A76"
FT                   /db_xref="InterPro:IPR000187"
FT                   /db_xref="InterPro:IPR003620"
FT                   /db_xref="InterPro:IPR018446"
FT                   /db_xref="MGI:MGI:1276123"
FT                   /db_xref="UniProtKB/TrEMBL:Q14A76"
FT                   /protein_id="EDL37339.1"
FT                   /translation="MIQRGRATLLVALLLLAQLRPESSQWSPAAAAATGVQDPNLRWSP
FT                   GVRNQGGGVRALLLLLAERFPRRAGSEPAGERQRRDDPPLSIDLTFHLLRTLLELARTQ
FT                   SQRERAEQNRIIFDSVGK"
FT   gene            complement(4951181..4964536)
FT                   /gene="Mpv17"
FT                   /locus_tag="mCG_126791"
FT                   /note="gene_id=mCG126791.0"
FT   mRNA            complement(join(4951181..4952060,4954910..4954962,
FT                   4955456..4955488,4955705..4955800,4955894..4955986,
FT                   4956183..4956298,4963970..4964044,4964493..4964536))
FT                   /gene="Mpv17"
FT                   /locus_tag="mCG_126791"
FT                   /product="Mpv17 transgene, kidney disease mutant,
FT                   transcript variant mCT128068"
FT                   /note="gene_id=mCG126791.0 transcript_id=mCT128068.0
FT                   created on 18-FEB-2003"
FT   mRNA            complement(join(4951668..4952060,4954910..4954962,
FT                   4955450..4955488,4955705..4955800,4955894..4955986,
FT                   4956183..4956298,4963970..4964044))
FT                   /gene="Mpv17"
FT                   /locus_tag="mCG_126791"
FT                   /product="Mpv17 transgene, kidney disease mutant,
FT                   transcript variant mCT180115"
FT                   /note="gene_id=mCG126791.0 transcript_id=mCT180115.0
FT                   created on 18-FEB-2003"
FT   mRNA            complement(join(4951868..4952060,4954910..4954962,
FT                   4955705..4955800,4955894..4955986,4956183..4956298,
FT                   4963970..4964044,4964493..>4964522))
FT                   /gene="Mpv17"
FT                   /locus_tag="mCG_126791"
FT                   /product="Mpv17 transgene, kidney disease mutant,
FT                   transcript variant mCT193578"
FT                   /note="gene_id=mCG126791.0 transcript_id=mCT193578.0
FT                   created on 09-MAR-2004"
FT   CDS             complement(join(4951991..4952060,4954910..4954962,
FT                   4955705..4955800,4955894..4955986,4956183..4956298,
FT                   4963970..4964044,4964493..>4964520))
FT                   /codon_start=1
FT                   /gene="Mpv17"
FT                   /locus_tag="mCG_126791"
FT                   /product="Mpv17 transgene, kidney disease mutant, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG126791.0 transcript_id=mCT193578.0
FT                   protein_id=mCP114519.0 isoform=CRA_c"
FT                   /protein_id="EDL37342.1"
FT                   /translation="EGSAQSWHSGSMALWRAYQRALAAHPWKVQVLTAGSLMGVGDMIS
FT                   QQLVERRGLQQHQAGRTLTMVSLGCGFVGPVVGGWYKVLDHLIPGTTKVHALKKMLLDQ
FT                   GGFAPCFLGCFLPLVGILNGMSAQDNWAKLKRLWPAVQLANFYLVPLHYRLAVVQCVAI
FT                   VWNSYLSWKAHQF"
FT   CDS             complement(join(4951991..4952060,4954910..4954962,
FT                   4955456..4955488,4955705..4955800,4955894..4955986,
FT                   4956183..4956298,4963970..4964039))
FT                   /codon_start=1
FT                   /gene="Mpv17"
FT                   /locus_tag="mCG_126791"
FT                   /product="Mpv17 transgene, kidney disease mutant, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG126791.0 transcript_id=mCT128068.0
FT                   protein_id=mCP64603.1 isoform=CRA_a"
FT                   /protein_id="EDL37340.1"
FT                   /translation="MALWRAYQRALAAHPWKVQVLTAGSLMGVGDMISQQLVERRGLQQ
FT                   HQAGRTLTMVSLGCGFVGPVVGGWYKVLDHLIPGTTKVHALKKMLLDQGGFAPCFLGCF
FT                   LPLVGILNGMSAQDNWAKLKRDYPDALITNYYLWPAVQLANFYLVPLHYRLAVVQCVAI
FT                   VWNSYLSWKAHQF"
FT   CDS             complement(join(4951991..4952060,4954910..4954962,
FT                   4955450..4955488,4955705..4955800,4955894..4955986,
FT                   4956183..4956298,4963970..4964039))
FT                   /codon_start=1
FT                   /gene="Mpv17"
FT                   /locus_tag="mCG_126791"
FT                   /product="Mpv17 transgene, kidney disease mutant, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG126791.0 transcript_id=mCT180115.0
FT                   protein_id=mCP103037.0 isoform=CRA_b"
FT                   /db_xref="GOA:G3UVW1"
FT                   /db_xref="InterPro:IPR007248"
FT                   /db_xref="MGI:MGI:97138"
FT                   /db_xref="UniProtKB/TrEMBL:G3UVW1"
FT                   /protein_id="EDL37341.1"
FT                   /translation="MALWRAYQRALAAHPWKVQVLTAGSLMGVGDMISQQLVERRGLQQ
FT                   HQAGRTLTMVSLGCGFVGPVVGGWYKVLDHLIPGTTKVHALKKMLLDQGGFAPCFLGCF
FT                   LPLVGILNGMSAQDNWAKLKRDYPDALITNYYVRLWPAVQLANFYLVPLHYRLAVVQCV
FT                   AIVWNSYLSWKAHQF"
FT   gene            complement(4966306..4990449)
FT                   /gene="Gtf3c2"
FT                   /locus_tag="mCG_126812"
FT                   /note="gene_id=mCG126812.0"
FT   mRNA            complement(join(4966306..4968069,4968445..4968552,
FT                   4968645..4968797,4969363..4969491,4969736..4969823,
FT                   4970046..4970207,4970294..4970438,4976232..4976361,
FT                   4976707..4976732,4978042..4978150,4978335..4978446,
FT                   4978597..4978824,4979397..4979495,4980183..4980260,
FT                   4980527..4980621,4983130..4983409,4984116..4984437,
FT                   4984580..4984843,4990216..4990449))
FT                   /gene="Gtf3c2"
FT                   /locus_tag="mCG_126812"
FT                   /product="general transcription factor IIIC, polypeptide 2,
FT                   beta, transcript variant mCT128087"
FT                   /note="gene_id=mCG126812.0 transcript_id=mCT128087.1
FT                   created on 25-SEP-2002"
FT   CDS             complement(join(4967851..4968069,4968445..4968552,
FT                   4968645..4968797,4969363..4969491,4969736..4969823,
FT                   4970046..4970207,4970294..4970438,4976232..4976361,
FT                   4976707..4976732,4978042..4978150,4978335..4978446,
FT                   4978597..4978824,4979397..4979495,4980183..4980260,
FT                   4980527..4980621,4983130..4983409,4984116..4984437,
FT                   4984580..4984820))
FT                   /codon_start=1
FT                   /gene="Gtf3c2"
FT                   /locus_tag="mCG_126812"
FT                   /product="general transcription factor IIIC, polypeptide 2,
FT                   beta, isoform CRA_a"
FT                   /note="gene_id=mCG126812.0 transcript_id=mCT128087.1
FT                   protein_id=mCP64754.1 isoform=CRA_a"
FT                   /protein_id="EDL37343.1"
FT                   /translation="MDTCGVGYVALGEADPVGSMIVVDSPGQEELSQLDVKASETSGVE
FT                   ASIEMSLPPPLPGFEDSSDRRLPPDQESLTRLEQQDLSSEMSKVSNTRASKPSGRRGGR
FT                   TARGAKRPQQRKPPSTPLVPGLLDQSNPLSTPMPKKRSQKSKGDLLLLKLSKGLDQPES
FT                   PHPKRPPEDFETPSGERPRRRAAQVALLYLQELAEELSTALPAPPLSGPKSPKVSSPTK
FT                   PKKTRQASSQGEEDGSARDEDFVLQVEGEDEEESEAPSENSSDPEPVAPRSTPRGPAAG
FT                   KQKPHCRGMAPNGLPNYIMAPVWKCLHLTKDLREQHHSFWEFAEWIPVAWKWQLLSELE
FT                   AAPYLPQEEKSPLFSVQREGIPEDGTIYRINRFSSITAHPERWDVSFFTGGPLWALDWC
FT                   PVPEGSAASQYVALFSSPDMNETHPLSQLHSGPGLLQLWGLGTLQQESCPGNRAHFVYG
FT                   IACDSGCIWDLKFCPSGAWEHPETLRKAPLLPRLGLLALACSDGKVLLFSLPHPEALLA
FT                   QQPPDAMKPAIYKVQCLATLQVGSVQASDPSECGQCLSLAWMPTRPHHHLAAGYYNGMV
FT                   VFWNLPTNSPLQRIRLSDGSLKLYPFQCFLAHDQAVRTIQWCKANSHFLVSAGSDRKIK
FT                   FWDLRRPYEPINCIKRFLSTELSWLLPYNGVTVAQDNCYASYGLCGIHYIDAGYLGFKA
FT                   YFTAPRKGTVWSLSGSDWLGTVAAGDISGELIAAILPDMASNPINVKKPAERRFPIYKA
FT                   DLIPYQDSPEDQDYSSTSSETPNPPKARTYTETINHHYLLFQDTDLSSFHNLLRREPML
FT                   RMQEGEGHSQLCLDRLQLEAIHKVRFSPNLDSYGWLVSGGQSGLVRIHFVRGLTSPLAH
FT                   RVQLESRANFNAMFQPSFPTEGPGFSPSSHCLLPNP"
FT   mRNA            complement(join(4970003..4970207,4970294..4970438,
FT                   4976232..4976361,4976707..4976732,4978042..4978150,
FT                   4978335..4978446,4978597..4978824,4979397..4979495,
FT                   4980183..4980260,4980527..4980621,4983130..4983409,
FT                   4984116..4984437,4984580..4984843,4990216..>4990243))
FT                   /gene="Gtf3c2"
FT                   /locus_tag="mCG_126812"
FT                   /product="general transcription factor IIIC, polypeptide 2,
FT                   beta, transcript variant mCT193531"
FT                   /note="gene_id=mCG126812.0 transcript_id=mCT193531.0
FT                   created on 09-MAR-2004"
FT   CDS             complement(join(4970024..4970207,4970294..4970438,
FT                   4976232..4976361,4976707..4976732,4978042..4978150,
FT                   4978335..4978446,4978597..4978824,4979397..4979495,
FT                   4980183..4980260,4980527..4980621,4983130..4983409,
FT                   4984116..4984437,4984580..4984843,4990216..>4990243))
FT                   /codon_start=1
FT                   /gene="Gtf3c2"
FT                   /locus_tag="mCG_126812"
FT                   /product="general transcription factor IIIC, polypeptide 2,
FT                   beta, isoform CRA_b"
FT                   /note="gene_id=mCG126812.0 transcript_id=mCT193531.0
FT                   protein_id=mCP114520.0 isoform=CRA_b"
FT                   /protein_id="EDL37344.1"
FT                   /translation="LDFRKDFGAGQPFWGVLMDTCGVGYVALGEADPVGSMIVVDSPGQ
FT                   EELSQLDVKASETSGVEASIEMSLPPPLPGFEDSSDRRLPPDQESLTRLEQQDLSSEMS
FT                   KVSNTRASKPSGRRGGRTARGAKRPQQRKPPSTPLVPGLLDQSNPLSTPMPKKRSQKSK
FT                   GDLLLLKLSKGLDQPESPHPKRPPEDFETPSGERPRRRAAQVALLYLQELAEELSTALP
FT                   APPLSGPKSPKVSSPTKPKKTRQASSQGEEDGSARDEDFVLQVEGEDEEESEAPSENSS
FT                   DPEPVAPRSTPRGPAAGKQKPHCRGMAPNGLPNYIMAPVWKCLHLTKDLREQHHSFWEF
FT                   AEWIPVAWKWQLLSELEAAPYLPQEEKSPLFSVQREGIPEDGTIYRINRFSSITAHPER
FT                   WDVSFFTGGPLWALDWCPVPEGSAASQYVALFSSPDMNETHPLSQLHSGPGLLQLWGLG
FT                   TLQQESCPGNRAHFVYGIACDSGCIWDLKFCPSGAWEHPETLRKAPLLPRLGLLALACS
FT                   DGKVLLFSLPHPEALLAQQPPDAMKPAIYKVQCLATLQVGSVQASDPSECGQCLSLAWM
FT                   PTRPHHHLAAGYYNGMVVFWNLPTNSPLQRIRLSDGSLKLYPFQCFLAHDQAVRTIQWC
FT                   KANSHFLVSAGSDRKIKFWDLRRPYEPINCIKRFLSTELSWLLPYNGVTVAQDNCYASY
FT                   DKMKI"
FT   gene            complement(4997909..5003803)
FT                   /gene="Eif2b4"
FT                   /locus_tag="mCG_141150"
FT                   /note="gene_id=mCG141150.0"
FT   mRNA            complement(join(4997909..4998149,4998263..4998443,
FT                   4999919..5000096,5000231..5000358,5000709..5000811,
FT                   5000932..5001008,5001187..5001301,5001499..5001590,
FT                   5001715..5001797,5001891..5002097,5002503..5002638,
FT                   5002932..5002975,5003343..5003803))
FT                   /gene="Eif2b4"
FT                   /locus_tag="mCG_141150"
FT                   /product="eukaryotic translation initiation factor 2B,
FT                   subunit 4 delta"
FT                   /note="gene_id=mCG141150.0 transcript_id=mCT173398.0
FT                   created on 17-SEP-2002"
FT   CDS             complement(join(4997950..4998149,4998263..4998443,
FT                   4999919..5000096,5000231..5000358,5000709..5000811,
FT                   5000932..5001008,5001187..5001301,5001499..5001590,
FT                   5001715..5001797,5001891..5002097,5002503..5002638,
FT                   5002932..5002975,5003343..5003373))
FT                   /codon_start=1
FT                   /gene="Eif2b4"
FT                   /locus_tag="mCG_141150"
FT                   /product="eukaryotic translation initiation factor 2B,
FT                   subunit 4 delta"
FT                   /note="gene_id=mCG141150.0 transcript_id=mCT173398.0
FT                   protein_id=mCP96317.0"
FT                   /db_xref="GOA:Q61749"
FT                   /db_xref="InterPro:IPR000649"
FT                   /db_xref="MGI:MGI:95300"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q61749"
FT                   /protein_id="EDL37345.1"
FT                   /translation="MAAVAVAVREESRSEMKTELSPRPGAAGRELTQEEKLQLRKEKKQ
FT                   QKKKRKEEKGADQEIGSAVSAAQRQDPIRELPGPGSQLGGTAGEKLPAGRSKAELRAER
FT                   RAKQEAERALKQARKGEQGGVPPQACPSTAGETTSGVKRVPEHTPADDPTLLRRLLRKP
FT                   DRQQVPTRKDYGSKVSLFSHLPQYSRQSSLTQYMSIPSSVIHPAMVRLGLQYSQGLISG
FT                   SNARCIALLHALQQVIQDYTTPPSEELSRDLVNKLKPYISFLTQCRPMSASMCNAIKFL
FT                   TKEVTGMSSSKREEEAKSELREALDRYVQEKIVLAAQAISRFASTKISDGDVILVYGCS
FT                   SLVSRILQEARVEGRRFRVVVVDSRPRLEGRHMLHSLVRAGVPTSYLLIPAASYVLPEV
FT                   SKVLLGAHALLANGSVMSRVGTAQLALVARAHNVPVLVCCETYKFCERVQTDAFVSNEL
FT                   DDPDDLQCKRGDQVALANWQSHPSLRLLNLVYDVTPPELVDLVITELGMIPCSSVPVVL
FT                   RVKSSDQ"
FT   gene            5001958..5009316
FT                   /gene="Snx17"
FT                   /locus_tag="mCG_23482"
FT                   /note="gene_id=mCG23482.1"
FT   mRNA            join(5001958..5002095,5002492..5002633,5002943..5002977,
FT                   5003331..5003815,5004219..5004293,5005146..5005263,
FT                   5005765..5005829,5006094..5006204,5006299..5006389,
FT                   5006525..5006612,5006829..5006898,5007331..5007423,
FT                   5007518..5007721,5007969..5008094,5008211..5008288,
FT                   5008418..5008492,5008584..5008625,5008706..5009316)
FT                   /gene="Snx17"
FT                   /locus_tag="mCG_23482"
FT                   /product="sorting nexin 17, transcript variant mCT23394"
FT                   /note="gene_id=mCG23482.1 transcript_id=mCT23394.2 created
FT                   on 03-FEB-2003"
FT   mRNA            join(5003677..5003815,5004219..5004293,5005146..5005263,
FT                   5005556..5005629,5005765..5005826)
FT                   /gene="Snx17"
FT                   /locus_tag="mCG_23482"
FT                   /product="sorting nexin 17, transcript variant mCT173716"
FT                   /note="gene_id=mCG23482.1 transcript_id=mCT173716.0 created
FT                   on 03-FEB-2003"
FT   mRNA            join(5003746..5003815,5005146..5005263,5005765..5005829,
FT                   5006094..>5006160)
FT                   /gene="Snx17"
FT                   /locus_tag="mCG_23482"
FT                   /product="sorting nexin 17, transcript variant mCT173715"
FT                   /note="gene_id=mCG23482.1 transcript_id=mCT173715.0 created
FT                   on 03-FEB-2003"
FT   CDS             join(5003753..5003815,5004219..5004293,5005146..5005263,
FT                   5005765..5005829,5006094..5006204,5006299..5006389,
FT                   5006525..5006612,5006829..5006898,5007331..5007423,
FT                   5007518..5007721,5007969..5008094,5008211..5008288,
FT                   5008418..5008492,5008584..5008625,5008706..5008819)
FT                   /codon_start=1
FT                   /gene="Snx17"
FT                   /locus_tag="mCG_23482"
FT                   /product="sorting nexin 17, isoform CRA_b"
FT                   /note="gene_id=mCG23482.1 transcript_id=mCT23394.2
FT                   protein_id=mCP4027.2 isoform=CRA_b"
FT                   /protein_id="EDL37347.1"
FT                   /translation="MHFSIPETESRSGDSGGSAYVAYNIHVNGVLHCRVRYSQLLGLHE
FT                   QLRKEYGANVVPAFPPKKLFSLTPAEVEQRREQLEKYMQAVRQDPLLGSSETFNSFLRR
FT                   AQQETQQVPTEEVSLEVLLSNGQKVLVTVLTSDQTEDVLEAVAAKLDLPDDLIGYFSLF
FT                   LVREKEDGAFSFVRKLQEFELPYVSVTSLRSQEYKIVLRKSYWDSAYDDDVMENRVGLN
FT                   LLYAQTVSDIEHGWILVTKEQHRQLKSLQEKVSKKEFLRLAQTLRHYGYLRFDACVADF
FT                   PEKDCPVVVSAGNSELSLQLRLPGQQLREGSFRVTRMRCWRVTSSVPLPSGGTSSPSRG
FT                   RGEVRLELAFEYLMSKDRLQWVTITSPQAIMMSICLQSMVDELMVKKSGGSIRKMLRRR
FT                   VGGTLRRSDSQQAVKSPPLLESPDASRESMVKLSSKLSAVSLRGIGSPSTDASASAVHG
FT                   NFAFEGIGDEDL"
FT   CDS             join(5003753..5003815,5005146..5005263,5005765..5005829,
FT                   5006094..>5006160)
FT                   /codon_start=1
FT                   /gene="Snx17"
FT                   /locus_tag="mCG_23482"
FT                   /product="sorting nexin 17, isoform CRA_a"
FT                   /note="gene_id=mCG23482.1 transcript_id=mCT173715.0
FT                   protein_id=mCP96634.0 isoform=CRA_a"
FT                   /protein_id="EDL37346.1"
FT                   /translation="MHFSIPETESRSGDSGGSAYVLRKEYGANVVPAFPPKKLFSLTPA
FT                   EVEQRREQLEKYMQAVRQDPLLGSSETFNSFLRRAQQETQQVPTEEVSLEVLLSNGQKV
FT                   "
FT   CDS             join(5003753..5003815,5004219..5004293,5005146..5005263,
FT                   5005556..5005563)
FT                   /codon_start=1
FT                   /gene="Snx17"
FT                   /locus_tag="mCG_23482"
FT                   /product="sorting nexin 17, isoform CRA_c"
FT                   /note="gene_id=mCG23482.1 transcript_id=mCT173716.0
FT                   protein_id=mCP96635.0 isoform=CRA_c"
FT                   /db_xref="GOA:H3BKG9"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="InterPro:IPR028666"
FT                   /db_xref="MGI:MGI:2387801"
FT                   /db_xref="UniProtKB/TrEMBL:H3BKG9"
FT                   /protein_id="EDL37348.1"
FT                   /translation="MHFSIPETESRSGDSGGSAYVAYNIHVNGVLHCRVRYSQLLGLHE
FT                   QLRKEYGANVVPAFPPKKLFSLTPAEVEQRREQLEKYMQAVL"
FT   gene            complement(5009328..>5012581)
FT                   /gene="Zfp513"
FT                   /locus_tag="mCG_23477"
FT                   /note="gene_id=mCG23477.1"
FT   mRNA            complement(join(5009328..5010975,5011045..5011170,
FT                   5011931..5012258))
FT                   /gene="Zfp513"
FT                   /locus_tag="mCG_23477"
FT                   /product="zinc finger protein 513, transcript variant
FT                   mCT23389"
FT                   /note="gene_id=mCG23477.1 transcript_id=mCT23389.1 created
FT                   on 02-OCT-2002"
FT   mRNA            complement(join(5009330..5010495,5010583..5011170,
FT                   5011931..5012086,5012335..>5012581))
FT                   /gene="Zfp513"
FT                   /locus_tag="mCG_23477"
FT                   /product="zinc finger protein 513, transcript variant
FT                   mCT193554"
FT                   /note="gene_id=mCG23477.1 transcript_id=mCT193554.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(5009669..5010495,5010583..5011170,
FT                   5011931..5012086,5012335..>5012476))
FT                   /codon_start=1
FT                   /gene="Zfp513"
FT                   /locus_tag="mCG_23477"
FT                   /product="zinc finger protein 513, isoform CRA_b"
FT                   /note="gene_id=mCG23477.1 transcript_id=mCT193554.0
FT                   protein_id=mCP114541.0 isoform=CRA_b"
FT                   /protein_id="EDL37350.1"
FT                   /translation="EQGPTAGPNWEGRGREASGRRRVGLEPVTMPRRKQSHPQPVKCEG
FT                   VKVDTEDSFDEGPGALVLESDLLLGQDLEFEEEEEEDEGDGHNDQLMGFERDSEGDSQG
FT                   ARPGLPYGLSDDESGGGRALSAESEVEEPARGPGEARGERPGPACQLCGGPTGEGPCCG
FT                   AGGPGGGPPLPPRLLYSCRLCAFVSHYSSHLKRHMQTHSGEKPFRCGRCPYASAQLVNL
FT                   TRHTRTHTGEKPYRCPHCPFACSSLGNLRRHQRTHTGPPTPPCPTCGFRCCAPRPTRPP
FT                   SPTEQEGTMPRRSEDALILPDLSLHVPPGGASFLPDCGQLRGEGESLCGTGSEPLPELL
FT                   FPWTCRGCGQELEEGEGSRLGAAMCGRCMRGEAGGVATGGPQGPGDKGFACSLCPFATH
FT                   YPNHLARHMKTHSGEKPFRCARCPYASAHLDNLKRHQRVHTGEKPYKCPLCPYACGNLA
FT                   NLKRHGRIHSGDKPFRCSLCNYSCNQSMNLKRHMLRHTGEKPFRCATCAYTTGHWDNYK
FT                   RHQKVHGHGGAGGPGLSAPEGWAPPHSPPSVLSTRGPAALGATGSRALHSDSP"
FT   mRNA            complement(join(<5009669..5010146,5011045..5011170,
FT                   5011931..>5012135))
FT                   /gene="Zfp513"
FT                   /locus_tag="mCG_23477"
FT                   /product="zinc finger protein 513, transcript variant
FT                   mCT193553"
FT                   /note="gene_id=mCG23477.1 transcript_id=mCT193553.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(5009669..5010146,5011045..>5011076))
FT                   /codon_start=1
FT                   /gene="Zfp513"
FT                   /locus_tag="mCG_23477"
FT                   /product="zinc finger protein 513, isoform CRA_a"
FT                   /note="gene_id=mCG23477.1 transcript_id=mCT193553.0
FT                   protein_id=mCP114540.0 isoform=CRA_a"
FT                   /protein_id="EDL37349.1"
FT                   /translation="GTSQGSRGGQGGEKPFRCARCPYASAHLDNLKRHQRVHTGEKPYK
FT                   CPLCPYACGNLANLKRHGRIHSGDKPFRCSLCNYSCNQSMNLKRHMLRHTGEKPFRCAT
FT                   CAYTTGHWDNYKRHQKVHGHGGAGGPGLSAPEGWAPPHSPPSVLSTRGPAALGATGSRA
FT                   LHSDSP"
FT   CDS             complement(5009669..5010877)
FT                   /codon_start=1
FT                   /gene="Zfp513"
FT                   /locus_tag="mCG_23477"
FT                   /product="zinc finger protein 513, isoform CRA_c"
FT                   /note="gene_id=mCG23477.1 transcript_id=mCT23389.1
FT                   protein_id=mCP3950.1 isoform=CRA_c"
FT                   /protein_id="EDL37351.1"
FT                   /translation="MQTHSGEKPFRCGRCPYASAQLVNLTRHTRTHTGEKPYRCPHCPF
FT                   ACSSLGNLRRHQRTHTGPPTPPCPTCGFRCCAPRPTRPPSPTEQEGTMPRRSEGKKNTR
FT                   HLGTWVGGDRDAWINGPYLIVPTDALILPDLSLHVPPGGASFLPDCGQLRGEGESLCGT
FT                   GSEPLPELLFPWTCRGCGQELEEGEGSRLGAAMCGRCMRGEAGGVATGGPQGPGDKGFA
FT                   CSLCPFATHYPNHLARHMKTHSGEKPFRCARCPYASAHLDNLKRHQRVHTGEKPYKCPL
FT                   CPYACGNLANLKRHGRIHSGDKPFRCSLCNYSCNQSMNLKRHMLRHTGEKPFRCATCAY
FT                   TTGHWDNYKRHQKVHGHGGAGGPGLSAPEGWAPPHSPPSVLSTRGPAALGATGSRALHS
FT                   DSP"
FT   gene            complement(5013018..5031015)
FT                   /gene="Ppm1g"
FT                   /locus_tag="mCG_23473"
FT                   /note="gene_id=mCG23473.2"
FT   mRNA            complement(join(5013018..5013632,5013920..5014022,
FT                   5014378..5014507,5014801..5015035,5015346..5015477,
FT                   5016386..5016801,5017911..5018043,5018361..5018446,
FT                   5018735..5018804,5030677..5031015))
FT                   /gene="Ppm1g"
FT                   /locus_tag="mCG_23473"
FT                   /product="protein phosphatase 1G (formerly 2C),
FT                   magnesium-dependent, gamma isoform, transcript variant
FT                   mCT23385"
FT                   /note="gene_id=mCG23473.2 transcript_id=mCT23385.2 created
FT                   on 18-FEB-2003"
FT   mRNA            complement(join(5013391..5013632,5013920..5014022,
FT                   5014378..5014507,5014801..5014824,5030677..5031002))
FT                   /gene="Ppm1g"
FT                   /locus_tag="mCG_23473"
FT                   /product="protein phosphatase 1G (formerly 2C),
FT                   magnesium-dependent, gamma isoform, transcript variant
FT                   mCT180310"
FT                   /note="gene_id=mCG23473.2 transcript_id=mCT180310.0 created
FT                   on 18-FEB-2003"
FT   CDS             complement(join(5013429..5013632,5013920..5014022,
FT                   5014378..5014507,5014801..5015035,5015346..5015477,
FT                   5016386..5016801,5017911..5018043,5018361..5018446,
FT                   5018735..5018804,5030677..5030796))
FT                   /codon_start=1
FT                   /gene="Ppm1g"
FT                   /locus_tag="mCG_23473"
FT                   /product="protein phosphatase 1G (formerly 2C),
FT                   magnesium-dependent, gamma isoform, isoform CRA_b"
FT                   /note="gene_id=mCG23473.2 transcript_id=mCT23385.2
FT                   protein_id=mCP3925.1 isoform=CRA_b"
FT                   /protein_id="EDL37353.1"
FT                   /translation="MGAYLSQPNTVKCSGDGVGAPRLPLPYGFSAMQGWRVSMEDAHNC
FT                   IPELDNETAMFSVYDGHGGEEVALYCAKYLPDIIKDQKAYKEGKLQKALQDAFLAIDAK
FT                   LTTEEVIKELAQIAGRPTEDEDDKDKVADEDDVDNEEAALLHEEATMTIEELLTRYGQN
FT                   CQKVPPHTKSGIGTGDEPGPQGLNGEAGPEDPSRETPSQENGPTAKGHTGFSSNSEHGT
FT                   EAGQISEPGTATGEAGPSCSSASDKLPRVAKSKFFEDSEDESDEVEEEEDDSEECSEDE
FT                   DGYSSEEAENEEDEDDTEEAEEDDDEEMMVPGMEGKEEPGSDSGTTAVVALIRGKQLIV
FT                   ANAGDSRCVVSEAGKALDMSYDHKPEDEVELARIKNAGGKVTMDGRVNGGLNLSRAIGD
FT                   HFYKRNKNLPPQEQMISALPDIKVLTLTDDHEFMVIACDGIWNVMSSQEVVDFIQSKIS
FT                   QRDENGELRLLSSIVEELLDQCLAPDTSGDGTGCDNMTCIIICFKPRNTVELQAESGKR
FT                   KLEEALSTEGAEDTGNSDKKKAKRD"
FT   CDS             complement(join(5014457..5014507,5014801..5014824,
FT                   5030677..5030796))
FT                   /codon_start=1
FT                   /gene="Ppm1g"
FT                   /locus_tag="mCG_23473"
FT                   /product="protein phosphatase 1G (formerly 2C),
FT                   magnesium-dependent, gamma isoform, isoform CRA_a"
FT                   /note="gene_id=mCG23473.2 transcript_id=mCT180310.0
FT                   protein_id=mCP103232.0 isoform=CRA_a"
FT                   /protein_id="EDL37352.1"
FT                   /translation="MGAYLSQPNTVKCSGDGVGAPRLPLPYGFSAMQGWRVSMEASTSP
FT                   GPLETTSTRETKTCHPRNR"
FT   gene            5051455..5062015
FT                   /gene="Nrbp"
FT                   /locus_tag="mCG_23472"
FT                   /note="gene_id=mCG23472.1"
FT   mRNA            join(5051455..5051563,5054202..5054430,5054605..5054727,
FT                   5054897..5054998,5055316..5055405,5055814..5055854,
FT                   5056202..5056296,5057793..5057876,5058135..5058193,
FT                   5058349..5058447,5060000..5060132,5060340..5060445,
FT                   5060541..5060591,5060681..5060816,5060995..5061048,
FT                   5061132..5061195,5061343..5061398,5061476..5062015)
FT                   /gene="Nrbp"
FT                   /locus_tag="mCG_23472"
FT                   /product="nuclear receptor binding protein, transcript
FT                   variant mCT23384"
FT                   /note="gene_id=mCG23472.1 transcript_id=mCT23384.2 created
FT                   on 02-OCT-2002"
FT   mRNA            join(5051470..5051564,5054200..5054434,5054603..5054728,
FT                   5054895..5055000,5055315..5055405,5056202..5056258)
FT                   /gene="Nrbp"
FT                   /locus_tag="mCG_23472"
FT                   /product="nuclear receptor binding protein, transcript
FT                   variant mCT174002"
FT                   /note="gene_id=mCG23472.1 transcript_id=mCT174002.0 created
FT                   on 02-OCT-2002"
FT   mRNA            join(<5051485..5051563,5054202..5054430,5054605..5054727,
FT                   5054897..5054998,5055316..5055405,5055814..5055854,
FT                   5056202..5056296,5056773..5056796,5057793..5057876,
FT                   5058135..5058193,5058349..5058447,5060000..5060132,
FT                   5060340..5060445,5060541..5060591,5060681..5060816,
FT                   5060995..5061048,5061132..5061195,5061343..5061398,
FT                   5061476..5062011)
FT                   /gene="Nrbp"
FT                   /locus_tag="mCG_23472"
FT                   /product="nuclear receptor binding protein, transcript
FT                   variant mCT193550"
FT                   /note="gene_id=mCG23472.1 transcript_id=mCT193550.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<5051535..5051563,5054202..5054430,5054605..5054727,
FT                   5054897..5054998,5055316..5055405,5055814..5055854,
FT                   5056202..5056296,5056773..5056796,5057793..5057876,
FT                   5058135..5058193,5058349..5058447,5060000..5060132,
FT                   5060340..5060445,5060541..5060591,5060681..5060816,
FT                   5060995..5061048,5061132..5061195,5061343..5061398,
FT                   5061476..5061580)
FT                   /codon_start=1
FT                   /gene="Nrbp"
FT                   /locus_tag="mCG_23472"
FT                   /product="nuclear receptor binding protein, isoform CRA_b"
FT                   /note="gene_id=mCG23472.1 transcript_id=mCT193550.0
FT                   protein_id=mCP114538.0 isoform=CRA_b"
FT                   /protein_id="EDL37355.1"
FT                   /translation="SAGCGRGVGRLSVHSSMSEGESQTVVSSGSDPKVESSSLAPGLTS
FT                   VSPPVTSTTSAASPEEEEESEDESEILEESPCGRWQKRREEVNQRNVPGIDSAYLAMDT
FT                   EEGVEVVWNEVQFSERKNYKLQEEKVRAVFDNLIQLEHLNIVKFHKYWADVKENKARVI
FT                   FITEYMSSGSLKQFLKKTKKNHKTMNEKAWKRWCTQILSALSYLHSCDPPIIHGNLTCD
FT                   TIFIQHNGLIKIGSVFHRIFANVAPDTINNHVKTCREEQKNLHFFAPEYGEVTNVTTAV
FT                   DIYSFGMCALEMAVLEIQGNGESSYVPQEAISSAIQLLEDSLQREFIQKCLQSEPARRP
FT                   TARELLFHPALFEVPSLKLLAAHCIVGHQHMIPENALEEITKNMDTSAVLAEIPAGPGR
FT                   EPVQTLYSQSPALELDKFLEDVRNGIYPLTAFGLPRPQQPQQEEVTSPVVPPSVKTPTP
FT                   EPAEVETRKVVLMQCNIESVEEGVKHHLTLLLKLEDKLNRHLSCDLMPNESIPDLAAEL
FT                   VQLGFISEADQSRLTSLLEETLNKFNFTRNSTLNTATVTVSS"
FT   CDS             join(5054221..5054430,5054605..5054727,5054897..5054998,
FT                   5055316..5055405,5055814..5055854,5056202..5056296,
FT                   5057793..5057876,5058135..5058193,5058349..5058447,
FT                   5060000..5060132,5060340..5060445,5060541..5060591,
FT                   5060681..5060816,5060995..5061048,5061132..5061195,
FT                   5061343..5061398,5061476..5061580)
FT                   /codon_start=1
FT                   /gene="Nrbp"
FT                   /locus_tag="mCG_23472"
FT                   /product="nuclear receptor binding protein, isoform CRA_d"
FT                   /note="gene_id=mCG23472.1 transcript_id=mCT23384.2
FT                   protein_id=mCP3921.2 isoform=CRA_d"
FT                   /protein_id="EDL37357.1"
FT                   /translation="MSEGESQTVVSSGSDPKVESSSLAPGLTSVSPPVTSTTSAASPEE
FT                   EEESEDESEILEESPCGRWQKRREEVNQRNVPGIDSAYLAMDTEEGVEVVWNEVQFSER
FT                   KNYKLQEEKVRAVFDNLIQLEHLNIVKFHKYWADVKENKARVIFITEYMSSGSLKQFLK
FT                   KTKKNHKTMNEKAWKRWCTQILSALSYLHSCDPPIIHGNLTCDTIFIQHNGLIKIGSVA
FT                   PDTINNHVKTCREEQKNLHFFAPEYGEVTNVTTAVDIYSFGMCALEMAVLEIQGNGESS
FT                   YVPQEAISSAIQLLEDSLQREFIQKCLQSEPARRPTARELLFHPALFEVPSLKLLAAHC
FT                   IVGHQHMIPENALEEITKNMDTSAVLAEIPAGPGREPVQTLYSQSPALELDKFLEDVRN
FT                   GIYPLTAFGLPRPQQPQQEEVTSPVVPPSVKTPTPEPAEVETRKVVLMQCNIESVEEGV
FT                   KHHLTLLLKLEDKLNRHLSCDLMPNESIPDLAAELVQLGFISEADQSRLTSLLEETLNK
FT                   FNFTRNSTLNTATVTVSS"
FT   CDS             join(5054221..5054434,5054603..5054728,5054895..5055000,
FT                   5055315..5055405,5056202..5056219)
FT                   /codon_start=1
FT                   /gene="Nrbp"
FT                   /locus_tag="mCG_23472"
FT                   /product="nuclear receptor binding protein, isoform CRA_c"
FT                   /note="gene_id=mCG23472.1 transcript_id=mCT174002.0
FT                   protein_id=mCP96921.0 isoform=CRA_c"
FT                   /protein_id="EDL37356.1"
FT                   /translation="MSEGESQTVVSSGSDPKVESSSLAPGLTSVSPPVTSTTSAASPEE
FT                   EEESEDESEILEESPCGRWQKRREEVKVNQRNVPGIDSAYLAMDTEEGVEVVWNEVQFS
FT                   ERKNYKLQEEEKVRAVFDNLIQLEHLNIVKFHKYWADVKENKARVVIFITEYMSSGSLK
FT                   QFLKKTKKNHKTMNEKLPALL"
FT   mRNA            join(<5055833..5055854,5056202..5056296,5057793..5057876,
FT                   5058135..5058157,5060073..5060132,5060340..5060445,
FT                   5060541..5060591,5060681..5060709)
FT                   /gene="Nrbp"
FT                   /locus_tag="mCG_23472"
FT                   /product="nuclear receptor binding protein, transcript
FT                   variant mCT174001"
FT                   /note="gene_id=mCG23472.1 transcript_id=mCT174001.0 created
FT                   on 02-OCT-2002"
FT   CDS             join(<5055835..5055854,5056202..5056296,5057793..5057876,
FT                   5058135..5058157,5060073..5060132,5060340..5060345)
FT                   /codon_start=1
FT                   /gene="Nrbp"
FT                   /locus_tag="mCG_23472"
FT                   /product="nuclear receptor binding protein, isoform CRA_a"
FT                   /note="gene_id=mCG23472.1 transcript_id=mCT174001.0
FT                   protein_id=mCP96920.0 isoform=CRA_a"
FT                   /protein_id="EDL37354.1"
FT                   /translation="QILSALSYLHSCDPPIIHGNLTCDTIFIQHNGLIKIGSVAPDTIN
FT                   NHVKTCREEQKNLHFFAPEYGEVTNVTTAHCLKCPHSSFLLLTVSWGTNT"
FT   gene            <5062151..5063648
FT                   /gene="Krtcap3"
FT                   /locus_tag="mCG_23476"
FT                   /note="gene_id=mCG23476.2"
FT   mRNA            join(<5062151..5062554,5062643..5062702,5062816..5063022,
FT                   5063106..5063240,5063346..5063453,5063545..5063648)
FT                   /gene="Krtcap3"
FT                   /locus_tag="mCG_23476"
FT                   /product="keratinocyte associated protein 3, transcript
FT                   variant mCT193552"
FT                   /note="gene_id=mCG23476.2 transcript_id=mCT193552.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(5062164..5062265,5062370..5062554,5062643..5062702,
FT                   5062816..5063022,5063106..5063240,5063346..5063453,
FT                   5063545..5063648)
FT                   /gene="Krtcap3"
FT                   /locus_tag="mCG_23476"
FT                   /product="keratinocyte associated protein 3, transcript
FT                   variant mCT23388"
FT                   /note="gene_id=mCG23476.2 transcript_id=mCT23388.1 created
FT                   on 13-FEB-2003"
FT   mRNA            join(5062178..5062265,5062370..5062554,5062643..5062702,
FT                   5062816..5063022,5063106..5063240,5063346..5063453,
FT                   5063549..5063648)
FT                   /gene="Krtcap3"
FT                   /locus_tag="mCG_23476"
FT                   /product="keratinocyte associated protein 3, transcript
FT                   variant mCT180311"
FT                   /note="gene_id=mCG23476.2 transcript_id=mCT180311.0 created
FT                   on 13-FEB-2003"
FT   CDS             join(5062211..5062265,5062370..5062554,5062643..5062702,
FT                   5062816..5063022,5063106..5063240,5063346..5063453)
FT                   /codon_start=1
FT                   /gene="Krtcap3"
FT                   /locus_tag="mCG_23476"
FT                   /product="keratinocyte associated protein 3, isoform CRA_a"
FT                   /note="gene_id=mCG23476.2 transcript_id=mCT180311.0
FT                   protein_id=mCP103233.0 isoform=CRA_a"
FT                   /protein_id="EDL37358.1"
FT                   /translation="MGGGSRAATMRCCGVCAFDAARGPRRLMRVGLALILVGHVNLLVG
FT                   AVLHGTVLRHVANPRGAVTPEYTTANVISVGSGLLSVSVGLVALLASRNLLRPRLHWAL
FT                   LTLALVNLLLSAACSMGLLLAVSLTVANGGRRLIADCHPGLMDPSIPLDQGPGHTDCSF
FT                   DPTRIYDTALALWIPSLFMSAAEAALSGYCCVAALTLRGIGPCRKEGLQEQLQELTELE
FT                   LPECKRQENVQLLHGRQDFQALQKTWV"
FT   CDS             join(5062211..5062265,5062370..5062554,5062643..5062702,
FT                   5062816..5063022,5063106..5063240,5063346..5063453)
FT                   /codon_start=1
FT                   /gene="Krtcap3"
FT                   /locus_tag="mCG_23476"
FT                   /product="keratinocyte associated protein 3, isoform CRA_a"
FT                   /note="gene_id=mCG23476.2 transcript_id=mCT23388.1
FT                   protein_id=mCP3928.2 isoform=CRA_a"
FT                   /protein_id="EDL37360.1"
FT                   /translation="MGGGSRAATMRCCGVCAFDAARGPRRLMRVGLALILVGHVNLLVG
FT                   AVLHGTVLRHVANPRGAVTPEYTTANVISVGSGLLSVSVGLVALLASRNLLRPRLHWAL
FT                   LTLALVNLLLSAACSMGLLLAVSLTVANGGRRLIADCHPGLMDPSIPLDQGPGHTDCSF
FT                   DPTRIYDTALALWIPSLFMSAAEAALSGYCCVAALTLRGIGPCRKEGLQEQLQELTELE
FT                   LPECKRQENVQLLHGRQDFQALQKTWV"
FT   CDS             join(<5062270..5062554,5062643..5062702,5062816..5063022,
FT                   5063106..5063240,5063346..5063453)
FT                   /codon_start=1
FT                   /gene="Krtcap3"
FT                   /locus_tag="mCG_23476"
FT                   /product="keratinocyte associated protein 3, isoform CRA_b"
FT                   /note="gene_id=mCG23476.2 transcript_id=mCT193552.0
FT                   protein_id=mCP114539.0 isoform=CRA_b"
FT                   /protein_id="EDL37359.1"
FT                   /translation="VVRLSTAPVVPQADAGPGAPPCTATVRPSPYLADAARGPRRLMRV
FT                   GLALILVGHVNLLVGAVLHGTVLRHVANPRGAVTPEYTTANVISVGSGLLSVSVGLVAL
FT                   LASRNLLRPRLHWALLTLALVNLLLSAACSMGLLLAVSLTVANGGRRLIADCHPGLMDP
FT                   SIPLDQGPGHTDCSFDPTRIYDTALALWIPSLFMSAAEAALSGYCCVAALTLRGIGPCR
FT                   KEGLQEQLQELTELELPECKRQENVQLLHGRQDFQALQKTWV"
FT   gene            complement(5063626..>5101642)
FT                   /gene="Ift172"
FT                   /locus_tag="mCG_23481"
FT                   /note="gene_id=mCG23481.2"
FT   mRNA            complement(join(5063626..5063875,5064004..5064095,
FT                   5064266..5064419,5064670..5064768,5064853..5064912,
FT                   5065104..5065199,5065702..5065821,5066016..5066126,
FT                   5067007..5067123,5067341..5067427,5067781..5067844,
FT                   5067967..5068076,5068264..5068362,5070843..5070972,
FT                   5071072..5071181,5071376..5071556,5071888..5071952,
FT                   5072280..5072409,5073369..5073511,5073815..5073931,
FT                   5074020..5074155,5074227..5074324,5074854..5074943,
FT                   5075765..5075909,5076090..5076210,5076362..5076440,
FT                   5076622..5076870,5077082..5077159,5077681..5077773,
FT                   5078057..5078126,5082077..5082184,5082424..5082560,
FT                   5086296..5086463,5087313..5087425,5090863..5090948,
FT                   5091110..5091213,5091406..5091459,5091788..5091949,
FT                   5093000..5093095,5093477..5093600,5094448..5094662,
FT                   5095696..5095783,5095903..5095982,5096207..5096272,
FT                   5096522..5096561,5097021..5097133,5097338..5097481,
FT                   5101562..5101603))
FT                   /gene="Ift172"
FT                   /locus_tag="mCG_23481"
FT                   /product="intraflagellar transport 172 homolog
FT                   (Chlamydomonas), transcript variant mCT23393"
FT                   /note="gene_id=mCG23481.2 transcript_id=mCT23393.1 created
FT                   on 17-SEP-2002"
FT   mRNA            complement(join(5063731..5063875,5064004..5064095,
FT                   5064266..5064419,5064670..5064768,5064853..5064912,
FT                   5065104..5065199,5065702..5065821,5066016..5066126,
FT                   5067007..5067123,5067341..5067427,5067781..5067844,
FT                   5067967..5068076,5068264..5068362,5070843..5070972,
FT                   5071072..5071181,5071376..5071556,5071888..5071952,
FT                   5072280..5072373,5073369..5073511,5073815..5073931,
FT                   5074020..5074155,5074227..5074324,5074854..5074943,
FT                   5075765..5075909,5076090..5076210,5076362..5076440,
FT                   5076622..5076870,5077082..5077159,5077681..5077773,
FT                   5078042..5078126,5082077..5082184,5082424..5082560,
FT                   5086296..5086463,5087313..5087425,5090863..5090948,
FT                   5091110..5091213,5091406..5091459,5091788..5091949,
FT                   5093000..5093095,5093477..5093600,5094448..5094662,
FT                   5095696..5095783,5095903..5095982,5096207..5096272,
FT                   5096522..5096561,5097021..5097133,5097338..5097481,
FT                   5101562..>5101642))
FT                   /gene="Ift172"
FT                   /locus_tag="mCG_23481"
FT                   /product="intraflagellar transport 172 homolog
FT                   (Chlamydomonas), transcript variant mCT193583"
FT                   /note="gene_id=mCG23481.2 transcript_id=mCT193583.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(5063786..5063875,5064004..5064095,
FT                   5064266..5064419,5064670..5064768,5064853..5064912,
FT                   5065104..5065199,5065702..5065821,5066016..5066126,
FT                   5067007..5067123,5067341..5067427,5067781..5067844,
FT                   5067967..5068076,5068264..5068362,5070843..5070972,
FT                   5071072..5071181,5071376..5071556,5071888..5071952,
FT                   5072280..5072373,5073369..5073511,5073815..5073931,
FT                   5074020..5074155,5074227..5074324,5074854..5074943,
FT                   5075765..5075909,5076090..5076210,5076362..5076440,
FT                   5076622..5076870,5077082..5077159,5077681..5077773,
FT                   5078042..5078126,5082077..5082184,5082424..5082560,
FT                   5086296..5086463,5087313..5087425,5090863..5090948,
FT                   5091110..5091213,5091406..5091459,5091788..5091949,
FT                   5093000..5093095,5093477..5093600,5094448..5094662,
FT                   5095696..5095783,5095903..5095982,5096207..5096272,
FT                   5096522..5096561,5097021..5097133,5097338..5097481,
FT                   5101562..>5101642))
FT                   /codon_start=1
FT                   /gene="Ift172"
FT                   /locus_tag="mCG_23481"
FT                   /product="intraflagellar transport 172 homolog
FT                   (Chlamydomonas), isoform CRA_a"
FT                   /note="gene_id=mCG23481.2 transcript_id=mCT193583.0
FT                   protein_id=mCP114586.0 isoform=CRA_a"
FT                   /protein_id="EDL37361.1"
FT                   /translation="GVVSVSEHPRPVYVMQLKHLRTLLSPQDGAAKVTCMAWSQNNAKF
FT                   AVCTVDRVVLLYDEHGERRDKFSTKPADMKYGRKSYMVKGMAFSPDSTKIAIGQTDNII
FT                   YVYKIGEDWGDKKVICNKFIQTSAVTCLQWPAEYVIVFGLAEGKVRLANTKTNKSSTIY
FT                   GTESYVVALTTNCSGKGILSGHADGTIVRYFFDDEGSGESQGKLVNHPCPPYALAWATN
FT                   SIVAAGCDRRIVAYGKEGHVLQTFDYSRDPQEREFTTAAASPGGQSVVLGSYDRLRVFN
FT                   WSPRRSIWEEAKPKEIANLYTVTALAWKRDGSRLCAGTLCGGVEQFDCCLRRSIYKNKF
FT                   ELTYVGPSQVIVKNLSSGTRVVLKSHYGYEVEEVKILGKERYLVAHTSDTLLLGDLNTN
FT                   RLSEIAWQGSGGNEKYFFENENVCMIFNAGELTLVEYGSNDSLGSVRTEFMNPHLISVR
FT                   INERCQRGMEDNKKLAYLVDIKTIAIVDLIGGYNIGTISHESRVDWLELNETGHKLLFR
FT                   DRKLRLHLYDIESCSKTMILNFCSYVQWVPGSDVLVAQNRNSLCVWYNIEAPERVTMSS
FT                   IRGDVVGLERGGGKTEVMVTEGVTTVAYTLDEGLIEFGTAIDDGNYTRATAFLETLEMT
FT                   PETEAMWKTLSKLALEARQLHTAERCFSALGHVAKARFLHETNEIADQVSREYGGEGTD
FT                   FYQVRARLAMLEKNYKLAEMIFLEQNAVEEAMDMYQELHRWEECIAVAEAKGHPALEKL
FT                   RRDYYQWLMDTQQEERAGELQESQGDGLAAISLYLKAGLPAKAARLVLTREELLANTEL
FT                   VEHITTALIKGELYERAGDLFEKIRNPQRALECYCKGNAFMKAVELARLAFPVEVVRLE
FT                   EAWGDHLVQQKQLDAAINHYIEARCSIKAIEAALGARQWKKAIYILDLQDRNTASKYYP
FT                   RVAQHYASLQEYEIAEELYTKGDRTKDAIDMYTQAGRWEQAHKLAMKCMRPEDVSVLYI
FT                   TQAQEMEKQGKYREAERLYVTVEEPDLAITMFKKHKLYDDMIRLVGKHHPDLLSDTHLH
FT                   LGKELEAEGRLQEAEYHYLEAQEWKATVNMYRSSGLWEEAYRVAKAHGGANAHKHVAYL
FT                   WAKSLGGEAAVRLLNKLGLLEATIDHAADNCSFEFAFELSRLAFKHKAPEIHLKYAMYL
FT                   EDEGKFEEAEAEFIRAGKPKEAVLMFVHNQDWEAAQRVAEAHDPDSVAEVLVGQARGAL
FT                   EEKDFQKAEGLLLRAQRPGLALNYYKEAGLWSDALRICKDYVPGQLEALQEEYEREATK
FT                   KGGRGVEGLVEQARQWEQAGEYSRAVDCYLKVRDSGSSGLMEKCWMKAAELSIKFLPPQ
FT                   RSLEVVRVVGPQLIGIGKHSAAAELYLNLDLVKEAIDAFIEGEEWNKAKRVAKELDPRY
FT                   EDYVDQHYKEFLKNQGKVDSLVGVDVVAALDLYVEQGQWDKCIETATKQNYKILHKYVA
FT                   LYATHLIREGGYAQALALYVQHGAPANPQNFNIYKRIFTDMVSSPGTNNAEAYHSWADL
FT                   RDVLFNLCENLVKSSEANSAAHEEFEMMLLISHYYATRSAAQSIKQLETVAARLSVSLL
FT                   RHTQLLPADKAFYEAGTAAKEVGWENMAFIFLNRFLDLTDAIEEGTLDALDHSDFQDTD
FT                   IPFEVPLPAKQHVPEAQREEVRDWVLTVSMDQRLEQVLPRDERGVYEASLVAASTGVRA
FT                   LPCLITGYPILRNKIEFKRPGKAANKDNWNKFLMAIKTSHSPVCQDVLKFISQWCGGLP
FT                   STSFSFQ"
FT   CDS             complement(join(5063786..5063875,5064004..5064095,
FT                   5064266..5064419,5064670..5064768,5064853..5064912,
FT                   5065104..5065199,5065702..5065821,5066016..5066126,
FT                   5067007..5067123,5067341..5067427,5067781..5067844,
FT                   5067967..5068076,5068264..5068362,5070843..5070972,
FT                   5071072..5071181,5071376..5071556,5071888..5071952,
FT                   5072280..5072409,5073369..5073511,5073815..5073931,
FT                   5074020..5074155,5074227..5074324,5074854..5074943,
FT                   5075765..5075909,5076090..5076210,5076362..5076440,
FT                   5076622..5076870,5077082..5077159,5077681..5077773,
FT                   5078057..5078126,5082077..5082184,5082424..5082560,
FT                   5086296..5086463,5087313..5087425,5090863..5090948,
FT                   5091110..5091213,5091406..5091459,5091788..5091949,
FT                   5093000..5093095,5093477..5093600,5094448..5094662,
FT                   5095696..5095783,5095903..5095982,5096207..5096272,
FT                   5096522..5096561,5097021..5097133,5097338..5097481,
FT                   5101562..5101600))
FT                   /codon_start=1
FT                   /gene="Ift172"
FT                   /locus_tag="mCG_23481"
FT                   /product="intraflagellar transport 172 homolog
FT                   (Chlamydomonas), isoform CRA_b"
FT                   /note="gene_id=mCG23481.2 transcript_id=mCT23393.1
FT                   protein_id=mCP3908.1 isoform=CRA_b"
FT                   /protein_id="EDL37362.1"
FT                   /translation="MQLKHLRTLLSPQDGAAKVTCMAWSQNNAKFAVCTVDRVVLLYDE
FT                   HGERRDKFSTKPADMKYGRKSYMVKGMAFSPDSTKIAIGQTDNIIYVYKIGEDWGDKKV
FT                   ICNKFIQTSAVTCLQWPAEYVIVFGLAEGKVRLANTKTNKSSTIYGTESYVVALTTNCS
FT                   GKGILSGHADGTIVRYFFDDEGSGESQGKLVNHPCPPYALAWATNSIVAAGCDRRIVAY
FT                   GKEGHVLQTFDYSRDPQEREFTTAAASPGGQSVVLGSYDRLRVFNWSPRRSIWEEAKPK
FT                   EIANLYTVTALAWKRDGSRLCAGTLCGGVEQFDCCLRRSIYKNKFELTYVGPSQVIVKN
FT                   LSSGTRVVLKSHYGYEVEEVKILGKERYLVAHTSDTLLLGDLNTNRLSEIAWQGSGGNE
FT                   KYFFENENVCMIFNAGELTLVEYGSNDSLGSVRTEFMNPHLISVRINERCQRGMEDNKK
FT                   LAYLVDIKTIAIVDLIGGYNIGTISHESRVDWLELNETGHKLLFRDRKLRLHLYDIESC
FT                   SKTMILNFCSYVQWVPGSDVLVAQNRNSLCVWYNIEAPERVTMSSIRGDVVGLERGGGK
FT                   TEVMVTEGVTTVAYTLDEGLIEFGTAIDDGNYTRATAFLETLEMTPETEAMWKTLSKLA
FT                   LEARQLHTAERCFSALGHVAKARFLHETNEIADQGGEGTDFYQVRARLAMLEKNYKLAE
FT                   MIFLEQNAVEEAMDMYQELHRWEECIAVAEAKGHPALEKLRRDYYQWLMDTQQEERAGE
FT                   LQESQGDGLAAISLYLKAGLPAKAARLVLTREELLANTELVEHITTALIKGELYERAGD
FT                   LFEKIRNPQRALECYCKGNAFMKAVELARLAFPVEVVRLEEAWGDHLVQQKQLDAAINH
FT                   YIEARCSIKAIEAALGARQWKKAIYILDLQDRNTASKYYPRVAQHYASLQEYEIAEELY
FT                   TKGDRTKDAIDMYTQAGRWEQAHKLAMKCMRPEDVSVLYITQAQEMEKQGKYREAERLY
FT                   VTVEEPDLAITMFKKHKLYDDMIRLVGKHHPDLLSDTHLHLGKELEAEGRLQEAEYHYL
FT                   EAQEWKATVNMYRSSGLWEEAYRVAKAHGGANAHKHVAYLWAKSLGGEAAVRLLNKLGL
FT                   LEATIDHAADNCMKYKLIQIVHFSSFEFAFELSRLAFKHKAPEIHLKYAMYLEDEGKFE
FT                   EAEAEFIRAGKPKEAVLMFVHNQDWEAAQRVAEAHDPDSVAEVLVGQARGALEEKDFQK
FT                   AEGLLLRAQRPGLALNYYKEAGLWSDALRICKDYVPGQLEALQEEYEREATKKGGRGVE
FT                   GLVEQARQWEQAGEYSRAVDCYLKVRDSGSSGLMEKCWMKAAELSIKFLPPQRSLEVVR
FT                   VVGPQLIGIGKHSAAAELYLNLDLVKEAIDAFIEGEEWNKAKRVAKELDPRYEDYVDQH
FT                   YKEFLKNQGKVDSLVGVDVVAALDLYVEQGQWDKCIETATKQNYKILHKYVALYATHLI
FT                   REGGYAQALALYVQHGAPANPQNFNIYKRIFTDMVSSPGTNNAEAYHSWADLRDVLFNL
FT                   CENLVKSSEANSAAHEEFEMMLLISHYYATRSAAQSIKQLETVAARLSVSLLRHTQLLP
FT                   ADKAFYEAGTAAKEVGWENMAFIFLNRFLDLTDAIEEGTLDALDHSDFQDTDIPFEVPL
FT                   PAKQHVPEAQREEVRDWVLTVSMDQRLEQVLPRDERGVYEASLVAASTGVRALPCLITG
FT                   YPILRNKIEFKRPGKAANKDNWNKFLMAIKTSHSPVCQDVLKFISQWCGGLPSTSFSFQ
FT                   "
FT   gene            complement(5102843..5106505)
FT                   /gene="Fndc4"
FT                   /locus_tag="mCG_23479"
FT                   /note="gene_id=mCG23479.2"
FT   mRNA            complement(join(5102843..5104074,5104274..5104401,
FT                   5104692..5104781,5105218..5105422,5105594..5105709,
FT                   5105801..5105945,5106122..5106505))
FT                   /gene="Fndc4"
FT                   /locus_tag="mCG_23479"
FT                   /product="fibronectin type III domain containing 4,
FT                   transcript variant mCT23391"
FT                   /note="gene_id=mCG23479.2 transcript_id=mCT23391.2 created
FT                   on 18-FEB-2003"
FT   mRNA            complement(join(5103474..5103752,5104002..5104074,
FT                   5104274..5104401,5104692..5104781,5105218..5105422,
FT                   5105594..5105709,5105801..5105945,5106122..5106461))
FT                   /gene="Fndc4"
FT                   /locus_tag="mCG_23479"
FT                   /product="fibronectin type III domain containing 4,
FT                   transcript variant mCT180312"
FT                   /note="gene_id=mCG23479.2 transcript_id=mCT180312.0 created
FT                   on 18-FEB-2003"
FT   CDS             complement(join(5104039..5104074,5104274..5104401,
FT                   5104692..5104781,5105218..5105422,5105594..5105709,
FT                   5105801..5105921))
FT                   /codon_start=1
FT                   /gene="Fndc4"
FT                   /locus_tag="mCG_23479"
FT                   /product="fibronectin type III domain containing 4, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG23479.2 transcript_id=mCT23391.2
FT                   protein_id=mCP3905.1 isoform=CRA_a"
FT                   /db_xref="GOA:B9EI95"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="MGI:MGI:1917195"
FT                   /db_xref="UniProtKB/TrEMBL:B9EI95"
FT                   /protein_id="EDL37363.1"
FT                   /translation="MPLAPPANSVETMASLMPLSPYLSPTVLLLVSCDLGFVRADRPPS
FT                   PVNVTVTHLRANSATVSWDVPEGNIVIGYSISQQRQNGPGQRVIREVNTTTRACALWGL
FT                   AEDSDYTVQVRSIGLRGESPPGPRVHFRTLKGSDRLPSNSSSPGDITVEGLDGERPLQT
FT                   GEVVIIVVVLLMWAAVIGLFCRQYDIIKDNDSNNNPKEKGKGPEQSPQGRPVGTTRQKK
FT                   SPSINTIDV"
FT   CDS             complement(join(5104039..5104074,5104274..5104401,
FT                   5104692..5104781,5105218..5105422,5105594..5105709,
FT                   5105801..5105921))
FT                   /codon_start=1
FT                   /gene="Fndc4"
FT                   /locus_tag="mCG_23479"
FT                   /product="fibronectin type III domain containing 4, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG23479.2 transcript_id=mCT180312.0
FT                   protein_id=mCP103234.0 isoform=CRA_a"
FT                   /db_xref="GOA:B9EI95"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="MGI:MGI:1917195"
FT                   /db_xref="UniProtKB/TrEMBL:B9EI95"
FT                   /protein_id="EDL37364.1"
FT                   /translation="MPLAPPANSVETMASLMPLSPYLSPTVLLLVSCDLGFVRADRPPS
FT                   PVNVTVTHLRANSATVSWDVPEGNIVIGYSISQQRQNGPGQRVIREVNTTTRACALWGL
FT                   AEDSDYTVQVRSIGLRGESPPGPRVHFRTLKGSDRLPSNSSSPGDITVEGLDGERPLQT
FT                   GEVVIIVVVLLMWAAVIGLFCRQYDIIKDNDSNNNPKEKGKGPEQSPQGRPVGTTRQKK
FT                   SPSINTIDV"
FT   gene            5108101..5137580
FT                   /gene="Gckr"
FT                   /locus_tag="mCG_23480"
FT                   /note="gene_id=mCG23480.2"
FT   mRNA            join(5108101..5108260,5108746..5108901,5109295..5109363,
FT                   5110139..5110207,5110580..5110653,5111160..5111226,
FT                   5111393..5111446,5112557..5112651,5115369..5115474,
FT                   5116888..5117006,5117466..5117564,5117721..5117818,
FT                   5118155..5118231,5118585..5118681,5119236..5119333,
FT                   5119421..5119504,5134850..5134999,5136635..5136769,
FT                   5137205..5137580)
FT                   /gene="Gckr"
FT                   /locus_tag="mCG_23480"
FT                   /product="glucokinase regulatory protein, transcript
FT                   variant mCT23392"
FT                   /note="gene_id=mCG23480.2 transcript_id=mCT23392.2 created
FT                   on 07-FEB-2003"
FT   mRNA            join(5108162..5108260,5108746..5108901,5109295..5109363,
FT                   5110139..5110207,5110580..5110653,5111160..5111226,
FT                   5111393..5111446,5112557..5112651,5115369..5115474,
FT                   5116888..5117006,5117466..5117564,5117721..5117818,
FT                   5118155..5118231,5118585..5118681,5119236..5119333,
FT                   5119421..5119504,5134850..5134891,5136635..5136769,
FT                   5137205..5137578)
FT                   /gene="Gckr"
FT                   /locus_tag="mCG_23480"
FT                   /product="glucokinase regulatory protein, transcript
FT                   variant mCT179730"
FT                   /note="gene_id=mCG23480.2 transcript_id=mCT179730.0 created
FT                   on 07-FEB-2003"
FT   CDS             join(5108201..5108260,5108746..5108901,5109295..5109363,
FT                   5110139..5110207,5110580..5110653,5111160..5111226,
FT                   5111393..5111446,5112557..5112651,5115369..5115474,
FT                   5116888..5117006,5117466..5117564,5117721..5117818,
FT                   5118155..5118231,5118585..5118681,5119236..5119333,
FT                   5119421..5119504,5134850..5134999,5136635..5136769,
FT                   5137205..5137369)
FT                   /codon_start=1
FT                   /gene="Gckr"
FT                   /locus_tag="mCG_23480"
FT                   /product="glucokinase regulatory protein, isoform CRA_b"
FT                   /note="gene_id=mCG23480.2 transcript_id=mCT23392.2
FT                   protein_id=mCP3986.2 isoform=CRA_b"
FT                   /protein_id="EDL37366.1"
FT                   /translation="MPSTKRYQHVIETPEPGEWELSGYEAAVPITEKSNPLTRNLDKAD
FT                   AEKIVQLLGQCDAEIFQEEGQIMPTYQRLYSESVLTTMLQVAGKVQEVLKEPDGGLVVL
FT                   SGGGTSGRMAFLMSVSFNQLMKGLGQKPLYTYLIAGGDRSVVASRERTEDSALHGIEEL
FT                   KKVAAGKKRVVVIGISVGLSAPFVAGQMDYCMDNTAVFLPVLVGFNPVSMARNDPIEDW
FT                   RSTFRQVAERMQKMQEKQEAFVLNPAIGPEGLSGSSRMKGGSATKILLETLLLAAHKTV
FT                   DQGVVSSQRCLLEILRTFERAHQVTYSQSSKIATLTKQVGISLEKKGHVHLVGWQTLGI
FT                   IAIMDGVECIHTFGADFRDIRGFLIGDHNDMFNQKDELSNQGPQFTFSQDDFLTSVLPS
FT                   LTEIDTVVFIFTLDDNLAEVQALAERVREKSWNIQALVHSTVGQSLPAPLKKLFPSLIS
FT                   ITWPLLFFDYEGSYVQKFQRELSTKWVLNTVSTGAHVLLGKILQNHMLDLRIANSKLFW
FT                   RALAMLQRFSGQSKARCIESLLQVIHFPQPLSNDVRAAPISCHVQVAHEKEKVIPTALL
FT                   SLLLRCSITEAKERLAAASSVCEVVRSALSGPGQKRSIQAFGDPVVP"
FT   CDS             join(5108201..5108260,5108746..5108901,5109295..5109363,
FT                   5110139..5110207,5110580..5110653,5111160..5111226,
FT                   5111393..5111446,5112557..5112651,5115369..5115474,
FT                   5116888..5117006,5117466..5117564,5117721..5117818,
FT                   5118155..5118231,5118585..5118681,5119236..5119333,
FT                   5119421..5119504,5134850..5134891,5136635..5136769,
FT                   5137205..5137369)
FT                   /codon_start=1
FT                   /gene="Gckr"
FT                   /locus_tag="mCG_23480"
FT                   /product="glucokinase regulatory protein, isoform CRA_a"
FT                   /note="gene_id=mCG23480.2 transcript_id=mCT179730.0
FT                   protein_id=mCP102652.0 isoform=CRA_a"
FT                   /protein_id="EDL37365.1"
FT                   /translation="MPSTKRYQHVIETPEPGEWELSGYEAAVPITEKSNPLTRNLDKAD
FT                   AEKIVQLLGQCDAEIFQEEGQIMPTYQRLYSESVLTTMLQVAGKVQEVLKEPDGGLVVL
FT                   SGGGTSGRMAFLMSVSFNQLMKGLGQKPLYTYLIAGGDRSVVASRERTEDSALHGIEEL
FT                   KKVAAGKKRVVVIGISVGLSAPFVAGQMDYCMDNTAVFLPVLVGFNPVSMARNDPIEDW
FT                   RSTFRQVAERMQKMQEKQEAFVLNPAIGPEGLSGSSRMKGGSATKILLETLLLAAHKTV
FT                   DQGVVSSQRCLLEILRTFERAHQVTYSQSSKIATLTKQVGISLEKKGHVHLVGWQTLGI
FT                   IAIMDGVECIHTFGADFRDIRGFLIGDHNDMFNQKDELSNQGPQFTFSQDDFLTSVLPS
FT                   LTEIDTVVFIFTLDDNLAEVQALAERVREKSWNIQALVHSTVGQSLPAPLKKLFPSLIS
FT                   ITWPLLFFDYEGSYVQKFQRELSTKWVLNTRFSGQSKARCIESLLQVIHFPQPLSNDVR
FT                   AAPISCHVQVAHEKEKVIPTALLSLLLRCSITEAKERLAAASSVCEVVRSALSGPGQKR
FT                   SIQAFGDPVVP"
FT   gene            5262578..5291319
FT                   /gene="Zfp512"
FT                   /locus_tag="mCG_141151"
FT                   /note="gene_id=mCG141151.1"
FT   mRNA            join(5262578..5262724,5263303..5263361,5275506..5275687,
FT                   5276292..5276390,5276646..5276729,5277376..5277500,
FT                   5278208..5278294,5280412..5280510,5281051..5281218,
FT                   5282824..5283015,5283507..5283608,5285685..5285789,
FT                   5286835..5286933,5290024..5291319)
FT                   /gene="Zfp512"
FT                   /locus_tag="mCG_141151"
FT                   /product="zinc finger protein 512"
FT                   /note="gene_id=mCG141151.1 transcript_id=mCT173400.1
FT                   created on 01-APR-2004"
FT   CDS             join(5262695..5262724,5263303..5263361,5275506..5275687,
FT                   5276292..5276390,5276646..5276729,5277376..5277500,
FT                   5278208..5278294,5280412..5280510,5281051..5281218,
FT                   5282824..5283015,5283507..5283608,5285685..5285789,
FT                   5286835..5286933,5290024..5290311)
FT                   /codon_start=1
FT                   /gene="Zfp512"
FT                   /locus_tag="mCG_141151"
FT                   /product="zinc finger protein 512"
FT                   /note="gene_id=mCG141151.1 transcript_id=mCT173400.1
FT                   protein_id=mCP96319.1"
FT                   /protein_id="EDL37367.1"
FT                   /translation="MSSRLGAVTATPGPTSLKQQRSTRIVGAKKAQCSIKDNSFQYTIP
FT                   HEDSLSGSSSASSCEPVSDFTATLRKSTYWMKMRRIKPAATSQVEGEKEKERAKGKRNV
FT                   KQEEDEDYRELPQKKHKLYGRKQRPKAQPHPKPQARRVRKEPPVYAAGSMEEKWYLEIM
FT                   DKGSVSCPTCQAVGRKTIEGLKKHMENCKQEMFTCHHCGKQLHSLAGMKYHVMANHNSL
FT                   PILKAGDEVDEPSERERLRTVLKRMGKLRCMRESCSSTFTSIMGYLYHVRKCGKEASEL
FT                   EKLALKCHHCGKPYRSKAGLAYHMRSEHGPVFFPESEQPDCLKEMSLEAKGGGRVQRRS
FT                   AKIAVYHLQELASAELTKEWPKRKVLQDLVPDDRKLKYTRPGLPTFSQEVLHKWKTDIK
FT                   KYHRIQCPNQGSVWHRLTLASLFQGCEAVYSSVSGLKAHLGSCTLGTFVAGKYKCLLCE
FT                   KEFVSESGVKYHINSVHAEDWFVVNPTTTKSFEKLMKIKQRQQEEEKQRQQHGRRRSLR
FT                   RQQQPCMEPPESQLEPKAGKEQGGNEELVGPDPEPVPAQPQKAEPAKTTHKRGRK"
FT   gene            5295917..5298525
FT                   /gene="4930548H24Rik"
FT                   /locus_tag="mCG_142381"
FT                   /note="gene_id=mCG142381.0"
FT   mRNA            join(5295917..5296354,5297332..5298525)
FT                   /gene="4930548H24Rik"
FT                   /locus_tag="mCG_142381"
FT                   /product="RIKEN cDNA 4930548H24"
FT                   /note="gene_id=mCG142381.0 transcript_id=mCT180060.0
FT                   created on 11-FEB-2003"
FT   CDS             join(5295978..5296354,5297332..5298268)
FT                   /codon_start=1
FT                   /gene="4930548H24Rik"
FT                   /locus_tag="mCG_142381"
FT                   /product="RIKEN cDNA 4930548H24"
FT                   /note="gene_id=mCG142381.0 transcript_id=mCT180060.0
FT                   protein_id=mCP102982.0"
FT                   /db_xref="GOA:Q9D496"
FT                   /db_xref="InterPro:IPR029584"
FT                   /db_xref="MGI:MGI:1914906"
FT                   /db_xref="UniProtKB/TrEMBL:Q9D496"
FT                   /protein_id="EDL37368.1"
FT                   /translation="MGRLDNGETEKESVVAEWDVGGGARPCSSEVREEMDSQMQCDCIS
FT                   QDRSPRSGGKFSRPARTKLVAKTKKLYVNPSCAKSHPVCPKVKTPLENCAPQRQTCGTS
FT                   SLAKILSEPQTHLNACLSSGTRFAQSSKGSPQPSTYLTILNELFKSERLTELEKEVKSK
FT                   TMEALESLSRKIEEARLQQEHLLQDSRLLQRDTLCVDAEKNCFLRVLRKQSEQCKKKHG
FT                   QLWNQYVQDLGEIIRRKQELTLRFAKQTEELQTQLFQGKIKQSQLEQQFQSMEHISSIQ
FT                   KSQEMKIQMLEKELEDVKAETARKDHQAHLQFLQRKTHLMRQIQELRSLQAGDHNTPEV
FT                   RQKAQLFKSTAKKVNSEYCRSVCRENQELQEDLLKLIQEYYKLESIKRKLEMCKERLKE
FT                   EQCYQEALVRGRGQLKAKREKSHTCDPCPPNQGVLRPH"
FT   gene            5304799..5321816
FT                   /gene="Xab1"
FT                   /locus_tag="mCG_141152"
FT                   /note="gene_id=mCG141152.0"
FT   mRNA            join(5304799..5304935,5305570..5305663,5307363..5307402,
FT                   5308392..5308458,5309319..5309356,5310906..5310984,
FT                   5311164..5311258,5313443..5313488,5314099..5314245,
FT                   5315140..5315222,5316380..5316419,5317662..5317752,
FT                   5319487..5319594,5321020..5321816)
FT                   /gene="Xab1"
FT                   /locus_tag="mCG_141152"
FT                   /product="XPA binding protein 1"
FT                   /note="gene_id=mCG141152.0 transcript_id=mCT173399.0
FT                   created on 17-SEP-2002"
FT   CDS             join(5304825..5304935,5305570..5305663,5307363..5307402,
FT                   5308392..5308458,5309319..5309356,5310906..5310984,
FT                   5311164..5311258,5313443..5313488,5314099..5314245,
FT                   5315140..5315222,5316380..5316419,5317662..5317752,
FT                   5319487..5319594,5321020..5321099)
FT                   /codon_start=1
FT                   /gene="Xab1"
FT                   /locus_tag="mCG_141152"
FT                   /product="XPA binding protein 1"
FT                   /note="gene_id=mCG141152.0 transcript_id=mCT173399.0
FT                   protein_id=mCP96318.0"
FT                   /db_xref="GOA:Q4VAB2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004130"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1921504"
FT                   /db_xref="UniProtKB/TrEMBL:Q4VAB2"
FT                   /protein_id="EDL37369.1"
FT                   /translation="MAAPVAPSEPQASRAPQPPVCLLVLGMAGSGKTTFVQRLTGHLHN
FT                   KGCPPYVINLDPAVHEVPFPANIDIRDTVKYKEVMKQYGLGPNGGIVTSLNLFATRFDQ
FT                   VMKFIEKAQNTFRYVLIDTPGQIEVFTWSASGTIITEALASSFPTVVIYVMDTSRSTNP
FT                   VTFMSNMLYACSILYKTKLPFIVVMNKTDIIDHSFAVEWMQDFEAFQDALNQETTYVSN
FT                   LTRSMSLVLDEFYSSLRVVGVSAVVGTGFDELCTQVTSAAEEYEREYRPEYERLKKSLA
FT                   NAQSNQQKEQLERLRKDMGSVALDPEAGKGNASPVLDPSDLILTRGTLDEEDEEADSDT
FT                   DDIDHRVTEESREEPAFQNFMEESMAHWKRNK"
FT   gene            complement(5324758..>5336921)
FT                   /gene="Supt7l"
FT                   /locus_tag="mCG_23470"
FT                   /note="gene_id=mCG23470.3"
FT   mRNA            complement(join(5324758..5326114,5328455..5328692,
FT                   5330271..5330595,5332842..5333449,5336803..5336901))
FT                   /gene="Supt7l"
FT                   /locus_tag="mCG_23470"
FT                   /product="suppressor of Ty 7 (S. cerevisiae)-like,
FT                   transcript variant mCT23337"
FT                   /note="gene_id=mCG23470.3 transcript_id=mCT23337.2 created
FT                   on 25-SEP-2002"
FT   CDS             complement(join(5325852..5326114,5328455..5328692,
FT                   5330271..5330595,5332842..5333254))
FT                   /codon_start=1
FT                   /gene="Supt7l"
FT                   /locus_tag="mCG_23470"
FT                   /product="suppressor of Ty 7 (S. cerevisiae)-like, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG23470.3 transcript_id=mCT23337.2
FT                   protein_id=mCP3937.2 isoform=CRA_b"
FT                   /protein_id="EDL37371.1"
FT                   /translation="MLRYWGEIPIPSGQTNRSSFDLLPREFRLVEVHDPPLHQPSANKP
FT                   KPPTMLDIPSEPCSLTIHTIQLIQHNRRLRSLIATAQTQSQQQTEGVKAEESEPLPSCP
FT                   GSPPLPDDLQPLDCKNPNAPFQIRHSDPESDFYRGKGEPVTELSWHSCRQLLYQAVATI
FT                   LAHTGFECANESVLETLTDVAHEYCLKFTKLLRFAVDREALLGQTPFPDVMEQVFHEVG
FT                   IGSVLSLQKFWQHRIKDYHTYMLQISKQLSEEYERIVNPEKATEDTKPVKIKEEPVSDI
FT                   TFPVSEELEADLASGDQSLPIGVLGAQSERFPSNLEVEASPQAPSAEVNASPLWNLAHV
FT                   KMEPQESEEGNVSAHGVLGSDVFEEPMSGMSEAGLPQSPDDSDSSYGSHSTDSLMGSSP
FT                   VFNQRCRKRMRKI"
FT   mRNA            complement(join(5326687..5328692,5330271..5330595,
FT                   5332842..5333449,5336803..>5336921))
FT                   /gene="Supt7l"
FT                   /locus_tag="mCG_23470"
FT                   /product="suppressor of Ty 7 (S. cerevisiae)-like,
FT                   transcript variant mCT193544"
FT                   /note="gene_id=mCG23470.3 transcript_id=mCT193544.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(5328396..5328692,5330271..5330595,
FT                   5332842..>5333284))
FT                   /codon_start=1
FT                   /gene="Supt7l"
FT                   /locus_tag="mCG_23470"
FT                   /product="suppressor of Ty 7 (S. cerevisiae)-like, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG23470.3 transcript_id=mCT193544.0
FT                   protein_id=mCP114536.0 isoform=CRA_a"
FT                   /protein_id="EDL37370.1"
FT                   /translation="AGEPFSACSKMLRYWGEIPIPSGQTNRSSFDLLPREFRLVEVHDP
FT                   PLHQPSANKPKPPTMLDIPSEPCSLTIHTIQLIQHNRRLRSLIATAQTQSQQQTEGVKA
FT                   EESEPLPSCPGSPPLPDDLQPLDCKNPNAPFQIRHSDPESDFYRGKGEPVTELSWHSCR
FT                   QLLYQAVATILAHTGFECANESVLETLTDVAHEYCLKFTKLLRFAVDREALLGQTPFPD
FT                   VMEQVFHEVGIGSVLSLQKFWQHRIKDYHTYMLQISKQLSEEYERIVNPEKATEDTKPV
FT                   KIKEEPVSDITFPVSEELEADLASGDQSLPIGVLGAQSERFPSNLEVEASPQAPSKKES
FT                   CIHFASGSAHLSTS"
FT   gene            5337185..5363995
FT                   /gene="Slc4a1ap"
FT                   /locus_tag="mCG_23471"
FT                   /note="gene_id=mCG23471.2"
FT   mRNA            join(5337185..5337370,5337411..5337753,5338112..5338307,
FT                   5340661..5340783,5342001..5342061,5342472..5342611,
FT                   5344073..5344233,5344886..5344955,5346166..5346352,
FT                   5350415..5350526,5353699..5353942,5358563..5358633,
FT                   5360665..5360734,5363691..5363995)
FT                   /gene="Slc4a1ap"
FT                   /locus_tag="mCG_23471"
FT                   /product="solute carrier family 4 (anion exchanger), member
FT                   1, adaptor protein, transcript variant mCT23336"
FT                   /note="gene_id=mCG23471.2 transcript_id=mCT23336.2 created
FT                   on 29-OCT-2002"
FT   mRNA            join(5337185..5337370,5337411..5337753,5338112..5338307,
FT                   5342001..5342061,5342472..5342611,5344073..5344477)
FT                   /gene="Slc4a1ap"
FT                   /locus_tag="mCG_23471"
FT                   /product="solute carrier family 4 (anion exchanger), member
FT                   1, adaptor protein, transcript variant mCT173713"
FT                   /note="gene_id=mCG23471.2 transcript_id=mCT173713.0 created
FT                   on 29-OCT-2002"
FT   mRNA            join(<5337199..5337753,5338112..5338307,5340661..5340783,
FT                   5342001..5342061,5342472..5342611,5344073..5344233,
FT                   5344886..5344955,5346166..5346352,5350415..5350526,
FT                   5353699..5353942,5358563..5358633,5360665..5360734,
FT                   5363691..5363995)
FT                   /gene="Slc4a1ap"
FT                   /locus_tag="mCG_23471"
FT                   /product="solute carrier family 4 (anion exchanger), member
FT                   1, adaptor protein, transcript variant mCT193549"
FT                   /note="gene_id=mCG23471.2 transcript_id=mCT193549.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<5337349..5337753,5338112..5338307,5340661..5340783,
FT                   5342001..5342061,5342472..5342611,5344073..5344233,
FT                   5344886..5344955,5346166..5346352,5350415..5350526,
FT                   5353699..5353942,5358563..5358633,5360665..5360734,
FT                   5363691..5363740)
FT                   /codon_start=1
FT                   /gene="Slc4a1ap"
FT                   /locus_tag="mCG_23471"
FT                   /product="solute carrier family 4 (anion exchanger), member
FT                   1, adaptor protein, isoform CRA_c"
FT                   /note="gene_id=mCG23471.2 transcript_id=mCT193549.0
FT                   protein_id=mCP114537.0 isoform=CRA_c partial"
FT                   /protein_id="EDL37374.1"
FT                   /translation="RKNVSRRSWXXXXXXXPSWGSPATAPYSLETLKGGTILGTRTLKD
FT                   TSCCFFGRLASCDICLEHPSVSRYHAVLQHRGADPSGDSEGHEQGFYLYDLGSTHGTFL
FT                   NKTRIPPRTYCRVHVGHVMRFGGSTRLFILQGPEEDREAESELTVTQLKELRKQQQILL
FT                   EKKMLGEDSDEEEEANTTEGKSSRSGQDDELGCTWGMGEDAVEDEAEENPIALDFQQDR
FT                   EAFYIKDPKKALQGFFDREGEELEYEFDEQGHSTWLCRVRLPVDDSTGKQLVAEAIHSG
FT                   KKKEAMVQCSLEACRVLDTLGLLRQEAVSRKRKAKNWEDEDFYDSDDDTFLDRTGLVEK
FT                   KRLNRMKKAGKLDEKPETFESLVAKLNDAERELAEISERLKASSKVLSEPSSQDSLDAF
FT                   MSEMKSGSTLDGVSRKKLHLRTFELRKEQQRLKGLIKLVKPAEIPELKKTELQTTNAEN
FT                   KTKKLALPLFGAMKGGSKFKLKTGTVGKLPPKRPELPPALMQMKDEPEVEEEEEEEEEE
FT                   EEKVKEEHEERVEDGGVRLLQEPELELEAAVEHPSAPSEPSCSKETKSHAAPANEYKQD
FT                   RDEPKKKKSPGPGKFPPILSSKYPEDDPDYCIWVPPEGQSGDGRTHLNDKYGY"
FT   CDS             join(5337715..5337753,5338112..5338307,5340661..5340783,
FT                   5342001..5342061,5342472..5342611,5344073..5344233,
FT                   5344886..5344955,5346166..5346352,5350415..5350526,
FT                   5353699..5353942,5358563..5358633,5360665..5360734,
FT                   5363691..5363740)
FT                   /codon_start=1
FT                   /gene="Slc4a1ap"
FT                   /locus_tag="mCG_23471"
FT                   /product="solute carrier family 4 (anion exchanger), member
FT                   1, adaptor protein, isoform CRA_e"
FT                   /note="gene_id=mCG23471.2 transcript_id=mCT23336.2
FT                   protein_id=mCP3958.2 isoform=CRA_e"
FT                   /db_xref="GOA:Q5BKS1"
FT                   /db_xref="MGI:MGI:1196608"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BKS1"
FT                   /protein_id="EDL37376.1"
FT                   /translation="MRFGGSTRLFILQGPEEDREAESELTVTQLKELRKQQQILLEKKM
FT                   LGEDSDEEEEANTTEGKSSRSGQDDELGCTWGMGEDAVEDEAEENPIALDFQQDREAFY
FT                   IKDPKKALQGFFDREGEELEYEFDEQGHSTWLCRVRLPVDDSTGKQLVAEAIHSGKKKE
FT                   AMVQCSLEACRVLDTLGLLRQEAVSRKRKAKNWEDEDFYDSDDDTFLDRTGLVEKKRLN
FT                   RMKKAGKLDEKPETFESLVAKLNDAERELAEISERLKASSKVLSEPSSQDSLDAFMSEM
FT                   KSGSTLDGVSRKKLHLRTFELRKEQQRLKGLIKLVKPAEIPELKKTELQTTNAENKTKK
FT                   LALPLFGAMKGGSKFKLKTGTVGKLPPKRPELPPALMQMKDEPEVEEEEEEEEEEEEKV
FT                   KEEHEERVEDGGVRLLQEPELELEAAVEHPSAPSEPSCSKETKSHAAPANEYKQDRDEP
FT                   KKKKSPGPGKFPPILSSKYPEDDPDYCIWVPPEGQSGDGRTHLNDKYGY"
FT   CDS             join(5337715..5337753,5338112..5338307,5342001..5342061,
FT                   5342472..5342611,5344073..5344248)
FT                   /codon_start=1
FT                   /gene="Slc4a1ap"
FT                   /locus_tag="mCG_23471"
FT                   /product="solute carrier family 4 (anion exchanger), member
FT                   1, adaptor protein, isoform CRA_d"
FT                   /note="gene_id=mCG23471.2 transcript_id=mCT173713.0
FT                   protein_id=mCP96631.0 isoform=CRA_d"
FT                   /protein_id="EDL37375.1"
FT                   /translation="MRFGGSTRLFILQGPEEDREAESELTVTQLKELRKQQQILLEKKM
FT                   LGEDSDEEEEANTTEGKSSRSGQDDELGCTWGMGEELEYEFDEQGHSTWLCRVRLPVDD
FT                   STGKQLVAEAIHSGKKKEAMVQCSLEACRVLDTLGLLRQEAVSRKRKAKNWEDEDFYDS
FT                   DDDTFLDRTGLVEKKRLNRMKKAGKLDEKPETFESLASCS"
FT   mRNA            join(<5353623..5353942,5356209..5356295,5358563..5358633,
FT                   5360665..5360734,5363691..5363994)
FT                   /gene="Slc4a1ap"
FT                   /locus_tag="mCG_23471"
FT                   /product="solute carrier family 4 (anion exchanger), member
FT                   1, adaptor protein, transcript variant mCT173712"
FT                   /note="gene_id=mCG23471.2 transcript_id=mCT173712.0 created
FT                   on 29-OCT-2002"
FT   mRNA            join(<5353623..5353942,5358563..5358633,5360665..5360734,
FT                   5363691..5363983)
FT                   /gene="Slc4a1ap"
FT                   /locus_tag="mCG_23471"
FT                   /product="solute carrier family 4 (anion exchanger), member
FT                   1, adaptor protein, transcript variant mCT175270"
FT                   /note="gene_id=mCG23471.2 transcript_id=mCT175270.0 created
FT                   on 29-OCT-2002"
FT   CDS             join(<5353699..5353942,5356209..5356295,5358563..5358633,
FT                   5360665..5360734,5363691..5363740)
FT                   /codon_start=1
FT                   /gene="Slc4a1ap"
FT                   /locus_tag="mCG_23471"
FT                   /product="solute carrier family 4 (anion exchanger), member
FT                   1, adaptor protein, isoform CRA_a"
FT                   /note="gene_id=mCG23471.2 transcript_id=mCT173712.0
FT                   protein_id=mCP96632.0 isoform=CRA_a"
FT                   /protein_id="EDL37372.1"
FT                   /translation="KLPPKRPELPPALMQMKDEPEVEEEEEEEEEEEEKVKEEHEERVE
FT                   DGGVRLLQEPELELEAAVEHPSAPSEPSCSKETKSHESISQLSQVEQSKDYQEMGKIVS
FT                   SCEDPSAAPANEYKQDRDEPKKKKSPGPGKFPPILSSKYPEDDPDYCIWVPPEGQSGDG
FT                   RTHLNDKYGY"
FT   CDS             join(<5353699..5353942,5358563..5358633,5360665..5360734,
FT                   5363691..5363740)
FT                   /codon_start=1
FT                   /gene="Slc4a1ap"
FT                   /locus_tag="mCG_23471"
FT                   /product="solute carrier family 4 (anion exchanger), member
FT                   1, adaptor protein, isoform CRA_b"
FT                   /note="gene_id=mCG23471.2 transcript_id=mCT175270.0
FT                   protein_id=mCP98189.0 isoform=CRA_b"
FT                   /protein_id="EDL37373.1"
FT                   /translation="KLPPKRPELPPALMQMKDEPEVEEEEEEEEEEEEKVKEEHEERVE
FT                   DGGVRLLQEPELELEAAVEHPSAPSEPSCSKETKSHAAPANEYKQDRDEPKKKKSPGPG
FT                   KFPPILSSKYPEDDPDYCIWVPPEGQSGDGRTHLNDKYGY"
FT   gene            complement(5379548..>5381344)
FT                   /locus_tag="mCG_1046215"
FT                   /note="gene_id=mCG1046215.1"
FT   mRNA            complement(join(5379548..5380383,5380753..5380872,
FT                   5381137..>5381344))
FT                   /locus_tag="mCG_1046215"
FT                   /product="mCG1046215"
FT                   /note="gene_id=mCG1046215.1 transcript_id=mCT163919.1
FT                   created on 14-OCT-2002"
FT   CDS             complement(5379918..>5380217)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1046215"
FT                   /product="mCG1046215"
FT                   /note="gene_id=mCG1046215.1 transcript_id=mCT163919.1
FT                   protein_id=mCP64692.1"
FT                   /protein_id="EDL37377.1"
FT                   /translation="VPQSNIKWSLGTLVEELWEGLQALKEIGTLQEDQQSQLTWTTRGS
FT                   QKLNHQPKSIHRLDLGLLAHMEQICSLVFMWISQQLEQGLSLNLLPACGSCSLN"
FT   gene            <5406949..5464959
FT                   /locus_tag="mCG_146108"
FT                   /note="gene_id=mCG146108.0"
FT   mRNA            join(<5406949..5407036,5418234..5418361,5451663..5453099,
FT                   5464566..5464959)
FT                   /locus_tag="mCG_146108"
FT                   /product="mCG146108"
FT                   /note="gene_id=mCG146108.0 transcript_id=mCT186211.0
FT                   created on 14-JUL-2003"
FT   gene            5423940..5432922
FT                   /gene="Mrpl33"
FT                   /locus_tag="mCG_11595"
FT                   /note="gene_id=mCG11595.2"
FT   mRNA            join(5423940..5424030,5424611..5424629,5426389..5426495,
FT                   5432386..5432922)
FT                   /gene="Mrpl33"
FT                   /locus_tag="mCG_11595"
FT                   /product="mitochondrial ribosomal protein L33, transcript
FT                   variant mCT11915"
FT                   /note="gene_id=mCG11595.2 transcript_id=mCT11915.2 created
FT                   on 18-FEB-2003"
FT   CDS             join(5424009..5424030,5424611..5424629,5426389..5426495,
FT                   5432386..5432435)
FT                   /codon_start=1
FT                   /gene="Mrpl33"
FT                   /locus_tag="mCG_11595"
FT                   /product="mitochondrial ribosomal protein L33, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG11595.2 transcript_id=mCT11915.2
FT                   protein_id=mCP3931.2 isoform=CRA_a"
FT                   /protein_id="EDL37379.1"
FT                   /translation="MLLSAVSFAKSKSKTILVKLVSQAGTGFSFNHKRSRLREKLSLLH
FT                   YDPIVNKKVLFVEQKKIRSL"
FT   mRNA            join(<5424020..5426495,5432386..5432651)
FT                   /gene="Mrpl33"
FT                   /locus_tag="mCG_11595"
FT                   /product="mitochondrial ribosomal protein L33, transcript
FT                   variant mCT193637"
FT                   /note="gene_id=mCG11595.2 transcript_id=mCT193637.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(<5424035..5424164,5424611..5424629,5426389..5426495,
FT                   5432386..5432629)
FT                   /gene="Mrpl33"
FT                   /locus_tag="mCG_11595"
FT                   /product="mitochondrial ribosomal protein L33, transcript
FT                   variant mCT180101"
FT                   /note="gene_id=mCG11595.2 transcript_id=mCT180101.0 created
FT                   on 18-FEB-2003"
FT   CDS             join(<5424035..5424164,5424611..5424629,5426389..5426495,
FT                   5432386..5432435)
FT                   /codon_start=1
FT                   /gene="Mrpl33"
FT                   /locus_tag="mCG_11595"
FT                   /product="mitochondrial ribosomal protein L33, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG11595.2 transcript_id=mCT180101.0
FT                   protein_id=mCP103023.0 isoform=CRA_b"
FT                   /protein_id="EDL37380.1"
FT                   /translation="VGLRRRQGLRRGAEAVTRRSRGGARRGGGPGAAAATPRRASGSVA
FT                   KSKSKTILVKLVSQAGTGFSFNHKRSRLREKLSLLHYDPIVNKKVLFVEQKKIRSL"
FT   CDS             <5424084..5424452
FT                   /codon_start=1
FT                   /gene="Mrpl33"
FT                   /locus_tag="mCG_11595"
FT                   /product="mitochondrial ribosomal protein L33, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG11595.2 transcript_id=mCT193637.0
FT                   protein_id=mCP114610.0 isoform=CRA_c"
FT                   /protein_id="EDL37381.1"
FT                   /translation="PAGPEVEPGGVEDLARRLPPRGAPPGLVRRRREPRRPLQGCPKNV
FT                   YWPLWYYPAAWLLADILIRVSISGDFAAVCKVQTRAVLQYKYLHYRRVGIEQILLRTML
FT                   RWQTTVDYTKTTTTTKHS"
FT   gene            complement(5434446..5507598)
FT                   /gene="Rbks"
FT                   /locus_tag="mCG_11589"
FT                   /note="gene_id=mCG11589.1"
FT   mRNA            complement(join(5434446..5434666,5457639..5457827,
FT                   5461907..5461998,5470005..5470169,5475844..5475906,
FT                   5476986..5477049,5483440..5483572,5507480..5507598))
FT                   /gene="Rbks"
FT                   /locus_tag="mCG_11589"
FT                   /product="ribokinase"
FT                   /note="gene_id=mCG11589.1 transcript_id=mCT11909.1 created
FT                   on 25-SEP-2002"
FT   CDS             complement(join(5434493..5434666,5457639..5457827,
FT                   5461907..5461998,5470005..5470169,5475844..5475906,
FT                   5476986..5477049,5483440..5483572,5507480..5507571))
FT                   /codon_start=1
FT                   /gene="Rbks"
FT                   /locus_tag="mCG_11589"
FT                   /product="ribokinase"
FT                   /note="gene_id=mCG11589.1 transcript_id=mCT11909.1
FT                   protein_id=mCP3996.1"
FT                   /protein_id="EDL37382.1"
FT                   /translation="MAACGEPGRPWQEEEAAAVVVVGSCMTDLVSLTSRLPKTGETIHG
FT                   HEFFIGFGGKGANQCVQAARLGAKAAIVCKVGNDSFGNDYIENLKQNHISTEFTYQTRD
FT                   AATGTASIIVNNEGQNIIVIVAGANLLLNSEDLKKAASVISRAKVMICQLEISPAASLE
FT                   ALTMARRSGVKTLFNPAPAMADLDPQFYTLSSIFCCNESEAEILTGHAVSDPTTAGKAA
FT                   MILLERGCQVVVITLGASGCVILSQAEPVPKHIPTEAVKAVDTTGAGDSFVGALAFYLA
FT                   YYPNLSLEEMLKRSNFIAAVSVQATGTQSSYPYKKDLPLALF"
FT   CDS             <5452426..5452779
FT                   /codon_start=1
FT                   /locus_tag="mCG_146108"
FT                   /product="mCG146108"
FT                   /note="gene_id=mCG146108.0 transcript_id=mCT186211.0
FT                   protein_id=mCP107473.0"
FT                   /protein_id="EDL37378.1"
FT                   /translation="EGTSLLWQEDIISEGVEGDSVCLHRDFRVLERLFARSSVKVSSVM
FT                   MTLPCLLDVASSQKLLARPQRDVYFKQQSNTLKTQVYGQERHEVESGIPSLSCQANPFL
FT                   SSHQNGSVSWLQR"
FT   gene            <5465594..5473556
FT                   /locus_tag="mCG_145570"
FT                   /note="gene_id=mCG145570.0"
FT   mRNA            join(<5465594..5465618,5467883..5468073,5472256..5472339,
FT                   5473015..5473556)
FT                   /locus_tag="mCG_145570"
FT                   /product="mCG145570"
FT                   /note="gene_id=mCG145570.0 transcript_id=mCT184994.0
FT                   created on 05-JUN-2003"
FT   CDS             <5473280..5473453
FT                   /codon_start=1
FT                   /locus_tag="mCG_145570"
FT                   /product="mCG145570"
FT                   /note="gene_id=mCG145570.0 transcript_id=mCT184994.0
FT                   protein_id=mCP105600.0"
FT                   /protein_id="EDL37383.1"
FT                   /translation="PSLALSSLQSSCVSLLSVGIIDLCCHVLHNLYSRILPYYKPGTAY
FT                   HNRHFGSQERKN"
FT   gene            <5508020..5887816
FT                   /gene="Bre"
FT                   /locus_tag="mCG_142373"
FT                   /note="gene_id=mCG142373.0"
FT   mRNA            join(5508020..5508047,5511796..5511947,5540931..5541007,
FT                   5595584..5595678,5630668..5630862,5641248..5641322,
FT                   5711284..5711393,5804407..5804506,5807756..5807826,
FT                   5810281..5810363,5860634..5860787,5887658..5887816)
FT                   /gene="Bre"
FT                   /locus_tag="mCG_142373"
FT                   /product="brain and reproductive organ-expressed protein,
FT                   transcript variant mCT180049"
FT                   /note="gene_id=mCG142373.0 transcript_id=mCT180049.0
FT                   created on 11-FEB-2003"
FT   mRNA            join(<5508020..5508047,5511796..5511897,5512001..5512073,
FT                   5540432..5540519,5540931..5541007,5595584..5595678,
FT                   5630668..5630862,5641248..5641322,5711284..5711393,
FT                   5804407..5804506,5807756..5807826,5810281..5810363,
FT                   5860634..5860787,5887658..5887816)
FT                   /gene="Bre"
FT                   /locus_tag="mCG_142373"
FT                   /product="brain and reproductive organ-expressed protein,
FT                   transcript variant mCT193614"
FT                   /note="gene_id=mCG142373.0 transcript_id=mCT193614.0
FT                   created on 09-MAR-2004"
FT   mRNA            join(<5508020..5508047,5512001..5512073,5540432..5540519,
FT                   5540931..5541007,5595584..5595678,5630668..5630862,
FT                   5641248..5641322,5711284..5711393,5804407..5804506,
FT                   5807756..5807826,5810281..5810363,5860634..5860787,
FT                   5887658..5887816)
FT                   /gene="Bre"
FT                   /locus_tag="mCG_142373"
FT                   /product="brain and reproductive organ-expressed protein,
FT                   transcript variant mCT193615"
FT                   /note="gene_id=mCG142373.0 transcript_id=mCT193615.0
FT                   created on 09-MAR-2004"
FT   mRNA            join(<5508020..5508047,5512001..5512073,5540931..5541007,
FT                   5595584..5595678,5630668..5630862,5641248..5641322,
FT                   5711284..5711393,5804407..5804506,5807756..5807826,
FT                   5810281..5810363,5860634..5860787,5887658..5887816)
FT                   /gene="Bre"
FT                   /locus_tag="mCG_142373"
FT                   /product="brain and reproductive organ-expressed protein,
FT                   transcript variant mCT193612"
FT                   /note="gene_id=mCG142373.0 transcript_id=mCT193612.0
FT                   created on 09-MAR-2004"
FT   mRNA            join(<5508020..5508047,5512001..5512073,5595584..5595678,
FT                   5630668..5630862,5641248..5641322,5711284..5711393,
FT                   5804407..5804506,5807756..5807826,5810281..5810363,
FT                   5860634..5860787,5887658..5887816)
FT                   /gene="Bre"
FT                   /locus_tag="mCG_142373"
FT                   /product="brain and reproductive organ-expressed protein,
FT                   transcript variant mCT193613"
FT                   /note="gene_id=mCG142373.0 transcript_id=mCT193613.0
FT                   created on 09-MAR-2004"
FT   CDS             join(<5508021..5508047,5512001..5512073,5540432..5540519,
FT                   5540931..5541007,5595584..5595678,5630668..5630862,
FT                   5641248..5641322,5711284..5711393,5804407..5804506,
FT                   5807756..5807826,5810281..5810363,5860634..5860787,
FT                   5887658..5887721)
FT                   /codon_start=1
FT                   /gene="Bre"
FT                   /locus_tag="mCG_142373"
FT                   /product="brain and reproductive organ-expressed protein,
FT                   isoform CRA_d"
FT                   /note="gene_id=mCG142373.0 transcript_id=mCT193615.0
FT                   protein_id=mCP114572.0 isoform=CRA_d"
FT                   /protein_id="EDL37387.1"
FT                   /translation="RLLIGLKFQIHEKGPSQKLSFKSCSYHLPMCACNEWYGVPDLEKA
FT                   SYLWRKKENHLPLEKGQNCTSLTPGPNCDRFKLHIPYAGETLKWDIIFNAQYPELPPDF
FT                   IFGEDAEFLPDPSALHNLASWNPSNPECLLLVVKELVQQYHQFQCGRLRESSRLMFEYQ
FT                   TLLEEPQYGENMEIYAGKKNNWTGEFSARFLLKLPVDFSNIPTYLLKDVNEDPGEDVAL
FT                   LSVSFEDTEATQVYPKLYLSPRIEHALGGSSALHIPAFPGGGCLIDYVPQVCHLLTNKV
FT                   QYVIQGYHKRREYIAAFLSHFGTGVVEYDAEGFTKLTLLLMWKDFCFLVHIDLPLFFPR
FT                   DQPTLTFQSVYHFTNSGQLYSQAQKNYPYSPRWDGNEMAKRAKAYFKTFVPQFQEAAFA
FT                   NGKL"
FT   CDS             join(<5508021..5508047,5512001..5512073,5595584..5595678,
FT                   5630668..5630862,5641248..5641322,5711284..5711393,
FT                   5804407..5804506,5807756..5807826,5810281..5810363,
FT                   5860634..5860787,5887658..5887721)
FT                   /codon_start=1
FT                   /gene="Bre"
FT                   /locus_tag="mCG_142373"
FT                   /product="brain and reproductive organ-expressed protein,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG142373.0 transcript_id=mCT193613.0
FT                   protein_id=mCP114570.0 isoform=CRA_b"
FT                   /protein_id="EDL37385.1"
FT                   /translation="RLLIGLKFQIHEKGPSQKLSFKSCSYHLPMCACRDIIFNAQYPEL
FT                   PPDFIFGEDAEFLPDPSALHNLASWNPSNPECLLLVVKELVQQYHQFQCGRLRESSRLM
FT                   FEYQTLLEEPQYGENMEIYAGKKNNWTGEFSARFLLKLPVDFSNIPTYLLKDVNEDPGE
FT                   DVALLSVSFEDTEATQVYPKLYLSPRIEHALGGSSALHIPAFPGGGCLIDYVPQVCHLL
FT                   TNKVQYVIQGYHKRREYIAAFLSHFGTGVVEYDAEGFTKLTLLLMWKDFCFLVHIDLPL
FT                   FFPRDQPTLTFQSVYHFTNSGQLYSQAQKNYPYSPRWDGNEMAKRAKAYFKTFVPQFQE
FT                   AAFANGKL"
FT   CDS             join(<5511802..5511897,5512001..5512073,5540432..5540519,
FT                   5540931..5541007,5595584..5595678,5630668..5630862,
FT                   5641248..5641322,5711284..5711393,5804407..5804506,
FT                   5807756..5807826,5810281..5810363,5860634..5860787,
FT                   5887658..5887721)
FT                   /codon_start=1
FT                   /gene="Bre"
FT                   /locus_tag="mCG_142373"
FT                   /product="brain and reproductive organ-expressed protein,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG142373.0 transcript_id=mCT193614.0
FT                   protein_id=mCP114571.0 isoform=CRA_c"
FT                   /protein_id="EDL37386.1"
FT                   /translation="LINQVKMSPEIALNRISPMLSPFISSVVRNGKIHEKGPSQKLSFK
FT                   SCSYHLPMCACNEWYGVPDLEKASYLWRKKENHLPLEKGQNCTSLTPGPNCDRFKLHIP
FT                   YAGETLKWDIIFNAQYPELPPDFIFGEDAEFLPDPSALHNLASWNPSNPECLLLVVKEL
FT                   VQQYHQFQCGRLRESSRLMFEYQTLLEEPQYGENMEIYAGKKNNWTGEFSARFLLKLPV
FT                   DFSNIPTYLLKDVNEDPGEDVALLSVSFEDTEATQVYPKLYLSPRIEHALGGSSALHIP
FT                   AFPGGGCLIDYVPQVCHLLTNKVQYVIQGYHKRREYIAAFLSHFGTGVVEYDAEGFTKL
FT                   TLLLMWKDFCFLVHIDLPLFFPRDQPTLTFQSVYHFTNSGQLYSQAQKNYPYSPRWDGN
FT                   EMAKRAKAYFKTFVPQFQEAAFANGKL"
FT   CDS             join(5511820..5511947,5540931..5541007,5595584..5595678,
FT                   5630668..5630862,5641248..5641322,5711284..5711393,
FT                   5804407..5804506,5807756..5807826,5810281..5810363,
FT                   5860634..5860787,5887658..5887721)
FT                   /codon_start=1
FT                   /gene="Bre"
FT                   /locus_tag="mCG_142373"
FT                   /product="brain and reproductive organ-expressed protein,
FT                   isoform CRA_e"
FT                   /note="gene_id=mCG142373.0 transcript_id=mCT180049.0
FT                   protein_id=mCP102971.0 isoform=CRA_e"
FT                   /protein_id="EDL37388.1"
FT                   /translation="MSPEIALNRISPMLSPFISSVVRNGKVGLDATNCLRITDLKSGCT
FT                   SLTPGPNCDRFKLHIPYAGETLKWDIIFNAQYPELPPDFIFGEDAEFLPDPSALHNLAS
FT                   WNPSNPECLLLVVKELVQQYHQFQCGRLRESSRLMFEYQTLLEEPQYGENMEIYAGKKN
FT                   NWTGEFSARFLLKLPVDFSNIPTYLLKDVNEDPGEDVALLSVSFEDTEATQVYPKLYLS
FT                   PRIEHALGGSSALHIPAFPGGGCLIDYVPQVCHLLTNKVQYVIQGYHKRREYIAAFLSH
FT                   FGTGVVEYDAEGFTKLTLLLMWKDFCFLVHIDLPLFFPRDQPTLTFQSVYHFTNSGQLY
FT                   SQAQKNYPYSPRWDGNEMAKRAKAYFKTFVPQFQEAAFANGKL"
FT   CDS             join(<5512009..5512073,5540931..5541007,5595584..5595678,
FT                   5630668..5630862,5641248..5641322,5711284..5711393,
FT                   5804407..5804506,5807756..5807826,5810281..5810363,
FT                   5860634..5860787,5887658..5887721)
FT                   /codon_start=1
FT                   /gene="Bre"
FT                   /locus_tag="mCG_142373"
FT                   /product="brain and reproductive organ-expressed protein,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG142373.0 transcript_id=mCT193612.0
FT                   protein_id=mCP114569.0 isoform=CRA_a"
FT                   /protein_id="EDL37384.1"
FT                   /translation="KRAVTEAFIQVLLLSSADVCLYCTSLTPGPNCDRFKLHIPYAGET
FT                   LKWDIIFNAQYPELPPDFIFGEDAEFLPDPSALHNLASWNPSNPECLLLVVKELVQQYH
FT                   QFQCGRLRESSRLMFEYQTLLEEPQYGENMEIYAGKKNNWTGEFSARFLLKLPVDFSNI
FT                   PTYLLKDVNEDPGEDVALLSVSFEDTEATQVYPKLYLSPRIEHALGGSSALHIPAFPGG
FT                   GCLIDYVPQVCHLLTNKVQYVIQGYHKRREYIAAFLSHFGTGVVEYDAEGFTKLTLLLM
FT                   WKDFCFLVHIDLPLFFPRDQPTLTFQSVYHFTNSGQLYSQAQKNYPYSPRWDGNEMAKR
FT                   AKAYFKTFVPQFQEAAFANGKL"
FT   gene            complement(5809023..>5813914)
FT                   /locus_tag="mCG_146318"
FT                   /note="gene_id=mCG146318.0"
FT   mRNA            complement(join(5809023..5811539,5813118..5813189,
FT                   5813817..>5813914))
FT                   /locus_tag="mCG_146318"
FT                   /product="mCG146318"
FT                   /note="gene_id=mCG146318.0 transcript_id=mCT186421.0
FT                   created on 14-JUL-2003"
FT   CDS             complement(5811251..>5811511)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146318"
FT                   /product="mCG146318"
FT                   /note="gene_id=mCG146318.0 transcript_id=mCT186421.0
FT                   protein_id=mCP107487.0"
FT                   /protein_id="EDL37389.1"
FT                   /translation="WRMCYQARAPYNAGAPYKLGITLRRKKFHPQTHSQLSTGSVRYAS
FT                   IRFQREPFLPSCGHLGASSLTICWYEIRFQKKKKEFETILI"
FT   gene            <5949943..5960937
FT                   /gene="Fosl2"
FT                   /locus_tag="mCG_11594"
FT                   /note="gene_id=mCG11594.3"
FT   mRNA            join(<5949943..5950194,5953539..5953646,5955789..5960937)
FT                   /gene="Fosl2"
FT                   /locus_tag="mCG_11594"
FT                   /product="fos-like antigen 2"
FT                   /note="gene_id=mCG11594.3 transcript_id=mCT11914.3 created
FT                   on 24-NOV-2004"
FT   CDS             join(<5949943..5950194,5953539..5953646,5955789..5956307)
FT                   /codon_start=1
FT                   /gene="Fosl2"
FT                   /locus_tag="mCG_11594"
FT                   /product="fos-like antigen 2"
FT                   /note="gene_id=mCG11594.3 transcript_id=mCT11914.3
FT                   protein_id=mCP3929.2 partial"
FT                   /protein_id="EDL37390.1"
FT                   /translation="KFRVDMPGSGSAFIPTINAITTSQDLQWMVQPTVITSMSNPYPRS
FT                   HPYSPLPGLASVPGHMALPRPGVIKTIGTTVGRRRRDEQLSPEEEEKRRIRRERNKLAA
FT                   AKCRNRRRELTEKLQAETEELEEEKSGLQKEIAELQKEKEKLEFMLVAHGPVCKISPEE
FT                   RRSPPTSGLQSLRGTGSAVGPVVVKQEPPEEDSPSSSAGMDKTQRSVIKPISIAGGGFY
FT                   GEEPLHTPIVVTSTPAITPGTSNLVFTYPNVLEQESPSSPSESCSKAHRRSSSSGDQSS
FT                   DSLNSPTLLAL"
FT   gene            6035738..6167336
FT                   /locus_tag="mCG_141231"
FT                   /note="gene_id=mCG141231.0"
FT   mRNA            join(6035738..6035821,6050054..6050259,6065318..6065379,
FT                   6066630..6066702,6067843..6067901,6072765..6072811,
FT                   6073313..6073356,6075979..6076069,6076375..6076426,
FT                   6078907..6078993,6083955..6084017,6084591..6084670,
FT                   6087736..6087808,6088654..6088752,6089655..6089711,
FT                   6092690..6092761,6094061..6094135,6096063..6096126,
FT                   6101397..6101459,6105540..6105609,6106207..6106250,
FT                   6109481..6109589,6112069..6112120,6113743..6113823,
FT                   6116569..6116634,6116900..6117005,6119498..6119577,
FT                   6119929..6120033,6120133..6120228,6120370..6120446,
FT                   6121455..6121476,6121895..6121955,6123185..6123243,
FT                   6124174..6124247,6128299..6128342,6128971..6129079,
FT                   6130864..6130915,6131285..6131365,6131901..6131966,
FT                   6132721..6132821,6133437..6133518,6134115..6134219,
FT                   6135997..6136092,6136636..6136707,6141143..6141208,
FT                   6144978..6145038,6145555..6145613,6147854..6147921,
FT                   6148386..6148429,6152534..6152655,6153520..6153600,
FT                   6154675..6154740,6155150..6155244,6156608..6156686,
FT                   6157768..6157872,6158299..6158394,6165511..6165585,
FT                   6166979..6167336)
FT                   /locus_tag="mCG_141231"
FT                   /product="mCG141231"
FT                   /note="gene_id=mCG141231.0 transcript_id=mCT173993.0
FT                   created on 02-OCT-2002"
FT   CDS             join(6050199..6050259,6065318..6065379,6066630..6066702,
FT                   6067843..6067901,6072765..6072811,6073313..6073356,
FT                   6075979..6076069,6076375..6076426,6078907..6078993,
FT                   6083955..6084017,6084591..6084670,6087736..6087808,
FT                   6088654..6088752,6089655..6089711,6092690..6092761,
FT                   6094061..6094135,6096063..6096126,6101397..6101459,
FT                   6105540..6105609,6106207..6106250,6109481..6109589,
FT                   6112069..6112120,6113743..6113823,6116569..6116634,
FT                   6116900..6117005,6119498..6119577,6119929..6120033,
FT                   6120133..6120228,6120370..6120446,6121455..6121476,
FT                   6121895..6121955,6123185..6123243,6124174..6124247,
FT                   6128299..6128342,6128971..6129079,6130864..6130915,
FT                   6131285..6131365,6131901..6131966,6132721..6132821,
FT                   6133437..6133518,6134115..6134219,6135997..6136092,
FT                   6136636..6136707,6141143..6141208,6144978..6145038,
FT                   6145555..6145613,6147854..6147921,6148386..6148429,
FT                   6152534..6152655,6153520..6153600,6154675..6154740,
FT                   6155150..6155244,6156608..6156686,6157768..6157872,
FT                   6158299..6158394,6165511..6165585,6166979..6167227)
FT                   /codon_start=1
FT                   /locus_tag="mCG_141231"
FT                   /product="mCG141231"
FT                   /note="gene_id=mCG141231.0 transcript_id=mCT173993.0
FT                   protein_id=mCP96912.0"
FT                   /protein_id="EDL37391.1"
FT                   /translation="MELYPGVSPVGLLLLLLLGQGPSQIHGSSGENTLAWQSQQVFWTL
FT                   KNFPFPCKPKKLELSVLSESVHSLRPSDIKLVAAIGNPEIPLAPGSGTINMEKPQSIKN
FT                   QPQDVCMGIMTVLSDIIRHFSPSVLMPTCSPGKGTAVHTTAEDLWIQAKELVRRLKDNP
FT                   QLDFEKDWKLITVFFSNTSQCHLCPSAQQKSHLMRHMEMLWGVLDYLHHEVPRAFVNLV
FT                   DLSEVLAMDLQHQETGFSPAPEVCKCTETTTLSKAVMQWSYQEAWEDLLASSKFNKHET
FT                   FAVVFQPFFDEIEPPLKRSSPQDPTTLALRIWNSMMEPVGQKDGLLNTAERKTMKCPSE
FT                   ESPYLFTYKNSNYQARRLKPITKLQMKEGSEFTCPDKNPSNSIPTTVHSLRPADIKIIG
FT                   ALGDSLTVGNGAGASPWNILDVLTEYRGLSWSVGGDETIKTVTTLPNILREFNPSLKGF
FT                   SVGTGKESTSRASFNQAVAGAKSDGLAGQARKLVDLMKADKTINFQEDWKIITVFIGGN
FT                   DLCASCSNSTRFSPQNFIDNIKNALDILHAEVPRAFVNMAMVMEITPLRELFNEPTVSC
FT                   PRNILRSGLCPCVLGLGDNSEELSSLVQRNRDYQKKTEELINSGRYDTRDNFTVVVQPL
FT                   FENVSMPRTPEGVPDKSFFAPDCFHFNAKTHARSAIALWKNMLEPVGHKTRHNNFEIKA
FT                   PIVCPNQVDTTKNSNLGNGTWMVCEERAPSASPPTSVHTLRPADIQVVAALGDSLTAGN
FT                   GISSQEGNLTDVSTQYRGLSYSAGGDKTLENVTTLPNILRKFNGNLTGYSVGTGDSSSA
FT                   NAFLNQAVPGAKAENLTSQVRTLVQKMKSDNRVNFNRDWKVITVMIGASDLCDFCTDSN
FT                   HYSAANFFDHLQNALDILHKEVPRALVNLVDFINPSIIREVFLKNPDKCPVNQSSVLCN
FT                   CVLTPRKDSYELARLEAFTKSYQSSMLQLVESGRYDTREDFSVVLQPFLLNTKLPVLEN
FT                   GKPDTSFFAPDCIHLNQKFHTQLARALWANMLEPLGKKTDTLDPKGHISLACPTKDQPF
FT                   LRTFRNSNYKYPTKPAIENWGSDFLCTEKSPSSQVPTSVHELRPADIKVVAAMGDFLTT
FT                   ATGARPSGYKRLATPWRGLSWSIGGDGKLETHTTLPILLESSLGSPSQASLKVTFVPLS
FT                   RDMPAQAKTLVKKMKSTPTINLQEDWKLITLLIGNNDLCLYCENPEDNSTKEYVKYIQQ
FT                   ALDILYEELPRVFINVVEVMELAGLHHVQGGKCAMPLAVQKNCSCLRHSQNLTAMQELK
FT                   KLNWNLQSGISELSYWHRYMEREDFAVTVQPFFRNTFIPLNEREGLDLTFFSEDCFYFS
FT                   DRGHAEMAIALWNNMLEPVGWKTSSNNFIYNRTKLKCPSPERPFLYTLRNSQLLPDKAE
FT                   EPSNALYWAVPVAAIGGLAVGILGVMLWRTVKPVQQEEEEEDTLPNTSVTQDAVSEKRL
FT                   KAGN"
FT   gene            6228536..6229936
FT                   /locus_tag="mCG_11593"
FT                   /note="gene_id=mCG11593.1"
FT   mRNA            6228536..6229936
FT                   /locus_tag="mCG_11593"
FT                   /product="mCG11593"
FT                   /note="gene_id=mCG11593.1 transcript_id=mCT11913.1 created
FT                   on 02-OCT-2002"
FT   CDS             6228608..6229468
FT                   /codon_start=1
FT                   /locus_tag="mCG_11593"
FT                   /product="mCG11593"
FT                   /note="gene_id=mCG11593.1 transcript_id=mCT11913.1
FT                   protein_id=mCP3927.2"
FT                   /protein_id="EDL37392.1"
FT                   /translation="MTTQQIILQGPGPWGFRLVDGKDFEQPLAVSRVTPGSKAAIANLC
FT                   IGDLITAIDGEGTSSMTHLEAQNKIKGCADNMTLTVSRSEQKIWSPLVTEEGKRHPYKM
FT                   NLASEPQEVLHIGSAHNRSAMPFTASPAPSTRVITNQYNSPTDLYSSENISNFNNAVES
FT                   KTSASGKEANSRPLVQPHPSGSLIIDKESEVYKMLQEKQELNEPPKQSTSFLVLQEILE
FT                   SDGKGDPNKPSGFRSVKAPVTKVAASVGNAQKLPICDKCGTGIVGVFVKLRDHHRHPEC
FT                   YVCTD"
FT   gene            <6264342..6298934
FT                   /gene="Ppp1cb"
FT                   /locus_tag="mCG_11588"
FT                   /note="gene_id=mCG11588.1"
FT   mRNA            join(<6264342..6264508,6283283..6283415,6285908..6286138,
FT                   6288578..6288682,6290478..6290549,6291100..6291251,
FT                   6292790..6292924,6296170..6298934)
FT                   /gene="Ppp1cb"
FT                   /locus_tag="mCG_11588"
FT                   /product="protein phosphatase 1, catalytic subunit, beta
FT                   isoform"
FT                   /note="gene_id=mCG11588.1 transcript_id=mCT11908.1 created
FT                   on 25-SEP-2002"
FT   CDS             join(<6283283..6283415,6285908..6286138,6288578..6288682,
FT                   6290478..6290549,6291100..6291251,6292790..6292924,
FT                   6296170..6296274)
FT                   /codon_start=1
FT                   /gene="Ppp1cb"
FT                   /locus_tag="mCG_11588"
FT                   /product="protein phosphatase 1, catalytic subunit, beta
FT                   isoform"
FT                   /note="gene_id=mCG11588.1 transcript_id=mCT11908.1
FT                   protein_id=mCP3975.2"
FT                   /protein_id="EDL37393.1"
FT                   /translation="VRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICG
FT                   DIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLR
FT                   GNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQ
FT                   SMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHD
FT                   LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPS
FT                   EKKAKYQYGGLNSGRPVTPPRTANPPKKR"
FT   gene            complement(6355063..6362572)
FT                   /pseudo
FT                   /locus_tag="mCG_1046117"
FT                   /note="gene_id=mCG1046117.0"
FT   mRNA            complement(join(6355063..6355123,6355786..6355870,
FT                   6357639..6357716,6358937..6359329,6362467..6362572))
FT                   /pseudo
FT                   /locus_tag="mCG_1046117"
FT                   /note="gene_id=mCG1046117.0 transcript_id=mCT163821.0
FT                   created on 11-OCT-2002"
FT   gene            <6416806..6484346
FT                   /gene="Yes1"
FT                   /locus_tag="mCG_121794"
FT                   /note="gene_id=mCG121794.1"
FT   mRNA            join(<6416806..6416962,6444047..6444319,6448721..6448820,
FT                   6455368..6455466,6456674..6456777,6456868..6457017,
FT                   6458817..6458972,6459139..6459318,6462746..6462822,
FT                   6464455..6464608,6467972..6468103,6481840..6482867)
FT                   /gene="Yes1"
FT                   /locus_tag="mCG_121794"
FT                   /product="Yamaguchi sarcoma viral (v-yes) oncogene homolog
FT                   1, transcript variant mCT193622"
FT                   /note="gene_id=mCG121794.1 transcript_id=mCT193622.0
FT                   created on 09-MAR-2004"
FT   CDS             join(<6416806..6416962,6444047..6444319,6448721..6448820,
FT                   6455368..6455466,6456674..6456777,6456868..6457017,
FT                   6458817..6458972,6459139..6459318,6462746..6462822,
FT                   6464455..6464608,6467972..6468103,6481840..6482048)
FT                   /codon_start=1
FT                   /gene="Yes1"
FT                   /locus_tag="mCG_121794"
FT                   /product="Yamaguchi sarcoma viral (v-yes) oncogene homolog
FT                   1, isoform CRA_b"
FT                   /note="gene_id=mCG121794.1 transcript_id=mCT193622.0
FT                   protein_id=mCP114564.0 isoform=CRA_b"
FT                   /protein_id="EDL37395.1"
FT                   /translation="PPQVKRPGPAAPPSLPPGAPRPGGGEGRGTRGRPPRPAAFSPRRP
FT                   VRVRPDSDLIMGCIKSKENKSPAIKYTPENLTEPVSPSASHYGVEHATVAPTSSTKGAS
FT                   VNFNSLSMTPFGGSSGVTPFGGASSSFSVVSSSYPTGLTGGVTIFVALYDYEARTTEDL
FT                   SFKKGERFQIINNTEGDWWEARSIATGKSGYIPSNYVVPADSIQAEEWYFGKMGRKDAE
FT                   RLLLNPGNQRGIFLVRESETTKGAYSLSIRDWDEVRGDNVKHYKIRKLDNGGYYITTRA
FT                   QFDTLQKLVKHYTEHADGLCHKLTTVCPTVKPQTQGLAKDAWEIPRESLRLEVKLGQGC
FT                   FGEVWMGTWNGTTKVAIKTLKPGTMMPEAFLQEAQIMKKLRHDKLVPLYAVVSEEPIYI
FT                   VTEFMSKGSLLDFLKEGDGKYLKLPQLVDMAAQIADGMAYIERMNYIHRDLRAANILVG
FT                   ENLICKIADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILQTE
FT                   LVTKGRVPYPGMVNREVLEQVERGYRMPCPQGCPESLHELMNLCWKKDPDERPTFEYIQ
FT                   SFLEDYFTATEPQYQPGENL"
FT   mRNA            join(6416820..6417424,6444047..6444319,6448721..6448820,
FT                   6455368..6455466,6456674..6456777,6456868..6457017,
FT                   6458817..6458972,6459139..6459318,6462746..6462822,
FT                   6464455..6464608,6467972..6468103,6481840..6484346)
FT                   /gene="Yes1"
FT                   /locus_tag="mCG_121794"
FT                   /product="Yamaguchi sarcoma viral (v-yes) oncogene homolog
FT                   1, transcript variant mCT123006"
FT                   /note="gene_id=mCG121794.1 transcript_id=mCT123006.0
FT                   created on 17-SEP-2002"
FT   mRNA            join(<6416922..6416962,6444047..6444319,6448721..6448820,
FT                   6455368..6455466,6456674..6456777,6456868..6457017,
FT                   6458817..6458972,6459139..6459318,6462746..6462822,
FT                   6464455..6464608,6467972..6468103,6481840..6482095,
FT                   6483811..6484346)
FT                   /gene="Yes1"
FT                   /locus_tag="mCG_121794"
FT                   /product="Yamaguchi sarcoma viral (v-yes) oncogene homolog
FT                   1, transcript variant mCT193623"
FT                   /note="gene_id=mCG121794.1 transcript_id=mCT193623.0
FT                   created on 09-MAR-2004"
FT   CDS             join(<6416923..6416962,6444047..6444319,6448721..6448820,
FT                   6455368..6455466,6456674..6456777,6456868..6457017,
FT                   6458817..6458972,6459139..6459318,6462746..6462822,
FT                   6464455..6464608,6467972..6468103,6481840..6482048)
FT                   /codon_start=1
FT                   /gene="Yes1"
FT                   /locus_tag="mCG_121794"
FT                   /product="Yamaguchi sarcoma viral (v-yes) oncogene homolog
FT                   1, isoform CRA_c"
FT                   /note="gene_id=mCG121794.1 transcript_id=mCT193623.0
FT                   protein_id=mCP114565.0 isoform=CRA_c"
FT                   /protein_id="EDL37396.1"
FT                   /translation="FSPRRPVRVRPDSDLIMGCIKSKENKSPAIKYTPENLTEPVSPSA
FT                   SHYGVEHATVAPTSSTKGASVNFNSLSMTPFGGSSGVTPFGGASSSFSVVSSSYPTGLT
FT                   GGVTIFVALYDYEARTTEDLSFKKGERFQIINNTEGDWWEARSIATGKSGYIPSNYVVP
FT                   ADSIQAEEWYFGKMGRKDAERLLLNPGNQRGIFLVRESETTKGAYSLSIRDWDEVRGDN
FT                   VKHYKIRKLDNGGYYITTRAQFDTLQKLVKHYTEHADGLCHKLTTVCPTVKPQTQGLAK
FT                   DAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTKVAIKTLKPGTMMPEAFLQEAQIMKK
FT                   LRHDKLVPLYAVVSEEPIYIVTEFMSKGSLLDFLKEGDGKYLKLPQLVDMAAQIADGMA
FT                   YIERMNYIHRDLRAANILVGENLICKIADFGLARLIEDNEYTARQGAKFPIKWTAPEAA
FT                   LYGRFTIKSDVWSFGILQTELVTKGRVPYPGMVNREVLEQVERGYRMPCPQGCPESLHE
FT                   LMNLCWKKDPDERPTFEYIQSFLEDYFTATEPQYQPGENL"
FT   CDS             join(6444055..6444319,6448721..6448820,6455368..6455466,
FT                   6456674..6456777,6456868..6457017,6458817..6458972,
FT                   6459139..6459318,6462746..6462822,6464455..6464608,
FT                   6467972..6468103,6481840..6482048)
FT                   /codon_start=1
FT                   /gene="Yes1"
FT                   /locus_tag="mCG_121794"
FT                   /product="Yamaguchi sarcoma viral (v-yes) oncogene homolog
FT                   1, isoform CRA_a"
FT                   /note="gene_id=mCG121794.1 transcript_id=mCT123006.0
FT                   protein_id=mCP64908.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q3TJI7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000980"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR008266"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR020635"
FT                   /db_xref="MGI:MGI:99147"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TJI7"
FT                   /protein_id="EDL37394.1"
FT                   /translation="MGCIKSKENKSPAIKYTPENLTEPVSPSASHYGVEHATVAPTSST
FT                   KGASVNFNSLSMTPFGGSSGVTPFGGASSSFSVVSSSYPTGLTGGVTIFVALYDYEART
FT                   TEDLSFKKGERFQIINNTEGDWWEARSIATGKSGYIPSNYVVPADSIQAEEWYFGKMGR
FT                   KDAERLLLNPGNQRGIFLVRESETTKGAYSLSIRDWDEVRGDNVKHYKIRKLDNGGYYI
FT                   TTRAQFDTLQKLVKHYTEHADGLCHKLTTVCPTVKPQTQGLAKDAWEIPRESLRLEVKL
FT                   GQGCFGEVWMGTWNGTTKVAIKTLKPGTMMPEAFLQEAQIMKKLRHDKLVPLYAVVSEE
FT                   PIYIVTEFMSKGSLLDFLKEGDGKYLKLPQLVDMAAQIADGMAYIERMNYIHRDLRAAN
FT                   ILVGENLICKIADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGI
FT                   LQTELVTKGRVPYPGMVNREVLEQVERGYRMPCPQGCPESLHELMNLCWKKDPDERPTF
FT                   EYIQSFLEDYFTATEPQYQPGENL"
FT   gene            6515621..6530848
FT                   /pseudo
FT                   /locus_tag="mCG_121797"
FT                   /note="gene_id=mCG121797.1"
FT   mRNA            join(6515621..6515751,6516581..6516662,6516917..6517095,
FT                   6518570..6518646,6519526..6519628,6521762..6521858,
FT                   6524337..6524467,6524849..6524920,6525540..6525613,
FT                   6525726..6525905,6528903..6528951,6529058..6529136,
FT                   6529642..6529807,6529871..6530848)
FT                   /pseudo
FT                   /locus_tag="mCG_121797"
FT                   /note="gene_id=mCG121797.1 transcript_id=mCT123009.1
FT                   created on 14-JAN-2003"
FT   gene            complement(6530044..6580086)
FT                   /locus_tag="mCG_2531"
FT                   /note="gene_id=mCG2531.2"
FT   mRNA            complement(join(6530044..6531184,6531716..6531876,
FT                   6532118..6532264,6532512..6532650,6532867..6533103,
FT                   6558604..6558779,6568216..6568286,6579998..6580086))
FT                   /locus_tag="mCG_2531"
FT                   /product="mCG2531, transcript variant mCT180275"
FT                   /note="gene_id=mCG2531.2 transcript_id=mCT180275.1 created
FT                   on 13-JUN-2003"
FT   mRNA            complement(join(6530044..6531184,6531716..6531876,
FT                   6532118..6532264,6532512..6532650,6532867..6533103,
FT                   6558604..6558779,6579998..6580085))
FT                   /locus_tag="mCG_2531"
FT                   /product="mCG2531, transcript variant mCT185408"
FT                   /note="gene_id=mCG2531.2 transcript_id=mCT185408.0 created
FT                   on 13-JUN-2003"
FT   mRNA            complement(join(6530045..6531184,6531716..6531876,
FT                   6532118..6532264,6532512..6532650,6532867..6533103,
FT                   6534354..6534519,6535940..6535992,6558604..6558779,
FT                   6568216..6568286,6579998..6580076))
FT                   /locus_tag="mCG_2531"
FT                   /product="mCG2531, transcript variant mCT1819"
FT                   /note="gene_id=mCG2531.2 transcript_id=mCT1819.1 created on
FT                   13-JUN-2003"
FT   CDS             complement(join(6530960..6531184,6531716..6531876,
FT                   6532118..6532264,6532512..6532650,6532867..6533103,
FT                   6558604..6558779,6568216..6568286,6579998..6580062))
FT                   /codon_start=1
FT                   /locus_tag="mCG_2531"
FT                   /product="mCG2531, isoform CRA_g"
FT                   /note="gene_id=mCG2531.2 transcript_id=mCT180275.1
FT                   protein_id=mCP103197.1 isoform=CRA_g"
FT                   /db_xref="GOA:Q505E1"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR005221"
FT                   /db_xref="MGI:MGI:2445114"
FT                   /db_xref="UniProtKB/TrEMBL:Q505E1"
FT                   /protein_id="EDL37403.1"
FT                   /translation="MAASGGRACVRSLRGGVLWRSSPCHYESTATRHFLGTLQKLPLQA
FT                   GVRNFHTAPVRSLFLLRPVPILLATGGGYAGYRQYEKYRERKLEKLGLEIPPKLASHWE
FT                   VSLYKSVPTRLLSRACGRLNQVELPYWLRRPVYSLYIWTFGVNMTEAAVEDLHHYRNLS
FT                   EFFRRKLKPQARPVCGLHCVTSPSDGKILTFGQVKNSEVEQVKGVTYSLESFLGPRANT
FT                   EDLPFPPASSSDSFRNQLVTREGNELYHCVIYLAPGDYHCFHSPTDWTISHRRHFPGSL
FT                   MSVNPGMARWIKELFCHNERVVLTGDWKHGFFSLTAVGATNVGSIRIHFDRDLHTNSPR
FT                   YSKGSYNDLSFVTHANKEGIPMRKGEPLGEFNLGSTIVLIFEAPKDFNFRLKAGQKIRF
FT                   GEALGSL"
FT   CDS             complement(join(6530960..6531184,6531716..6531876,
FT                   6532118..6532264,6532512..6532650,6532867..6533103,
FT                   6534354..6534519,6535940..6535992,6558604..6558779,
FT                   6568216..6568286,6579998..6580062))
FT                   /codon_start=1
FT                   /locus_tag="mCG_2531"
FT                   /product="mCG2531, isoform CRA_a"
FT                   /note="gene_id=mCG2531.2 transcript_id=mCT1819.1
FT                   protein_id=mCP3897.3 isoform=CRA_a"
FT                   /protein_id="EDL37397.1"
FT                   /translation="MAASGGRACVRSLRGGVLWRSSPCHYESTATRHFLGTLQKLPLQA
FT                   GVRNFHTAPVRSLFLLRPVPILLATGGGYAGYRQYEKYRERKLEKLGLEIPPKLASHWE
FT                   MCQSEKQPGPELQAAAKWLYFPQLALRRRLGQLSCMSRPALKLRSWPLTILHYLLPFRA
FT                   LGPLSQVGWRPMSRVSLYKSVPTRLLSRACGRLNQVELPYWLRRPVYSLYIWTFGVNMT
FT                   EAAVEDLHHYRNLSEFFRRKLKPQARPVCGLHCVTSPSDGKILTFGQVKNSEVEQVKGV
FT                   TYSLESFLGPRANTEDLPFPPASSSDSFRNQLVTREGNELYHCVIYLAPGDYHCFHSPT
FT                   DWTISHRRHFPGSLMSVNPGMARWIKELFCHNERVVLTGDWKHGFFSLTAVGATNVGSI
FT                   RIHFDRDLHTNSPRYSKGSYNDLSFVTHANKEGIPMRKGEPLGEFNLGSTIVLIFEAPK
FT                   DFNFRLKAGQKIRFGEALGSL"
FT   CDS             complement(join(6530960..6531184,6531716..6531876,
FT                   6532118..6532264,6532512..6532650,6532867..6532974))
FT                   /codon_start=1
FT                   /locus_tag="mCG_2531"
FT                   /product="mCG2531, isoform CRA_h"
FT                   /note="gene_id=mCG2531.2 transcript_id=mCT185408.0
FT                   protein_id=mCP106666.0 isoform=CRA_h"
FT                   /db_xref="GOA:Q3TJ76"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR005221"
FT                   /db_xref="MGI:MGI:2445114"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TJ76"
FT                   /protein_id="EDL37404.1"
FT                   /translation="MTEAAVEDLHHYRNLSEFFRRKLKPQARPVCGLHCVTSPSDGKIL
FT                   TFGQVKNSEVEQVKGVTYSLESFLGPRANTEDLPFPPASSSDSFRNQLVTREGNELYHC
FT                   VIYLAPGDYHCFHSPTDWTISHRRHFPGSLMSVNPGMARWIKELFCHNERVVLTGDWKH
FT                   GFFSLTAVGATNVGSIRIHFDRDLHTNSPRYSKGSYNDLSFVTHANKEGIPMRKGEPLG
FT                   EFNLGSTIVLIFEAPKDFNFRLKAGQKIRFGEALGSL"
FT   mRNA            complement(join(6531577..6531876,6532118..6532264,
FT                   6532512..>6532806))
FT                   /locus_tag="mCG_2531"
FT                   /product="mCG2531, transcript variant mCT185409"
FT                   /note="gene_id=mCG2531.2 transcript_id=mCT185409.0 created
FT                   on 13-JUN-2003"
FT   CDS             complement(join(6531605..6531876,6532118..6532264,
FT                   6532512..>6532806))
FT                   /codon_start=1
FT                   /locus_tag="mCG_2531"
FT                   /product="mCG2531, isoform CRA_b"
FT                   /note="gene_id=mCG2531.2 transcript_id=mCT185409.0
FT                   protein_id=mCP106667.0 isoform=CRA_b"
FT                   /protein_id="EDL37398.1"
FT                   /translation="ARLSSTAWPWHSGRLPPDLDWSSLRTWQVVEFGEPLKVRTTPSLP
FT                   SKLCLLQTSPSDGKILTFGQVKNSEVEQVKGVTYSLESFLGPRANTEDLPFPPASSSDS
FT                   FRNQLVTREGNELYHCVIYLAPGDYHCFHSPTDWTISHRRHFPGSLMSVNPGMARWIKE
FT                   LFCHNERVVLTGDWKHGFFSLTAVGATNVGSIRIHFDRVSKAHRPNLLGPTTSFAVQPY
FT                   LWAYKFCGGGGGGMF"
FT   mRNA            complement(join(6531643..6532264,6532512..6532650,
FT                   6532867..6533103,6558604..6558779,6568216..6568286,
FT                   6579998..6580076))
FT                   /locus_tag="mCG_2531"
FT                   /product="mCG2531, transcript variant mCT185410"
FT                   /note="gene_id=mCG2531.2 transcript_id=mCT185410.0 created
FT                   on 13-JUN-2003"
FT   CDS             complement(join(6532095..6532264,6532512..6532650,
FT                   6532867..6533103,6558604..6558779,6568216..6568286,
FT                   6579998..6580062))
FT                   /codon_start=1
FT                   /locus_tag="mCG_2531"
FT                   /product="mCG2531, isoform CRA_c"
FT                   /note="gene_id=mCG2531.2 transcript_id=mCT185410.0
FT                   protein_id=mCP106669.0 isoform=CRA_c"
FT                   /protein_id="EDL37399.1"
FT                   /translation="MAASGGRACVRSLRGGVLWRSSPCHYESTATRHFLGTLQKLPLQA
FT                   GVRNFHTAPVRSLFLLRPVPILLATGGGYAGYRQYEKYRERKLEKLGLEIPPKLASHWE
FT                   VSLYKSVPTRLLSRACGRLNQVELPYWLRRPVYSLYIWTFGVNMTEAAVEDLHHYRNLS
FT                   EFFRRKLKPQARPVCGLHCVTSPSDGKILTFGQVKNSEVEQVKGVTYSLESFLGPRANT
FT                   EDLPFPPASSSDSFRNQLVTREGNELYHCVIYLAPGDYHCFHSPTDWTISHRRHFPGLP
FT                   RGGH"
FT   mRNA            complement(join(6532607..6533103,6534354..6534519,
FT                   6534775..6534862,6535940..6536205,6558604..6558779,
FT                   6568216..6568286,6579998..6580071))
FT                   /locus_tag="mCG_2531"
FT                   /product="mCG2531, transcript variant mCT185412"
FT                   /note="gene_id=mCG2531.2 transcript_id=mCT185412.0 created
FT                   on 13-JUN-2003"
FT   mRNA            complement(join(6532679..6533103,6534354..6534519,
FT                   6535940..6536205,6539199..6539412,6539943..6540072))
FT                   /locus_tag="mCG_2531"
FT                   /product="mCG2531, transcript variant mCT185411"
FT                   /note="gene_id=mCG2531.2 transcript_id=mCT185411.0 created
FT                   on 13-JUN-2003"
FT   CDS             complement(join(6532807..6533103,6534354..6534519,
FT                   6535940..6535992))
FT                   /codon_start=1
FT                   /locus_tag="mCG_2531"
FT                   /product="mCG2531, isoform CRA_d"
FT                   /note="gene_id=mCG2531.2 transcript_id=mCT185411.0
FT                   protein_id=mCP106668.0 isoform=CRA_d"
FT                   /protein_id="EDL37400.1"
FT                   /translation="MCQSEKQPGPELQAAAKWLYFPQLALRRRLGQLSCMSRPALKLRS
FT                   WPLTILHYLLPFRALGPLSQVGWRPMSRVSLYKSVPTRLLSRACGRLNQVELPYWLRRP
FT                   VYSLYIWTFGVNMTEAAVEDLHHYRNLSEFFRRKLKPQARPVCGLHCVVRPGPCLHSSL
FT                   GNEILVCL"
FT   CDS             complement(join(6532807..6533103,6534354..6534467))
FT                   /codon_start=1
FT                   /locus_tag="mCG_2531"
FT                   /product="mCG2531, isoform CRA_e"
FT                   /note="gene_id=mCG2531.2 transcript_id=mCT185412.0
FT                   protein_id=mCP106670.0 isoform=CRA_e"
FT                   /protein_id="EDL37401.1"
FT                   /translation="MSRPALKLRSWPLTILHYLLPFRALGPLSQVGWRPMSRVSLYKSV
FT                   PTRLLSRACGRLNQVELPYWLRRPVYSLYIWTFGVNMTEAAVEDLHHYRNLSEFFRRKL
FT                   KPQARPVCGLHCVVRPGPCLHSSLGNEILVCL"
FT   mRNA            complement(join(6558264..6558779,6568216..6568286,
FT                   6579998..6580075))
FT                   /locus_tag="mCG_2531"
FT                   /product="mCG2531, transcript variant mCT185413"
FT                   /note="gene_id=mCG2531.2 transcript_id=mCT185413.0 created
FT                   on 13-JUN-2003"
FT   CDS             complement(join(6558568..6558779,6568216..6568286,
FT                   6579998..6580062))
FT                   /codon_start=1
FT                   /locus_tag="mCG_2531"
FT                   /product="mCG2531, isoform CRA_f"
FT                   /note="gene_id=mCG2531.2 transcript_id=mCT185413.0
FT                   protein_id=mCP106671.0 isoform=CRA_f"
FT                   /protein_id="EDL37402.1"
FT                   /translation="MAASGGRACVRSLRGGVLWRSSPCHYESTATRHFLGTLQKLPLQA
FT                   GVRNFHTAPVRSLFLLRPVPILLATGGGYAGYRQYEKYRERKLEKLGLEIPPKLASHWE
FT                   VGLMSSHLRQL"
FT   gene            complement(6583280..>6648783)
FT                   /gene="C330019G07Rik"
FT                   /locus_tag="mCG_51681"
FT                   /note="gene_id=mCG51681.2"
FT   mRNA            complement(join(6583280..6588431,6590189..6590260,
FT                   6614433..6614539,6615160..6615331,6616634..6616705,
FT                   6621640..6621796,6622196..6622374,6638652..6638741,
FT                   6648643..>6648783))
FT                   /gene="C330019G07Rik"
FT                   /locus_tag="mCG_51681"
FT                   /product="RIKEN cDNA C330019G07"
FT                   /note="gene_id=mCG51681.2 transcript_id=mCT51864.2 created
FT                   on 02-OCT-2002"
FT   CDS             complement(join(6588131..6588431,6590189..6590260,
FT                   6614433..6614539,6615160..6615331,6616634..6616705,
FT                   6621640..6621796,6622196..6622374,6638652..>6638740))
FT                   /codon_start=1
FT                   /gene="C330019G07Rik"
FT                   /locus_tag="mCG_51681"
FT                   /product="RIKEN cDNA C330019G07"
FT                   /note="gene_id=mCG51681.2 transcript_id=mCT51864.2
FT                   protein_id=mCP27000.2"
FT                   /protein_id="EDL37405.1"
FT                   /translation="PKSMEPKVFRDQGDQAQVFRDPCEGAKEDPLTTATKPQELRCRRD
FT                   SSSLVPLAKNYKRLRYKKLLDGFSHNAMQLDPYLAATGWNRGSNTLCSPGCYRIWTKRR
FT                   NFSSNMPIMQRLFLTQFTQGLKGLRSPASIADKVFCSLHTTIPNVPLPGMGAAHTTNSS
FT                   HLRLEPVFPALVPKSCLVTEAAVSTLLLSASELAVPGCDELDGVSAACPRPQSSPAQQK
FT                   EAEPEKRPKKVSQIRIRKTIPKPDPNLTPMGLPRPKRLKKKEFSLEEIYTNKNYKSPPA
FT                   SRCLETIFEEPKERNGTLISISQQKRKRVLEFQDFTVPRKRRARGKVKLAGSFTRAQKA
FT                   ALQTQELDALLIQKLMELETFFAKEGEQEHQPAAENSSGSPL"
FT   gene            6658317..6802032
FT                   /gene="Depdc5"
FT                   /locus_tag="mCG_141233"
FT                   /note="gene_id=mCG141233.0"
FT   mRNA            join(6658317..6658370,6659126..6659248,6662521..6662608,
FT                   6663368..6663414,6669826..6669915,6671615..6671697,
FT                   6673172..6673221,6681527..6681596,6687927..6688005,
FT                   6690463..6690524,6692462..6692531,6693575..6693647,
FT                   6696037..6696140,6696411..6696485,6698370..6698504,
FT                   6698868..6698929,6699052..6699125,6705064..6705133,
FT                   6706816..6706852,6707707..6707827,6712531..6712751,
FT                   6718768..6718971,6722154..6722289,6723109..6723203,
FT                   6729248..6729313,6732854..6733010,6733451..6733611,
FT                   6738536..6738653,6739275..6739442,6740226..6740445,
FT                   6742529..6742662,6764428..6764533,6772951..6773102,
FT                   6775936..6776013,6776836..6776968,6781793..6781901,
FT                   6783261..6783488,6787321..6787490,6791650..6791821,
FT                   6794728..6794788,6798536..6798618,6798739..6802032)
FT                   /gene="Depdc5"
FT                   /locus_tag="mCG_141233"
FT                   /product="DEP domain containing 5"
FT                   /note="gene_id=mCG141233.0 transcript_id=mCT174000.0
FT                   created on 29-OCT-2002"
FT   CDS             join(6659191..6659248,6662521..6662608,6663368..6663414,
FT                   6669826..6669915,6671615..6671697,6673172..6673221,
FT                   6681527..6681596,6687927..6688005,6690463..6690524,
FT                   6692462..6692531,6693575..6693647,6696037..6696140,
FT                   6696411..6696485,6698370..6698504,6698868..6698929,
FT                   6699052..6699125,6705064..6705133,6706816..6706852,
FT                   6707707..6707827,6712531..6712751,6718768..6718971,
FT                   6722154..6722289,6723109..6723203,6729248..6729313,
FT                   6732854..6733010,6733451..6733611,6738536..6738653,
FT                   6739275..6739442,6740226..6740445,6742529..6742662,
FT                   6764428..6764533,6772951..6773102,6775936..6776013,
FT                   6776836..6776968,6781793..6781901,6783261..6783488,
FT                   6787321..6787490,6791650..6791821,6794728..6794788,
FT                   6798536..6798618,6798739..6799031)
FT                   /codon_start=1
FT                   /gene="Depdc5"
FT                   /locus_tag="mCG_141233"
FT                   /product="DEP domain containing 5"
FT                   /note="gene_id=mCG141233.0 transcript_id=mCT174000.0
FT                   protein_id=mCP96919.0"
FT                   /protein_id="EDL37406.1"
FT                   /translation="MRTTKVYKLVIHKKGFGGSDDELVVNPKVFPHIKLGDIVEIAHPN
FT                   DEYSPLLLQVKSLKEDLQKETISVDQTVTQVFRLRPYQDVYVNVVDPKANVTLDLVELT
FT                   FKDQYIGRGDMWRLKKSLVSTCAYITQKVEFAGIRAQAGELWVKNEKVMCGYISEETRV
FT                   VFRSTSAMVYIFIQMSCEMWDFDIYGDLYFEKAVNGFLADLFTKWKEKNCSHEVTVVLF
FT                   SRTFYDAKSIDEFPEINRASIQEDHKGRFYEDFYKVVVQNERREEWTSLLVTIKKLFIQ
FT                   YPVLVRLEQAGGFPQGDNSTSAQGNYLEAINLSFNVFDKHYINRNFDRTGQMSVVITPG
FT                   VGVFEVDRLLMILTKQRMIDNGIGVDLVCMGEQPLHAVPLFKLHNRSVPRDSRLGDDYN
FT                   IPHWINHSFYTSKSQLFCNSFTPRIKLAGKKSASEKTKNGRDTSLGTPKESENTLPIQV
FT                   DYDAYDAQVFRLPGPSRAQRLATCRSVREQENHSRKSASSCDVSSSPSLPSRALPTEEV
FT                   RSQASDDSSLGKSTNILMIPNPHLHQYEVSSSLGYTSTRDVLENMIEPPQRDSSAPGRF
FT                   HVGSAESMLHVRPGGYTPQRALINPFAPSRMPMKLTSNRRRWMHTFPVGPSGEAIQIHH
FT                   QTRQNMAELQGSRQRDPTHSSAELLELAYHEAAGRHSTSRQPGDSMSLNFSGTEELSVS
FT                   LLSNSSTGVNPRTQNKDSLEDSVSTSPDPMPGFCCTVGVDWKSLTTPACLPLTTDYFPD
FT                   RQGLQNDYTEGCYDLLPEADMDRRDEEGVQMTAQQVFEEFICQRLMQGYQIIVQPKTQK
FT                   PNTTVPPPLSSSPLYSRGLVSRNRPEEEGQYWLSMGRTFHKVTLKDKMITVTRYLPKYP
FT                   YESAQIHYTYSLCPSHSDSEFVSCWVDFCHERLEEYKWNYLDQYICSAGSEDFSLIESL
FT                   KFWRTRFLLLPACVTATKRITEGEVHCDIYGDKPRADEDEWQLLDGFIRFVEGLNRIRR
FT                   RHRSDRMIRKGTAMKGLQMTGPISAHSLESTGPPVGKKGTSALSALLEMEASQKSLGEQ
FT                   QTTVHGKSSTQPAENSSVAMTPTYVDSPRKASVDQTAPLVLDSTSLGVSTGQPMDRGNN
FT                   QTFGNSQNIEQAFPSANSGDYSSQQHVASSLTSSSTLVEILEAMKHPSTGVQLLSEQKG
FT                   LSPCCFISAEVVHWLMNNVEGVQTQAMGIDIMQKMLEEQLITHASGEAWRTFIYGFYFY
FT                   KIVMDKEPERVAMQQPSAPWYTAGADDFASFQRKWFEVAFVAEELVHSEIPAFLLPWLP
FT                   SRPASYASRHSSFSRSFGGRSQAAALLAATVPEQRTVTLDVDVNNRTDRLEWCSCYYHG
FT                   NFSLNAAFEIKLHWMAVTATVLFEMVQGWHRKATSCGFLLVPVLEGPFALPSYLYGDPL
FT                   RAQLFIPLNLSCLLKEGSEHLFDSFEPETYWDRMHLFQEAIAHRFGFVQDKYSVSAFNF
FT                   PAENKPQYIHVTGTVFLQLPYSKRKFSGQQRRRRNSTSSTNQNMFCEERVGYNWAYNTM
FT                   LTKTWRSSATGDEKFADRLLKDFTDFCINRDNRLVTFWTNCLEKMHASAP"
FT   gene            6792361..6793609
FT                   /locus_tag="mCG_148297"
FT                   /note="gene_id=mCG148297.0"
FT   mRNA            6792361..6793609
FT                   /locus_tag="mCG_148297"
FT                   /product="mCG148297"
FT                   /note="gene_id=mCG148297.0 transcript_id=mCT188560.0
FT                   created on 13-JAN-2004"
FT   CDS             6792441..6792890
FT                   /codon_start=1
FT                   /locus_tag="mCG_148297"
FT                   /product="mCG148297"
FT                   /note="gene_id=mCG148297.0 transcript_id=mCT188560.0
FT                   protein_id=mCP109211.0"
FT                   /protein_id="EDL37407.1"
FT                   /translation="MLLSFELLLHGLARATLPALQGQCEANSGWERGLFAVHLYTIAVS
FT                   CVLPATCSACLNLRRAFCMLVPRKTIKSKTGSGVLLCKVVAGFVSPRLPVCVSRAVSQV
FT                   RALPSVRKGLSQQTTPMCLLLTPSPHLHLPLLSPSTHADEFINSS"
FT   gene            6826619..6835696
FT                   /gene="Ywhah"
FT                   /locus_tag="mCG_2700"
FT                   /note="gene_id=mCG2700.1"
FT   mRNA            join(6826619..6826885,6834272..6835696)
FT                   /gene="Ywhah"
FT                   /locus_tag="mCG_2700"
FT                   /product="tyrosine 3-monooxygenase/tryptophan
FT                   5-monooxygenase activation protein, eta polypeptide"
FT                   /note="gene_id=mCG2700.1 transcript_id=mCT1824.1 created on
FT                   17-SEP-2002"
FT   CDS             join(6826799..6826885,6834272..6834925)
FT                   /codon_start=1
FT                   /gene="Ywhah"
FT                   /locus_tag="mCG_2700"
FT                   /product="tyrosine 3-monooxygenase/tryptophan
FT                   5-monooxygenase activation protein, eta polypeptide"
FT                   /note="gene_id=mCG2700.1 transcript_id=mCT1824.1
FT                   protein_id=mCP3894.2"
FT                   /protein_id="EDL37408.1"
FT                   /translation="MGDREQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLL
FT                   SVAYKNVVGARRSSWRVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLALL
FT                   DKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKE
FT                   HMQPTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQAFDDAIAELDTLNEDSYKDSTLI
FT                   MQLLRDNLTLWTSDQQDEEAGEGN"
FT   gene            6883733..6884181
FT                   /locus_tag="mCG_121795"
FT                   /note="gene_id=mCG121795.1"
FT   mRNA            6883733..6884181
FT                   /locus_tag="mCG_121795"
FT                   /product="mCG121795"
FT                   /note="gene_id=mCG121795.1 transcript_id=mCT123007.1
FT                   created on 02-OCT-2002"
FT   CDS             6883791..6884123
FT                   /codon_start=1
FT                   /locus_tag="mCG_121795"
FT                   /product="mCG121795"
FT                   /note="gene_id=mCG121795.1 transcript_id=mCT123007.1
FT                   protein_id=mCP64918.1"
FT                   /db_xref="GOA:Q6ZWX1"
FT                   /db_xref="InterPro:IPR001780"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR018266"
FT                   /db_xref="MGI:MGI:1928894"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ZWX1"
FT                   /protein_id="EDL37409.1"
FT                   /translation="MSGRLWCKAIFAGYKRGLRNQREHTALLKIEGVYARDETEFYLGK
FT                   RCAYVYKAKNNTVTPGGKPNKTRVIWGKVTRAHGNSGMVRAKFRSNLPAKAIGHRIRVM
FT                   LYPSRI"
FT   gene            6912004..6969094
FT                   /gene="Slc5a1"
FT                   /locus_tag="mCG_2536"
FT                   /note="gene_id=mCG2536.2"
FT   mRNA            join(6912004..6912364,6939183..6939280,6940615..6940674,
FT                   6941814..6941918,6951212..6951317,6952496..6952576,
FT                   6953754..6953974,6954190..6954325,6956192..6956299,
FT                   6959852..6960002,6961639..6961807,6965329..6965544,
FT                   6966318..6966426,6968020..6969094)
FT                   /gene="Slc5a1"
FT                   /locus_tag="mCG_2536"
FT                   /product="solute carrier family 5 (sodium/glucose
FT                   cotransporter), member 1"
FT                   /note="gene_id=mCG2536.2 transcript_id=mCT1812.2 created on
FT                   17-SEP-2002"
FT   CDS             join(6912229..6912364,6939183..6939280,6940615..6940674,
FT                   6941814..6941918,6951212..6951317,6952496..6952576,
FT                   6953754..6953974,6954190..6954325,6956192..6956299,
FT                   6959852..6960002,6961639..6961807,6965329..6965544,
FT                   6966318..6966426,6968020..6968243)
FT                   /codon_start=1
FT                   /gene="Slc5a1"
FT                   /locus_tag="mCG_2536"
FT                   /product="solute carrier family 5 (sodium/glucose
FT                   cotransporter), member 1"
FT                   /note="gene_id=mCG2536.2 transcript_id=mCT1812.2
FT                   protein_id=mCP3966.2"
FT                   /protein_id="EDL37410.1"
FT                   /translation="MDSSTLSPAVTATDAPIPSYERIRNAADISVIVIYFVVVMAVGLW
FT                   ASLFASNIGSGHFVGLAGTGAAAGIAMGGFEWNALVLVVVLGWIFVPIYIKAGVVTMPE
FT                   YLRKRFGGKRIQIYLSVLSLLLYIFTKISADIFSGAIFINLALGLDIYLAIFILLAITA
FT                   LYTITGGLAAVIYTDTLQTAIMLVGSFILTGFAFNEVGGYEAFMDKYMKAIPTKVSNGN
FT                   FTAKEECYTPRADSFHIFRDPITGDMPWPGLIFGLAILALWYWCTDQVIVQRCLSAKNM
FT                   SHVKAGCTLCGYLKLLPMFLMVMPGMISRILYTEKIACVLPEECQKYCGTPVGCTNIAY
FT                   PTLVVELMPNGLRGLMLSVMMASLMSSLTSIFNSASTLFTMDIYTKIRKKASEKELMIA
FT                   GRLFILVLIGISIAWVPIVQSAQSGQLFDYIQSITSYLGPPIAAVFLLAIFCKRVNEQG
FT                   AFWGLILGFLIGISRMITEFAYGTGSCMEPSNCPKIICGVHYLYFAIILFVISVITILI
FT                   ISFLTKPIPDVHLYRLCWSLRNSKEERIDLDAGEEEDIPEDSKDTIEIDTEAPQKKKGC
FT                   FRRAYDLFCGLDQDKGPKMTKEEEEAMKMKMTDTSEKPLWRTVVNINGIILLAVAVFCH
FT                   AYFA"
FT   gene            6990940..6991384
FT                   /pseudo
FT                   /locus_tag="mCG_1046057"
FT                   /note="gene_id=mCG1046057.1"
FT   mRNA            6990940..6991384
FT                   /pseudo
FT                   /locus_tag="mCG_1046057"
FT                   /note="gene_id=mCG1046057.1 transcript_id=mCT163761.1
FT                   created on 14-OCT-2002"
FT   gene            complement(7023903..7028603)
FT                   /gene="Spon2"
FT                   /locus_tag="mCG_2535"
FT                   /note="gene_id=mCG2535.1"
FT   mRNA            complement(join(7023903..7025038,7025935..7026109,
FT                   7026716..7026907,7026980..7027203,7027627..7027846,
FT                   7028331..7028603))
FT                   /gene="Spon2"
FT                   /locus_tag="mCG_2535"
FT                   /product="spondin 2, extracellular matrix protein,
FT                   transcript variant mCT1814"
FT                   /note="gene_id=mCG2535.1 transcript_id=mCT1814.1 created on
FT                   17-SEP-2002"
FT   mRNA            complement(join(7024320..7025038,7025935..7026109,
FT                   7026716..7027203,7027627..7027846,7028331..>7028570))
FT                   /gene="Spon2"
FT                   /locus_tag="mCG_2535"
FT                   /product="spondin 2, extracellular matrix protein,
FT                   transcript variant mCT193587"
FT                   /note="gene_id=mCG2535.1 transcript_id=mCT193587.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(7024854..7025038,7025935..7026109,
FT                   7026716..7026907,7026980..7027203,7027627..7027843))
FT                   /codon_start=1
FT                   /gene="Spon2"
FT                   /locus_tag="mCG_2535"
FT                   /product="spondin 2, extracellular matrix protein, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG2535.1 transcript_id=mCT1814.1
FT                   protein_id=mCP3940.1 isoform=CRA_c"
FT                   /protein_id="EDL37413.1"
FT                   /translation="MENVSLALGRALWVFLLAMIGSTTSQPLGGESVCTARPLARYSIT
FT                   FIGKWSQTAFPKQYPLFRPPAQWSSLLGAAHSSDYSMWRKNEYVSNGLRDFAERGEAWA
FT                   LMKEIEAAGEKLQSVHAVFSAPAIPSGTGQTSTELEVHPRHSLVSFVVRIVPSPDWFVG
FT                   IDSLDLCEGGRWKEQVVLDLYPHDAGTDSGFTFSSPNFATIPQDTVTEITASSPSHPAN
FT                   SFYYPRLKSLPPIAKVTFVRLQQSPRAFAPPSLDLASRGNEIVDSLSVPETPLDCEVSL
FT                   WSSWGLCGGPCGKLGAKSRTRYVRVQPANNGTPCPELEEEAECAPDNCV"
FT   CDS             complement(join(7024854..7025038,7025935..7026109,
FT                   7026716..>7026964))
FT                   /codon_start=1
FT                   /gene="Spon2"
FT                   /locus_tag="mCG_2535"
FT                   /product="spondin 2, extracellular matrix protein, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG2535.1 transcript_id=mCT193587.0
FT                   protein_id=mCP114593.0 isoform=CRA_b"
FT                   /protein_id="EDL37412.1"
FT                   /translation="PGRGYVPMAAAAKSSGPIQVSFVVRIVPSPDWFVGIDSLDLCEGG
FT                   RWKEQVVLDLYPHDAGTDSGFTFSSPNFATIPQDTVTEITASSPSHPANSFYYPRLKSL
FT                   PPIAKVTFVRLQQSPRAFAPPSLDLASRGNEIVDSLSVPETPLDCEVSLWSSWGLCGGP
FT                   CGKLGAKSRTRYVRVQPANNGTPCPELEEEAECAPDNCV"
FT   mRNA            complement(join(<7027122..7027203,7027627..7027846,
FT                   7027956..7028043,7028331..7028526))
FT                   /gene="Spon2"
FT                   /locus_tag="mCG_2535"
FT                   /product="spondin 2, extracellular matrix protein,
FT                   transcript variant mCT173413"
FT                   /note="gene_id=mCG2535.1 transcript_id=mCT173413.0 created
FT                   on 17-SEP-2002"
FT   CDS             complement(join(<7027122..7027203,7027627..7027843))
FT                   /codon_start=1
FT                   /gene="Spon2"
FT                   /locus_tag="mCG_2535"
FT                   /product="spondin 2, extracellular matrix protein, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG2535.1 transcript_id=mCT173413.0
FT                   protein_id=mCP96332.0 isoform=CRA_a"
FT                   /protein_id="EDL37411.1"
FT                   /translation="MENVSLALGRALWVFLLAMIGSTTSQPLGGESVCTARPLARYSIT
FT                   FIGKWSQTAFPKQYPLFRPPAQWSSLLGAAHSSDYSMWRKNEYVSNGLRDFAERG"
FT   gene            complement(7058210..7080117)
FT                   /gene="Ctbp1"
FT                   /locus_tag="mCG_2534"
FT                   /note="gene_id=mCG2534.2"
FT   mRNA            complement(join(7058210..7059172,7059593..7059710,
FT                   7060073..7060200,7060857..7060987,7061344..7061558,
FT                   7069619..7069825,7071490..7071634,7077364..7077518,
FT                   7079924..7080117))
FT                   /gene="Ctbp1"
FT                   /locus_tag="mCG_2534"
FT                   /product="C-terminal binding protein 1, transcript variant
FT                   mCT1813"
FT                   /note="gene_id=mCG2534.2 transcript_id=mCT1813.2 created on
FT                   18-FEB-2003"
FT   mRNA            complement(join(7058213..7059169,7059593..7059710,
FT                   7060073..7060200,7060857..7060987,7061344..7061558,
FT                   7069619..7069825,7071490..7071634,7077364..>7077522))
FT                   /gene="Ctbp1"
FT                   /locus_tag="mCG_2534"
FT                   /product="C-terminal binding protein 1, transcript variant
FT                   mCT193586"
FT                   /note="gene_id=mCG2534.2 transcript_id=mCT193586.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(7058986..7059172,7059593..7059710,
FT                   7060073..7060200,7060857..7060987,7061344..7061558,
FT                   7069619..7069825,7071490..7071634,7077364..7077518,
FT                   7079924..7079930))
FT                   /codon_start=1
FT                   /gene="Ctbp1"
FT                   /locus_tag="mCG_2534"
FT                   /product="C-terminal binding protein 1, isoform CRA_b"
FT                   /note="gene_id=mCG2534.2 transcript_id=mCT1813.2
FT                   protein_id=mCP3953.2 isoform=CRA_b"
FT                   /protein_id="EDL37415.1"
FT                   /translation="MSGVRPPIMNGPMHPRPLVALLDGRDCTVEMPILKDVATVAFCDA
FT                   QSTQEIHEKVLNEAVGALMYHTITLTREDLEKFKALRIIVRIGSGFDNIDIKSAGDLGI
FT                   AVCNVPAASVEETADSTLCHILNLYRRTTWLHQALREGTRVQSVEQIREVASGAARIRG
FT                   ETLGIIGLGRVGQAVALRAKAFGFNVLFYDPYLSDGIERALGLQRVSTLQDLLFHSDCV
FT                   TLHCGLNEHNHHLINDFTVKQMRQGAFLVNTARGGLVDEKALAQALKEGRIRGAALDVH
FT                   ESEPFSFSQGPLKDAPNLICTPHAAWYSEQASIEMREEAAREIRRAITGRIPDSLKNCV
FT                   NKDHLTAATHWASMDPAVVHPELNGAAYSRYPPGVVSVAPTGIPAAVEGIVPSAMSLSH
FT                   GLPPVAHPPHAPSPGQTVKPEADRDHTSDQL"
FT   CDS             complement(join(7058986..7059169,7059593..7059710,
FT                   7060073..7060200,7060857..7060987,7061344..7061558,
FT                   7069619..7069825,7071490..7071634,7077364..>7077522))
FT                   /codon_start=1
FT                   /gene="Ctbp1"
FT                   /locus_tag="mCG_2534"
FT                   /product="C-terminal binding protein 1, isoform CRA_c"
FT                   /note="gene_id=mCG2534.2 transcript_id=mCT193586.0
FT                   protein_id=mCP114592.0 isoform=CRA_c"
FT                   /protein_id="EDL37416.1"
FT                   /translation="AGVRPPIMNGPMHPRPLVALLDGRDCTVEMPILKDVATVAFCDAQ
FT                   STQEIHEKVLNEAVGALMYHTITLTREDLEKFKALRIIVRIGSGFDNIDIKSAGDLGIA
FT                   VCNVPAASVEETADSTLCHILNLYRRTTWLHQALREGTRVQSVEQIREVASGAARIRGE
FT                   TLGIIGLGRVGQAVALRAKAFGFNVLFYDPYLSDGIERALGLQRVSTLQDLLFHSDCVT
FT                   LHCGLNEHNHHLINDFTVKQMRQGAFLVNTARGGLVDEKALAQALKEGRIRGAALDVHE
FT                   SEPFSFSQGPLKDAPNLICTPHAAWYSEQASIEMREEAAREIRRAITGRIPDSLKNCVN
FT                   KDHLTAATHWASMDPAVVHPELNGAAYRYPPGVVSVAPTGIPAAVEGIVPSAMSLSHGL
FT                   PPVAHPPHAPSPGQTVKPEADRDHTSDQL"
FT   mRNA            complement(join(7060869..7060987,7061344..7061558,
FT                   7069619..7069825,7077364..7077518,7079924..7080017))
FT                   /gene="Ctbp1"
FT                   /locus_tag="mCG_2534"
FT                   /product="C-terminal binding protein 1, transcript variant
FT                   mCT180272"
FT                   /note="gene_id=mCG2534.2 transcript_id=mCT180272.0 created
FT                   on 18-FEB-2003"
FT   CDS             complement(join(7069754..7069825,7077364..7077518,
FT                   7079924..7079930))
FT                   /codon_start=1
FT                   /gene="Ctbp1"
FT                   /locus_tag="mCG_2534"
FT                   /product="C-terminal binding protein 1, isoform CRA_a"
FT                   /note="gene_id=mCG2534.2 transcript_id=mCT180272.0
FT                   protein_id=mCP103194.0 isoform=CRA_a"
FT                   /protein_id="EDL37414.1"
FT                   /translation="MSGVRPPIMNGPMHPRPLVALLDGRDCTVEMPILKDVATVAFCDA
FT                   QSTQEIHEKASQCAMCRQHLWKKRQTPPCATS"
FT   gene            7146115..7183854
FT                   /gene="Maea"
FT                   /locus_tag="mCG_2530"
FT                   /note="gene_id=mCG2530.2"
FT   mRNA            join(7146115..7146198,7169014..7169196,7170926..7171129,
FT                   7173269..7173391,7176296..7176372,7179212..7179320,
FT                   7181005..7181138,7182188..7182383,7182841..7183854)
FT                   /gene="Maea"
FT                   /locus_tag="mCG_2530"
FT                   /product="macrophage erythroblast attacher"
FT                   /note="gene_id=mCG2530.2 transcript_id=mCT1818.1 created on
FT                   17-SEP-2002"
FT   CDS             join(7146163..7146198,7169014..7169196,7170926..7171129,
FT                   7173269..7173391,7176296..7176372,7179212..7179320,
FT                   7181005..7181138,7182188..7182383,7182841..7182936)
FT                   /codon_start=1
FT                   /gene="Maea"
FT                   /locus_tag="mCG_2530"
FT                   /product="macrophage erythroblast attacher"
FT                   /note="gene_id=mCG2530.2 transcript_id=mCT1818.1
FT                   protein_id=mCP3930.0"
FT                   /protein_id="EDL37417.1"
FT                   /translation="MTLKVQEYPTLKVPYETLNKRFRAAQKNIDRETSHVTMVVAELEK
FT                   TLSSCPAVDSVVSLLDGVVEKLSVLKRKAVESIQAEDESAKLCKRRIEHLKEHSSDQPA
FT                   AASMWKRKRMDRMMVEHLLRCGYYNTAVKLARQSGIEDLVNIEMFLTAKEVEESLERRE
FT                   TATCLAWCHDNKSRLRKMKSCLEFSLRIQEFIELVRQNKRLDAVRHARKHFSQAEGSQL
FT                   DEVRQVMGMLAFPPDTHISPYKDLLDPARWRMLIQQFRYDNYRLHQLGNSSVFTLTLQA
FT                   GLSAIKTPQCYKEDGSSKSPDCPVCSRSLNKLAQPLPMAHCANSRLVCKISGDVMNENN
FT                   PPMMLPNGYVYGYNSLLSIRQDDKVVCPRTKEVFHFSQAEKVYIM"
FT   gene            <7189123..7225376
FT                   /locus_tag="mCG_2528"
FT                   /note="gene_id=mCG2528.3"
FT   mRNA            join(<7189123..7189899,7198128..7198458,7199188..7199308,
FT                   7200114..7200509,7202214..7202326,7202526..7202654,
FT                   7212962..7213067,7219277..7219448,7219895..7220987)
FT                   /locus_tag="mCG_2528"
FT                   /product="mCG2528, transcript variant mCT193558"
FT                   /note="gene_id=mCG2528.3 transcript_id=mCT193558.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(7189129..7189576,7189800..7189899,7198128..7198458,
FT                   7199188..7199308,7200114..7200509,7202214..7202326,
FT                   7202526..7202654,7212962..7213067,7219277..7219448,
FT                   7219895..7220017,7221327..7221510,7222029..7222140,
FT                   7224367..7224541,7225266..7225376)
FT                   /locus_tag="mCG_2528"
FT                   /product="mCG2528, transcript variant mCT1821"
FT                   /note="gene_id=mCG2528.3 transcript_id=mCT1821.2 created on
FT                   25-SEP-2002"
FT   CDS             join(<7189706..7189899,7198128..7198458,7199188..7199308,
FT                   7200114..7200509,7202214..7202326,7202526..7202654,
FT                   7212962..7213067,7219277..7219448,7219895..7220021)
FT                   /codon_start=1
FT                   /locus_tag="mCG_2528"
FT                   /product="mCG2528, isoform CRA_b"
FT                   /note="gene_id=mCG2528.3 transcript_id=mCT193558.0
FT                   protein_id=mCP114547.0 isoform=CRA_b"
FT                   /protein_id="EDL37419.1"
FT                   /translation="SPVFGVPHKLKTKTVKYLLYVNSASPRPLFLDMDQKLSQLIEELT
FT                   TSGESQLNAQKMKELKKICKSSEEQLSHAYRLLITQLTQGHAEIRLSAFQIVDELFTRS
FT                   HQFRMLLVSDFQEFLELTLGTDSDRPLPPPREAAQRLRQAAMQAVEGWNEKFGQAYKKL
FT                   ALGYHFLKHTKKVDFRDINVRTVAERKREEEKQKHLDKIHRESADRAKREMEEMYDEIE
FT                   CCLTEVENCFKLLVPLDFVPCPEDKFFGEASSMTEGYAPCPLSPDLATPRESGLSGPQD
FT                   EEQPCCSKDLVASAYHVGSVVGLKALPQTAMKDSSRDEDEPSDPDDFLRSHGLGSHKYT
FT                   LDVEVPSDGLKVQENEDNLAVLHAARDSLKLIQNKFLPTVCSWVQRFTRAGTYSAHLKQ
FT                   AIDLKMELELALKKYEELNIEPGRGQRSRTEALEDSEDEDQDFVEVPEKEGYEPRIPDH
FT                   LRAEYGLEPKAPLKTLEKGTAVCKLQERTRMRREEEASDPTSAAAQMLRLQDCLSSPSP
FT                   SSTRVLPGPEEAQKQAERARAPIVPFGVDLCYWGQEQLTAGKILK"
FT   CDS             join(7189802..7189899,7198128..7198458,7199188..7199308,
FT                   7200114..7200509,7202214..7202326,7202526..7202654,
FT                   7212962..7213067,7219277..7219448,7219895..7220017,
FT                   7221327..7221510,7222029..7222140,7224367..7224541,
FT                   7225266..7225359)
FT                   /codon_start=1
FT                   /locus_tag="mCG_2528"
FT                   /product="mCG2528, isoform CRA_a"
FT                   /note="gene_id=mCG2528.3 transcript_id=mCT1821.2
FT                   protein_id=mCP4008.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q9D479"
FT                   /db_xref="InterPro:IPR008942"
FT                   /db_xref="InterPro:IPR018610"
FT                   /db_xref="MGI:MGI:1918351"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9D479"
FT                   /protein_id="EDL37418.1"
FT                   /translation="MDQKLSQLIEELTTSGESQLNAQKMKELKKICKSSEEQLSHAYRL
FT                   LITQLTQGHAEIRLSAFQIVDELFTRSHQFRMLLVSDFQEFLELTLGTDSDRPLPPPRE
FT                   AAQRLRQAAMQAVEGWNEKFGQAYKKLALGYHFLKHTKKVDFRDINVRTVAERKREEEK
FT                   QKHLDKIHRESADRAKREMEEMYDEIECCLTEVENCFKLLVPLDFVPCPEDKFFGEASS
FT                   MTEGYAPCPLSPDLATPRESGLSGPQDEEQPCCSKDLVASAYHVGSVVGLKALPQTAMK
FT                   DSSRDEDEPSDPDDFLRSHGLGSHKYTLDVEVPSDGLKVQENEDNLAVLHAARDSLKLI
FT                   QNKFLPTVCSWVQRFTRAGTYSAHLKQAIDLKMELELALKKYEELNIEPGRGQRSRTEA
FT                   LEDSEDEDQDFVEVPEKEGYEPRIPDHLRAEYGLEPKAPLKTLEKGTAVCKLQERTRMR
FT                   REEEASDPTSAAAQMLRLQDCLSSPSPSSTRVLPGPEEAQKQAERARAPIVPFGVDLCY
FT                   WGQEQLTAGKILKSDSQHRFWKPSEVEEEVDSAHVSEMLHSRHITFSGTFEPVQHKCRA
FT                   LRPNGRLCERQDRLKCPFHGKIIPRDDKGQPLNPEDRAREQRQQLQRQQAHPDWQDPEF
FT                   LKDVEAATGVDLGSSRSSKKGKGKKKKHPNLTDLRERTNTARARLEKKVFAKAAVQRVV
FT                   AAMNQMDQKKHEKFANQFNYALK"
FT   gene            complement(7241167..7242300)
FT                   /pseudo
FT                   /locus_tag="mCG_122510"
FT                   /note="gene_id=mCG122510.1"
FT   mRNA            complement(7241167..7242300)
FT                   /pseudo
FT                   /locus_tag="mCG_122510"
FT                   /note="gene_id=mCG122510.1 transcript_id=mCT123715.1
FT                   created on 02-OCT-2002"
FT   gene            complement(7407777..7437045)
FT                   /gene="2410018C17Rik"
FT                   /locus_tag="mCG_122502"
FT                   /note="gene_id=mCG122502.0"
FT   mRNA            complement(join(7407777..7408306,7414890..7415653,
FT                   7417858..7417912,7422029..7422156,7436268..7436358,
FT                   7436857..7437045))
FT                   /gene="2410018C17Rik"
FT                   /locus_tag="mCG_122502"
FT                   /product="RIKEN cDNA 2410018C17, transcript variant
FT                   mCT123703"
FT                   /note="gene_id=mCG122502.0 transcript_id=mCT123703.1
FT                   created on 13-FEB-2003"
FT   mRNA            complement(join(7407780..7408306,7414890..7415653,
FT                   7417858..7417912,7422029..7422260,7436272..7436396,
FT                   7436756..>7436992))
FT                   /gene="2410018C17Rik"
FT                   /locus_tag="mCG_122502"
FT                   /product="RIKEN cDNA 2410018C17, transcript variant
FT                   mCT180110"
FT                   /note="gene_id=mCG122502.0 transcript_id=mCT180110.0
FT                   created on 13-FEB-2003"
FT   mRNA            complement(join(7407782..7408306,7414890..7415653,
FT                   7417858..7417912,7422029..7422260,7436272..>7437043))
FT                   /gene="2410018C17Rik"
FT                   /locus_tag="mCG_122502"
FT                   /product="RIKEN cDNA 2410018C17, transcript variant
FT                   mCT180109"
FT                   /note="gene_id=mCG122502.0 transcript_id=mCT180109.0
FT                   created on 13-FEB-2003"
FT   CDS             complement(join(7407995..7408306,7414890..7415653,
FT                   7417858..7417912,7422029..7422156,7436268..7436358,
FT                   7436857..7437018))
FT                   /codon_start=1
FT                   /gene="2410018C17Rik"
FT                   /locus_tag="mCG_122502"
FT                   /product="RIKEN cDNA 2410018C17, isoform CRA_a"
FT                   /note="gene_id=mCG122502.0 transcript_id=mCT123703.1
FT                   protein_id=mCP64732.1 isoform=CRA_a"
FT                   /protein_id="EDL37420.1"
FT                   /translation="MRGARPARPAPCPSYGARCSLASRRVLCAVVRLLIAKSSSHRNAV
FT                   SLRCDPGVSGIPRADPPQRPVEGDLEVYSEATFLRRLRVLFWKSSAHRCGLRKSPAMVT
FT                   LITEKLQNQSLDDLTRRACEAGPYSAEKLNKSGHLFPLEISVDKSPWKALRGGWPTGSQ
FT                   AASGPFSVGPHGVSHTEGLKWQLESPGPMDVGHFLDLHDSTGPPAAPPTKRHCRSLSEP
FT                   EELARCRSPWRPGSSKVWTPISKRRCNSGGSATLQCCSGVGNPTLQGTLVPGLPRRPVS
FT                   PAGPTSPLTPRPASASSGFVDGSEGSTSSGPPWLSTGPCPFSSRRRLSLSQEHLVDTGA
FT                   CLPSASSTPTSTPELGRHHGLLRCRSQPCVLDGRRVRRKRRREEDARWTRPSLDFLKMT
FT                   RTLKNSKSLCSLDYEDDEDDTQEKTLVSSPCNSQGLVGIITPSSSPRIPRPGPDSPSVW
FT                   ASGEPEASPGEGGSSGDPSDWDSAGEEGIFPLDHGDLDLEQIENN"
FT   CDS             complement(join(7407995..7408306,7414890..7415653,
FT                   7417858..7417912,7422029..>7422163))
FT                   /codon_start=1
FT                   /gene="2410018C17Rik"
FT                   /locus_tag="mCG_122502"
FT                   /product="RIKEN cDNA 2410018C17, isoform CRA_b"
FT                   /note="gene_id=mCG122502.0 transcript_id=mCT180110.0
FT                   protein_id=mCP103031.0 isoform=CRA_b"
FT                   /protein_id="EDL37421.1"
FT                   /translation="CPVFWKSSAHRCGLRKSPAMVTLITEKLQNQSLDDLTRRACEAGP
FT                   YSAEKLNKSGHLFPLEISVDKSPWKALRGGWPTGSQAASGPFSVGPHGVSHTEGLKWQL
FT                   ESPGPMDVGHFLDLHDSTGPPAAPPTKRHCRSLSEPEELARCRSPWRPGSSKVWTPISK
FT                   RRCNSGGSATLQCCSGVGNPTLQGTLVPGLPRRPVSPAGPTSPLTPRPASASSGFVDGS
FT                   EGSTSSGPPWLSTGPCPFSSRRRLSLSQEHLVDTGACLPSASSTPTSTPELGRHHGLLR
FT                   CRSQPCVLDGRRVRRKRRREEDARWTRPSLDFLKMTRTLKNSKSLCSLDYEDDEDDTQE
FT                   KTLVSSPCNSQGLVGIITPSSSPRIPRPGPDSPSVWASGEPEASPGEGGSSGDPSDWDS
FT                   AGEEGIFPLDHGDLDLEQIENN"
FT   CDS             complement(join(7407995..7408306,7414890..7415653,
FT                   7417858..7417912,7422029..>7422163))
FT                   /codon_start=1
FT                   /gene="2410018C17Rik"
FT                   /locus_tag="mCG_122502"
FT                   /product="RIKEN cDNA 2410018C17, isoform CRA_b"
FT                   /note="gene_id=mCG122502.0 transcript_id=mCT180109.0
FT                   protein_id=mCP103032.0 isoform=CRA_b"
FT                   /protein_id="EDL37422.1"
FT                   /translation="CPVFWKSSAHRCGLRKSPAMVTLITEKLQNQSLDDLTRRACEAGP
FT                   YSAEKLNKSGHLFPLEISVDKSPWKALRGGWPTGSQAASGPFSVGPHGVSHTEGLKWQL
FT                   ESPGPMDVGHFLDLHDSTGPPAAPPTKRHCRSLSEPEELARCRSPWRPGSSKVWTPISK
FT                   RRCNSGGSATLQCCSGVGNPTLQGTLVPGLPRRPVSPAGPTSPLTPRPASASSGFVDGS
FT                   EGSTSSGPPWLSTGPCPFSSRRRLSLSQEHLVDTGACLPSASSTPTSTPELGRHHGLLR
FT                   CRSQPCVLDGRRVRRKRRREEDARWTRPSLDFLKMTRTLKNSKSLCSLDYEDDEDDTQE
FT                   KTLVSSPCNSQGLVGIITPSSSPRIPRPGPDSPSVWASGEPEASPGEGGSSGDPSDWDS
FT                   AGEEGIFPLDHGDLDLEQIENN"
FT   gene            7437343..7439511
FT                   /gene="LOC433873"
FT                   /locus_tag="mCG_148302"
FT                   /note="gene_id=mCG148302.0"
FT   mRNA            join(7437343..7437713,7438135..7439511)
FT                   /gene="LOC433873"
FT                   /locus_tag="mCG_148302"
FT                   /product="hypothetical protein EG433873"
FT                   /note="gene_id=mCG148302.0 transcript_id=mCT188565.0
FT                   created on 13-JAN-2004"
FT   CDS             join(7437568..7437713,7438135..7438378)
FT                   /codon_start=1
FT                   /gene="LOC433873"
FT                   /locus_tag="mCG_148302"
FT                   /product="hypothetical protein EG433873"
FT                   /note="gene_id=mCG148302.0 transcript_id=mCT188565.0
FT                   protein_id=mCP109216.0"
FT                   /db_xref="MGI:MGI:3646113"
FT                   /db_xref="UniProtKB/TrEMBL:Q8C9Y8"
FT                   /protein_id="EDL37423.1"
FT                   /translation="MPSFSCPLLVMCLWAGPFPLGVSFLDLPCDWKALLCIGYRCCEGK
FT                   LLCRFLEDRGLATWITAGRSQIRTETSGRHLCLRGTLPRTVLNHTLPGQIWTNGGLLKS
FT                   PRSPCVSQALQLIKLHTPHSSAVFE"
FT   gene            complement(7447477..7459989)
FT                   /locus_tag="mCG_16335"
FT                   /note="gene_id=mCG16335.3"
FT   mRNA            complement(join(7447477..7448348,7449321..7449402,
FT                   7451153..7451302,7452916..7453053,7457159..7457263,
FT                   7459378..7459494,7459610..7459721))
FT                   /locus_tag="mCG_16335"
FT                   /product="mCG16335, transcript variant mCT180242"
FT                   /note="gene_id=mCG16335.3 transcript_id=mCT180242.0 created
FT                   on 18-FEB-2003"
FT   mRNA            complement(join(7447483..7448348,7449321..7449402,
FT                   7451153..7451302,7452916..7453053,7453426..7453485,
FT                   7457159..7457263,7459378..7459494,7459610..7459989))
FT                   /locus_tag="mCG_16335"
FT                   /product="mCG16335, transcript variant mCT17784"
FT                   /note="gene_id=mCG16335.3 transcript_id=mCT17784.2 created
FT                   on 18-FEB-2003"
FT   mRNA            complement(join(7447485..7448348,7449321..7449402,
FT                   7451153..7451302,7452916..7453053,7453426..7453485,
FT                   7459378..7459494,7459610..7459989))
FT                   /locus_tag="mCG_16335"
FT                   /product="mCG16335, transcript variant mCT173411"
FT                   /note="gene_id=mCG16335.3 transcript_id=mCT173411.0 created
FT                   on 18-FEB-2003"
FT   CDS             complement(join(7448232..7448348,7449321..7449402,
FT                   7451153..7451302,7452916..7453053,7453426..7453485,
FT                   7459378..7459494,7459610..7459668))
FT                   /codon_start=1
FT                   /locus_tag="mCG_16335"
FT                   /product="mCG16335, isoform CRA_a"
FT                   /note="gene_id=mCG16335.3 transcript_id=mCT173411.0
FT                   protein_id=mCP96330.0 isoform=CRA_a"
FT                   /protein_id="EDL37424.1"
FT                   /translation="MACRPRSPPGYGSRRDGGASPRSPARWSLGRKRRADGRDRKPEDS
FT                   EEGELQTADHRPERYKRKLLINDFGRERKSSSGSSDSKESMSSVPADVETDESVLMRRQ
FT                   KQINYGKNTIAYDRYIKEVPRHLRQPGIHPRTPNKFKKYSRRSWDQQIKLWKVALHFWD
FT                   PPAEEGCDLQEIQPVDLGEMETEFTESSSESQTSSQDNFDVYAGTPTKVRHVDCQVEDE
FT                   FDLEACLTEPLKDFSAMS"
FT   CDS             complement(join(7448232..7448348,7449321..7449402,
FT                   7451153..7451302,7452916..7453053,7457159..7457263,
FT                   7459378..7459494,7459610..7459668))
FT                   /codon_start=1
FT                   /locus_tag="mCG_16335"
FT                   /product="mCG16335, isoform CRA_c"
FT                   /note="gene_id=mCG16335.3 transcript_id=mCT180242.0
FT                   protein_id=mCP103164.0 isoform=CRA_c"
FT                   /db_xref="GOA:Q8K2W7"
FT                   /db_xref="InterPro:IPR026502"
FT                   /db_xref="InterPro:IPR029344"
FT                   /db_xref="MGI:MGI:108402"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K2W7"
FT                   /protein_id="EDL37426.1"
FT                   /translation="MACRPRSPPGYGSRRDGGASPRSPARWSLGRKRRADGRDRKPEDS
FT                   EEGELQTADHRPESFTTPEGHKPRSRCSDWASAVEEDEMRTRVNKEIASSDSKESMSSV
FT                   PADVETDESVLMRRQKQINYGKNTIAYDRYIKEVPRHLRQPGIHPRTPNKFKKYSRRSW
FT                   DQQIKLWKVALHFWDPPAEEGCDLQEIQPVDLGEMETEFTESSSESQTSSQDNFDVYAG
FT                   TPTKVRHVDCQVEDEFDLEACLTEPLKDFSAMS"
FT   CDS             complement(join(7448232..7448348,7449321..7449402,
FT                   7451153..7451302,7452916..7453053,7453426..7453485,
FT                   7457159..7457263,7459378..7459494,7459610..7459668))
FT                   /codon_start=1
FT                   /locus_tag="mCG_16335"
FT                   /product="mCG16335, isoform CRA_b"
FT                   /note="gene_id=mCG16335.3 transcript_id=mCT17784.2
FT                   protein_id=mCP3896.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q3U4T7"
FT                   /db_xref="InterPro:IPR026502"
FT                   /db_xref="InterPro:IPR029344"
FT                   /db_xref="MGI:MGI:108402"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U4T7"
FT                   /protein_id="EDL37425.1"
FT                   /translation="MACRPRSPPGYGSRRDGGASPRSPARWSLGRKRRADGRDRKPEDS
FT                   EEGELQTADHRPESFTTPEGHKPRSRCSDWASAVEEDEMRTRVNKEIARYKRKLLINDF
FT                   GRERKSSSGSSDSKESMSSVPADVETDESVLMRRQKQINYGKNTIAYDRYIKEVPRHLR
FT                   QPGIHPRTPNKFKKYSRRSWDQQIKLWKVALHFWDPPAEEGCDLQEIQPVDLGEMETEF
FT                   TESSSESQTSSQDNFDVYAGTPTKVRHVDCQVEDEFDLEACLTEPLKDFSAMS"
FT   gene            complement(7460634..7465312)
FT                   /gene="Tmem129"
FT                   /locus_tag="mCG_16347"
FT                   /note="gene_id=mCG16347.1"
FT   mRNA            complement(join(7460634..7462029,7462128..7462287,
FT                   7462738..7463212,7465038..7465312))
FT                   /gene="Tmem129"
FT                   /locus_tag="mCG_16347"
FT                   /product="transmembrane protein 129"
FT                   /note="gene_id=mCG16347.1 transcript_id=mCT17796.1 created
FT                   on 25-SEP-2002"
FT   CDS             complement(join(7461781..7462029,7462128..7462287,
FT                   7462738..7463212,7465038..7465242))
FT                   /codon_start=1
FT                   /gene="Tmem129"
FT                   /locus_tag="mCG_16347"
FT                   /product="transmembrane protein 129"
FT                   /note="gene_id=mCG16347.1 transcript_id=mCT17796.1
FT                   protein_id=mCP3998.2"
FT                   /protein_id="EDL37427.1"
FT                   /translation="MDSPEVTFTLAYLVFAVCFVFTPNEFYSAGLTVQNLLSGWLGSED
FT                   AAFVPYHLRRTSATLLCHSLLPLGYYMGMCFAASEKQLYSPGQAPEAWQLFLLLAVTLP
FT                   LLSCTLIYYWSWDRWTRHPLAQTLALYALPQSGWQAVASSINTEFRRIDKFATGAPGAR
FT                   VIVTDTWVMKVTTYRVHVAQQQDVHLTVTESRQHDLSPDSNLPVQLLTIRVASTSPGTQ
FT                   PFDIRLNSSEYGELCEKLHAPIRSAANVVIRQSLGDLFLETFASHVEVNPAYSVPSNQE
FT                   LEPCIGCMQTRASVKLVKTCQEPAVGECQQCYCRPMWCLTCMGKWFASRQDPQRPDTWL
FT                   ASRVPCPTCRARFCILDVCCVR"
FT   gene            <7465541..7486412
FT                   /gene="Tacc3"
FT                   /locus_tag="mCG_16333"
FT                   /note="gene_id=mCG16333.3"
FT   mRNA            join(<7465541..7466142,7468637..7468799,7468936..7469060,
FT                   7471236..7471317,7471682..7472270,7474108..7474160,
FT                   7474479..7474582,7475378..7475468,7475549..7475650,
FT                   7476077..7476153,7476233..7476276,7476893..7477062,
FT                   7478819..7478925,7479080..7479200,7479397..7479491,
FT                   7486035..7486412)
FT                   /gene="Tacc3"
FT                   /locus_tag="mCG_16333"
FT                   /product="transforming, acidic coiled-coil containing
FT                   protein 3, transcript variant mCT193582"
FT                   /note="gene_id=mCG16333.3 transcript_id=mCT193582.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<7465943..7466142,7468637..7468799,7468936..7469060,
FT                   7471236..7471317,7471682..7472270,7474108..7474160,
FT                   7474479..7474582,7475378..7475468,7475549..7475650,
FT                   7476077..7476153,7476233..7476276,7476893..7477062,
FT                   7478819..7478925,7479080..7479200,7479397..7479462)
FT                   /codon_start=1
FT                   /gene="Tacc3"
FT                   /locus_tag="mCG_16333"
FT                   /product="transforming, acidic coiled-coil containing
FT                   protein 3, isoform CRA_b"
FT                   /note="gene_id=mCG16333.3 transcript_id=mCT193582.0
FT                   protein_id=mCP114580.0 isoform=CRA_b"
FT                   /protein_id="EDL37429.1"
FT                   /translation="LAVERQLSVFESGAGVADDVPGLRERTLLGFLRLGFSCSVFLARS
FT                   GHGAPPLRWASARAQGLATVVRMSLHVLNDENVPNEKSSQCRDFQFLPPELTGRSSVLC
FT                   LSQKENVPPQSQAKATNVTFQTPPRDPQTHRILSPNMTNKREAPFGLQNDHCVFLQKEN
FT                   QRPLAPVDDAPVVQMAAEILRAEGELQEGILTSSSLSASTSLLDSELVTPPIEPVLEPS
FT                   HQGLEPVLESELVTPPVEPVLEPSHQELEPVLESELVTPPIEPVLEPSHQGLEPVLDSE
FT                   LVTPPIEPVLEPSHQGLEPVLESELVTPPIEPVLEPSHQGLEPVLDSELVTPPIEPVLE
FT                   PSHQGLEPVLDSELVTPPIEPLLEPSHQGLEPVVDLKEESFRDPSEVLGTGAEVDYLEQ
FT                   FGTSSFKESAWRKQSLYVKFDPLLKDSPLRPMPVAPITNSTQDTEEESGSGKPTEAELV
FT                   NLDFLGDLDVPVSAPPLCVLEPRGLLPAEPIVDVLKYSQKDLDAVVNVMQQENLELKSK
FT                   YEDLNTKYLEMGKSVDEFEKIAYKSLEEAEKQRELKEIAEDKIQKVLKERDQLNADLNS
FT                   MEKSFSDLFKRFEKRKEVIEGYQKNEESLKKYVGECIVKIEKEGQRYQALKIHAEEKLR
FT                   LANEEIAQVHSKAQAEVLALQASLRKAQMQNHSLEMTLEQKTKEIDELTRICDDLISKM
FT                   EKI"
FT   mRNA            join(7465998..7466142,7468637..7468799,7468936..7469060,
FT                   7471236..7471317,7471682..7472270,7474114..7474160,
FT                   7474458..7474582,7475378..7475468,7475549..7475650,
FT                   7476077..7476153,7476233..7476276,7476893..7477062,
FT                   7478819..7478925,7479080..7479200,7479397..7479491,
FT                   7486035..7486409)
FT                   /gene="Tacc3"
FT                   /locus_tag="mCG_16333"
FT                   /product="transforming, acidic coiled-coil containing
FT                   protein 3, transcript variant mCT173410"
FT                   /note="gene_id=mCG16333.3 transcript_id=mCT173410.0 created
FT                   on 17-SEP-2002"
FT   mRNA            join(7466011..7466142,7468637..7468799,7468936..7469060,
FT                   7471236..7471317,7471682..7471939,7472216..7472270,
FT                   7474108..7474160,7474458..7474582,7475378..7475468,
FT                   7475549..7475650,7476077..7476153,7476233..7476276,
FT                   7476893..7477062,7478819..7478925,7479080..7479200,
FT                   7479397..7479610)
FT                   /gene="Tacc3"
FT                   /locus_tag="mCG_16333"
FT                   /product="transforming, acidic coiled-coil containing
FT                   protein 3, transcript variant mCT17782"
FT                   /note="gene_id=mCG16333.3 transcript_id=mCT17782.2 created
FT                   on 17-SEP-2002"
FT   CDS             join(7468638..7468799,7468936..7469060,7471236..7471317,
FT                   7471682..7472270,7474114..7474160,7474458..7474582,
FT                   7475378..7475468,7475549..7475650,7476077..7476153,
FT                   7476233..7476276,7476893..7477062,7478819..7478925,
FT                   7479080..7479200,7479397..7479462)
FT                   /codon_start=1
FT                   /gene="Tacc3"
FT                   /locus_tag="mCG_16333"
FT                   /product="transforming, acidic coiled-coil containing
FT                   protein 3, isoform CRA_c"
FT                   /note="gene_id=mCG16333.3 transcript_id=mCT173410.0
FT                   protein_id=mCP96329.0 isoform=CRA_c"
FT                   /protein_id="EDL37430.1"
FT                   /translation="MSLHVLNDENVPNEKSSQCRDFQFLPPELTGRSSVLCLSQKENVP
FT                   PQSQAKATNVTFQTPPRDPQTHRILSPNMTNKREAPFGLQNDHCVFLQKENQRPLAPVD
FT                   DAPVVQMAAEILRAEGELQEGILTSSSLSASTSLLDSELVTPPIEPVLEPSHQGLEPVL
FT                   ESELVTPPVEPVLEPSHQELEPVLESELVTPPIEPVLEPSHQGLEPVLDSELVTPPIEP
FT                   VLEPSHQGLEPVLESELVTPPIEPVLEPSHQGLEPVLDSELVTPPIEPVLEPSHQGLEP
FT                   VLDSELVTPPIEPLLEPSHQGLEPVVDLKEESFRDPSEGTGAEVDYLEQFGTSSSHLSN
FT                   SQFKESAWRKQSLYVKFDPLLKDSPLRPMPVAPITNSTQDTEEESGSGKPTEAELVNLD
FT                   FLGDLDVPVSAPPLCVLEPRGLLPAEPIVDVLKYSQKDLDAVVNVMQQENLELKSKYED
FT                   LNTKYLEMGKSVDEFEKIAYKSLEEAEKQRELKEIAEDKIQKVLKERDQLNADLNSMEK
FT                   SFSDLFKRFEKRKEVIEGYQKNEESLKKYVGECIVKIEKEGQRYQALKIHAEEKLRLAN
FT                   EEIAQVHSKAQAEVLALQASLRKAQMQNHSLEMTLEQKTKEIDELTRICDDLISKMEKI
FT                   "
FT   CDS             join(7468638..7468799,7468936..7469060,7471236..7471317,
FT                   7471682..7471939,7472216..7472270,7474108..7474160,
FT                   7474458..7474582,7475378..7475468,7475549..7475650,
FT                   7476077..7476153,7476233..7476276,7476893..7477062,
FT                   7478819..7478925,7479080..7479200,7479397..7479462)
FT                   /codon_start=1
FT                   /gene="Tacc3"
FT                   /locus_tag="mCG_16333"
FT                   /product="transforming, acidic coiled-coil containing
FT                   protein 3, isoform CRA_a"
FT                   /note="gene_id=mCG16333.3 transcript_id=mCT17782.2
FT                   protein_id=mCP4010.2 isoform=CRA_a"
FT                   /protein_id="EDL37428.1"
FT                   /translation="MSLHVLNDENVPNEKSSQCRDFQFLPPELTGRSSVLCLSQKENVP
FT                   PQSQAKATNVTFQTPPRDPQTHRILSPNMTNKREAPFGLQNDHCVFLQKENQRPLAPVD
FT                   DAPVVQMAAEILRAEGELQEGILTSSSLSASTSLLDSELVTPPIEPVLEPSHQGLEPVL
FT                   ESELVTPPVEPVLEPSHQELEPVLESELVTPPIEPVLEPSHQGLEPGLEPVVDLKEESF
FT                   RDPSEVLGTGAEVDYLEQFGTSSSHLSNSQFKESAWRKQSLYVKFDPLLKDSPLRPMPV
FT                   APITNSTQDTEEESGSGKPTEAELVNLDFLGDLDVPVSAPPLCVLEPRGLLPAEPIVDV
FT                   LKYSQKDLDAVVNVMQQENLELKSKYEDLNTKYLEMGKSVDEFEKIAYKSLEEAEKQRE
FT                   LKEIAEDKIQKVLKERDQLNADLNSMEKSFSDLFKRFEKRKEVIEGYQKNEESLKKYVG
FT                   ECIVKIEKEGQRYQALKIHAEEKLRLANEEIAQVHSKAQAEVLALQASLRKAQMQNHSL
FT                   EMTLEQKTKEIDELTRICDDLISKMEKI"
FT   gene            7529146..7544481
FT                   /gene="Fgfr3"
FT                   /locus_tag="mCG_16331"
FT                   /note="gene_id=mCG16331.2"
FT   mRNA            join(7529146..7529369,7529721..7529926,7535062..7535331,
FT                   7535607..7535660,7537096..7537265,7537351..7537474,
FT                   7537559..7537749,7539532..7539676,7540137..7540327,
FT                   7540672..7540817,7541075..7541196,7541271..7541381,
FT                   7541462..7541652,7541762..7541884,7541968..7542038,
FT                   7542266..7542403,7542548..7542653,7542829..7544451)
FT                   /gene="Fgfr3"
FT                   /locus_tag="mCG_16331"
FT                   /product="fibroblast growth factor receptor 3, transcript
FT                   variant mCT17780"
FT                   /note="gene_id=mCG16331.2 transcript_id=mCT17780.1 created
FT                   on 17-SEP-2002"
FT   mRNA            join(<7529227..7529343,7529721..7529926,7535062..7535331,
FT                   7535607..7535660,7537096..7537265,7537351..7537474,
FT                   7537559..7537749,7539532..7539676,7540137..7540327,
FT                   7540672..7540817,7541075..7541196,7541271..7541381,
FT                   7541462..7541652,7541762..7541884,7541968..7542038,
FT                   7542266..7542403,7542548..7542653,7542829..7544481)
FT                   /gene="Fgfr3"
FT                   /locus_tag="mCG_16331"
FT                   /product="fibroblast growth factor receptor 3, transcript
FT                   variant mCT193581"
FT                   /note="gene_id=mCG16331.2 transcript_id=mCT193581.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<7529797..7529926,7535062..7535331,7535607..7535660,
FT                   7537096..7537265,7537351..7537474,7537559..7537749,
FT                   7539532..7539676,7540137..7540327,7540672..7540817,
FT                   7541075..7541196,7541271..7541381,7541462..7541652,
FT                   7541762..7541884,7541968..7542038,7542266..7542403,
FT                   7542548..7542653,7542829..7542975)
FT                   /codon_start=1
FT                   /gene="Fgfr3"
FT                   /locus_tag="mCG_16331"
FT                   /product="fibroblast growth factor receptor 3, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG16331.2 transcript_id=mCT193581.0
FT                   protein_id=mCP114530.0 isoform=CRA_c"
FT                   /protein_id="EDL37433.1"
FT                   /translation="GRRGPRSGAMVVPACVLVFCVAVVAGATSEPPGPEQRVVRRAAEV
FT                   PGPEPSQQEQVAFGSGDTVELSCHPPGGAPTGPTVWAKDGTGLVASHRILVGPQRLQVL
FT                   NASHEDAGVYSCQHRLTRRVLCHFSVRVTDAPSSGDDEDGEDVAEDTGAPYWTRPERMD
FT                   KKLLAVPAANTVRFRCPAAGNPTPSISWLKNGKEFRGEHRIGGIKLRHQQWSLVMESVV
FT                   PSDRGNYTCVVENKFGSIRQTYTLDVLERSPHRPILQAGLPANQTAILGSDVEFHCKVY
FT                   SDAQPHIQWLKHVEVNGSKVGPDGTPYVTVLKTAGANTTDKELEVLSLHNVTFEDAGEY
FT                   TCLAGNSIGFSHHSAWLVVLPAEEELMETDEAGSVYAGVLSYGVVFFLFILVVAAVILC
FT                   RLRSPPKKGLGSPTVHKVSRFPLKRQVSLESNSSMNSNTPLVRIARLSSGEGPVLANVS
FT                   ELELPADPKWELSRTRLTLGKPLGEGCFGQVVMAEAIGIDKDRTAKPVTVAVKMLKDDA
FT                   TDKDLSDLVSEMEMMKMIGKHKNIINLLGACTQGGPLYVLVEYAAKGNLREFLRARRPP
FT                   GMDYSFDACRLPEEQLTCKDLVSCAYQVARGMEYLASQKCIHRDLAARNVLVTEDNVMK
FT                   IADFGLARDVHNLDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLLWEIFTLG
FT                   GSPYPGIPVEELFKLLKEGHRMDKPASCTHDLYMIMRECWHAVPSQRPTFKQLVEDLDR
FT                   ILTVTSTDEYLDLSVPFEQYSPGGQDTPSSSSSGDDSVFTHDLLPPGPPSNGGPRT"
FT   mRNA            join(7529813..7529926,7535062..7535331,7537096..7537265,
FT                   7537351..7537474,7537559..7537749,7539532..7539676,
FT                   7540137..7540327,7540672..7540817,7541075..7541196,
FT                   7541271..7541381,7541462..7541652,7541762..7541884,
FT                   7541968..7542038,7542266..7542403,7542548..7542653,
FT                   7542829..7544451)
FT                   /gene="Fgfr3"
FT                   /locus_tag="mCG_16331"
FT                   /product="fibroblast growth factor receptor 3, transcript
FT                   variant mCT173409"
FT                   /note="gene_id=mCG16331.2 transcript_id=mCT173409.0 created
FT                   on 17-SEP-2002"
FT   CDS             join(7529824..7529926,7535062..7535331,7535607..7535660,
FT                   7537096..7537265,7537351..7537474,7537559..7537749,
FT                   7539532..7539676,7540137..7540327,7540672..7540817,
FT                   7541075..7541196,7541271..7541381,7541462..7541652,
FT                   7541762..7541884,7541968..7542038,7542266..7542403,
FT                   7542548..7542653,7542829..7542975)
FT                   /codon_start=1
FT                   /gene="Fgfr3"
FT                   /locus_tag="mCG_16331"
FT                   /product="fibroblast growth factor receptor 3, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG16331.2 transcript_id=mCT17780.1
FT                   protein_id=mCP3984.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q7TSI8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR003598"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR008266"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR013098"
FT                   /db_xref="InterPro:IPR013151"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016248"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR020635"
FT                   /db_xref="InterPro:IPR028176"
FT                   /db_xref="MGI:MGI:95524"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TSI8"
FT                   /protein_id="EDL37432.1"
FT                   /translation="MVVPACVLVFCVAVVAGATSEPPGPEQRVVRRAAEVPGPEPSQQE
FT                   QVAFGSGDTVELSCHPPGGAPTGPTVWAKDGTGLVASHRILVGPQRLQVLNASHEDAGV
FT                   YSCQHRLTRRVLCHFSVRVTDAPSSGDDEDGEDVAEDTGAPYWTRPERMDKKLLAVPAA
FT                   NTVRFRCPAAGNPTPSISWLKNGKEFRGEHRIGGIKLRHQQWSLVMESVVPSDRGNYTC
FT                   VVENKFGSIRQTYTLDVLERSPHRPILQAGLPANQTAILGSDVEFHCKVYSDAQPHIQW
FT                   LKHVEVNGSKVGPDGTPYVTVLKTAGANTTDKELEVLSLHNVTFEDAGEYTCLAGNSIG
FT                   FSHHSAWLVVLPAEEELMETDEAGSVYAGVLSYGVVFFLFILVVAAVILCRLRSPPKKG
FT                   LGSPTVHKVSRFPLKRQVSLESNSSMNSNTPLVRIARLSSGEGPVLANVSELELPADPK
FT                   WELSRTRLTLGKPLGEGCFGQVVMAEAIGIDKDRTAKPVTVAVKMLKDDATDKDLSDLV
FT                   SEMEMMKMIGKHKNIINLLGACTQGGPLYVLVEYAAKGNLREFLRARRPPGMDYSFDAC
FT                   RLPEEQLTCKDLVSCAYQVARGMEYLASQKCIHRDLAARNVLVTEDNVMKIADFGLARD
FT                   VHNLDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLLWEIFTLGGSPYPGIPV
FT                   EELFKLLKEGHRMDKPASCTHDLYMIMRECWHAVPSQRPTFKQLVEDLDRILTVTSTDE
FT                   YLDLSVPFEQYSPGGQDTPSSSSSGDDSVFTHDLLPPGPPSNGGPRT"
FT   CDS             join(7529824..7529926,7535062..7535331,7537096..7537265,
FT                   7537351..7537474,7537559..7537749,7539532..7539676,
FT                   7540137..7540327,7540672..7540817,7541075..7541196,
FT                   7541271..7541381,7541462..7541652,7541762..7541884,
FT                   7541968..7542038,7542266..7542403,7542548..7542653,
FT                   7542829..7542975)
FT                   /codon_start=1
FT                   /gene="Fgfr3"
FT                   /locus_tag="mCG_16331"
FT                   /product="fibroblast growth factor receptor 3, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG16331.2 transcript_id=mCT173409.0
FT                   protein_id=mCP96328.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q61563"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR003598"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR008266"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR013098"
FT                   /db_xref="InterPro:IPR013151"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016248"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR020635"
FT                   /db_xref="InterPro:IPR028176"
FT                   /db_xref="MGI:MGI:95524"
FT                   /db_xref="UniProtKB/TrEMBL:Q61563"
FT                   /protein_id="EDL37431.1"
FT                   /translation="MVVPACVLVFCVAVVAGATSEPPGPEQRVVRRAAEVPGPEPSQQE
FT                   QVAFGSGDTVELSCHPPGGAPTGPTVWAKDGTGLVASHRILVGPQRLQVLNASHEDAGV
FT                   YSCQHRLTRRVLCHFSVRVTGAPYWTRPERMDKKLLAVPAANTVRFRCPAAGNPTPSIS
FT                   WLKNGKEFRGEHRIGGIKLRHQQWSLVMESVVPSDRGNYTCVVENKFGSIRQTYTLDVL
FT                   ERSPHRPILQAGLPANQTAILGSDVEFHCKVYSDAQPHIQWLKHVEVNGSKVGPDGTPY
FT                   VTVLKTAGANTTDKELEVLSLHNVTFEDAGEYTCLAGNSIGFSHHSAWLVVLPAEEELM
FT                   ETDEAGSVYAGVLSYGVVFFLFILVVAAVILCRLRSPPKKGLGSPTVHKVSRFPLKRQV
FT                   SLESNSSMNSNTPLVRIARLSSGEGPVLANVSELELPADPKWELSRTRLTLGKPLGEGC
FT                   FGQVVMAEAIGIDKDRTAKPVTVAVKMLKDDATDKDLSDLVSEMEMMKMIGKHKNIINL
FT                   LGACTQGGPLYVLVEYAAKGNLREFLRARRPPGMDYSFDACRLPEEQLTCKDLVSCAYQ
FT                   VARGMEYLASQKCIHRDLAARNVLVTEDNVMKIADFGLARDVHNLDYYKKTTNGRLPVK
FT                   WMAPEALFDRVYTHQSDVWSFGVLLWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPAS
FT                   CTHDLYMIMRECWHAVPSQRPTFKQLVEDLDRILTVTSTDEYLDLSVPFEQYSPGGQDT
FT                   PSSSSSGDDSVFTHDLLPPGPPSNGGPRT"
FT   gene            complement(7548767..>7590130)
FT                   /gene="Letm1"
FT                   /locus_tag="mCG_16329"
FT                   /note="gene_id=mCG16329.2"
FT   mRNA            complement(join(7548767..7550027,7551057..7551195,
FT                   7552431..7552618,7553655..7553789,7554791..7554925,
FT                   7555576..7555716,7556157..7556288,7559893..7560012,
FT                   7568124..7568327,7568981..7569118,7569860..7570003,
FT                   7576762..7577212,7586011..7586071,7589873..7590103))
FT                   /gene="Letm1"
FT                   /locus_tag="mCG_16329"
FT                   /product="leucine zipper-EF-hand containing transmembrane
FT                   protein 1, transcript variant mCT17779"
FT                   /note="gene_id=mCG16329.2 transcript_id=mCT17779.1 created
FT                   on 17-SEP-2002"
FT   mRNA            complement(join(7549738..7550027,7551057..7551189,
FT                   7555591..>7555702))
FT                   /gene="Letm1"
FT                   /locus_tag="mCG_16329"
FT                   /product="leucine zipper-EF-hand containing transmembrane
FT                   protein 1, transcript variant mCT173407"
FT                   /note="gene_id=mCG16329.2 transcript_id=mCT173407.0 created
FT                   on 17-SEP-2002"
FT   CDS             complement(join(7549878..7550027,7551057..7551195,
FT                   7552431..7552618,7553655..7553789,7554791..7554925,
FT                   7555576..7555716,7556157..7556288,7559893..7560012,
FT                   7568124..7568327,7568981..7569118,7569860..7570003,
FT                   7576762..7577212,7586011..7586071,7589873..7589951))
FT                   /codon_start=1
FT                   /gene="Letm1"
FT                   /locus_tag="mCG_16329"
FT                   /product="leucine zipper-EF-hand containing transmembrane
FT                   protein 1, isoform CRA_c"
FT                   /note="gene_id=mCG16329.2 transcript_id=mCT17779.1
FT                   protein_id=mCP3941.1 isoform=CRA_c"
FT                   /protein_id="EDL37436.1"
FT                   /translation="MASILLRSCRGRGPARLAPPRAASPRGSLRDRACLSCTRTLGLTS
FT                   RESVLSRCCTPAHPVYLCFKGEPLSCWTQRPECQGTAARTTWTPASARLVVTGPQYLPV
FT                   RGWHSSSPLGEDSVIEKSLKSLKDKNKKLEEGGPVYSPPAQVVVRKSLGQKVLDELRHY
FT                   YHGFRLLWIDTKIAARMLWRILNGHTLTRRERRQFLRICADLFRLVPFLVFVVVPFMEF
FT                   LLPVVVKLFPNMLPSTFETQSIKEERLKKELRVKLELAKFLQDTIEEMALKNKAAKGNA
FT                   TKDFSAFFQKIRETGERPSNEEIMRFSKLFEDELTLDNLTRPQLVALCKLLELQSIGTN
FT                   NFLRFQLTMRLRSIKADDKLISEEGVDSLTVKELQAACRARGMRALGVTEDRLKGQLKQ
FT                   WLDLHLHHEIPTSLLILSRAMYLPDTLSPADQLKSTLQTLPEIVAKEAQVKVAEVEGEK
FT                   VDNKAKLEATLQEEAAIQQEHLEELKRASEAVKDIQPEVAEATLPGRPGPEPQPPVDDV
FT                   ILPSEVLTDTAPVLEGLKGEEITKEEIDILSDACSKLQEQKKSLTKEKEELELLKEDVQ
FT                   DYSEDLQEIKKELSKTGEEKYIEESAASKRLSKRVQQMIGQIDGLITQLETTQQDGKLG
FT                   PSQSTPTGESVISITELISAMKQIKHIPEHKLISLTSALDDNKDGNINIDDLVKVIDLV
FT                   NKEDVQISTTQVAEIVATLEKEEKIEEKEKAKEKAEKEAAEVKN"
FT   CDS             complement(join(7549878..7550027,7551057..7551189,
FT                   7555591..>7555595))
FT                   /codon_start=1
FT                   /gene="Letm1"
FT                   /locus_tag="mCG_16329"
FT                   /product="leucine zipper-EF-hand containing transmembrane
FT                   protein 1, isoform CRA_a"
FT                   /note="gene_id=mCG16329.2 transcript_id=mCT173407.0
FT                   protein_id=mCP96327.0 isoform=CRA_a"
FT                   /protein_id="EDL37434.1"
FT                   /translation="RDVISITELISAMKQIKHIPEHKLISLTSALDDNKDGNINIDDLV
FT                   KVIDLVNKEDVQISTTQVAEIVATLEKEEKIEEKEKAKEKAEKEAAEVKN"
FT   gene            7566736..7567052
FT                   /pseudo
FT                   /locus_tag="mCG_16330"
FT                   /note="gene_id=mCG16330.1"
FT   mRNA            7566736..7567052
FT                   /pseudo
FT                   /locus_tag="mCG_16330"
FT                   /note="gene_id=mCG16330.1 transcript_id=mCT17519.1 created
FT                   on 02-OCT-2002"
FT   mRNA            complement(join(<7577118..7577212,7589873..>7590130))
FT                   /gene="Letm1"
FT                   /locus_tag="mCG_16329"
FT                   /product="leucine zipper-EF-hand containing transmembrane
FT                   protein 1, transcript variant mCT173408"
FT                   /note="gene_id=mCG16329.2 transcript_id=mCT173408.0 created
FT                   on 17-SEP-2002"
FT   CDS             complement(join(<7577118..7577212,7589873..>7590128))
FT                   /codon_start=1
FT                   /gene="Letm1"
FT                   /locus_tag="mCG_16329"
FT                   /product="leucine zipper-EF-hand containing transmembrane
FT                   protein 1, isoform CRA_b"
FT                   /note="gene_id=mCG16329.2 transcript_id=mCT173408.0
FT                   protein_id=mCP96326.0 isoform=CRA_b"
FT                   /protein_id="EDL37435.1"
FT                   /translation="LRTFVPGHGRCGCRVLELSACCRSQPLPSTVRAGWAQAPGRPRSA
FT                   EEAEAAIERRRGGRMASILLRSCRGRGPARLAPPRAASPRGVFCLVAVLQPTLCTSASK
FT                   VSPSAVGLRGLSA"
FT   gene            7629326..7706510
FT                   /locus_tag="mCG_16344"
FT                   /note="gene_id=mCG16344.2"
FT   mRNA            join(7629326..7629351,7651582..7652207,7654575..7654737,
FT                   7663187..7663353,7663831..7664313,7669592..7669736,
FT                   7677312..7677436,7687615..7687746,7688609..7688732,
FT                   7689544..7689744,7690545..7690724,7691084..7691240,
FT                   7691356..7691561,7693544..7693647,7693935..7694204,
FT                   7695805..7695921,7700059..7700200,7700493..7700599,
FT                   7701957..7702161,7703456..7706510)
FT                   /locus_tag="mCG_16344"
FT                   /product="mCG16344"
FT                   /note="gene_id=mCG16344.2 transcript_id=mCT123713.0 created
FT                   on 19-JUN-2003"
FT   CDS             join(7651611..7652207,7654575..7654737,7663187..7663353,
FT                   7663831..7664313,7669592..7669736,7677312..7677436,
FT                   7687615..7687746,7688609..7688732,7689544..7689744,
FT                   7690545..7690724,7691084..7691240,7691356..7691561,
FT                   7693544..7693647,7693935..7694204,7695805..7695921,
FT                   7700059..7700200,7700493..7700599,7701957..7702161,
FT                   7703456..7703727)
FT                   /codon_start=1
FT                   /locus_tag="mCG_16344"
FT                   /product="mCG16344"
FT                   /note="gene_id=mCG16344.2 transcript_id=mCT123713.0
FT                   protein_id=mCP65164.1"
FT                   /protein_id="EDL37437.1"
FT                   /translation="MEFSIRKSPLSVQKVVKCMKMKQTPEILGSANGKTQNCEVNHECS
FT                   VFLSKAQLSNSLQEGVMQKFNGHDALPFLPAEKLKDLTSCVFNGEPGAHDTKLCFEAQE
FT                   VKGIGTPPNTTPIKNGSPEIKLKITKTYMNGKPLFESSICGDGAADVSQSEENEQKSDN
FT                   KTRRNRKRSIKYDSLLEQGLVEAALVSKISSPADKKIPVKKESCPNTGRDRDLLLKYNV
FT                   GDLVWSKVSGYPWWPCMVSADPLLHNHTKLKGQKKSARQYHVQFFGDAPERAWIFEKSL
FT                   VAFEGEEQFEKLCQESAKQAPTKAEKIKLLKPISGRLRAQWEMGIVQAEEAASMSIEER
FT                   KAKFTFLYVGDQLHLNPQVAKEAGIVTEPLGEMVDSSGASEEAAVDPGSVREEDIPTKR
FT                   RRRTKRSSSAENQEGDPGTDKSTPPKMAEAEPKRGVGSPAGRKKSTGSAPRSRKGDSAA
FT                   QFLVFCQKHRDEVVAEHPDASGEEIEELLGSQWSMLNEKQKARYNTKFSLMISAQSEED
FT                   SATKNLSDACKPLKKRNRASATASSALGFNKSSSPSASLTEHEVSDSPGDEPSESPYES
FT                   ADETQTEASVSSKKSERGMAAKKEYVCQLCEKTGSLLLCEGPCCGAFHLACLGLSRRPE
FT                   GRFTCTECASGIHSCFVCKESKMEVKRCVVNQCGKFYHEACVKKYPLTVFESRGFRCPL
FT                   HSCMSCHASNPSNPRPSKGKMMRCVRCPVAYHGGDACLAAGCSVIASNSIICTGHFTAR
FT                   KGKRHHTHVNVSWCFVCSKGGSLLCCEACPAAFHPDCLNIEMPDGSWFCNDCRAGKKLH
FT                   FQDIIWVKLGNYRWWPAEVCHPKNVPPNIQKMKHEIGEFPVFFFGSKDYYWTHQARVFP
FT                   YMEGDRGSRYQGVRGIGRVFKNALQEAEARFNEVKLQREARETQESERKPPPYKHIKVN
FT                   KPYGKVQIYTADISEIPKCNCKPTDENPCGSDSECLNRMLMFECHPQVCPAGEYCQNQC
FT                   FTKRQYPETKIIKTDGKGWGLVAKRDIRKGEFVNEYVGELIDEEECMARIKYAHENDIT
FT                   HFYMLTIDKDRIIDAGPKGNYSRFMNHSCQPNCETLKWTVNGDTRVGLFAVCDIPAGTE
FT                   LTFNYNLDCLGNEKTVCRCGASNCSGFLGDRPKTSASLSSEEKGKKAKKKTRRRRAKGE
FT                   GKRQSEDECFRCGDGGQLVLCDRKFCTKAYHLSCLGLGKRPFGKWECPWHHCDVCGKPS
FT                   TSFCHLCPNSFCKEHQDGTAFRSTQDGQSYCCEHDLRADSSSSTKTEKPFPESLKSKGK
FT                   RKKRRCWRRVTDGK"
FT   gene            complement(7705679..7736724)
FT                   /gene="Whsc2"
FT                   /locus_tag="mCG_16346"
FT                   /note="gene_id=mCG16346.1"
FT   mRNA            complement(join(7705679..7707459,7707562..7707661,
FT                   7707832..7708103,7708963..7709074,7709741..7709829,
FT                   7710138..7710207,7710295..7710425,7711921..7712010,
FT                   7720889..7721050,7722243..7722414,7736428..7736724))
FT                   /gene="Whsc2"
FT                   /locus_tag="mCG_16346"
FT                   /product="Wolf-Hirschhorn syndrome candidate 2 (human)"
FT                   /note="gene_id=mCG16346.1 transcript_id=mCT17794.2 created
FT                   on 25-SEP-2002"
FT   CDS             complement(join(7707275..7707459,7707562..7707661,
FT                   7707832..7708103,7708963..7709074,7709741..7709829,
FT                   7710138..7710207,7710295..7710425,7711921..7712010,
FT                   7720889..7721050,7722243..7722414,7736428..7736637))
FT                   /codon_start=1
FT                   /gene="Whsc2"
FT                   /locus_tag="mCG_16346"
FT                   /product="Wolf-Hirschhorn syndrome candidate 2 (human)"
FT                   /note="gene_id=mCG16346.1 transcript_id=mCT17794.2
FT                   protein_id=mCP3980.1"
FT                   /protein_id="EDL37438.1"
FT                   /translation="MASMRESDTGLWLHNKLGATDELWAPPSIASLLTAAVIDNIRLCF
FT                   HRLSSAVKLKLLLGTLHLPRRTVDEMKAALMDIIQLATLDSDPWVLMVADILKSFPDTG
FT                   SLNLDLEEQNPNVQDILGELREKVSECEASAMLPLECQYLNKNALTTLAGPLTPPVKHF
FT                   QLKRKPKSATLRAELLQKSTETAQQLKRSAGVPFHAKGRGLLRKMDTTTPLKGIPKQAP
FT                   FRSPTTPSVFSPSGNRTPIPPSRTPLQKERGVKLLDISELNTVGAGREAKRRRKTLDTE
FT                   VVEKPTKEETVVENATPDYAAGLVSTQKLGSLNSEPTLPSTSYLPSTPSVVPASSYIPS
FT                   SETPPAPPSREASRPPEEPSAPSPTLPTQFKQRAPMYNSGLSPATPAPAAPTSPLTPTT
FT                   PPAVTPTAQTPPVAMVAPQTQAPAPVQQQPKKNLSLTREQMFAAQEMFKTANKVTRPEK
FT                   ALILGFMAGSRENPCPEQGDVIQIKLSEHTEDLPKADGQGSTTMLVDTVFEMNYATGQW
FT                   TRFKKYKPMTNVS"
FT   gene            <7784452..7786033
FT                   /locus_tag="mCG_16345"
FT                   /note="gene_id=mCG16345.2"
FT   mRNA            join(<7784452..7784911,7785067..7785155,7785923..7786033)
FT                   /locus_tag="mCG_16345"
FT                   /product="mCG16345, transcript variant mCT173998"
FT                   /note="gene_id=mCG16345.2 transcript_id=mCT173998.0 created
FT                   on 13-FEB-2003"
FT   mRNA            join(<7784452..7784654,7784772..7784911,7785067..7785155,
FT                   7785923..7786033)
FT                   /locus_tag="mCG_16345"
FT                   /product="mCG16345, transcript variant mCT17793"
FT                   /note="gene_id=mCG16345.2 transcript_id=mCT17793.2 created
FT                   on 13-FEB-2003"
FT   mRNA            join(<7784481..7784579,7784772..7784911,7785067..7785155,
FT                   7785923..7786030)
FT                   /locus_tag="mCG_16345"
FT                   /product="mCG16345, transcript variant mCT180264"
FT                   /note="gene_id=mCG16345.2 transcript_id=mCT180264.0 created
FT                   on 13-FEB-2003"
FT   CDS             join(<7784482..7784579,7784772..7784911,7785067..7785155,
FT                   7785923..7785988)
FT                   /codon_start=1
FT                   /locus_tag="mCG_16345"
FT                   /product="mCG16345, isoform CRA_b"
FT                   /note="gene_id=mCG16345.2 transcript_id=mCT180264.0
FT                   protein_id=mCP103186.0 isoform=CRA_b"
FT                   /protein_id="EDL37440.1"
FT                   /translation="PGWGRLGRMRARAGRGRSSRVARAACSRFLEPRAAWAPSAMAPAL
FT                   RSLLSPRTLLLLLLSLALLGARAEPATGSAVPAQSRPCVDCHAFEFMQRALQDLRKTAY
FT                   SLDARTETLLLQAERRALCACWPAGR"
FT   mRNA            join(<7784562..7784658,7784772..7784911,7785067..7785155,
FT                   7785923..7786033)
FT                   /locus_tag="mCG_16345"
FT                   /product="mCG16345, transcript variant mCT180265"
FT                   /note="gene_id=mCG16345.2 transcript_id=mCT180265.0 created
FT                   on 13-FEB-2003"
FT   CDS             join(<7784632..7784654,7784772..7784911,7785067..7785155,
FT                   7785923..7785988)
FT                   /codon_start=1
FT                   /locus_tag="mCG_16345"
FT                   /product="mCG16345, isoform CRA_a"
FT                   /note="gene_id=mCG16345.2 transcript_id=mCT17793.2
FT                   protein_id=mCP3991.0 isoform=CRA_a"
FT                   /protein_id="EDL37439.1"
FT                   /translation="AHLSSRDTAAWAPSAMAPALRSLLSPRTLLLLLLSLALLGARAEP
FT                   ATGSAVPAQSRPCVDCHAFEFMQRALQDLRKTAYSLDARTETLLLQAERRALCACWPAG
FT                   R"
FT   CDS             join(<7784642..7784658,7784772..7784911,7785067..7785155,
FT                   7785923..7785988)
FT                   /codon_start=1
FT                   /locus_tag="mCG_16345"
FT                   /product="mCG16345, isoform CRA_c"
FT                   /note="gene_id=mCG16345.2 transcript_id=mCT180265.0
FT                   protein_id=mCP103187.0 isoform=CRA_c"
FT                   /protein_id="EDL37441.1"
FT                   /translation="ARGTREAAWAPSAMAPALRSLLSPRTLLLLLLSLALLGARAEPAT
FT                   GSAVPAQSRPCVDCHAFEFMQRALQDLRKTAYSLDARTETLLLQAERRALCACWPAGR"
FT   CDS             join(<7784659..7784911,7785067..7785155,7785923..7785988)
FT                   /codon_start=1
FT                   /locus_tag="mCG_16345"
FT                   /product="mCG16345, isoform CRA_d"
FT                   /note="gene_id=mCG16345.2 transcript_id=mCT173998.0
FT                   protein_id=mCP96917.0 isoform=CRA_d"
FT                   /protein_id="EDL37442.1"
FT                   /translation="VRLGCGWRAVGGRGRGITSGTVRGAARCAAPLTATRCRAAWAPSA
FT                   MAPALRSLLSPRTLLLLLLSLALLGARAEPATGSAVPAQSRPCVDCHAFEFMQRALQDL
FT                   RKTAYSLDARTETLLLQAERRALCACWPAGR"
FT   gene            7797939..7804099
FT                   /gene="1110038O08Rik"
FT                   /locus_tag="mCG_16342"
FT                   /note="gene_id=mCG16342.2"
FT   mRNA            join(7797939..7798246,7799405..7799569,7801816..7804099)
FT                   /gene="1110038O08Rik"
FT                   /locus_tag="mCG_16342"
FT                   /product="RIKEN cDNA 1110038O08"
FT                   /note="gene_id=mCG16342.2 transcript_id=mCT17790.2 created
FT                   on 02-OCT-2002"
FT   CDS             join(7797991..7798246,7799405..7799569,7801816..7802183)
FT                   /codon_start=1
FT                   /gene="1110038O08Rik"
FT                   /locus_tag="mCG_16342"
FT                   /product="RIKEN cDNA 1110038O08"
FT                   /note="gene_id=mCG16342.2 transcript_id=mCT17790.2
FT                   protein_id=mCP3920.2"
FT                   /protein_id="EDL37443.1"
FT                   /translation="MWPPLPAAPGPAAAPPPAAGPQPHGGTGGAGPPEGRGVCIREFRA
FT                   AEQEAARRIFYDGILERIPNTAFRGLRQHPRTQLLYALLAALCFAVTRSLLLTCLVPAG
FT                   LLALRYYYSRKVILAYLECALHTDMADIEQYYMKPPGSCFWVAVLDGNVVGIVAARAHE
FT                   EDNTVELLRMSVDSRFRGKGIAKALGRRVLEFAMLHNYSAVVLGTTAVKVAAHKLYESL
FT                   GFRHMGASDHYVLPGMTLSLAERLFFQVRYHRYRLQLREE"
FT   gene            complement(7808222..>7917613)
FT                   /gene="Poln"
FT                   /locus_tag="mCG_16349"
FT                   /note="gene_id=mCG16349.2"
FT   mRNA            complement(join(7808222..7808542,7809873..7809934,
FT                   7810620..7810687,7816571..7816649,7817312..7817422,
FT                   7827375..7827506,7835784..7835866,7879811..7879925,
FT                   7881476..7881553,7882462..7882519,7906099..7906164,
FT                   7907886..7907984,7910515..7910610,7911550..7911633,
FT                   7915496..7915560,7916266..7916326,7917547..>7917613))
FT                   /gene="Poln"
FT                   /locus_tag="mCG_16349"
FT                   /product="DNA polymerase N"
FT                   /note="gene_id=mCG16349.2 transcript_id=mCT17797.2 created
FT                   on 02-OCT-2002"
FT   CDS             complement(join(7808462..7808542,7809873..7809934,
FT                   7810620..7810687,7816571..7816649,7817312..7817422,
FT                   7827375..7827506,7835784..7835866,7879811..7879925,
FT                   7881476..7881553,7882462..7882519,7906099..7906164,
FT                   7907886..7907984,7910515..7910610,7911550..7911633,
FT                   7915496..7915560,7916266..7916326,7917547..>7917612))
FT                   /codon_start=1
FT                   /gene="Poln"
FT                   /locus_tag="mCG_16349"
FT                   /product="DNA polymerase N"
FT                   /note="gene_id=mCG16349.2 transcript_id=mCT17797.2
FT                   protein_id=mCP4014.2"
FT                   /protein_id="EDL37444.1"
FT                   /translation="QNVCMNLKILYDLTMDLCSKLKAYGLWQLFCTLELPLIPILAVME
FT                   NHKIPVDKEEMERTSALLGARLKELEQEAHFVAGEQFLIMSNNQLREILFGKLKLHLLS
FT                   QRKHLPRTGLQNQLSTSEAMTQWRTSGVPAGPHCCATTADSCLLSWLYPIGLLGSISST
FT                   WNQTGTVTGRLSAKHPNIQGISKHPIKISKPWNFKGKEEETVTISPRTLFVSSEGHTFL
FT                   AADFSQIELRILAHLSGDPELLKLFQESERDDVFSTLTSQWKDIPIERVTHMDREQTKK
FT                   VVYSVVYGAGKERLAACLGVTVLEATHFLERFLQKYKKIKDFAQTVIGQCHSAGYVTSI
FT                   LGRRRPLPRICAQDQQLRAQAERQAVNFVVQGSAADLCKLAMIRISTAVATSPTLTARL
FT                   VAQIHDELLFEVEDTQVPEFAALVRRIMESLQQVQTLELQLQVPLKVNLSVGRSWGHLT
FT                   PLQEILGSA"
FT   gene            7898859..7899269
FT                   /pseudo
FT                   /locus_tag="mCG_1046219"
FT                   /note="gene_id=mCG1046219.1"
FT   mRNA            7898859..7899269
FT                   /pseudo
FT                   /locus_tag="mCG_1046219"
FT                   /note="gene_id=mCG1046219.1 transcript_id=mCT163923.1
FT                   created on 15-OCT-2002"
FT   gene            <7920883..7937267
FT                   /locus_tag="mCG_146324"
FT                   /note="gene_id=mCG146324.0"
FT   mRNA            join(<7920883..7921265,7921351..7921779,7936255..7936367,
FT                   7937117..7937267)
FT                   /locus_tag="mCG_146324"
FT                   /product="mCG146324"
FT                   /note="gene_id=mCG146324.0 transcript_id=mCT186427.0
FT                   created on 14-JUL-2003"
FT   CDS             join(<7921170..7921265,7921351..7921623)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146324"
FT                   /product="mCG146324"
FT                   /note="gene_id=mCG146324.0 transcript_id=mCT186427.0
FT                   protein_id=mCP107486.0"
FT                   /protein_id="EDL37445.1"
FT                   /translation="IVIWVLEKYCNIKFYLSLCSIYTPRLTSESYELLCRIHTLDLVQA
FT                   SKCSTSRHARSFLLPLHGATPTHTAEDGICSCMSTLLHPQLVQPAQEMFWASSLPTHLS
FT                   QKDPHVLNCSFFHHLMNF"
FT   gene            complement(7955770..7971346)
FT                   /gene="BC023882"
FT                   /locus_tag="mCG_16332"
FT                   /note="gene_id=mCG16332.2"
FT   mRNA            complement(join(7955770..7955996,7965419..7965647,
FT                   7967816..7968255,7969306..7970344,7971291..7971346))
FT                   /gene="BC023882"
FT                   /locus_tag="mCG_16332"
FT                   /product="cDNA sequence BC023882"
FT                   /note="gene_id=mCG16332.2 transcript_id=mCT17520.2 created
FT                   on 02-OCT-2002"
FT   CDS             complement(join(7955862..7955996,7965419..7965647,
FT                   7967816..7968255,7969306..7970214))
FT                   /codon_start=1
FT                   /gene="BC023882"
FT                   /locus_tag="mCG_16332"
FT                   /product="cDNA sequence BC023882"
FT                   /note="gene_id=mCG16332.2 transcript_id=mCT17520.2
FT                   protein_id=mCP3978.2"
FT                   /protein_id="EDL37446.1"
FT                   /translation="MSCGNEFVETLKKIGYPKADILNGEDFDWLFEDVEDESFLKWFCG
FT                   NVNEQNVLSEKELEAFSDLQRSGKPILEGTALDEVLRTCKTFDLKTCKLDDKEIQILED
FT                   EVQTLQKLNNSKIQRRNKYQLMVSETSYRFLALNAKQEEATKKLKQKQGFLNSVNTKLS
FT                   NELQGLTEEVNNLMIFFRNSNLSERTNPMVFLSQFPLGKYISQEEQSTAALTLYTKKQF
FT                   FQGMHEVVESSNEDNFQLLDIQTPSICDNEEILRERRLEMARLQMACICVQKQIIYLKT
FT                   SNLSMKSSIKWAEENLNRLTNEVIDKENLDAEISSLNSEILKLEEQITHIKDKVLPAVV
FT                   KEYAQLLNMPVVKGDFELQIAKQDYYTARQELVLNELIKQKASFELVQLSYEIELRKHW
FT                   DTYRQLESLVQQLSQRNTVLCQHLAVLSDIPASEQLTSRTPIDTKDHSTHRLYELLEGD
FT                   NKKKELFITHEHLEEVAEKLKQDVSVIQDQLAVSTQEHFFFLSKLNNDVDMLCDALYRG
FT                   GNQLLLCDQELKEHFHQVESQLNELHHLLTDILADVKTKRRILATNKLHQVER"
FT   gene            complement(7978410..>7989649)
FT                   /gene="Mxd4"
FT                   /locus_tag="mCG_16343"
FT                   /note="gene_id=mCG16343.2"
FT   mRNA            complement(join(7978410..7979029,7979478..7979640,
FT                   7980690..7980804,7989336..7989364,7989448..>7989649))
FT                   /gene="Mxd4"
FT                   /locus_tag="mCG_16343"
FT                   /product="Max dimerization protein 4"
FT                   /note="gene_id=mCG16343.2 transcript_id=mCT17791.2 created
FT                   on 17-SEP-2002"
FT   CDS             complement(join(7978872..7979029,7979478..7979640,
FT                   7980690..7980804,7989336..7989364,7989448..>7989501))
FT                   /codon_start=1
FT                   /gene="Mxd4"
FT                   /locus_tag="mCG_16343"
FT                   /product="Max dimerization protein 4"
FT                   /note="gene_id=mCG16343.2 transcript_id=mCT17791.2
FT                   protein_id=mCP3922.1"
FT                   /protein_id="EDL37447.1"
FT                   /translation="TLCCCCWRRPSTWSVGTEAEHGYASVLPRAKLRLYLEQLKQLVPL
FT                   GPDSTRHTTLSLLKRAKMHIKKLEEQDRRALSIKEQLQREHRFLKRRLEQLSVQSVERV
FT                   RTDSTGSAVSTDDSEQEVDIEGMEFGPGELDSAGSSSDADDHYSLQSSGCSDSSYGHPC
FT                   RRPGCPGLS"
FT   gene            complement(7996806..>8090159)
FT                   /gene="Zfyve28"
FT                   /locus_tag="mCG_141232"
FT                   /note="gene_id=mCG141232.0"
FT   mRNA            complement(join(7996806..7998032,7998509..7998612,
FT                   7999414..7999518,8000711..8000827,8001525..8001676,
FT                   8018498..8019802,8026889..8026990,8034090..8034179,
FT                   8035241..8035330,8036221..8036423,8037939..8038076,
FT                   8045109..8045249,8090055..>8090159))
FT                   /gene="Zfyve28"
FT                   /locus_tag="mCG_141232"
FT                   /product="zinc finger, FYVE domain containing 28"
FT                   /note="gene_id=mCG141232.0 transcript_id=mCT173999.0
FT                   created on 02-OCT-2002"
FT   CDS             complement(join(7997901..7998032,7998509..7998612,
FT                   7999414..7999518,8000711..8000827,8001525..8001676,
FT                   8018498..8019802,8026889..8026990,8034090..8034179,
FT                   8035241..8035330,8036221..8036423,8037939..8038076,
FT                   8045109..8045249,8090055..>8090159))
FT                   /codon_start=1
FT                   /gene="Zfyve28"
FT                   /locus_tag="mCG_141232"
FT                   /product="zinc finger, FYVE domain containing 28"
FT                   /note="gene_id=mCG141232.0 transcript_id=mCT173999.0
FT                   protein_id=mCP96918.0"
FT                   /protein_id="EDL37448.1"
FT                   /translation="PDPGAALQRARAARSVARAGAAMMNRFRKWLYKPKRSDPQLLAQF
FT                   YYADEELNQVAAELDSLDGRKEPQRCTLLVSQFRSCQDNVLNIINQIMEECIPQDRAPR
FT                   DFCVKFPEEIRHDNLAGQLWFGAECLAAGSIIMNRELESMAMRPLAKELTRSLEDVRGT
FT                   LRDQALRDLNTYTEKMREALRRFDVLFAEFELSYVSAMVPVKSPREYYVQQEVIVLFCE
FT                   TVERALDFGYLTQDMIDDYEPALMFTIPRLAIVCGLVVYADGPLNLDRKVEDMSELFRP
FT                   FHTLLRKIRDLLQALTEEELHTLERSLCVSQDVELPIRADTQAPSALAPTFSASLPPEE
FT                   TLSASANNPEAELACSMQYDDQELEELSRMVHRAGDEMSSLLSPPSACQSPAHRPGSEA
FT                   SPRGEASPARARLKSGSDEEERVFFMDDVEVTESPARPESPGNTFELTQGNAQQRGQDG
FT                   QSGEVGVEAPALVKEEDWSNNNVEGDKIKLASLMGSTSCSCLDSQLYLDGWEVSAEDAE
FT                   TAEMIAHRTGGMKLSATVIFNPKSPTSQDSAVAAQEAPGHGTSPLEPRAEGTGDNSHKL
FT                   STTATNCLLHSCVCCGSCGDSRDDAVERLREKCGPGSVISASNPSVSLAKGGDKEPERI
FT                   DEAQPSDVTLPAEDASNRQEPKAPASSKCLAHTSGPQVDTASRLQGEGEVKGQPEPEAR
FT                   KQDPEKSPVVSGDSPRGDVAQTEHQHLLGSSSTVGSCSLDNTRLDVATAAMPVTPMATR
FT                   EKIRSRFHGSHDLIHRLFVCISGVADQLQTNYASDLRSILKTLFEVMATKPETDDKEKL
FT                   KKVTQTLRSAALEDCALCQETVSSSELAAKTRDGDFEDPPEWVPDEACGFCTSCKAPFT
FT                   VIRRKHHCRSCGKIFCSRCSSHSAPLPRYGQVKPVRVCTHCYMFHVTPFYSDKTGM"
FT   gene            8138225..8155336
FT                   /locus_tag="mCG_16337"
FT                   /note="gene_id=mCG16337.2"
FT   mRNA            join(8138225..8138361,8144407..8144564,8148678..8148804,
FT                   8150567..8150640,8151787..8151974,8152693..8152741,
FT                   8153134..8155336)
FT                   /locus_tag="mCG_16337"
FT                   /product="mCG16337, transcript variant mCT17786"
FT                   /note="gene_id=mCG16337.2 transcript_id=mCT17786.2 created
FT                   on 13-FEB-2003"
FT   mRNA            join(<8138231..8138361,8144407..8144564,8148678..8148804,
FT                   8150567..8150646,8151815..8151974,8152693..8152741,
FT                   8153134..8155336)
FT                   /locus_tag="mCG_16337"
FT                   /product="mCG16337, transcript variant mCT193584"
FT                   /note="gene_id=mCG16337.2 transcript_id=mCT193584.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(8138255..8138304,8144407..8144564,8148678..8148804,
FT                   8150567..8150646,8151815..8151974,8152693..8152741,
FT                   8153134..8153147)
FT                   /locus_tag="mCG_16337"
FT                   /product="mCG16337, transcript variant mCT180262"
FT                   /note="gene_id=mCG16337.2 transcript_id=mCT180262.0 created
FT                   on 13-FEB-2003"
FT   mRNA            join(8138750..8138917,8144407..8144564,8148678..8148804,
FT                   8150567..8150646,8151815..8151974,8152693..8152741,
FT                   8153134..8155327)
FT                   /locus_tag="mCG_16337"
FT                   /product="mCG16337, transcript variant mCT180263"
FT                   /note="gene_id=mCG16337.2 transcript_id=mCT180263.0 created
FT                   on 13-FEB-2003"
FT   CDS             join(<8144460..8144564,8148678..8148804,8150567..8150646,
FT                   8151815..8151880)
FT                   /codon_start=1
FT                   /locus_tag="mCG_16337"
FT                   /product="mCG16337, isoform CRA_c"
FT                   /note="gene_id=mCG16337.2 transcript_id=mCT193584.0
FT                   protein_id=mCP114581.0 isoform=CRA_c"
FT                   /protein_id="EDL37451.1"
FT                   /translation="VFSGHERLRTSYHTINLGVDHFLFCGLKPESTMSTRNPQRKRRGG
FT                   TVNSRQTQKRTRETTSTPEVSLETEPIELVETVGDEIVDLTCESLEPVVVDLTHNDSVV
FT                   KGEGQGEMGGGCAKTMLTAVW"
FT   CDS             join(8144556..8144564,8148678..8148804,8150567..8150640,
FT                   8151787..8151974,8152693..8152741,8153134..8153283)
FT                   /codon_start=1
FT                   /locus_tag="mCG_16337"
FT                   /product="mCG16337, isoform CRA_a"
FT                   /note="gene_id=mCG16337.2 transcript_id=mCT17786.2
FT                   protein_id=mCP3915.2 isoform=CRA_a"
FT                   /protein_id="EDL37449.1"
FT                   /translation="MSTRNPQRKRRGGTVNSRQTQKRTRETTSTPEVSLETEPIELVET
FT                   VGDEIVDLTCESLEPVVVDLTHNDSMAENVAFSLERRRPRRNGRRLRQDHADSCVVSSD
FT                   DEELSRDKDVYVTTHTPRSTKDDGATGPRPSGTVSCPICMDGYSEIVQNGRLIVSTECG
FT                   HVFCSQCLRDSLKNANTCPTCRKKINHKRYHPIYI"
FT   CDS             join(8144556..8144564,8148678..8148804,8150567..8150646,
FT                   8151815..8151880)
FT                   /codon_start=1
FT                   /locus_tag="mCG_16337"
FT                   /product="mCG16337, isoform CRA_b"
FT                   /note="gene_id=mCG16337.2 transcript_id=mCT180262.0
FT                   protein_id=mCP103185.0 isoform=CRA_b"
FT                   /protein_id="EDL37450.1"
FT                   /translation="MSTRNPQRKRRGGTVNSRQTQKRTRETTSTPEVSLETEPIELVET
FT                   VGDEIVDLTCESLEPVVVDLTHNDSVVKGEGQGEMGGGCAKTMLTAVW"
FT   CDS             join(8144556..8144564,8148678..8148804,8150567..8150646,
FT                   8151815..8151880)
FT                   /codon_start=1
FT                   /locus_tag="mCG_16337"
FT                   /product="mCG16337, isoform CRA_b"
FT                   /note="gene_id=mCG16337.2 transcript_id=mCT180263.0
FT                   protein_id=mCP103184.0 isoform=CRA_b"
FT                   /protein_id="EDL37452.1"
FT                   /translation="MSTRNPQRKRRGGTVNSRQTQKRTRETTSTPEVSLETEPIELVET
FT                   VGDEIVDLTCESLEPVVVDLTHNDSVVKGEGQGEMGGGCAKTMLTAVW"
FT   gene            8212854..8288723
FT                   /locus_tag="mCG_16334"
FT                   /note="gene_id=mCG16334.1"
FT   mRNA            join(8212854..8213025,8222252..8222364,8222993..8223160,
FT                   8228479..8228713,8233342..8233466,8238661..8238808,
FT                   8241521..8241598,8242331..8242443,8242558..8242800,
FT                   8245507..8245660,8245794..8245964,8246868..8247119,
FT                   8260111..8260309,8261204..8261494,8263302..8263584,
FT                   8264291..8264474,8266181..8266411,8267811..8268654,
FT                   8277928..8278009,8287856..8288723)
FT                   /locus_tag="mCG_16334"
FT                   /product="mCG16334"
FT                   /note="gene_id=mCG16334.1 transcript_id=mCT17783.2 created
FT                   on 03-OCT-2002"
FT   CDS             join(8212921..8213025,8222252..8222364,8222993..8223160,
FT                   8228479..8228713,8233342..8233466,8238661..8238808,
FT                   8241521..8241598,8242331..8242443,8242558..8242800,
FT                   8245507..8245660,8245794..8245964,8246868..8247119,
FT                   8260111..8260309,8261204..8261494,8263302..8263584,
FT                   8264291..8264474,8266181..8266411,8267811..8268654,
FT                   8277928..8278009,8287856..8287949)
FT                   /codon_start=1
FT                   /locus_tag="mCG_16334"
FT                   /product="mCG16334"
FT                   /note="gene_id=mCG16334.1 transcript_id=mCT17783.2
FT                   protein_id=mCP3995.2"
FT                   /protein_id="EDL37453.1"
FT                   /translation="MAPKGNSVLHLPLWVCPDCRRTVEKEERHSGLDQPPETSGAGRLA
FT                   LGTQTMTSSGLGTTPSDACSCEACSERRDISAETEREPQQLQNYWSEVRYMVRCIYRQA
FT                   GTPLAEDQDQSLVPDKEGVKELVDRLCERDPYQLYQRLEQQAREYVLEMKVRLLRQLSA
FT                   AAKAKAPSGLQGPPQAHHFVSLLLEEYAALCQAARSISTFLGTLENEHLKKFQVTWELH
FT                   NKHLFENLVFSEPLLQSNLPALVSQIRLGTTTHDTCTEDMYSTLLQRYQRSEEELRKVA
FT                   EEWLECQKRIDAYVDEQMTMKTKQRMLTEDWEIFKQRRLIEEQLTNKKVVTGENNFTDT
FT                   RRHMLSSRLSMPDCPNCNYRRRCACDDCSLSHILTCGIMDTPVTDDIHIHQLPLQVDSA
FT                   PDYLSEMRPPSVSSASSGSGSSSPITIQQHPRLILTDNGSAPTFCSDDEDVAPLSAKFA
FT                   DIYPLTNYDDTNVVANMNGIHSELNGGGENMALKDEVSSTSRSSSEADDEDADGESSGE
FT                   PPGAPKQEEAIGNGNPKTEESNVNTPPPSYPAQQAEQTPNTCECHVCKQEASGLPASAM
FT                   TAGALPPGHQFLSPEKPTHPALHLYPHIHGHVPLHTVPHLPRPLIHPTLYPAPPFTHSK
FT                   ALPPAPVQSHTNKPQAFNASLQDHIYPSCFGNTPDWNSSKFISLWESEMMNDKNWNPGT
FT                   FLPDTISGNDILGPVLSETRPEALPPPPSNEAPAVSDIKEKKNAAKKKCLYNFQDAFME
FT                   ANEVAMANTVAMATSSATSSVSCTATTVQSSSSQFKVSSRRPPSIGDVFHGLNKEDHRH
FT                   SAPAAPRNSPTGLAPLPALSPSALSPASTPHLPNLAAPSFPKTATTAPGFVDTRKSFCP
FT                   TPVAPPPSTTDGSISAPPSVCSDPDCEGHRCENGVYDPQQDDGDESADEDSCSEHSSST
FT                   STSTNQKEGKYCDCCYCEFFGHGGPPAAPTSRNYAEMREKLRLRLTKRKEEQPKKMEQI
FT                   SEREGVVDHRRVEDLLQFINSSEAKPVSSSRAAKRARHKQRKARAREHLHHQEEQKQRE
FT                   EEEDEEEEDEEQHFKEEFQRLQELQKLRAAKKKKKDRPSKDCSKLDMLARNFQAATESI
FT                   SNSENIHNGSLEQTEEPETSSHSPSRHMNHSEPRPGPGANGDATDPVDPRDPSKLLLPK
FT                   EVNGKQHEPLAFLLDMMHHHKEGNSKQKLKQTSKTSNEPARKPTEPPKTTEVQLKPRAQ
FT                   PELKPKVVDLALLTEQKREERKTNSNNNNKKQLSHIKEEKLSTVTPEPPSPSQLLQNGR
FT                   LILASSPQPKGKNKKNKKKKGDRTSSSLDDVFLPKDIDLDSVDMDETEREVEYFKRFCL
FT                   DSARQNRQRLSINWSNFSLKKATFAAH"
FT   gene            complement(8283596..8284780)
FT                   /pseudo
FT                   /locus_tag="mCG_16350"
FT                   /note="gene_id=mCG16350.2"
FT   mRNA            complement(8283596..8284780)
FT                   /pseudo
FT                   /locus_tag="mCG_16350"
FT                   /note="gene_id=mCG16350.2 transcript_id=mCT17798.2 created
FT                   on 03-OCT-2002"
FT   gene            complement(8298218..8316141)
FT                   /gene="Tnip2"
FT                   /locus_tag="mCG_16338"
FT                   /note="gene_id=mCG16338.2"
FT   mRNA            complement(join(8298218..8299153,8301383..8301502,
FT                   8301691..8301939,8303111..8303200,8305740..8306030,
FT                   8315781..8316141))
FT                   /gene="Tnip2"
FT                   /locus_tag="mCG_16338"
FT                   /product="TNFAIP3 interacting protein 2, transcript variant
FT                   mCT17787"
FT                   /note="gene_id=mCG16338.2 transcript_id=mCT17787.2 created
FT                   on 25-SEP-2002"
FT   mRNA            complement(join(8298290..8299153,8301383..8301502,
FT                   8301691..8301939,8303111..8303200,8303661..8303723,
FT                   8305740..8306030,8315781..>8316125))
FT                   /gene="Tnip2"
FT                   /locus_tag="mCG_16338"
FT                   /product="TNFAIP3 interacting protein 2, transcript variant
FT                   mCT193585"
FT                   /note="gene_id=mCG16338.2 transcript_id=mCT193585.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(8298890..8299153,8301383..8301502,
FT                   8301691..8301939,8303111..8303200,8303661..8303723,
FT                   8305740..8306030,8315781..>8316125))
FT                   /codon_start=1
FT                   /gene="Tnip2"
FT                   /locus_tag="mCG_16338"
FT                   /product="TNFAIP3 interacting protein 2, isoform CRA_a"
FT                   /note="gene_id=mCG16338.2 transcript_id=mCT193585.0
FT                   protein_id=mCP114582.0 isoform=CRA_a"
FT                   /protein_id="EDL37454.1"
FT                   /translation="LVFAPPVWRSWRRPSPHGRPTAMSSGDPRSGRQDGAPRAAAALCG
FT                   LYHEAGQQLQRLKDQLAARDALIASLRTRLAALEGHTAPSLVDALLDQVERFREQLRRQ
FT                   EEGASETQLRQEVERLTERLEEKEREMQQLMSQPQHEQEKEVVLLRRSVAEKEKARAAS
FT                   DVLCRSLADETHQLRRTLAATAHMCQHLAKCLDERQCAQGDAGEKSPAEEVRWICGQAY
FT                   TKDLKKPPGCWLEQTSSDASGQSVIKKLQEENRLLKQKVTHVEDLNAKWQRYDASRDEY
FT                   VKGLHAQLKRRQVPLEPELMKKEISRLNRQLEEKISDCAEANQELTAMRMSRDTALERV
FT                   QMLEQQILAYKDDFKSERADRERAHSRIQELEEKIMSLMYQVSQRQDSREPGPCRIHTG
FT                   NKTAKYLEMDALEHVTPGGWRPESRSQQMEPSAEGGHVCTAQRGQGDLQCPHCLRCFSD
FT                   EQGEAFLRHLSECCQ"
FT   CDS             complement(join(8298890..8299153,8301383..8301502,
FT                   8301691..8301939,8303111..8303200,8305740..8306030,
FT                   8315781..8316059))
FT                   /codon_start=1
FT                   /gene="Tnip2"
FT                   /locus_tag="mCG_16338"
FT                   /product="TNFAIP3 interacting protein 2, isoform CRA_b"
FT                   /note="gene_id=mCG16338.2 transcript_id=mCT17787.2
FT                   protein_id=mCP3885.2 isoform=CRA_b"
FT                   /protein_id="EDL37455.1"
FT                   /translation="MSSGDPRSGRQDGAPRAAAALCGLYHEAGQQLQRLKDQLAARDAL
FT                   IASLRTRLAALEGHTAPSLVDALLDQVERFREQLRRQEEGASETQLRQEVERLTERLEE
FT                   KEREMQQLMSQPQHEQEKEVVLLRRSVAEKEKARAASDVLCRSLADETHQLRRTLAATA
FT                   HMCQHLAKCLDERQCAQGDAGEKSPAELEQTSSDASGQSVIKKLQEENRLLKQKVTHVE
FT                   DLNAKWQRYDASRDEYVKGLHAQLKRRQVPLEPELMKKEISRLNRQLEEKISDCAEANQ
FT                   ELTAMRMSRDTALERVQMLEQQILAYKDDFKSERADRERAHSRIQELEEKIMSLMYQVS
FT                   QRQDSREPGPCRIHTGNKTAKYLEMDALEHVTPGGWRPESRSQQMEPSAEGGHVCTAQR
FT                   GQGDLQCPHCLRCFSDEQGEAFLRHLSECCQ"
FT   gene            8328057..8365816
FT                   /gene="Sh3bp2"
FT                   /locus_tag="mCG_16341"
FT                   /note="gene_id=mCG16341.2"
FT   mRNA            join(8328057..8328164,8353821..8353961,8354998..8355100,
FT                   8357718..8357835,8358203..8358273,8359152..8359240,
FT                   8361262..>8361389)
FT                   /gene="Sh3bp2"
FT                   /locus_tag="mCG_16341"
FT                   /product="SH3-domain binding protein 2, transcript variant
FT                   mCT173412"
FT                   /note="gene_id=mCG16341.2 transcript_id=mCT173412.0 created
FT                   on 17-SEP-2002"
FT   mRNA            join(8328112..8328164,8353822..8353961,8354998..8355100,
FT                   8357718..8357835,8358203..8358273,8359152..8359240,
FT                   8359556..8359624,8361262..8361910,8362605..8362713,
FT                   8362950..8363005,8363287..8363368,8363864..8363923,
FT                   8364620..8365816)
FT                   /gene="Sh3bp2"
FT                   /locus_tag="mCG_16341"
FT                   /product="SH3-domain binding protein 2, transcript variant
FT                   mCT17789"
FT                   /note="gene_id=mCG16341.2 transcript_id=mCT17789.0 created
FT                   on 17-SEP-2002"
FT   CDS             join(8353826..8353961,8354998..8355100,8357718..8357835,
FT                   8358203..8358273,8359152..8359240,8359556..8359624,
FT                   8361262..8361910,8362605..8362713,8362950..8363005,
FT                   8363287..8363368,8363864..8363923,8364620..8364757)
FT                   /codon_start=1
FT                   /gene="Sh3bp2"
FT                   /locus_tag="mCG_16341"
FT                   /product="SH3-domain binding protein 2, isoform CRA_a"
FT                   /note="gene_id=mCG16341.2 transcript_id=mCT17789.0
FT                   protein_id=mCP3899.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q5U3L0"
FT                   /db_xref="InterPro:IPR000980"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="MGI:MGI:1346349"
FT                   /db_xref="UniProtKB/TrEMBL:Q5U3L0"
FT                   /protein_id="EDL37456.1"
FT                   /translation="MAAEEMQWPVPMKAIGAQNLLTMPGGVAKAGYLHKKGGTQLQLLK
FT                   WPLRFVIIHKRCIYYFKSSTSASPQGAFSLSGYNRVMRAAEETTSNNVFPFKIIHISKK
FT                   HRTWFFSASSEDERKSWMALLRREIGHFHEKKELPLDTSDSSSDTDSFYGAVERPIDIS
FT                   LSSYPMDNEDYEHEDEDDSYLEPDSPGPMKLEDALTYPPAYPPPPVPVPRKPAFSDLPR
FT                   AHSFTSKSPSPLLPPPPPKRGLPDTGSAPEDAKDALGLRRVEPGLRVPATPRRMSDPPM
FT                   SNVPTVPNLRKHPCFRDSVNPGLEPWTPGHGTSSVSSSTTMAVATSRNCDKLKSFHLSS
FT                   RGPPTSEPPPVPANKPKFLKIAEEPSPREAAKFAPVPPVAPRPPVQKMPMPEATVRPAV
FT                   LPRPENTPLPHLQRSPPDGQSFRGFSFEKARQPSQADTGEEDSDEDYEKVPLPNSVFVN
FT                   TTESCEVERLFKATDPRGEPQDGLYCIRNSSTKSGKVLVVWDESSNKVRNYRIFEKDSK
FT                   FYLEGEVLFASVGSMVEHYHTHVLPSHQSLLLRHPYGYAGPR"
FT   CDS             join(8353826..8353961,8354998..8355100,8357718..8357835,
FT                   8358203..8358273,8359152..8359240,8361262..>8361389)
FT                   /codon_start=1
FT                   /gene="Sh3bp2"
FT                   /locus_tag="mCG_16341"
FT                   /product="SH3-domain binding protein 2, isoform CRA_b"
FT                   /note="gene_id=mCG16341.2 transcript_id=mCT173412.0
FT                   protein_id=mCP96331.0 isoform=CRA_b"
FT                   /protein_id="EDL37457.1"
FT                   /translation="MAAEEMQWPVPMKAIGAQNLLTMPGGVAKAGYLHKKGGTQLQLLK
FT                   WPLRFVIIHKRCIYYFKSSTSASPQGAFSLSGYNRVMRAAEETTSNNVFPFKIIHISKK
FT                   HRTWFFSASSEDERKSWMALLRREIGHFHEKKELPLDTSDSSSDTDSFYGAVERPIDIS
FT                   LSSYPMDNEDALTYPPAYPPPPVPVPRKPAFSDLPRAHSFTSKSPSPLLPPP"
FT   gene            8376082..8434539
FT                   /gene="Add1"
FT                   /locus_tag="mCG_122447"
FT                   /note="gene_id=mCG122447.2"
FT   mRNA            join(8376082..8376156,8403559..8403773,8406925..8407087,
FT                   8408063..8408214,8412427..8412507,8412725..8412874,
FT                   8415523..8415666,8415754..8415852,8416419..8416595,
FT                   8418797..8419048,8421584..8421685,8422279..8422368,
FT                   8427513..8427669,8430649..8430747,8431370..8431406,
FT                   8432704..8433849)
FT                   /gene="Add1"
FT                   /locus_tag="mCG_122447"
FT                   /product="adducin 1 (alpha), transcript variant mCT123665"
FT                   /note="gene_id=mCG122447.2 transcript_id=mCT123665.0
FT                   created on 18-SEP-2002"
FT   mRNA            join(<8376104..8376156,8403559..8403773,8406925..8407087,
FT                   8408063..8408214,8412427..8412507,8412725..8412874,
FT                   8415523..8415666,8415754..8415852,8416419..8416595,
FT                   8418797..8419141,8421584..8421685,8422279..8422368,
FT                   8427513..8427669,8430649..8430747,8431370..8431406,
FT                   8432704..8434539)
FT                   /gene="Add1"
FT                   /locus_tag="mCG_122447"
FT                   /product="adducin 1 (alpha), transcript variant mCT193603"
FT                   /note="gene_id=mCG122447.2 transcript_id=mCT193603.0
FT                   created on 09-MAR-2004"
FT   mRNA            join(8376117..8376156,8400404..8400682,8403559..8403773,
FT                   8406925..8407087,8408063..8408214,8412427..8412507,
FT                   8412725..8412874,8415523..8415666,8415754..8415852,
FT                   8416419..8416595,8418797..8419048,8421584..8421685,
FT                   8422279..8422368,8427513..8427669,8430649..8430747,
FT                   8432704..8434531)
FT                   /gene="Add1"
FT                   /locus_tag="mCG_122447"
FT                   /product="adducin 1 (alpha), transcript variant mCT173396"
FT                   /note="gene_id=mCG122447.2 transcript_id=mCT173396.0
FT                   created on 18-SEP-2002"
FT   CDS             join(<8403567..8403773,8406925..8407087,8408063..8408214,
FT                   8412427..8412507,8412725..8412874,8415523..8415666,
FT                   8415754..8415852,8416419..8416595,8418797..8419141,
FT                   8421584..8421685,8422279..8422368,8427513..8427669,
FT                   8430649..8430747,8431370..8431406,8432704)
FT                   /codon_start=1
FT                   /gene="Add1"
FT                   /locus_tag="mCG_122447"
FT                   /product="adducin 1 (alpha), isoform CRA_b"
FT                   /note="gene_id=mCG122447.2 transcript_id=mCT193603.0
FT                   protein_id=mCP114566.0 isoform=CRA_b"
FT                   /protein_id="EDL37459.1"
FT                   /translation="ENCAMNGDTRAAVVTSPPPTTAPHKERYFDRVDENNPEYLRERNM
FT                   APDLRQDFNMMEQKKRVSMILQSPAFCEELESMIQEQFKKGKNPTGLLALQQIADFMTA
FT                   SVPNVYPAAPQGGMAALNMSLGMVTPVNDLRGSDSIAYDKGEKLLRCKLAAFYRLADLF
FT                   GWSQLIYNHITTRVNSEQEHFLIVPFGLLYSEVTASSLVKVNLQGDIVDRGSTNLGVNQ
FT                   AGFTLHSAVYAARPDAKCIVHIHTPAGAAVSAMKCGLLPISPEALSLGDVAYHDYHGIL
FT                   VDEEEKILIQKNLGPKSKVLILRNHGLVSVGESVEEAFYYIHNLVVACEIQVRTLASAG
FT                   GPDNLVLLDPGKYKAKSRSPGTPAGEGSGSPPKWQIGEQEFEALMRMLDNLGYRTGYPY
FT                   RYPALRERSKKYSDVEVPASVTGHSFASDGDSGTCSPLRHSFQKQQREKTRWLHSGRGD
FT                   DASEEGQNGSSPKSKTKVWTNITHDHVKPLLQSLSSGVCVPSCITNCLWTKEDGHRTST
FT                   SAVPNLFVPLNTNPKEVQEMRNKIREQNLQDIKTAGPQSQVLCGVMMDRSLVQGELVTA
FT                   SKAIIEKEYQPHVIVSTTGPNPFNTLTDRELEEYRREVERKQKGSEENLDETREQKEKS
FT                   PPDQSAVPNTPPSTPVKLEEAGDGCAKEYLLP"
FT   CDS             join(8403579..8403773,8406925..8407087,8408063..8408214,
FT                   8412427..8412507,8412725..8412874,8415523..8415666,
FT                   8415754..8415852,8416419..8416595,8418797..8419048,
FT                   8421584..8421685,8422279..8422368,8427513..8427669,
FT                   8430649..8430747,8432704..8433050)
FT                   /codon_start=1
FT                   /gene="Add1"
FT                   /locus_tag="mCG_122447"
FT                   /product="adducin 1 (alpha), isoform CRA_c"
FT                   /note="gene_id=mCG122447.2 transcript_id=mCT173396.0
FT                   protein_id=mCP96315.0 isoform=CRA_c"
FT                   /protein_id="EDL37460.1"
FT                   /translation="MNGDTRAAVVTSPPPTTAPHKERYFDRVDENNPEYLRERNMAPDL
FT                   RQDFNMMEQKKRVSMILQSPAFCEELESMIQEQFKKGKNPTGLLALQQIADFMTASVPN
FT                   VYPAAPQGGMAALNMSLGMVTPVNDLRGSDSIAYDKGEKLLRCKLAAFYRLADLFGWSQ
FT                   LIYNHITTRVNSEQEHFLIVPFGLLYSEVTASSLVKVNLQGDIVDRGSTNLGVNQAGFT
FT                   LHSAVYAARPDAKCIVHIHTPAGAAVSAMKCGLLPISPEALSLGDVAYHDYHGILVDEE
FT                   EKILIQKNLGPKSKVLILRNHGLVSVGESVEEAFYYIHNLVVACEIQVRTLASAGGPDN
FT                   LVLLDPGKYKAKSRSPGTPAGEGSGSPPKWQIGEQEFEALMRMLDNLGYRTGYPYRYPA
FT                   LRERSKKYSDVEVPASVTGHSFASDGDSGTCSPLRHSFQKQQREKTRWLHSGRGDDASE
FT                   EGQNGSSPKSKTKWTKEDGHRTSTSAVPNLFVPLNTNPKEVQEMRNKIREQNLQDIKTA
FT                   GPQSQVLCGVMMDRSLVQGELVTASKAIIEKEYQPHVIVSTTGPNPFNTLTDRELEEYR
FT                   REVERKQKGSEENLDETREQKEKSPPDQSAVPNTPPSTPVKLEEDLPQEPTSRDDSDAT
FT                   TFKPTPPDLSPDEPSEALAFPAVEEEAHASPDPTQPPAEADPEPASAPTPGAEEVASPA
FT                   TEEGSPMDPGSDGSPGKSPSKKKKKFRTPSFLKKSKKKSDS"
FT   CDS             join(8403579..8403773,8406925..8407087,8408063..8408214,
FT                   8412427..8412507,8412725..8412874,8415523..8415666,
FT                   8415754..8415852,8416419..8416595,8418797..8419048,
FT                   8421584..8421685,8422279..8422368,8427513..8427669,
FT                   8430649..8430747,8431370..8431406,8432704)
FT                   /codon_start=1
FT                   /gene="Add1"
FT                   /locus_tag="mCG_122447"
FT                   /product="adducin 1 (alpha), isoform CRA_a"
FT                   /note="gene_id=mCG122447.2 transcript_id=mCT123665.0
FT                   protein_id=mCP65087.1 isoform=CRA_a"
FT                   /protein_id="EDL37458.1"
FT                   /translation="MNGDTRAAVVTSPPPTTAPHKERYFDRVDENNPEYLRERNMAPDL
FT                   RQDFNMMEQKKRVSMILQSPAFCEELESMIQEQFKKGKNPTGLLALQQIADFMTASVPN
FT                   VYPAAPQGGMAALNMSLGMVTPVNDLRGSDSIAYDKGEKLLRCKLAAFYRLADLFGWSQ
FT                   LIYNHITTRVNSEQEHFLIVPFGLLYSEVTASSLVKVNLQGDIVDRGSTNLGVNQAGFT
FT                   LHSAVYAARPDAKCIVHIHTPAGAAVSAMKCGLLPISPEALSLGDVAYHDYHGILVDEE
FT                   EKILIQKNLGPKSKVLILRNHGLVSVGESVEEAFYYIHNLVVACEIQVRTLASAGGPDN
FT                   LVLLDPGKYKAKSRSPGTPAGEGSGSPPKWQIGEQEFEALMRMLDNLGYRTGYPYRYPA
FT                   LRERSKKYSDVEVPASVTGHSFASDGDSGTCSPLRHSFQKQQREKTRWLHSGRGDDASE
FT                   EGQNGSSPKSKTKWTKEDGHRTSTSAVPNLFVPLNTNPKEVQEMRNKIREQNLQDIKTA
FT                   GPQSQVLCGVMMDRSLVQGELVTASKAIIEKEYQPHVIVSTTGPNPFNTLTDRELEEYR
FT                   REVERKQKGSEENLDETREQKEKSPPDQSAVPNTPPSTPVKLEEAGDGCAKEYLLP"
FT   gene            complement(8435880..>8439418)
FT                   /gene="0610009O03Rik"
FT                   /locus_tag="mCG_2550"
FT                   /note="gene_id=mCG2550.2"
FT   mRNA            complement(join(8435880..8436248,8436365..8436454,
FT                   8436527..8436574,8436657..8436747,8436825..8436933,
FT                   8437085..8437196,8437285..8437393,8437604..8437765,
FT                   8437843..8438001,8438255..8438358,8438644..8438740,
FT                   8438828..8439017,8439333..>8439418))
FT                   /gene="0610009O03Rik"
FT                   /locus_tag="mCG_2550"
FT                   /product="RIKEN cDNA 0610009O03, transcript variant
FT                   mCT193644"
FT                   /note="gene_id=mCG2550.2 transcript_id=mCT193644.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(8435883..8436248,8436365..8436454,
FT                   8436527..8436574,8436657..8436747,8436825..8436933,
FT                   8437085..8437196,8437285..8437393,8437604..8437765,
FT                   8437843..8438001,8438255..8438358,8438644..8438740,
FT                   8438828..8439017,8439161..8439361))
FT                   /gene="0610009O03Rik"
FT                   /locus_tag="mCG_2550"
FT                   /product="RIKEN cDNA 0610009O03, transcript variant
FT                   mCT1553"
FT                   /note="gene_id=mCG2550.2 transcript_id=mCT1553.1 created on
FT                   18-SEP-2002"
FT   CDS             complement(join(8436133..8436248,8436365..8436454,
FT                   8436527..8436574,8436657..8436747,8436825..8436933,
FT                   8437085..8437196,8437285..8437393,8437604..8437765,
FT                   8437843..8438001,8438255..8438358,8438644..8438740,
FT                   8438828..8439017,8439333..>8439418))
FT                   /codon_start=1
FT                   /gene="0610009O03Rik"
FT                   /locus_tag="mCG_2550"
FT                   /product="RIKEN cDNA 0610009O03, isoform CRA_a"
FT                   /note="gene_id=mCG2550.2 transcript_id=mCT193644.0
FT                   protein_id=mCP114617.0 isoform=CRA_a"
FT                   /protein_id="EDL37461.1"
FT                   /translation="VAAIQGGSLFIHPFVPAWSCGTCAQVPAGVGASTMGWAGDAGCTP
FT                   RPPIRPRPASERRVIIVLFLGLLLDLLAFTLLLPLLPGLLERHGREQDPLYGSWQRGVD
FT                   WFASAIGMPAEKRYNSVLFGGLIGSAFSLLQFFSAPLTGAASDYLGRRPVMMLSLTGLA
FT                   ISYAVWATSRSFKAFLASRVIGGISKGNVNLSTAIVADLGSPPTRSQGMAVIGVAFSLA
FT                   FTLGPMLGAFLSVEMVPWISLLFAISDMLFIFCFLPETLPQEKRASSVTLGFHTAAHLL
FT                   SPLALLRFAAVTHSQDPPAEHRLRNLRRLGLVYFLYLFLFSGLEYTLSFLAHQRFQFSS
FT                   LQQGKMFFFIGLTMATIQGTYARRISPGKEAAAVTRAMLLLVPAFLLIGWAHSLPTLGL
FT                   GLMLYSFAAAVVVPGLSTMVSSYGSPGQKGTIMGILRSLGALGRALGPVVAASVYWLTG
FT                   AQVCFTVCSALFLLPFLLLWKLKHPAETSKEE"
FT   CDS             complement(join(8436133..8436248,8436365..8436454,
FT                   8436527..8436574,8436657..8436747,8436825..8436933,
FT                   8437085..8437196,8437285..8437393,8437604..8437765,
FT                   8437843..8438001,8438255..8438358,8438644..8438740,
FT                   8438828..8439001))
FT                   /codon_start=1
FT                   /gene="0610009O03Rik"
FT                   /locus_tag="mCG_2550"
FT                   /product="RIKEN cDNA 0610009O03, isoform CRA_b"
FT                   /note="gene_id=mCG2550.2 transcript_id=mCT1553.1
FT                   protein_id=mCP3901.2 isoform=CRA_b"
FT                   /protein_id="EDL37462.1"
FT                   /translation="MGWAGDAGCTPRPPIRPRPASERRVIIVLFLGLLLDLLAFTLLLP
FT                   LLPGLLERHGREQDPLYGSWQRGVDWFASAIGMPAEKRYNSVLFGGLIGSAFSLLQFFS
FT                   APLTGAASDYLGRRPVMMLSLTGLAISYAVWATSRSFKAFLASRVIGGISKGNVNLSTA
FT                   IVADLGSPPTRSQGMAVIGVAFSLAFTLGPMLGAFLSVEMVPWISLLFAISDMLFIFCF
FT                   LPETLPQEKRASSVTLGFHTAAHLLSPLALLRFAAVTHSQDPPAEHRLRNLRRLGLVYF
FT                   LYLFLFSGLEYTLSFLAHQRFQFSSLQQGKMFFFIGLTMATIQGTYARRISPGKEAAAV
FT                   TRAMLLLVPAFLLIGWAHSLPTLGLGLMLYSFAAAVVVPGLSTMVSSYGSPGQKGTIMG
FT                   ILRSLGALGRALGPVVAASVYWLTGAQVCFTVCSALFLLPFLLLWKLKHPAETSKEE"
FT   gene            complement(8440770..8465031)
FT                   /gene="2610033H07Rik"
FT                   /locus_tag="mCG_2543"
FT                   /note="gene_id=mCG2543.1"
FT   mRNA            complement(join(8440770..8440885,8441125..8441280,
FT                   8441419..8441537,8443104..8443251,8446748..8446907,
FT                   8448807..8448960,8449594..8449695,8452046..8452181,
FT                   8453276..8453361,8454227..8454357,8455234..8455528,
FT                   8456658..8456789,8457204..8457326,8458791..8458925,
FT                   8459344..8459477,8461649..8461790,8462783..8462917,
FT                   8464759..8465031))
FT                   /gene="2610033H07Rik"
FT                   /locus_tag="mCG_2543"
FT                   /product="RIKEN cDNA 2610033H07, transcript variant
FT                   mCT1559"
FT                   /note="gene_id=mCG2543.1 transcript_id=mCT1559.2 created on
FT                   25-SEP-2002"
FT   mRNA            complement(join(8440771..8440885,8441125..8441280,
FT                   8441419..8441537,8443104..8443251,8445562..8445721,
FT                   8448807..8448960,8449594..8449695,8452046..8452181,
FT                   8453276..8453361,8454227..8454357,8455234..8455528,
FT                   8456658..8456789,8457204..8457326,8458791..8458925,
FT                   8459344..8459477,8461649..8461790,8462783..8462917,
FT                   8464759..>8464977))
FT                   /gene="2610033H07Rik"
FT                   /locus_tag="mCG_2543"
FT                   /product="RIKEN cDNA 2610033H07, transcript variant
FT                   mCT193626"
FT                   /note="gene_id=mCG2543.1 transcript_id=mCT193626.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(8440771..8440885,8441125..8441280,
FT                   8441419..8441537,8443104..8443251,8443557..8443716,
FT                   8448807..>8448919))
FT                   /gene="2610033H07Rik"
FT                   /locus_tag="mCG_2543"
FT                   /product="RIKEN cDNA 2610033H07, transcript variant
FT                   mCT173699"
FT                   /note="gene_id=mCG2543.1 transcript_id=mCT173699.0 created
FT                   on 25-SEP-2002"
FT   CDS             complement(join(8440786..8440885,8441125..8441280,
FT                   8441419..8441537,8443104..8443251,8445562..8445721,
FT                   8448807..8448960,8449594..8449695,8452046..8452181,
FT                   8453276..8453361,8454227..8454357,8455234..8455528,
FT                   8456658..8456789,8457204..8457326,8458791..8458925,
FT                   8459344..8459477,8461649..8461790,8462783..8462917,
FT                   8464759..>8464977))
FT                   /codon_start=1
FT                   /gene="2610033H07Rik"
FT                   /locus_tag="mCG_2543"
FT                   /product="RIKEN cDNA 2610033H07, isoform CRA_b"
FT                   /note="gene_id=mCG2543.1 transcript_id=mCT193626.0
FT                   protein_id=mCP114597.0 isoform=CRA_b"
FT                   /protein_id="EDL37464.1"
FT                   /translation="PKCGGVNVMGKAKRTGARRQVHKAPAGASGGPAKTNPNPFEVKVN
FT                   RQKFQILGRKTRHDVGLPGVSRARAIRKRTQTLLKEYKERNKSNVFADKRFGEYNSNIS
FT                   PEEKMMKRFALEQQRYHEKKNIYNLNEDEELTHYGQSLADIEKHNDIVDSDSDTEDRGA
FT                   LSAELTASHFGGGVHKNSSQKEGEDGDKPKTRKELIEELIAKSKQEKRERQAQREDALE
FT                   LTEKLDQDWKEIQILMSRKPKKSEDKEKKEKPQPDEYDMMVRELGFEMKAQPSNRMKTE
FT                   EELAKEEQERLKKLEAERLRRMLGKDEHENKKKPKHTSADDLNDGFILDKDDRRLLSYK
FT                   DGKMNIEDVQEEQSKEADGQENDQKEGEDDSEEEDESHEDSEESEDPDSHSDLESNIES
FT                   EEENETPKKEQRQTPGGKLPKDDQKAQKAVAAELPYVFAAPESFEELKFLLSGRSMEEQ
FT                   LLVVERIQKCNHPSLAVGNKAKLEKLFGFLLQYIGDLATDSTPDLKTIDKLVVHLYSLC
FT                   QMFPESASDSIRFVLRDAMHEMEEMIETKGRAAFPGLDVLIYLKITGLLFPTSDFWHPV
FT                   VTPALLCMSQMLTKCPVMSLQDVIKGLFVCCLFLEYVSLSRRFIPELFNFLLGILYIAT
FT                   PNTKSQGSTLVHPFRALGKNSELLVVSDKADVTTWQRGSLPLHWANRLSTLTATEANHT
FT                   RLSCVASCLSLMKHCVLMYQALPSFHAIFRPHQALLSKHLADCSLPQELQELAQSILSA
FT                   MEGQKQHCRPLVCEKSKPVPLKQFTPRLVKVLEFGRKQGSSKEEQERKRLIHKHKREFK
FT                   GAVREIRKDNQFLARMQLSEIMERDAERKRKVKQLFNSLATQEGEWKALKRKKFKK"
FT   CDS             complement(join(8440786..8440885,8441125..8441280,
FT                   8441419..8441537,8443104..8443251,8446748..8446907,
FT                   8448807..8448960,8449594..8449695,8452046..8452181,
FT                   8453276..8453361,8454227..8454357,8455234..8455528,
FT                   8456658..8456789,8457204..8457326,8458791..8458925,
FT                   8459344..8459477,8461649..8461790,8462783..8462917,
FT                   8464759..8464953))
FT                   /codon_start=1
FT                   /gene="2610033H07Rik"
FT                   /locus_tag="mCG_2543"
FT                   /product="RIKEN cDNA 2610033H07, isoform CRA_a"
FT                   /note="gene_id=mCG2543.1 transcript_id=mCT1559.2
FT                   protein_id=mCP3945.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q8R3N1"
FT                   /db_xref="InterPro:IPR007276"
FT                   /db_xref="MGI:MGI:1922666"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8R3N1"
FT                   /protein_id="EDL37463.1"
FT                   /translation="MGKAKRTGARRQVHKAPAGASGGPAKTNPNPFEVKVNRQKFQILG
FT                   RKTRHDVGLPGVSRARAIRKRTQTLLKEYKERNKSNVFADKRFGEYNSNISPEEKMMKR
FT                   FALEQQRYHEKKNIYNLNEDEELTHYGQSLADIEKHNDIVDSDSDTEDRGALSAELTAS
FT                   HFGGGVHKNSSQKEGEDGDKPKTRKELIEELIAKSKQEKRERQAQREDALELTEKLDQD
FT                   WKEIQILMSRKPKKSEDKEKKEKPQPDEYDMMVRELGFEMKAQPSNRMKTEEELAKEEQ
FT                   ERLKKLEAERLRRMLGKDEHENKKKPKHTSADDLNDGFILDKDDRRLLSYKDGKMNIED
FT                   VQEEQSKEADGQENDQKEGEDDSEEEDESHEDSEESEDPDSHSDLESNIESEEENETPK
FT                   KEQRQTPGGKLPKDDQKAQKAVAAELPYVFAAPESFEELKFLLSGRSMEEQLLVVERIQ
FT                   KCNHPSLAVGNKAKLEKLFGFLLQYIGDLATDSTPDLKTIDKLVVHLYSLCQMFPESAS
FT                   DSIRFVLRDAMHEMEEMIETKGRAAFPGLDVLIYLKITGLLFPTSDFWHPVVTPALLCM
FT                   SQMLTKCPVMSLQDVIKGLFVCCLFLEYVSLSRRFIPELFNFLLGILYIATPNTKSQGS
FT                   TLVHPFRALGKNSELLVVSDKADVTTWQRGSLPLHWANRLSTLTATEANHTRLSCVASC
FT                   LSLMKHCVLMYQALPSFHAIFRPHQALLSKHLADCSLPQELQELAQSILSAMEGQKQHC
FT                   RPLVCEKSKPVPLKQFTPRLVKVLEFGRKQGSSKEEQERKRLIHKHKREFKGAVREIRK
FT                   DNQFLARMQLSEIMERDAERKRKVKQLFNSLATQEGEWKALKRKKFKK"
FT   CDS             complement(join(8440786..8440885,8441125..8441280,
FT                   8441419..8441537,8443104..8443251,8443557..8443716,
FT                   8448807..>8448918))
FT                   /codon_start=1
FT                   /gene="2610033H07Rik"
FT                   /locus_tag="mCG_2543"
FT                   /product="RIKEN cDNA 2610033H07, isoform CRA_c"
FT                   /note="gene_id=mCG2543.1 transcript_id=mCT173699.0
FT                   protein_id=mCP96618.0 isoform=CRA_c"
FT                   /protein_id="EDL37465.1"
FT                   /translation="VCCLFLEYVSLSRRFIPELFNFLLGILYIATPNTKSQGSTLVHPF
FT                   RALGKNSELLVVSDKADVTTWQRGSLPLHWANRLSTLTATEANHTRLSCVASCLSLMKH
FT                   CVLMYQALPSFHAIFRPHQALLSKHLADCSLPQELQELAQSILSAMEGQKQHCRPLVCE
FT                   KSKPVPLKQFTPRLVKVLEFGRKQGSSKEEQERKRLIHKHKREFKGAVREIRKDNQFLA
FT                   RMQLSEIMERDAERKRKVKQLFNSLATQEGEWKALKRKKFKK"
FT   gene            8465286..8560724
FT                   /gene="Gprk2l"
FT                   /locus_tag="mCG_2548"
FT                   /note="gene_id=mCG2548.2"
FT   mRNA            join(8465286..8465912,8474018..8474110,8479438..8479550,
FT                   8481014..8481088,8499773..8499879,8515160..8515252,
FT                   8516725..8516788,8521216..8521356,8524728..8524918,
FT                   8535030..8535067,8536506..8536595,8550137..8550345,
FT                   8553153..8553290,8556529..8556666,8557110..8557241,
FT                   8560565..8560724)
FT                   /gene="Gprk2l"
FT                   /locus_tag="mCG_2548"
FT                   /product="G protein-coupled receptor kinase 2, groucho gene
FT                   related (Drosophila)"
FT                   /note="gene_id=mCG2548.2 transcript_id=mCT1552.1 created on
FT                   18-SEP-2002"
FT   CDS             join(8465861..8465912,8474018..8474110,8479438..8479550,
FT                   8481014..8481088,8499773..8499879,8515160..8515252,
FT                   8516725..8516788,8521216..8521356,8524728..8524918,
FT                   8535030..8535067,8536506..8536595,8550137..8550345,
FT                   8553153..8553290,8556529..8556666,8557110..8557241,
FT                   8560565..8560615)
FT                   /codon_start=1
FT                   /gene="Gprk2l"
FT                   /locus_tag="mCG_2548"
FT                   /product="G protein-coupled receptor kinase 2, groucho gene
FT                   related (Drosophila)"
FT                   /note="gene_id=mCG2548.2 transcript_id=mCT1552.1
FT                   protein_id=mCP4016.0"
FT                   /db_xref="GOA:O70291"
FT                   /db_xref="InterPro:IPR000239"
FT                   /db_xref="InterPro:IPR000342"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000961"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR016137"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="MGI:MGI:95801"
FT                   /db_xref="UniProtKB/Swiss-Prot:O70291"
FT                   /protein_id="EDL37466.1"
FT                   /translation="MELENFVANNLLLKARLGFNKQTGRSKKWRELLKFPPVSMCTELR
FT                   WSIEKDFSSLCDKQPIGRLLFRQFCDTKPDLKRCIEFLDAVAEYEVTIEEEQREFGLAI
FT                   FSRFFKEKSEVPLPEIPPDIVKECKWNLKQNSPSQNVFEECAGIVCKYLSETPFEEYQE
FT                   STYFNRFLQWKWLERRPVTKNTFRQYRVLGKGGFGEVCACQVRATGKMYACKKLEKKRI
FT                   KKRKGEAMALNEKRILEKLHSRFVVSLAYTYETKDALCLVLTIMNGGDLKYHIYNLGDP
FT                   GFEEPRAVFYAAELCCGLEDLQRKRIVYRDLKPENILLDDHGHIRISDLGLAMEVPEGE
FT                   MVRGRVGTVGYMAPEIINHEKYTFSPDWWGLGCLIYEMIAGHSPFRKYKEKVNREELER
FT                   RVKNETEEYSERFSEDAKSICSMLLIKDPSKRLGCQRDGVSAVKQHPIFKDINFSRLEA
FT                   NMLDPPFIPDPQAIYCRNILDIGQFSVVKGVNLDTNDEIFYAEFATGSVTIPWQNEMIE
FT                   SGCFKDLNENEDDLSSLEKYKMCSSILRPKRNFFRRLFRRTGCLNIALSEEREPTEH"
FT   gene            8567165..8718141
FT                   /gene="Hdh"
FT                   /locus_tag="mCG_2547"
FT                   /note="gene_id=mCG2547.2"
FT   mRNA            join(8567165..8567530,8588164..8588247,8595669..8595789,
FT                   8599507..8599566,8601293..8601372,8604778..8604916,
FT                   8608979..8609120,8609763..8609941,8611834..8612038,
FT                   8613130..8613177,8616696..8616776,8618113..8618453,
FT                   8622404..8622530,8622959..8623077,8623860..8623971,
FT                   8624158..8624295,8625212..8625370,8625463..8625560,
FT                   8626973..8627112,8629123..8629186,8629620..8629720,
FT                   8630077..8630223,8631209..8631329,8632517..8632593,
FT                   8633734..8633885,8634932..8635134,8637822..8637948,
FT                   8639516..8639643,8648047..8648157,8651246..8651323,
FT                   8652710..8652933,8653987..8654065,8654193..8654354,
FT                   8656462..8656517,8657326..8657474,8658003..8658139,
FT                   8659918..8660034,8669397..8669519,8669797..8670029,
FT                   8671726..8671868,8675861..8676068,8681057..8681198,
FT                   8681881..8682060,8682176..8682352,8682579..8682655,
FT                   8683954..8684092,8684955..8685077,8688001..8688214,
FT                   8689123..8689268,8690503..8690680,8691656..8691751,
FT                   8694481..8694668,8696502..8696628,8699496..8699596,
FT                   8700490..8700644,8701035..8701174,8702039..8702121,
FT                   8703680..8703810,8703948..8704077,8704923..8705078,
FT                   8708360..8708550,8710474..8710588,8710691..8710904,
FT                   8711259..8711364,8712244..8712406,8712593..8712753,
FT                   8713792..8718141)
FT                   /gene="Hdh"
FT                   /locus_tag="mCG_2547"
FT                   /product="Huntington disease gene homolog, transcript
FT                   variant mCT1562"
FT                   /note="gene_id=mCG2547.2 transcript_id=mCT1562.2 created on
FT                   03-OCT-2002"
FT   mRNA            join(<8567211..8567530,8588164..8588247,8595669..8595789,
FT                   8599507..8599566,8601293..8601372,8604778..8604916,
FT                   8608979..8609120,8609763..8609941,8611834..8612038,
FT                   8613130..8613177,8616696..8616776,8618113..8618453,
FT                   8622404..8622530,8622959..8623077,8623860..8623971,
FT                   8624158..8624295,8625212..8625370,8625463..8625560,
FT                   8626973..8627112,8629123..8629186,8629620..8629720,
FT                   8630077..8630223,8631209..8631329,8632517..8632593,
FT                   8633734..8633885,8634932..8635134,8637822..8637948,
FT                   8639516..8639643,8648047..8648157,8651246..8651323,
FT                   8652710..8652933,8653987..8654065,8654193..8654354,
FT                   8656462..8656517,8657326..8657495,8682579..8682655,
FT                   8683954..8684092,8684955..8685077,8688001..8688214,
FT                   8689123..8689268,8690503..8690680,8691656..8691751,
FT                   8694481..8694668,8696502..8696628,8699496..8699596,
FT                   8700490..8700644,8701035..8701174,8702039..8702121,
FT                   8703680..8703810,8703948..8704077,8704923..8705078,
FT                   8708360..8708550,8710474..8710588,8710691..8710904,
FT                   8711259..8711364,8712244..8712406,8712593..8712753,
FT                   8713792..8714203,8714239..8714556)
FT                   /gene="Hdh"
FT                   /locus_tag="mCG_2547"
FT                   /product="Huntington disease gene homolog, transcript
FT                   variant mCT193629"
FT                   /note="gene_id=mCG2547.2 transcript_id=mCT193629.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(<8567211..8567530,8588164..8588247,8595669..8595789,
FT                   8599507..8599566,8601293..8601372,8604778..8604916,
FT                   8608979..8609120,8609763..8609941,8611834..8612038,
FT                   8613130..8613177,8616696..8616776,8618113..8618453,
FT                   8622404..8622530,8622959..8623077,8623860..8623971,
FT                   8624158..8624295,8625212..8625370,8625463..8625560,
FT                   8626973..8627112,8629123..8629186,8629620..8629720,
FT                   8630077..8630223,8631209..8631329,8632517..8632593,
FT                   8633734..8633885,8634932..8635134,8637822..8637948,
FT                   8639516..8639643,8648047..8648157,8651246..8651323,
FT                   8652710..8652933,8653987..8654065,8654193..8654354,
FT                   8656462..8656517,8657326..8657474,8658003..8658139,
FT                   8659918..8660034,8669397..8669519,8669797..8670029,
FT                   8671726..8671868,8675861..8676068,8681057..8681198,
FT                   8681881..8682060,8682176..8682352,8682579..8682655,
FT                   8683954..8684092,8684955..8685077,8688001..8688214,
FT                   8689123..8689268,8690503..8690680,8691656..8691751,
FT                   8694481..8694668,8696502..8696628,8699496..8699596,
FT                   8700490..8700644,8701035..8701174,8702039..8702121,
FT                   8703680..8703810,8703948..8704077,8704923..8705078,
FT                   8708360..8708550,8710474..8710588,8710691..8710904,
FT                   8711259..8711364,8712244..8712406,8712593..8712753,
FT                   8713792..8714203,8714239..8714556)
FT                   /gene="Hdh"
FT                   /locus_tag="mCG_2547"
FT                   /product="Huntington disease gene homolog, transcript
FT                   variant mCT193628"
FT                   /note="gene_id=mCG2547.2 transcript_id=mCT193628.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<8567262..8567530,8588164..8588247,8595669..8595789,
FT                   8599507..8599566,8601293..8601372,8604778..8604916,
FT                   8608979..8609120,8609763..8609941,8611834..8612038,
FT                   8613130..8613177,8616696..8616776,8618113..8618453,
FT                   8622404..8622530,8622959..8623077,8623860..8623971,
FT                   8624158..8624295,8625212..8625370,8625463..8625560,
FT                   8626973..8627112,8629123..8629186,8629620..8629720,
FT                   8630077..8630223,8631209..8631329,8632517..8632593,
FT                   8633734..8633885,8634932..8635134,8637822..8637948,
FT                   8639516..8639643,8648047..8648157,8651246..8651323,
FT                   8652710..8652933,8653987..8654065,8654193..8654354,
FT                   8656462..8656517,8657326..8657474,8658003..8658139,
FT                   8659918..8660034,8669397..8669519,8669797..8670029,
FT                   8671726..8671868,8675861..8676068,8681057..8681198,
FT                   8681881..8682060,8682176..8682352,8682579..8682655,
FT                   8683954..8684092,8684955..8685077,8688001..8688214,
FT                   8689123..8689268,8690503..8690680,8691656..8691751,
FT                   8694481..8694668,8696502..8696628,8699496..8699596,
FT                   8700490..8700644,8701035..8701174,8702039..8702121,
FT                   8703680..8703810,8703948..8704077,8704923..8705078,
FT                   8708360..8708550,8710474..8710588,8710691..8710904,
FT                   8711259..8711364,8712244..8712406,8712593..8712753,
FT                   8713792..8714005)
FT                   /codon_start=1
FT                   /gene="Hdh"
FT                   /locus_tag="mCG_2547"
FT                   /product="Huntington disease gene homolog, isoform CRA_b"
FT                   /note="gene_id=mCG2547.2 transcript_id=mCT193628.0
FT                   protein_id=mCP114598.0 isoform=CRA_b"
FT                   /protein_id="EDL37468.1"
FT                   /translation="VAPRSASRLQVFRVCPIGQEAVMATLEKLMKAFESLKSFQQQQQQ
FT                   QPPPQAPPPPPPPPPPQPPQPPPQGQPPPPPPPLPGPAEEPLHRPKKELSATKKDRVNH
FT                   CLTICENIVAQSLRNSPEFQKLLGIAMELFLLCSDDAESDVRMVADECLNKVIKALMDS
FT                   NLPRLQLELYKEIKKNGAPRSLRAALWRFAELAHLVRPQKCRPYLVNLLPCLTRTSKRP
FT                   EESVQETLAAAVPKIMASFGNFANDNEIKVLLKAFIANLKSSSPTVRRTAAGSAVSICQ
FT                   HSRRTQYFYNWLLNVLLGLLVPMEEEHSTLLILGVLLTLRCLVPLLQQQVKDTSLKGSF
FT                   GVTRKEMEVSPSTEQLVQVYELTLHHTQHQDHNVVTGALELLQQLFRTPPPELLQALTT
FT                   PGGLGQLTLVQEEARGRGRSGSIVELLAGGGSSCSPVLSRKQKGKVLLGEEEALEDDSE
FT                   SRSDVSSSAFAASVKSEIGGELAASSGVSTPGSVGHDIITEQPRSQHTLQADSVDLSGC
FT                   DLTSAATDGDEEDILSHSSSQFSAVPSDPAMDLNDGTQASSPISDSSQTTTEGPDSAVT
FT                   PSDSSEIVLDGADSQYLGMQIGQPQEDDEEGAAGVLSGEVSDVFRNSSLALQQAHLLER
FT                   MGHSRQPSDSSIDKYVTRDEVAEASDPESKPCRIKGDIGQPNDDDSAPLVHCVRLLSAS
FT                   FLLTGEKKALVPDRDVRVSVKALALSCIGAAVALHPESFFSRLYKVPLNTTESTEEQYV
FT                   SDILNYIDHGDPQVRGATAILCGTLVYSILSRSRLRVGDWLGNIRTLTGNTFSLVDCIP
FT                   LLQKTLKDESSVTCKLACTAVRHCVLSLCSSSYSDLGLQLLIDMLPLKNSSYWLVRTEL
FT                   LDTLAEIDFRLVSFLEAKAESLHRGAHHYTGFLKLQERVLNNVVIYLLGDEDPRVRHVA
FT                   ATSLTRLVPKLFYKCDQGQADPVVAVARDQSSVYLKLLMHETQPPSHFSVSTITRIYRG
FT                   YSLLPSITDVTMENNLSRVVAAVSHELITSTTRALTFGCCEALCLLSAAFPVCTWSLGW
FT                   HCGVPPLSASDESRKSCTVGMASMILTLLSSAWFPLDLSAHQDALILAGNLLAASAPKS
FT                   LRSSWTSEEEANSAATRQEEIWPALGDRTLVPLVEQLFSHLLKVINICAHVLDDVTPGP
FT                   AIKAALPSLTNPPSLSPIRRKGKEKEPGEQASTPMSPKKVGEASAASRQSDTSGPVTAS
FT                   KSSSLGSFYHLPSYLKLHDVLKATHANYKVTLDLQNSTEKFGGFLRSALDVLSQILELA
FT                   TLQDIGKCVEEVLGYLKSCFSREPMMATVCVQQLLKTLFGTNLASQFDGLSSNPSKSQC
FT                   RAQRLGSSSVRPGLYHYCFMAPYTHFTQALADASLRNMVQAEQERDASGWFDVLQKVSA
FT                   QLKTNLTSVTKNRADKNAIHNHIRLFEPLVIKALKQYTTTTSVQLQKQVLDLLAQLVQL
FT                   RVNYCLLDSDQVFIGFVLKQFEYIEVGQFRESEAIIPNIFFFLVLLSYERYHSKQIIGI
FT                   PKIIQLCDGIMASGRKAVTHAIPALQPIVHDLFVLRGTNKADAGKELETQKEVVVSMLL
FT                   RLIQYHQVLEMFILVLQQCHKENEDKWKRLSRQVADIILPMLAKQQMHIDSHEALGVLN
FT                   TLFEILAPSSLRPVDMLLRSMFITPSTMASVSTVQLWISGILAILRVLISQSTEDIVLC
FT                   RIQELSFSPHLLSCPVINRLRGGGGNVTLGECSEGKQKSLPEDTFSRFLLQLVGILLED
FT                   IVTKQLKVDMSEQQHTFYCQELGTLLMCLIHIFKSGMFRRITAAATRLFTSDGCEGSFY
FT                   TLESLNARVRSMVPTHPALVLLWCQILLLINHTDHRWWAEVQQTPKRHSLSCTKSLNPQ
FT                   KSGEEEDSGSAAQLGMCNREIVRRGALILFCDYVCQNLHDSEHLTWLIVNHIQDLISLS
FT                   HEPPVQDFISAIHRNSAASGLFIQAIQSRCENLSTPTTLKKTLQCLEGIHLSQSGAVLT
FT                   LYVDRLLGTPFRALARMVDTLACRRVEMLLAANLQSSMAQLPEEELNRIQEHLQNSGLA
FT                   QRHQRLYSLLDRFRLSTVQDSLSPLPPVTSHPLDGDGHTSLETVSPDKDWYLQLVRSQC
FT                   WTRSDSALLEGAELVNRIPAEDMNDFMMSSEFNLSLLAPCLSLGMSEIANGQKSPLFEA
FT                   ARGVILNRVTSVVQQLPAVHQVFQPFLPIEPTAYWNKLNDLLGDTTSYQSLTILARALA
FT                   QYLVVLSKVPAHLHLPPEKEGDTVKFVVMTVEALSWHLIHEQIPLSLDLQAGLDCCCLA
FT                   LQVPGLWGVLSSPEYVTHACSLIHCVRFILEAIAVQPGDQLLGPESRSHTPRAVRKEEV
FT                   DSDIQNLSHVTSACEMVADMVESLQSVLALGHKRNSTLPSFLTAVLKNIVISLARLPLV
FT                   NSYTRVPPLVWKLGWSPKPGGDFGTVFPEIPVEFLQEKEILKEFIYRINTLGWTNRTQF
FT                   EETWATLLGVLVTQPLVMEQEESPPEEDTERTQIHVLAVQAITSLVLSAMTVPVAGNPA
FT                   VSCLEQQPRNKPLKALDTRFGRKLSMIRGIVEQEIQEMVSQRENTATHHSHQAWDPVPS
FT                   LLPATTGALISHDKLLLQINPEREPGNMSYKLGQVSIHSVWLGNNITPLREEEWDEEEE
FT                   EESDVPAPTSPPVSPVNSRKHRAGVDIHSCSQFLLELYSRWILPSSAARRTPVILISEV
FT                   VRSLLVVSDLFTERTQFEMMYLTLTELRRVHPSEDEILIQYLVPATCKAAAVLGMDKTV
FT                   AEPVSRLLESTLRSSHLPSQIGALHGILYVLECDLLDDTAKQLIPVVSDYLLSNLKGIA
FT                   HCVNIHSQQHVLVMCATAFYLMENYPLDVGPEFSASVIQMCGVMLSGSEESTPSIIYHC
FT                   ALRGLERLLLSEQLSRLDTESLVKLSVDRVNVQSPHRAMAALGLMLTCMYTGKEKASPG
FT                   RASDPSPATPDSESVIVAMERVSVLFDRIRKGFPCEARVVARILPQFLDDFFPPQDVMN
FT                   KVIGEFLSNQQPYPQFMATVVYKVFQTLHSAGQSSMVRDWVMLSLSNFTQRTPVAMAMW
FT                   SLSCFLVSASTSPWVSAILPHVISRMGKLEQVDVNLFCLVATDFYRHQIEEEFDRRAFQ
FT                   SVFEVVAAPGSPYHRLLACLQNVHKVTTC"
FT   CDS             join(<8567262..8567530,8588164..8588247,8595669..8595789,
FT                   8599507..8599566,8601293..8601372,8604778..8604916,
FT                   8608979..8609120,8609763..8609941,8611834..8612038,
FT                   8613130..8613177,8616696..8616776,8618113..8618453,
FT                   8622404..8622530,8622959..8623077,8623860..8623971,
FT                   8624158..8624295,8625212..8625370,8625463..8625560,
FT                   8626973..8627112,8629123..8629186,8629620..8629720,
FT                   8630077..8630223,8631209..8631329,8632517..8632593,
FT                   8633734..8633885,8634932..8635134,8637822..8637948,
FT                   8639516..8639643,8648047..8648157,8651246..8651323,
FT                   8652710..8652933,8653987..8654065,8654193..8654354,
FT                   8656462..8656517,8657326..8657495,8682579..8682580)
FT                   /codon_start=1
FT                   /gene="Hdh"
FT                   /locus_tag="mCG_2547"
FT                   /product="Huntington disease gene homolog, isoform CRA_c"
FT                   /note="gene_id=mCG2547.2 transcript_id=mCT193629.0
FT                   protein_id=mCP114599.0 isoform=CRA_c"
FT                   /protein_id="EDL37469.1"
FT                   /translation="VAPRSASRLQVFRVCPIGQEAVMATLEKLMKAFESLKSFQQQQQQ
FT                   QPPPQAPPPPPPPPPPQPPQPPPQGQPPPPPPPLPGPAEEPLHRPKKELSATKKDRVNH
FT                   CLTICENIVAQSLRNSPEFQKLLGIAMELFLLCSDDAESDVRMVADECLNKVIKALMDS
FT                   NLPRLQLELYKEIKKNGAPRSLRAALWRFAELAHLVRPQKCRPYLVNLLPCLTRTSKRP
FT                   EESVQETLAAAVPKIMASFGNFANDNEIKVLLKAFIANLKSSSPTVRRTAAGSAVSICQ
FT                   HSRRTQYFYNWLLNVLLGLLVPMEEEHSTLLILGVLLTLRCLVPLLQQQVKDTSLKGSF
FT                   GVTRKEMEVSPSTEQLVQVYELTLHHTQHQDHNVVTGALELLQQLFRTPPPELLQALTT
FT                   PGGLGQLTLVQEEARGRGRSGSIVELLAGGGSSCSPVLSRKQKGKVLLGEEEALEDDSE
FT                   SRSDVSSSAFAASVKSEIGGELAASSGVSTPGSVGHDIITEQPRSQHTLQADSVDLSGC
FT                   DLTSAATDGDEEDILSHSSSQFSAVPSDPAMDLNDGTQASSPISDSSQTTTEGPDSAVT
FT                   PSDSSEIVLDGADSQYLGMQIGQPQEDDEEGAAGVLSGEVSDVFRNSSLALQQAHLLER
FT                   MGHSRQPSDSSIDKYVTRDEVAEASDPESKPCRIKGDIGQPNDDDSAPLVHCVRLLSAS
FT                   FLLTGEKKALVPDRDVRVSVKALALSCIGAAVALHPESFFSRLYKVPLNTTESTEEQYV
FT                   SDILNYIDHGDPQVRGATAILCGTLVYSILSRSRLRVGDWLGNIRTLTGNTFSLVDCIP
FT                   LLQKTLKDESSVTCKLACTAVRHCVLSLCSSSYSDLGLQLLIDMLPLKNSSYWLVRTEL
FT                   LDTLAEIDFRLVSFLEAKAESLHRGAHHYTGFLKLQERVLNNVVIYLLGDEDPRVRHVA
FT                   ATSLTRLVPKLFYKCDQGQADPVVAVARDQSSVYLKLLMHETQPPSHFSVSTITRIYRG
FT                   YSLLPSITDVTMENNLSRVVAAVSHELITSTTRALTFGCCEALCLLSAAFPVCTWSLGW
FT                   HCGVPPLSASDESRKSCTVGMASMILTLLSSAWFPLDLSAHQDALILAGNLLAASAPKS
FT                   LRSSWTSEEEANSAATRQEEIWPALGDRTLVPLVEQLFSHLLKVINICAHVLDDVTPGP
FT                   AIKAALPSLTNPPSLSPIRRKGKEKEPGEQASTPMSPKKVGEASAASRQSDTSGPVTAS
FT                   KSSSLGSFYHLPSYLKLHDVLKATHANYKVTLDLQNSTEKFGGFLRSALDVLSQILELA
FT                   TLQDIGKCVEEVLGYLKSCFSREPMMATVCVQQLLKTLFGTNLASQFDGLSSNPSKSQC
FT                   RAQRLGSSSVRPGLYHYCFMAPYTHFTQALADASLRNMVQAEQERDASGWFDVLQKVSA
FT                   QLKTNLTSVTKNRADKNAIHNHIRLFEPLVIKALKQYTTTTSVQLQKQVLDLLAQLVQL
FT                   RVNYCLLDSDQVFIGFVLKQFEYIEVGQFRESEAIIPNIFFFLVLLSYERYHSKQIIGI
FT                   PKIIQLCDGIMASGRKAVTHGNVCISA"
FT   CDS             join(8567328..8567530,8588164..8588247,8595669..8595789,
FT                   8599507..8599566,8601293..8601372,8604778..8604916,
FT                   8608979..8609120,8609763..8609941,8611834..8612038,
FT                   8613130..8613177,8616696..8616776,8618113..8618453,
FT                   8622404..8622530,8622959..8623077,8623860..8623971,
FT                   8624158..8624295,8625212..8625370,8625463..8625560,
FT                   8626973..8627112,8629123..8629186,8629620..8629720,
FT                   8630077..8630223,8631209..8631329,8632517..8632593,
FT                   8633734..8633885,8634932..8635134,8637822..8637948,
FT                   8639516..8639643,8648047..8648157,8651246..8651323,
FT                   8652710..8652933,8653987..8654065,8654193..8654354,
FT                   8656462..8656517,8657326..8657474,8658003..8658139,
FT                   8659918..8660034,8669397..8669519,8669797..8670029,
FT                   8671726..8671868,8675861..8676068,8681057..8681198,
FT                   8681881..8682060,8682176..8682352,8682579..8682655,
FT                   8683954..8684092,8684955..8685077,8688001..8688214,
FT                   8689123..8689268,8690503..8690680,8691656..8691751,
FT                   8694481..8694668,8696502..8696628,8699496..8699596,
FT                   8700490..8700644,8701035..8701174,8702039..8702121,
FT                   8703680..8703810,8703948..8704077,8704923..8705078,
FT                   8708360..8708550,8710474..8710588,8710691..8710904,
FT                   8711259..8711364,8712244..8712406,8712593..8712753,
FT                   8713792..8714005)
FT                   /codon_start=1
FT                   /gene="Hdh"
FT                   /locus_tag="mCG_2547"
FT                   /product="Huntington disease gene homolog, isoform CRA_a"
FT                   /note="gene_id=mCG2547.2 transcript_id=mCT1562.2
FT                   protein_id=mCP4004.2 isoform=CRA_a partial"
FT                   /db_xref="GOA:G3X9H5"
FT                   /db_xref="InterPro:IPR000091"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR024613"
FT                   /db_xref="InterPro:IPR028426"
FT                   /db_xref="MGI:MGI:96067"
FT                   /db_xref="UniProtKB/TrEMBL:G3X9H5"
FT                   /protein_id="EDL37467.1"
FT                   /translation="MATLEKLMKAFESLKSFQQQQQQQPPPQAPPPPPPPPPPQPPQPP
FT                   PQGQPPPPPPPLPGPAEEPLHRPKKELSATKKDRVNHCLTICENIVAQSLRNSPEFQKL
FT                   LGIAMELFLLCSDDAESDVRMVADECLNKVIKALMDSNLPRLQLELYKEIKKNGAPRSL
FT                   RAALWRFAELAHLVRPQKCRPYLVNLLPCLTRTSKRPEESVQETLAAAVPKIMASFGNF
FT                   ANDNEIKVLLKAFIANLKSSSPTVRRTAAGSAVSICQHSRRTQYFYNWLLNVLLGLLVP
FT                   MEEEHSTLLILGVLLTLRCLVPLLQQQVKDTSLKGSFGVTRKEMEVSPSTEQLVQVYEL
FT                   TLHHTQHQDHNVVTGALELLQQLFRTPPPELLQALTTPGGLGQLTLVQEEARGRGRSGS
FT                   IVELLAGGGSSCSPVLSRKQKGKVLLGEEEALEDDSESRSDVSSSAFAASVKSEIGGEL
FT                   AASSGVSTPGSVGHDIITEQPRSQHTLQADSVDLSGCDLTSAATDGDEEDILSHSSSQF
FT                   SAVPSDPAMDLNDGTQASSPISDSSQTTTEGPDSAVTPSDSSEIVLDGADSQYLGMQIG
FT                   QPQEDDEEGAAGVLSGEVSDVFRNSSLALQQAHLLERMGHSRQPSDSSIDKYVTRDEVA
FT                   EASDPESKPCRIKGDIGQPNDDDSAPLVHCVRLLSASFLLTGEKKALVPDRDVRVSVKA
FT                   LALSCIGAAVALHPESFFSRLYKVPLNTTESTEEQYVSDILNYIDHGDPQVRGATAILC
FT                   GTLVYSILSRSRLRVGDWLGNIRTLTGNTFSLVDCIPLLQKTLKDESSVTCKLACTAVR
FT                   HCVLSLCSSSYSDLGLQLLIDMLPLKNSSYWLVRTELLDTLAEIDFRLVSFLEAKAESL
FT                   HRGAHHYTGFLKLQERVLNNVVIYLLGDEDPRVRHVAATSLTRLVPKLFYKCDQGQADP
FT                   VVAVARDQSSVYLKLLMHETQPPSHFSVSTITRIYRGYSLLPSITDVTMENNLSRVVAA
FT                   VSHELITSTTRALTFGCCEALCLLSAAFPVCTWSLGWHCGVPPLSASDESRKSCTVGMA
FT                   SMILTLLSSAWFPLDLSAHQDALILAGNLLAASAPKSLRSSWTSEEEANSAATRQEEIW
FT                   PALGDRTLVPLVEQLFSHLLKVINICAHVLDDVTPGPAIKAALPSLTNPPSLSPIRRKG
FT                   KEKEPGEQASTPMSPKKVGEASAASRQSDTSGPVTASKSSSLGSFYHLPSYLKLHDVLK
FT                   ATHANYKVTLDLQNSTEKFGGFLRSALDVLSQILELATLQDIGKCVEEVLGYLKSCFSR
FT                   EPMMATVCVQQLLKTLFGTNLASQFDGLSSNPSKSQCRAQRLGSSSVRPGLYHYCFMAP
FT                   YTHFTQALADASLRNMVQAEQERDASGWFDVLQKVSAQLKTNLTSVTKNRADKNAIHNH
FT                   IRLFEPLVIKALKQYTTTTSVQLQKQVLDLLAQLVQLRVNYCLLDSDQVFIGFVLKQFE
FT                   YIEVGQFRESEAIIPNIFFFLVLLSYERYHSKQIIGIPKIIQLCDGIMASGRKAVTHAI
FT                   PALQPIVHDLFVLRGTNKADAGKELETQKEVVVSMLLRLIQYHQVLEMFILVLQQCHKE
FT                   NEDKWKRLSRQVADIILPMLAKQQMHIDSHEALGVLNTLFEILAPSSLRPVDMLLRSMF
FT                   ITPSTMASVSTVQLWISGILAILRVLISQSTEDIVLCRIQELSFSPHLLSCPVINRLRG
FT                   GGGNVTLGECSEGKQKSLPEDTFSRFLLQLVGILLEDIVTKQLKVDMSEQQHTFYCQEL
FT                   GTLLMCLIHIFKSGMFRRITAAATRLFTSDGCEGSFYTLESLNARVRSMVPTHPALVLL
FT                   WCQILLLINHTDHRWWAEVQQTPKRHSLSCTKSLNPQKSGEEEDSGSAAQLGMCNREIV
FT                   RRGALILFCDYVCQNLHDSEHLTWLIVNHIQDLISLSHEPPVQDFISAIHRNSAASGLF
FT                   IQAIQSRCENLSTPTTLKKTLQCLEGIHLSQSGAVLTLYVDRLLGTPFRALARMVDTLA
FT                   CRRVEMLLAANLQSSMAQLPEEELNRIQEHLQNSGLAQRHQRLYSLLDRFRLSTVQDSL
FT                   SPLPPVTSHPLDGDGHTSLETVSPDKDWYLQLVRSQCWTRSDSALLEGAELVNRIPAED
FT                   MNDFMMSSEFNLSLLAPCLSLGMSEIANGQKSPLFEAARGVILNRVTSVVQQLPAVHQV
FT                   FQPFLPIEPTAYWNKLNDLLGDTTSYQSLTILARALAQYLVVLSKVPAHLHLPPEKEGD
FT                   TVKFVVMTVEALSWHLIHEQIPLSLDLQAGLDCCCLALQVPGLWGVLSSPEYVTHACSL
FT                   IHCVRFILEAIAVQPGDQLLGPESRSHTPRAVRKEEVDSDIQNLSHVTSACEMVADMVE
FT                   SLQSVLALGHKRNSTLPSFLTAVLKNIVISLARLPLVNSYTRVPPLVWKLGWSPKPGGD
FT                   FGTVFPEIPVEFLQEKEILKEFIYRINTLGWTNRTQFEETWATLLGVLVTQPLVMEQEE
FT                   SPPEEDTERTQIHVLAVQAITSLVLSAMTVPVAGNPAVSCLEQQPRNKPLKALDTRFGR
FT                   KLSMIRGIVEQEIQEMVSQRENTATHHSHQAWDPVPSLLPATTGALISHDKLLLQINPE
FT                   REPGNMSYKLGQVSIHSVWLGNNITPLREEEWDEEEEEESDVPAPTSPPVSPVNSRKHR
FT                   AGVDIHSCSQFLLELYSRWILPSSAARRTPVILISEVVRSLLVVSDLFTERTQFEMMYL
FT                   TLTELRRVHPSEDEILIQYLVPATCKAAAVLGMDKTVAEPVSRLLESTLRSSHLPSQIG
FT                   ALHGILYVLECDLLDDTAKQLIPVVSDYLLSNLKGIAHCVNIHSQQHVLVMCATAFYLM
FT                   ENYPLDVGPEFSASVIQMCGVMLSGSEESTPSIIYHCALRGLERLLLSEQLSRLDTESL
FT                   VKLSVDRVNVQSPHRAMAALGLMLTCMYTGKEKASPGRASDPSPATPDSESVIVAMERV
FT                   SVLFDRIRKGFPCEARVVARILPQFLDDFFPPQDVMNKVIGEFLSNQQPYPQFMATVVY
FT                   KVFQTLHSAGQSSMVRDWVMLSLSNFTQRTPVAMAMWSLSCFLVSASTSPWVSAILPHV
FT                   ISRMGKLEQVDVNLFCLVATDFYRHQIEEEFDRRAFQSVFEVVAAPGSPYHRLLACLQN
FT                   VHKVTTC"
FT   gene            8722738..8729035
FT                   /gene="A930005I04Rik"
FT                   /locus_tag="mCG_2553"
FT                   /note="gene_id=mCG2553.1"
FT   mRNA            join(8722738..8723111,8726601..8726876,8728521..8729035)
FT                   /gene="A930005I04Rik"
FT                   /locus_tag="mCG_2553"
FT                   /product="RIKEN cDNA A930005I04, transcript variant
FT                   mCT1551"
FT                   /note="gene_id=mCG2553.1 transcript_id=mCT1551.1 created on
FT                   18-FEB-2003"
FT   mRNA            join(8722739..8723111,8728521..8728837)
FT                   /gene="A930005I04Rik"
FT                   /locus_tag="mCG_2553"
FT                   /product="RIKEN cDNA A930005I04, transcript variant
FT                   mCT180190"
FT                   /note="gene_id=mCG2553.1 transcript_id=mCT180190.0 created
FT                   on 18-FEB-2003"
FT   CDS             join(8722792..8723111,8726601..8726876,8728521..8728761)
FT                   /codon_start=1
FT                   /gene="A930005I04Rik"
FT                   /locus_tag="mCG_2553"
FT                   /product="RIKEN cDNA A930005I04, isoform CRA_b"
FT                   /note="gene_id=mCG2553.1 transcript_id=mCT1551.1
FT                   protein_id=mCP4021.1 isoform=CRA_b"
FT                   /protein_id="EDL37471.1"
FT                   /translation="MVRWPGLRPCLSAILNPAGASNMAAAEVPGYLVSPQTEKHRRARN
FT                   WTDAEMRGLMLVWEEFFDELKQTKRNAKVYEKMASKLFEMTGERRLGEEIKIKITNMTF
FT                   QYRKLKCMTDSESIPPDWPYYLAIDRILAKVPESCEGKLPDGQQPGPSTSQTEASLSPS
FT                   AKSTPLYLPYTQCSYEGHFEDDRSDSSSSLLSLKFRSEERPVKKRKMRSCHLQKKKLRL
FT                   LEAMLEEQRRLSRAMEETCREVRRVLDQQNILQVQSLQLQERMMSLLEKIIAKSNV"
FT   CDS             join(8722792..8723111,8728521..8728761)
FT                   /codon_start=1
FT                   /gene="A930005I04Rik"
FT                   /locus_tag="mCG_2553"
FT                   /product="RIKEN cDNA A930005I04, isoform CRA_a"
FT                   /note="gene_id=mCG2553.1 transcript_id=mCT180190.0
FT                   protein_id=mCP103112.0 isoform=CRA_a"
FT                   /protein_id="EDL37470.1"
FT                   /translation="MVRWPGLRPCLSAILNPAGASNMAAAEVPGYLVSPQTEKHRRARN
FT                   WTDAEMRGLMLVWEEFFDELKQTKRNAKVYEKMASKLFEMTGERRLGEEIKIKITNMTF
FT                   QYRSEERPVKKRKMRSCHLQKKKLRLLEAMLEEQRRLSRAMEETCREVRRVLDQQNILQ
FT                   VQSLQLQERMMSLLEKIIAKSNV"
FT   gene            8754570..8845732
FT                   /gene="Rgs12"
FT                   /locus_tag="mCG_2541"
FT                   /note="gene_id=mCG2541.1"
FT   mRNA            join(8754570..8754644,8769893..8771302,8771600..8771875,
FT                   8780847..8780963,8804747..8804768,8825433..8825602,
FT                   8826403..8826495,8827205..8827348,8828681..8828860,
FT                   8829118..8829271,8830366..8830442,8831938..8832132,
FT                   8832417..8832490,8832952..8833078,8834625..8834721,
FT                   8836100..8836179,8836557..8836710,8837960..8838523,
FT                   8845252..8845732)
FT                   /gene="Rgs12"
FT                   /locus_tag="mCG_2541"
FT                   /product="regulator of G-protein signaling 12, transcript
FT                   variant mCT1560"
FT                   /note="gene_id=mCG2541.1 transcript_id=mCT1560.2 created on
FT                   25-SEP-2002"
FT   mRNA            join(<8754571..8754644,8769893..8771875,8780847..8780963,
FT                   8804747..8804768,8825433..8825602,8826403..8826495,
FT                   8827205..8827348,8828681..8828860,8829118..8829271,
FT                   8830366..8830442,8831938..8832132,8832417..8832490,
FT                   8832952..8833078,8834625..8834721,8836100..8836179,
FT                   8836557..8836710,8837960..8839680)
FT                   /gene="Rgs12"
FT                   /locus_tag="mCG_2541"
FT                   /product="regulator of G-protein signaling 12, transcript
FT                   variant mCT193624"
FT                   /note="gene_id=mCG2541.1 transcript_id=mCT193624.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<8769983..8771875,8780847..8780963,8804747..8804768,
FT                   8825433..8825602,8826403..8826495,8827205..8827348,
FT                   8828681..8828860,8829118..8829271,8830366..8830442,
FT                   8831938..8832132,8832417..8832490,8832952..8833078,
FT                   8834625..8834721,8836100..8836179,8836557..8836710,
FT                   8837960..8838540)
FT                   /codon_start=1
FT                   /gene="Rgs12"
FT                   /locus_tag="mCG_2541"
FT                   /product="regulator of G-protein signaling 12, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG2541.1 transcript_id=mCT193624.0
FT                   protein_id=mCP114596.0 isoform=CRA_b"
FT                   /protein_id="EDL37473.1"
FT                   /translation="QYSRMYRAGEPGKRQPGPAPPRVRSVEVARGRAGYGFTLSGQAPC
FT                   VLSCVMRGSPADFVGLRAGDQILAINEINVKKASHEDVVKLIGKCSGVLHMVIAEGTSH
FT                   VESCSSDEEGGLYEGKGWLRPKLDSKALGINRAERVVEEVQSGGIFNMIFESSSLCASG
FT                   PEPLKLKQRSLSESAALRLDAGQAGLCAPHPSMLSKEDISKVINDDSVFTVGLDSHDDF
FT                   GLDASILNVAMVVGYLGSIELPSTSSNLEHDSLQAIRGCMRRLRAEQKIHSLVTMKVMH
FT                   DCVQLVTDRAGVVAEYPAEKLAFSAVCPDDRRFFGLVTMQTNDDGGLAQEDEGALRTSC
FT                   HVFMVDPDLFHHKIHQGIARRFGFACTADPDTSGCLEFPASSLPVLQFISVLYRDMGEL
FT                   IEGVRARAFLDGDADAHQNNSTSSNSDSGIGNFNQEEKSNRVLVVDLGGGSSRHGQGSS
FT                   PGWESGGGRGSQPWSAPWNGAFCHDSEAGSPLETSPNTDRFWDLTKHSGPVSHMEVPPA
FT                   TLRSSIPPSKRGAAGSSCGFNQRWLPVHVLQEWQCGHASDQESYTDSTDGWSSVNCGTL
FT                   PPPMSKIPADRYRVEGSFAQAPLSTQKRDWSRKAFGMQNLFGPHRNVRKTKEDKKSSKL
FT                   GRGVALAQTSQRTSARRSFGRSRRFSITRSLDDLESATVSDGELTGADLKDCISNNSLS
FT                   SNASLPSVQSCRRLRERRVASWAVSFERLLQDPVGVRYFSDFLRKEFSEENILFWQACE
FT                   CFSHVPAHDKKELSYRAREIFSKFLCSKATTPVNIDSQAQLADDILNAPHPDMFKEQQL
FT                   QIFNLMKFDSYTRFLKSQLYQECVLAEVEGRTLPDSQQVPSSPASKHSISSDHSNVSTP
FT                   KKLSGKSKSGRSLNEDVGEEDSEKKRRGAFFSWSRSRSTGRSQKKKDHGDHAHDAPHAN
FT                   GGLCRRESQGSVSSAGSLDLSEACRTSALEKDKAAKHCCVHLPDGTSCVVAVKSGFSIK
FT                   EILSGLCERHGINGAAVDLFLVGGDKPLVLHQDSSILATRDLRLEKRTLFRLDLVPINR
FT                   SVGLKAKPTKPVTEVLRPVVAKYGLDLGSLLVRLSGEKEPLDLGAPISSLDGQRVILEE
FT                   RDPSRGKVSTDKQKGAPVKQNSAVNSSPRNHLAMGEERTLGKSNSIKIRGENGKSARDP
FT                   RLSKREESIAKIGKKKYQKINLDEAEEFFELISKAQSNRADDQRGLLRKEDLVLPEFLR
FT                   LPAGSSELALSSPPPVKGYSKRAVTGHGQEGAAQTEESYSDSPATSPASAQSPCSAYSP
FT                   GSAHSPGSAHSTPGPPGTTQPGEKPTKPSCVSMVQEGTTQAWRRLSPEMEAGGIQTVED
FT                   EQVADLTLMGEGDISSPNSTLLPPPPTPQDTPGPPRPGTSRF"
FT   CDS             join(8769995..8771302,8771600..8771875,8780847..8780963,
FT                   8804747..8804768,8825433..8825602,8826403..8826495,
FT                   8827205..8827348,8828681..8828860,8829118..8829271,
FT                   8830366..8830442,8831938..8832132,8832417..8832490,
FT                   8832952..8833078,8834625..8834721,8836100..8836179,
FT                   8836557..8836710,8837960..8838523,8845252..8845478)
FT                   /codon_start=1
FT                   /gene="Rgs12"
FT                   /locus_tag="mCG_2541"
FT                   /product="regulator of G-protein signaling 12, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG2541.1 transcript_id=mCT1560.2
FT                   protein_id=mCP4030.2 isoform=CRA_a"
FT                   /protein_id="EDL37472.1"
FT                   /translation="MYRAGEPGKRQPGPAPPRVRSVEVARGRAGYGFTLSGQAPCVLSC
FT                   VMRGSPADFVGLRAGDQILAINEINVKKASHEDVVKLIGKCSGVLHMVIAEGTSHVESC
FT                   SSDEEGGLYEGKGWLRPKLDSKALGINRAERVVEEVQSGGIFNMIFESSSLCASGPEPL
FT                   KLKQRSLSESAALRLDAGQAGLCAPHPSMLSKEDISKVINDDSVFTVGLDSHDDFGLDA
FT                   SILNVAMVVGYLGSIELPSTSSNLEHDSLQAIRGCMRRLRAEQKIHSLVTMKVMHDCVQ
FT                   LVTDRAGVVAEYPAEKLAFSAVCPDDRRFFGLVTMQTNDDGGLAQEDEGALRTSCHVFM
FT                   VDPDLFHHKIHQGIARRFGFACTADPDTSGCLEFPASSLPVLQFISVLYRDMGELIEGV
FT                   RARAFLDGDADAHQNNSTSSNSDSGIGNFNQEEKSNRRWLPVHVLQEWQCGHASDQESY
FT                   TDSTDGWSSVNCGTLPPPMSKIPADRYRVEGSFAQAPLSTQKRDWSRKAFGMQNLFGPH
FT                   RNVRKTKEDKKSSKLGRGVALAQTSQRTSARRSFGRSRRFSITRSLDDLESATVSDGEL
FT                   TGADLKDCISNNSLSSNASLPSVQSCRRLRERRVASWAVSFERLLQDPVGVRYFSDFLR
FT                   KEFSEENILFWQACECFSHVPAHDKKELSYRAREIFSKFLCSKATTPVNIDSQAQLADD
FT                   ILNAPHPDMFKEQQLQIFNLMKFDSYTRFLKSQLYQECVLAEVEGRTLPDSQQVPSSPA
FT                   SKHSISSDHSNVSTPKKLSGKSKSGRSLNEDVGEEDSEKKRRGAFFSWSRSRSTGRSQK
FT                   KKDHGDHAHDAPHANGGLCRRESQGSVSSAGSLDLSEACRTSALEKDKAAKHCCVHLPD
FT                   GTSCVVAVKSGFSIKEILSGLCERHGINGAAVDLFLVGGDKPLVLHQDSSILATRDLRL
FT                   EKRTLFRLDLVPINRSVGLKAKPTKPVTEVLRPVVAKYGLDLGSLLVRLSGEKEPLDLG
FT                   APISSLDGQRVILEERDPSRGKVSTDKQKGAPVKQNSAVNSSPRNHLAMGEERTLGKSN
FT                   SIKIRGENGKSARDPRLSKREESIAKIGKKKYQKINLDEAEEFFELISKAQSNRADDQR
FT                   GLLRKEDLVLPEFLRLPAGSSELALSSPPPVKGYSKRAVTGHGQEGAAQTEESYSDSPA
FT                   TSPASAQSPCSAYSPGSAHSPGSAHSTPGPPGTTQPGEKPTKPSCVSMVQEGTTQAWRR
FT                   LSPEMEAGGIQTVEDEQVADLTLMGEGDISSPNSTLLPPPPTPQDTPGPPRPGGGARVS
FT                   GGLPVNRIIDVDLVSGVSPGWGGSILGVQLGPRRVKANGPSLPNGPGLSTIPGEPTKPK
FT                   TSTHHATFV"
FT   gene            8847677..8854515
FT                   /gene="Hgfac"
FT                   /locus_tag="mCG_2546"
FT                   /note="gene_id=mCG2546.2"
FT   mRNA            join(8847677..8847799,8848380..8848554,8848656..8848752,
FT                   8848945..8849024,8849650..8849772,8849914..8850045,
FT                   8850238..8850348,8850447..8850621,8850854..8850939,
FT                   8851341..8851596,8852579..8852718,8852974..8853114,
FT                   8853206..8853354,8854247..8854515)
FT                   /gene="Hgfac"
FT                   /locus_tag="mCG_2546"
FT                   /product="hepatocyte growth factor activator"
FT                   /note="gene_id=mCG2546.2 transcript_id=mCT1556.2 created on
FT                   18-SEP-2002"
FT   CDS             join(8847686..8847799,8848380..8848554,8848656..8848752,
FT                   8848945..8849024,8849650..8849772,8849914..8850045,
FT                   8850238..8850348,8850447..8850621,8850854..8850939,
FT                   8851341..8851596,8852579..8852718,8852974..8853114,
FT                   8853206..8853354,8854247..8854429)
FT                   /codon_start=1
FT                   /gene="Hgfac"
FT                   /locus_tag="mCG_2546"
FT                   /product="hepatocyte growth factor activator"
FT                   /note="gene_id=mCG2546.2 transcript_id=mCT1556.2
FT                   protein_id=mCP3987.1"
FT                   /db_xref="GOA:Q8VCS4"
FT                   /db_xref="InterPro:IPR000001"
FT                   /db_xref="InterPro:IPR000083"
FT                   /db_xref="InterPro:IPR000562"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR001314"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR013032"
FT                   /db_xref="InterPro:IPR013806"
FT                   /db_xref="InterPro:IPR014394"
FT                   /db_xref="InterPro:IPR018056"
FT                   /db_xref="InterPro:IPR018114"
FT                   /db_xref="MGI:MGI:1859281"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VCS4"
FT                   /protein_id="EDL37474.1"
FT                   /translation="MGRQAWISSLCPLPRPCPFLLLLLLLVVPRGAQPQAGRNHTEPPG
FT                   PNVTATPVTPTIPVISGNVSTSTESAPAAETEGPQSERYPPPSSSSPPGGQVLTESGQP
FT                   CRFPFRYGGRMLHSCTSEGSAYRKWCATTHNYDRDRAWGYCAEVTLPVEGPAILDPCAS
FT                   GPCLNGGTCSSTHDHGSYHCSCPLAFTGKDCGTEKCFDETRYEYFEVGDHWARVSEGHV
FT                   EQCGCMEGQARCEDTHHTACLSSPCLNGGTCHLIVGTGTSVCTCPLGYAGRFCNIVPTE
FT                   HCFLGNGTEYRGVASTAASGLSCLAWNSDLLYQELHVDSVAAAVLLGLGPHAYCRNPDK
FT                   DERPWCYVVKDNALSWEYCRLTACESLARVHSQSPEILAALPESAPAVRPTCGKRHKKR
FT                   TFLRPRIIGGSSSLPGSHPWLAAIYIGNSFCAGSLVHTCWVVSAAHCFANSPPRDSITV
FT                   VLGQHFFNRTTDVTQTFGIEKYVPYTLYSVFNPNNHDLVLIRLKKKGERCAVRSQFVQP
FT                   ICLPEAGSSFPTGHKCQIAGWGHMDENVSSYSNSLLEALVPLVADHKCSSPEVYGADIS
FT                   PNMLCAGYFDCKSDACQGDSGGPLVCEKNGVAYLYGIISWGDGCGRLNKPGVYTRVANY
FT                   VDWINDRIRPPKRPVATS"
FT   gene            8863167..8893753
FT                   /gene="A930013K19Rik"
FT                   /locus_tag="mCG_2539"
FT                   /note="gene_id=mCG2539.2"
FT   mRNA            join(8863167..8863222,8870414..8870644,8872587..8872787,
FT                   8881437..8881556,8883282..8883401,8884954..8885678,
FT                   8889087..8889129,8892471..8892623,8892919..8893753)
FT                   /gene="A930013K19Rik"
FT                   /locus_tag="mCG_2539"
FT                   /product="RIKEN cDNA A930013K19"
FT                   /note="gene_id=mCG2539.2 transcript_id=mCT1568.2 created on
FT                   12-JUN-2003"
FT   CDS             join(8870425..8870644,8872587..8872787,8881437..8881556,
FT                   8883282..8883401,8884954..8885678,8889087..8889129,
FT                   8892471..8892623,8892919..8893049)
FT                   /codon_start=1
FT                   /gene="A930013K19Rik"
FT                   /locus_tag="mCG_2539"
FT                   /product="RIKEN cDNA A930013K19"
FT                   /note="gene_id=mCG2539.2 transcript_id=mCT1568.2
FT                   protein_id=mCP3887.1"
FT                   /protein_id="EDL37475.1"
FT                   /translation="MLVYKDKCERSKGLRERSSLTLEDICGLEPALPYEGLAHTLAIIC
FT                   LSQAVMLGFDSHEAMCAWDTRIRYALGEVHRFHVTVAPGTKLESGPATLHLCNDILVLA
FT                   RDIPPTVMGQWKLSDLRRYGAVPNGFIFEGGTRCGYWAGVFFLSSAEGEQMSFLFDCIV
FT                   RGISPTKGPFGLRPVLPDPSSGGPSASEERVAQEALEALQLEKRLSLLSHSGRPGSGGD
FT                   DRSLSSSSSEASHSDISASSRLTAWPEQSSSSAGTSQEGPGLVAAQGPGEAMLGASRPP
FT                   LKPLRPRQLQEVGRQSSSDSGIATGSHSSYSGSFSSYAGSNLDVWRAGEEFGSLLSLPP
FT                   GASAPEPRLCACPPGAAEYQVPTSLRHHYDTPRSLRQAPRDPSPASQGSSDHGSATDLG
FT                   GQAPTGCPSSWLGARRRGQATEGPGSDAALPSPSPGESWEAGSPHAGPPPAFFLSCSIC
FT                   GGLKVMATSSPGFTVTHPGSPGRVAADSPGPERPHSEMPTYVNIPISPISRPQLHYMDL
FT                   ELPGASAGVRGASTSRYAQIDIAATETAHRVGVRHAQTREERLPELEQRKKGP"
FT   gene            complement(8897409..8911639)
FT                   /gene="Lrpap1"
FT                   /locus_tag="mCG_2555"
FT                   /note="gene_id=mCG2555.2"
FT   mRNA            complement(join(8897409..8899300,8900764..8900940,
FT                   8901890..8901972,8903445..8903603,8904067..8904187,
FT                   8905071..8905192,8908309..8908453,8911393..8911639))
FT                   /gene="Lrpap1"
FT                   /locus_tag="mCG_2555"
FT                   /product="low density lipoprotein receptor-related protein
FT                   associated protein 1, transcript variant mCT1549"
FT                   /note="gene_id=mCG2555.2 transcript_id=mCT1549.2 created on
FT                   03-OCT-2002"
FT   mRNA            complement(join(8897409..8899300,8900764..8900940,
FT                   8901890..8901972,8903445..8903520,8908367..>8908435))
FT                   /gene="Lrpap1"
FT                   /locus_tag="mCG_2555"
FT                   /product="low density lipoprotein receptor-related protein
FT                   associated protein 1, transcript variant mCT173996"
FT                   /note="gene_id=mCG2555.2 transcript_id=mCT173996.0 created
FT                   on 03-OCT-2002"
FT   CDS             complement(join(8899238..8899300,8900764..8900940,
FT                   8901890..8901972,8903445..8903603,8904067..8904187,
FT                   8905071..8905192,8908309..8908453,8911393..8911605))
FT                   /codon_start=1
FT                   /gene="Lrpap1"
FT                   /locus_tag="mCG_2555"
FT                   /product="low density lipoprotein receptor-related protein
FT                   associated protein 1, isoform CRA_a"
FT                   /note="gene_id=mCG2555.2 transcript_id=mCT1549.2
FT                   protein_id=mCP4024.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q52KI7"
FT                   /db_xref="InterPro:IPR009066"
FT                   /db_xref="InterPro:IPR010483"
FT                   /db_xref="MGI:MGI:96829"
FT                   /db_xref="UniProtKB/TrEMBL:Q52KI7"
FT                   /protein_id="EDL37476.1"
FT                   /translation="MAPRRERVSTLPRLQLLVLLLLPLMLVPQPIAGHGGKYSREKNEP
FT                   EMAAKRESGEEFRMEKLNQLWEKAKRLHLSPVRLAELHSDLKIQERDELNWKKLKVEGL
FT                   DKDGEKEAKLIHNLNVILARYGLDGRKDAQMVHSNALNEDTQDELGDPRLEKLWHKAKT
FT                   SGKFSSEELDKLWREFLHYKEKIQEYNVLLDTLSRAEEGYENLLSPSDMAHIKSDTLIS
FT                   KHSELKDRLRSINQGLDRLRKVSHQGYGSTTEFEEPRVIDLWDLAQSANFTEKELESFR
FT                   EELKHFEAKIEKHNHYQKQLEISHQKLKHVESIGDPEHISRNKEKYVLLEEKTKELGYK
FT                   VKKHLQDLSSRVSRARHNEL"
FT   CDS             complement(join(8899238..8899300,8900764..8900940,
FT                   8901890..8901972,8903445..8903520,8908367..>8908435))
FT                   /codon_start=1
FT                   /gene="Lrpap1"
FT                   /locus_tag="mCG_2555"
FT                   /product="low density lipoprotein receptor-related protein
FT                   associated protein 1, isoform CRA_b"
FT                   /note="gene_id=mCG2555.2 transcript_id=mCT173996.0
FT                   protein_id=mCP96915.0 isoform=CRA_b"
FT                   /protein_id="EDL37477.1"
FT                   /translation="RLAELHSDLKIQERDELNWKKLKDRLRSINQGLDRLRKVSHQGYG
FT                   STTEFEEPRVIDLWDLAQSANFTEKELESFREELKHFEAKIEKHNHYQKQLEISHQKLK
FT                   HVESIGDPEHISRNKEKYVLLEEKTKELGYKVKKHLQDLSSRVSRARHNEL"
FT   gene            9086673..9088550
FT                   /locus_tag="mCG_2544"
FT                   /note="gene_id=mCG2544.1"
FT   mRNA            9086673..9088550
FT                   /locus_tag="mCG_2544"
FT                   /product="mCG2544"
FT                   /note="gene_id=mCG2544.1 transcript_id=mCT1557.1 created on
FT                   18-SEP-2002"
FT   CDS             9086676..9088052
FT                   /codon_start=1
FT                   /locus_tag="mCG_2544"
FT                   /product="mCG2544"
FT                   /note="gene_id=mCG2544.1 transcript_id=mCT1557.1
FT                   protein_id=mCP3976.0"
FT                   /protein_id="EDL37478.1"
FT                   /translation="MASPALAAALAAAAAEGPNGSDAGEWGSGGGANASGTDWVPPPGQ
FT                   YSAGAVAGLAAVVGFLIVFTVVGNVLVVIAVLTSRALRAPQNLFLVSLASADILVATLV
FT                   MPFSLANELMAYWYFGQVWCGVYLALDVLFCTSSIVHLCAISLDRYWSVTQAVEYNLKR
FT                   TPRRVKATIVAVWLISAVISFPPLVSFYRRPDGAAYPQCGLNDETWYILSSCIGSFFAP
FT                   CLIMGLVYARIYRVAKLRTRTLSEKRGPAGPDGASPTTENGLGKAAGENGHCAPPRTEV
FT                   EPDESSAAERRRRRGALRRGGRRREGAEGDTGSADGPGPGLAAEQGARTASRSPGPGGR
FT                   LSRASSRSVEFFLSRRRRARSSVCRRKVAQAREKRFTFVLAVVMGVFVLCWFPFFFSYS
FT                   LYGICREACQLPEPLFKFFFWIGYCNSSLNPVIYTVFNQDFRRSFKHILFRRRRRGFRQ
FT                   "
FT   gene            <9168274..9174414
FT                   /locus_tag="mCG_2552"
FT                   /note="gene_id=mCG2552.2"
FT   mRNA            join(<9168274..9169378,9170671..9170769,9173676..9174413)
FT                   /locus_tag="mCG_2552"
FT                   /product="mCG2552, transcript variant mCT1555"
FT                   /note="gene_id=mCG2552.2 transcript_id=mCT1555.1 created on
FT                   18-FEB-2003"
FT   mRNA            join(<9168275..9168926,9170671..9170769,9171472..9171505,
FT                   9173579..9174180)
FT                   /locus_tag="mCG_2552"
FT                   /product="mCG2552, transcript variant mCT173698"
FT                   /note="gene_id=mCG2552.2 transcript_id=mCT173698.0 created
FT                   on 18-FEB-2003"
FT   mRNA            join(<9168287..9169378,9170671..9170769,9171472..9171505,
FT                   9173579..9174414)
FT                   /locus_tag="mCG_2552"
FT                   /product="mCG2552, transcript variant mCT180250"
FT                   /note="gene_id=mCG2552.2 transcript_id=mCT180250.0 created
FT                   on 18-FEB-2003"
FT   CDS             join(<9169274..9169378,9170671..9170769,9173676..9173807)
FT                   /codon_start=1
FT                   /locus_tag="mCG_2552"
FT                   /product="mCG2552, isoform CRA_a"
FT                   /note="gene_id=mCG2552.2 transcript_id=mCT1555.1
FT                   protein_id=mCP3969.0 isoform=CRA_a"
FT                   /protein_id="EDL37479.1"
FT                   /translation="TRQTAHSIHFGEVGLEPTWHRGPGTWRSHREAYKLANSHAAADPS
FT                   CQVPAWQKSFCSKERLRQQWDLKSVCILGKADVSIHLLKEHLQEILSSSPSETSKQGPI
FT                   RCPRGTL"
FT   CDS             join(<9170694..9170769,9171472..9171505,9173579..9173807)
FT                   /codon_start=1
FT                   /locus_tag="mCG_2552"
FT                   /product="mCG2552, isoform CRA_b"
FT                   /note="gene_id=mCG2552.2 transcript_id=mCT173698.0
FT                   protein_id=mCP96617.0 isoform=CRA_b"
FT                   /protein_id="EDL37480.1"
FT                   /translation="SILPGPSLAEVILQQGETKTAVGSQGSELSLMSSLYRVLWERKAN
FT                   QKPWCLKPLKDQSPETQAGVHLLQSVCILGKADVSIHLLKEHLQEILSSSPSETSKQGP
FT                   IRCPRGTL"
FT   CDS             join(<9170694..9170769,9171472..9171505,9173579..9173807)
FT                   /codon_start=1
FT                   /locus_tag="mCG_2552"
FT                   /product="mCG2552, isoform CRA_b"
FT                   /note="gene_id=mCG2552.2 transcript_id=mCT180250.0
FT                   protein_id=mCP103172.0 isoform=CRA_b"
FT                   /protein_id="EDL37481.1"
FT                   /translation="SILPGPSLAEVILQQGETKTAVGSQGSELSLMSSLYRVLWERKAN
FT                   QKPWCLKPLKDQSPETQAGVHLLQSVCILGKADVSIHLLKEHLQEILSSSPSETSKQGP
FT                   IRCPRGTL"
FT   gene            complement(9185825..9195151)
FT                   /gene="E130018O15Rik"
FT                   /locus_tag="mCG_148305"
FT                   /note="gene_id=mCG148305.0"
FT   mRNA            complement(join(9185825..9189548,9195098..9195151))
FT                   /gene="E130018O15Rik"
FT                   /locus_tag="mCG_148305"
FT                   /product="RIKEN cDNA E130018O15"
FT                   /note="gene_id=mCG148305.0 transcript_id=mCT188568.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(9188943..9189467)
FT                   /codon_start=1
FT                   /gene="E130018O15Rik"
FT                   /locus_tag="mCG_148305"
FT                   /product="RIKEN cDNA E130018O15"
FT                   /note="gene_id=mCG148305.0 transcript_id=mCT188568.0
FT                   protein_id=mCP109220.0"
FT                   /protein_id="EDL37482.1"
FT                   /translation="MGSPGYSTGHPFHPPANCSSCDTHPTSSRSHHGNLLLESGGGDCF
FT                   GGFPGDRILYYGELEMHKFGFQLCPLISRDPKHVIYSLQVVIRLSVLVAEVASGEWGAG
FT                   SEKKKGGKKKSSEMDDGQPDGRMLSRGLPFSWNPPGAACPVQLFGSPSSPSCGHFNTGG
FT                   MSGFNVRSISK"
FT   gene            9195787..9199545
FT                   /gene="Hmx1"
FT                   /locus_tag="mCG_2542"
FT                   /note="gene_id=mCG2542.2"
FT   mRNA            join(9195787..9196162,9198411..9199545)
FT                   /gene="Hmx1"
FT                   /locus_tag="mCG_2542"
FT                   /product="H6 homeobox 1"
FT                   /note="gene_id=mCG2542.2 transcript_id=mCT1570.2 created on
FT                   18-SEP-2002"
FT   CDS             join(9195790..9196162,9198411..9199036)
FT                   /codon_start=1
FT                   /gene="Hmx1"
FT                   /locus_tag="mCG_2542"
FT                   /product="H6 homeobox 1"
FT                   /note="gene_id=mCG2542.2 transcript_id=mCT1570.2
FT                   protein_id=mCP3974.1"
FT                   /protein_id="EDL37483.1"
FT                   /translation="MPDELTEPGRATPARASSFLIENLLAAEAKGAGRSTQGDGVREEE
FT                   EEDDDDPEDEDPEQARRRLQRRRQQRAGSGPGGEARARALGLGPRPPPGPGPPFALGCG
FT                   GTTRWYPRVHGGYGGGLSPDTSDRDSPETGEEMGRAESAWPRCPGPGTVPREVTTQGPA
FT                   TGGEEAAELAEAPAVAAAATGEARGGRRKKTRTVFSRSQVFQLESTFDLKRYLSSAERA
FT                   GLAASLQLTETQVKIWFQNRRNKWKRQLAAELEAASLSPPGAQRLVRVPVLYHESPPAA
FT                   AGPALPFPLAPPAPAPPPPLLGFSGALAYPLAAFPAAASVPFLRAQMPGLV"
FT   gene            complement(9203443..>9206796)
FT                   /locus_tag="mCG_144990"
FT                   /note="gene_id=mCG144990.0"
FT   mRNA            complement(join(9203443..9204075,9204772..9204968,
FT                   9205813..9205899,9206174..9206283,9206601..>9206796))
FT                   /locus_tag="mCG_144990"
FT                   /product="mCG144990"
FT                   /note="gene_id=mCG144990.0 transcript_id=mCT184414.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(9203649..9204075,9204772..9204968,
FT                   9205813..9205899,9206174..>9206185))
FT                   /codon_start=1
FT                   /locus_tag="mCG_144990"
FT                   /product="mCG144990"
FT                   /note="gene_id=mCG144990.0 transcript_id=mCT184414.0
FT                   protein_id=mCP105599.0"
FT                   /protein_id="EDL37484.1"
FT                   /translation="SQHQSYVATRDIESHSKGKAQALDQSLGTWLHQGRSVPRDQAELL
FT                   PSGGSIFCSRPRRALPGLHQHPRSCTSASFPMPSGPRRPHLRYMPSARKGTFTIVPGEP
FT                   REPAGGGRGRETFQGERRTMASRRLDPQRWCPCNPGSRRAHGCLVCLAVSSPGLPGGPD
FT                   AALLHPPFASVACGPRASFPHSAPQIPGAPETEDLDPRPERRPQGTTPHCVARSRPLSP
FT                   FAPSKAPGPRVRSPVRSP"
FT   gene            complement(9308874..>9332151)
FT                   /gene="Cpz"
FT                   /locus_tag="mCG_2545"
FT                   /note="gene_id=mCG2545.1"
FT   mRNA            complement(join(9308874..9309338,9310309..9310408,
FT                   9313329..9313468,9314773..9314908,9317770..9317928,
FT                   9318450..9318611,9319158..9319354,9322061..9322273,
FT                   9324103..9324477,9325791..9325823,9332049..>9332151))
FT                   /gene="Cpz"
FT                   /locus_tag="mCG_2545"
FT                   /product="carboxypeptidase Z"
FT                   /note="gene_id=mCG2545.1 transcript_id=mCT1558.2 created on
FT                   19-SEP-2002"
FT   CDS             complement(join(9308992..9309338,9310309..9310408,
FT                   9313329..9313468,9314773..9314908,9317770..9317928,
FT                   9318450..9318611,9319158..9319354,9322061..9322273,
FT                   9324103..9324477,9325791..9325823,9332049..9332151))
FT                   /codon_start=1
FT                   /gene="Cpz"
FT                   /locus_tag="mCG_2545"
FT                   /product="carboxypeptidase Z"
FT                   /note="gene_id=mCG2545.1 transcript_id=mCT1558.2
FT                   protein_id=mCP3981.2"
FT                   /db_xref="GOA:Q8R4V4"
FT                   /db_xref="InterPro:IPR000834"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR014766"
FT                   /db_xref="InterPro:IPR020067"
FT                   /db_xref="MGI:MGI:88487"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8R4V4"
FT                   /protein_id="EDL37485.1"
FT                   /translation="MPTMPLLLAALAALAVLALAARPSPSCSPGPDPSGKCQRLVYTHS
FT                   ATCVDLHLRTCADAAYNHTSFPTPLEHRSWEAVESSPEYMLLGVIHFLLEGQCNPDLRL
FT                   LGCSVLAPRCEGGHTQRPCRHVCEGLREACQPAFDAIDMAWPYFLDCAQYFAPEEEGCY
FT                   DPLEELRGELDVEEALPSGLPPTFIRFAHHSYAQMVRVLKRTAARCSQVAKTYSIGRSF
FT                   EGKDLVVIEFSSRPGQHELMEPEVKLIGNIHGNEVAGREVLIYLAQYLCSEYLLGNPRI
FT                   QRLLNTTRIHLLPSMNPDGYEVAAAEGAGYNGWTSGRQNAQNLDLNRNFPDLTSEYYRL
FT                   ASTRGVRTDHIPISQYYWWGKVAPETKAIMKWIQTIPFVLSASLHGGDLVVSYPFDFSK
FT                   NPHEKKMFSPTPDEKMFKLLARAYADVHPMMMDRSENRCGGNFLKRGSIINGADWYSFT
FT                   GGMSDFNYLHTNCFEITVELGCVKFPPEEALYGLWQQNKEPLLNFLEMVHRGIKGMVTD
FT                   KYGKPVKNARILVKGIRHDVTTAPDGDYWRLLPPGSHIVIAQAPGYSKVMKRVTIPLRM
FT                   KKAGRVDFILHPLATGPKNFLPGPSRALPRFQDPQREPTQMDFEPPRARRQPASGSKPW
FT                   WWAYFTSLSPYKPRWLLKY"
FT   gene            9358035..9360572
FT                   /pseudo
FT                   /locus_tag="mCG_2549"
FT                   /note="gene_id=mCG2549.2"
FT   mRNA            9358035..9360572
FT                   /pseudo
FT                   /locus_tag="mCG_2549"
FT                   /note="gene_id=mCG2549.2 transcript_id=mCT1563.2 created on
FT                   03-OCT-2002"
FT   gene            complement(9361166..9379408)
FT                   /gene="2310079F23Rik"
FT                   /locus_tag="mCG_2554"
FT                   /note="gene_id=mCG2554.1"
FT   mRNA            complement(join(9361166..9362375,9366812..9366928,
FT                   9368343..9368775,9369681..9369864,9370743..9370849,
FT                   9373082..9373153,9374218..9374325,9375391..9375459,
FT                   9377050..9377269,9378427..9378541,9378906..9379408))
FT                   /gene="2310079F23Rik"
FT                   /locus_tag="mCG_2554"
FT                   /product="RIKEN cDNA 2310079F23"
FT                   /note="gene_id=mCG2554.1 transcript_id=mCT1548.2 created on
FT                   08-NOV-2002"
FT   CDS             complement(join(9362146..9362375,9366812..9366928,
FT                   9368343..9368775,9369681..9369864,9370743..9370849,
FT                   9373082..9373153,9374218..9374325,9375391..9375459,
FT                   9377050..9377269,9378427..9378541,9378906..9379392))
FT                   /codon_start=1
FT                   /gene="2310079F23Rik"
FT                   /locus_tag="mCG_2554"
FT                   /product="RIKEN cDNA 2310079F23"
FT                   /note="gene_id=mCG2554.1 transcript_id=mCT1548.2
FT                   protein_id=mCP3972.2"
FT                   /db_xref="GOA:Q9D2Q2"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR011671"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="MGI:MGI:1926140"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9D2Q2"
FT                   /protein_id="EDL37486.1"
FT                   /translation="MEELGRVRLSDPDALLPAGFWAAVTVWLERPQVANKRLCGARMEA
FT                   RGRTLRSHAQAECGPRQGQGHGLEREPGQASPKGEPESGPRASREGTAPAADLNSLWDR
FT                   VSQSLVHANPEMLAFLCGPSLGPQPEAAQELDLILRTVIPKASPHSPLTEPKKELVVQD
FT                   VSSGSVTFLPLEEDNEGNLEVKTSNVYQLHLHHNEGEWFISVLIFCPERWHSDGVVYPK
FT                   PAWLGEELLSKLARWAVENRKSEFKSTLSLVSILRYSRMYQELKEKYRDMVKVWPEVTD
FT                   PEKFVYEDVAIATYLLILWEEERAEKGVTTKQSFVDLGCGNGLLVHILSNEGHPGRGID
FT                   IRRRKIWDMYGPQTQLEEGSITPSDETLFPGVDWLIGNHSDELTPWIPVIAARSSYTCR
FT                   FFVLPCCFFDFVGRYQRQQSRKTQYREYLDFVLEVGLSCGFHVQEDCLRIPSTKRVCLI
FT                   GKSRTYPPSAEVWMDEQRTRYLHSRQGHPQSRPGGAHAPSAPQTAAHDAGLQDSCRTVN
FT                   AGSECVLEGLAAERGAGAPAPGLWVPGFCPREKAERVRNCAALPRDFVDQVVLQVANLL
FT                   LDRKKFNTGNSEARSLKPWNGGGSLSLAEVAAELNSETLQRLKRECGGLQTLLKNSHQV
FT                   FEVLNGRVHIRDWRQELQRGKPPEAKQNLSAAVFKTRICWFFAHHPDGCVLPAAQCPFA
FT                   HGPEELRLSQTLKKQRQAP"
FT   gene            complement(9385574..>9393115)
FT                   /gene="4931431C16Rik"
FT                   /locus_tag="mCG_146112"
FT                   /note="gene_id=mCG146112.0"
FT   mRNA            complement(join(9385574..9387921,9392020..9392087,
FT                   9392395..9392527,9392927..>9393115))
FT                   /gene="4931431C16Rik"
FT                   /locus_tag="mCG_146112"
FT                   /product="RIKEN cDNA 4931431C16"
FT                   /note="gene_id=mCG146112.0 transcript_id=mCT186215.0
FT                   created on 14-JUL-2003"
FT   CDS             complement(9387310..>9387762)
FT                   /codon_start=1
FT                   /gene="4931431C16Rik"
FT                   /locus_tag="mCG_146112"
FT                   /product="RIKEN cDNA 4931431C16"
FT                   /note="gene_id=mCG146112.0 transcript_id=mCT186215.0
FT                   protein_id=mCP107477.0"
FT                   /protein_id="EDL37487.1"
FT                   /translation="EFAKSTMHLRSINSVLPGHSREQSSDTTNSTYKLTLFCLGIPPGR
FT                   RADCKKLRSVRSPASEYDVRQSANASSHPSLSSCKPFLSGISRARHVLTSRIQLGIRGP
FT                   SQPGVWRTLFIRNILTSEGGASWWCRPAPPRPIPDIIPPLTGVAAG"
FT   gene            <9387387..9418384
FT                   /gene="Acox3"
FT                   /locus_tag="mCG_2540"
FT                   /note="gene_id=mCG2540.3"
FT   mRNA            join(<9387387..9387481,9388223..9388322,9392508..9392662,
FT                   9392968..9393201,9393525..9393599,9394043..9394132,
FT                   9396426..9396569,9398660..9398748,9402665..9402761,
FT                   9404043..9404225,9405800..9405922,9407218..9407338,
FT                   9408903..9409025,9409496..9409609,9411371..9411486,
FT                   9412841..9413015,9413603..9413670,9414319..9414405,
FT                   9416598..9416790)
FT                   /gene="Acox3"
FT                   /locus_tag="mCG_2540"
FT                   /product="acyl-Coenzyme A oxidase 3, pristanoyl, transcript
FT                   variant mCT193619"
FT                   /note="gene_id=mCG2540.3 transcript_id=mCT193619.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(9387396..9387666,9388223..9388322,9392508..9392662,
FT                   9392968..9393201,9393525..9393599,9394043..9394132,
FT                   9396426..9396569,9398660..9398748,9402665..9402761,
FT                   9404043..9404225,9405800..9405922,9407218..9407338,
FT                   9408903..9409025,9409496..9409609,9411371..9411486,
FT                   9412841..9413015,9413603..9413670,9414319..9414405,
FT                   9416598..9418384)
FT                   /gene="Acox3"
FT                   /locus_tag="mCG_2540"
FT                   /product="acyl-Coenzyme A oxidase 3, pristanoyl, transcript
FT                   variant mCT1561"
FT                   /note="gene_id=mCG2540.3 transcript_id=mCT1561.1 created on
FT                   18-SEP-2002"
FT   mRNA            join(<9387448..9387943,9388223..9388322,9392508..9392662,
FT                   9392968..9393201,9393525..9393599,9394043..9394132,
FT                   9396426..9396569,9398660..9398748,9402665..9402761,
FT                   9404043..9404225,9405800..9405922,9407218..9407338,
FT                   9408903..9409025,9409496..9409609,9411371..9411486,
FT                   9412841..9413015,9413603..9413670,9414319..9414405,
FT                   9415663..9416451)
FT                   /gene="Acox3"
FT                   /locus_tag="mCG_2540"
FT                   /product="acyl-Coenzyme A oxidase 3, pristanoyl, transcript
FT                   variant mCT193618"
FT                   /note="gene_id=mCG2540.3 transcript_id=mCT193618.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<9388301..9388322,9392508..9392662,9392968..9393201,
FT                   9393525..9393599,9394043..9394132,9396426..9396569,
FT                   9398660..9398748,9402665..9402761,9404043..9404225,
FT                   9405800..9405922,9407218..9407338,9408903..9409025,
FT                   9409496..9409609,9411371..9411486,9412841..9413015,
FT                   9413603..9413670,9414319..9414405,9416598..9416717)
FT                   /codon_start=1
FT                   /gene="Acox3"
FT                   /locus_tag="mCG_2540"
FT                   /product="acyl-Coenzyme A oxidase 3, pristanoyl, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG2540.3 transcript_id=mCT193619.0
FT                   protein_id=mCP114595.0 isoform=CRA_c"
FT                   /protein_id="EDL37490.1"
FT                   /translation="ETGTKQVGDSTMGSLPEEKDSALWSDTPKGPLSAYRARASFNSGE
FT                   LLLFWDGQDVIHFKKTIFSTLENDPLFARSYGADLPLEKLRELNFLRCKRVFEYGFFKV
FT                   EELLKNPLKILVLINCLGMYDWSLANKCVLHMLVFGTTVFVSGSEKHFKYLEKIYSLEI
FT                   FGCFALTELSHGSNTKAMRTTAHYDPDTQEFILHSPDFEAAKFWVGNLGKTATHAVVFA
FT                   QLYMPDGQCHGLHSFLVQIRDTKTLLPMTGVMVGDIGKKLGQNGLDNGFAMFNKVRIPR
FT                   QNLLDRTGNITSEGTYNSPFKDVRQRLGASLGSLSSGRISIISMSVVNLKLAVSIAIRF
FT                   SATRCQFGPTDKEEIPVLEYPLQQWRILPYLAAAYALDHFSKTIFMDLIEVQSARLRGD
FT                   HSDQQAELGREIHALASAGKPLASWTAQRGIQECREACGGHGYLAMNRFGDLRNDNDPN
FT                   CTYEGDNNVLLQQTSNYLLSLLEPPLQDGAHFTSPLKTVDFLEAYPGILGQKFLGSSKA
FT                   DWMDSAAPLAAYRWLVCYLLQESHRRYCQEKKSRGSDFEARNNSQVYGCRPLALAFMEL
FT                   TVMQRFHEHIHSSGLSPSLRTVLGRLSTLYGLWCLSQHMALLYRGGYISGEQTGRAMED
FT                   AILTLCEQLKDDAVALVDVIAPSDFVLNSPIAKADGELYKNLWAAVLQQNGVLERAAWW
FT                   PEFSANKSVADRLKSQL"
FT   CDS             join(<9388301..9388322,9392508..9392662,9392968..9393201,
FT                   9393525..9393599,9394043..9394132,9396426..9396569,
FT                   9398660..9398748,9402665..9402761,9404043..9404225,
FT                   9405800..9405922,9407218..9407338,9408903..9409025,
FT                   9409496..9409609,9411371..9411486,9412841..9413015,
FT                   9413603..9413670,9414319..9414405,9415663..9415773)
FT                   /codon_start=1
FT                   /gene="Acox3"
FT                   /locus_tag="mCG_2540"
FT                   /product="acyl-Coenzyme A oxidase 3, pristanoyl, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG2540.3 transcript_id=mCT193618.0
FT                   protein_id=mCP114594.0 isoform=CRA_b"
FT                   /protein_id="EDL37489.1"
FT                   /translation="ETGTKQVGDSTMGSLPEEKDSALWSDTPKGPLSAYRARASFNSGE
FT                   LLLFWDGQDVIHFKKTIFSTLENDPLFARSYGADLPLEKLRELNFLRCKRVFEYGFFKV
FT                   EELLKNPLKILVLINCLGMYDWSLANKCVLHMLVFGTTVFVSGSEKHFKYLEKIYSLEI
FT                   FGCFALTELSHGSNTKAMRTTAHYDPDTQEFILHSPDFEAAKFWVGNLGKTATHAVVFA
FT                   QLYMPDGQCHGLHSFLVQIRDTKTLLPMTGVMVGDIGKKLGQNGLDNGFAMFNKVRIPR
FT                   QNLLDRTGNITSEGTYNSPFKDVRQRLGASLGSLSSGRISIISMSVVNLKLAVSIAIRF
FT                   SATRCQFGPTDKEEIPVLEYPLQQWRILPYLAAAYALDHFSKTIFMDLIEVQSARLRGD
FT                   HSDQQAELGREIHALASAGKPLASWTAQRGIQECREACGGHGYLAMNRFGDLRNDNDPN
FT                   CTYEGDNNVLLQQTSNYLLSLLEPPLQDGAHFTSPLKTVDFLEAYPGILGQKFLGSSKA
FT                   DWMDSAAPLAAYRWLVCYLLQESHRRYCQEKKSRGSDFEARNNSQVYGCRPLALAFMEL
FT                   TVMQRFHEHIHSSGLSPSLRTVLGRLSTLYGLWCLSQHMALLYRGGYISGEQTGRAMED
FT                   AILTLCEQLKDDAVALVDVIAPSDFVLNSPIAKADGEVDFSGICRQDLLGRTTTCRACC
FT                   LQKELSTCSLVKNC"
FT   CDS             join(9392519..9392662,9392968..9393201,9393525..9393599,
FT                   9394043..9394132,9396426..9396569,9398660..9398748,
FT                   9402665..9402761,9404043..9404225,9405800..9405922,
FT                   9407218..9407338,9408903..9409025,9409496..9409609,
FT                   9411371..9411486,9412841..9413015,9413603..9413670,
FT                   9414319..9414405,9416598..9416717)
FT                   /codon_start=1
FT                   /gene="Acox3"
FT                   /locus_tag="mCG_2540"
FT                   /product="acyl-Coenzyme A oxidase 3, pristanoyl, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG2540.3 transcript_id=mCT1561.1
FT                   protein_id=mCP3935.1 isoform=CRA_a"
FT                   /protein_id="EDL37488.1"
FT                   /translation="MGSLPEEKDSALWSDTPKGPLSAYRARASFNSGELLLFWDGQDVI
FT                   HFKKTIFSTLENDPLFARSYGADLPLEKLRELNFLRCKRVFEYGFFKVEELLKNPLKIL
FT                   VLINCLGMYDWSLANKCVLHMLVFGTTVFVSGSEKHFKYLEKIYSLEIFGCFALTELSH
FT                   GSNTKAMRTTAHYDPDTQEFILHSPDFEAAKFWVGNLGKTATHAVVFAQLYMPDGQCHG
FT                   LHSFLVQIRDTKTLLPMTGVMVGDIGKKLGQNGLDNGFAMFNKVRIPRQNLLDRTGNIT
FT                   SEGTYNSPFKDVRQRLGASLGSLSSGRISIISMSVVNLKLAVSIAIRFSATRCQFGPTD
FT                   KEEIPVLEYPLQQWRILPYLAAAYALDHFSKTIFMDLIEVQSARLRGDHSDQQAELGRE
FT                   IHALASAGKPLASWTAQRGIQECREACGGHGYLAMNRFGDLRNDNDPNCTYEGDNNVLL
FT                   QQTSNYLLSLLEPPLQDGAHFTSPLKTVDFLEAYPGILGQKFLGSSKADWMDSAAPLAA
FT                   YRWLVCYLLQESHRRYCQEKKSRGSDFEARNNSQVYGCRPLALAFMELTVMQRFHEHIH
FT                   SSGLSPSLRTVLGRLSTLYGLWCLSQHMALLYRGGYISGEQTGRAMEDAILTLCEQLKD
FT                   DAVALVDVIAPSDFVLNSPIAKADGELYKNLWAAVLQQNGVLERAAWWPEFSANKSVAD
FT                   RLKSQL"
FT   gene            complement(9456776..9484612)
FT                   /gene="Htra3"
FT                   /locus_tag="mCG_7096"
FT                   /note="gene_id=mCG7096.2"
FT   mRNA            complement(join(9456776..9457571,9457793..9457894,
FT                   9458847..9458942,9460326..9460374,9468738..9468852,
FT                   9470189..9470221,9470825..9471019,9472972..9473194,
FT                   9475823..9475922,9483738..9484612))
FT                   /gene="Htra3"
FT                   /locus_tag="mCG_7096"
FT                   /product="HtrA serine peptidase 3, transcript variant
FT                   mCT6193"
FT                   /note="gene_id=mCG7096.2 transcript_id=mCT6193.2 created on
FT                   18-FEB-2003"
FT   CDS             complement(join(9457523..9457571,9457793..9457894,
FT                   9458847..9458942,9460326..9460374,9468738..9468852,
FT                   9470189..9470221,9470825..9471019,9472972..9473194,
FT                   9475823..9475922,9483738..9484140))
FT                   /codon_start=1
FT                   /gene="Htra3"
FT                   /locus_tag="mCG_7096"
FT                   /product="HtrA serine peptidase 3, isoform CRA_a"
FT                   /note="gene_id=mCG7096.2 transcript_id=mCT6193.2
FT                   protein_id=mCP3903.2 isoform=CRA_a"
FT                   /protein_id="EDL37491.1"
FT                   /translation="MQARALLPATLAILATLAVLALAREPPAAPCPARCDVSRCPSPRC
FT                   PGGYVPDLCNCCLVCAASEGEPCGRPLDSPCGDSLECVRGVCRCRWTHTVCGTDGHTYA
FT                   DVCALQAASRRALQVSGTPVRQLQKGACPSGLHQLTSPRYKFNFIADVVEKIAPAVVHI
FT                   ELFLRHPLFGRNVPLSSGSGFIMSEAGLIVTNAHVVSSSSTASGRQQLKVQLQNGDAYE
FT                   ATIQDIDKKSDIATIVIHPKKKLPVLLLGHSADLRPGEFVVAIGSPFALQNTVTTGIVS
FT                   TAQRDGKELGLRDSDMDYIQTDAIINYGNSGGPLVNLDGEVIGINTLKVAAGISFAIPS
FT                   DRITRFLSEFQNKHVKDWKKRFIGIRMRTITPSLVEELKAANPDFPAVSSGIYVQEVVP
FT                   NSPSQRGGIQDGDIIVKVNGRPLADSSELQEAVLNESSLLPRLDLTRGPDLSLDP"
FT   mRNA            complement(join(<9457793..9457894,9458847..9458942,
FT                   9460326..9460374,9468738..9468852,9470189..9470221,
FT                   9470825..9470878,9483787..9484164))
FT                   /gene="Htra3"
FT                   /locus_tag="mCG_7096"
FT                   /product="HtrA serine peptidase 3, transcript variant
FT                   mCT180348"
FT                   /note="gene_id=mCG7096.2 transcript_id=mCT180348.0 created
FT                   on 18-FEB-2003"
FT   CDS             complement(join(<9457793..9457894,9458847..9458942,
FT                   9460326..9460374,9468738..9468852,9470189..9470221,
FT                   9470825..9470878,9483787..9484140))
FT                   /codon_start=1
FT                   /gene="Htra3"
FT                   /locus_tag="mCG_7096"
FT                   /product="HtrA serine peptidase 3, isoform CRA_b"
FT                   /note="gene_id=mCG7096.2 transcript_id=mCT180348.0
FT                   protein_id=mCP103270.0 isoform=CRA_b"
FT                   /protein_id="EDL37492.1"
FT                   /translation="MQARALLPATLAILATLAVLALAREPPAAPCPARCDVSRCPSPRC
FT                   PGGYVPDLCNCCLVCAASEGEPCGRPLDSPCGDSLECVRGVCRCRWTHTVCGTDGHTYA
FT                   DVCALQAASRRALQLGLRDSDMDYIQTDAIINYGNSGGPLVNLDGEVIGINTLKVAAGI
FT                   SFAIPSDRITRFLSEFQNKHVKDWKKRFIGIRMRTITPSLVEELKAANPDFPAVSSGIY
FT                   VQEVVPNSPSQRGGIQDGDIIVKVNGRPLADSSELQEAVLNESSLL"
FT   gene            complement(9501964..9528927)
FT                   /gene="Sh3tc1"
FT                   /locus_tag="mCG_7089"
FT                   /note="gene_id=mCG7089.1"
FT   mRNA            complement(join(9501964..9502350,9504493..9504689,
FT                   9505039..9505189,9505367..9505489,9506633..9506783,
FT                   9508133..9508313,9510644..9512323,9514423..9514464,
FT                   9515639..9515772,9518838..9519033,9519801..9519877,
FT                   9520884..9521094,9521705..9521851,9523046..9523151,
FT                   9523748..9523875,9526305..9526379,9528689..9528927))
FT                   /gene="Sh3tc1"
FT                   /locus_tag="mCG_7089"
FT                   /product="SH3 domain and tetratricopeptide repeats 1,
FT                   transcript variant mCT6197"
FT                   /note="gene_id=mCG7089.1 transcript_id=mCT6197.2 created on
FT                   03-OCT-2002"
FT   mRNA            complement(join(9501965..9502350,9504493..9504689,
FT                   9505039..9505189,9505367..9505489,9506633..9506783,
FT                   9508133..9508313,9510644..9512323,9514423..9514464,
FT                   9515639..9515772,9518838..9519033,9519801..9519877,
FT                   9520884..9521094,9521705..9521851,9523046..9523151,
FT                   9526305..9526379,9528689..>9528721))
FT                   /gene="Sh3tc1"
FT                   /locus_tag="mCG_7089"
FT                   /product="SH3 domain and tetratricopeptide repeats 1,
FT                   transcript variant mCT193605"
FT                   /note="gene_id=mCG7089.1 transcript_id=mCT193605.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(9501965..9502350,9504493..9504577,
FT                   9505039..9505189,9505367..9505489,9506633..9506783,
FT                   9508133..9508313,9510644..9512323,9514423..9514464,
FT                   9515639..9515772,9518838..9519033,9519801..9519877,
FT                   9520884..9521094,9521705..9521851,9523046..9523151,
FT                   9523748..9523875,9526305..>9526378))
FT                   /gene="Sh3tc1"
FT                   /locus_tag="mCG_7089"
FT                   /product="SH3 domain and tetratricopeptide repeats 1,
FT                   transcript variant mCT193606"
FT                   /note="gene_id=mCG7089.1 transcript_id=mCT193606.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(9501965..9502350,9504493..9505189,
FT                   9505367..9505489,9506633..9506783,9508133..9508313,
FT                   9510644..9512323,9514423..9514464,9515639..9515772,
FT                   9518838..9519033,9519801..9519877,9520884..9521094,
FT                   9521705..9521851,9523046..>9524013))
FT                   /gene="Sh3tc1"
FT                   /locus_tag="mCG_7089"
FT                   /product="SH3 domain and tetratricopeptide repeats 1,
FT                   transcript variant mCT193607"
FT                   /note="gene_id=mCG7089.1 transcript_id=mCT193607.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(9502093..9502350,9504493..9504689,
FT                   9505039..9505189,9505367..9505489,9506633..9506783,
FT                   9508133..9508313,9510644..9512323,9514423..9514464,
FT                   9515639..9515772,9518838..9519033,9519801..9519877,
FT                   9520884..9521094,9521705..9521851,9523046..9523151,
FT                   9523748..9523875,9526305..9526379,9528689..9528872))
FT                   /codon_start=1
FT                   /gene="Sh3tc1"
FT                   /locus_tag="mCG_7089"
FT                   /product="SH3 domain and tetratricopeptide repeats 1,
FT                   isoform CRA_d"
FT                   /note="gene_id=mCG7089.1 transcript_id=mCT6197.2
FT                   protein_id=mCP3895.2 isoform=CRA_d"
FT                   /db_xref="GOA:G3X9F6"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="MGI:MGI:2678949"
FT                   /db_xref="UniProtKB/TrEMBL:G3X9F6"
FT                   /protein_id="EDL37496.1"
FT                   /translation="MRSFREEEEEATSEELFTMGRGPEEPRGSCSPEDQIQSVSMGLPT
FT                   GQERTGSAEAEATVRGDVAPPRIVVGLAAEPPPSQMTVYPTDLTLQLLAVRRKSGLRSP
FT                   SLQQALRSRLRLLENDSREVARVLGELSARLLSIHSDQDRIVVTFKTFEEIWKFSTYHA
FT                   LGFTHHCLENLLVDQTFWLLSPSEEEETAILMYVNKDALKQTHKNLLTQEGSIFVLCPD
FT                   HRVRRTIGPKGAGKGPQTLRRASGVPLGVAILETDSSSPTPNMSSNVEAAEAEPEPLTP
FT                   FHQWTLRVPWDPIDESMSGPGTPDAQLMRFGLASAIADFQGSGPEEMSFSVGDVIEILG
FT                   AQVPGLPWCVGRHMASGQVGFVRTGLVSMQGPASDLESAIFLSEEERSFFRSEGHFSDE
FT                   DARRLLSRTSGTDVCTTCSLDWLEEAEGEQLEQREMSLPHLNPEPHGTLQMVKNILEKC
FT                   KACPDHPEAPVSWSLGGVSRRASSLDLEEPRFCLDPEDDWTDPEPLDSLLQVLNAPGYG
FT                   AHFRSLYDISLPWLSTALYGFDDEEELAERLAQARGVAKKVDLSMALARLCLLLGRLCA
FT                   RKLKLSQARVYFEEALGALEGSFGDLSLVAAVYSSLTTVYLKQKNAEKCVQVAPKAAAL
FT                   LLGTPGHSCNADAELLKYALRRVICGLSPQAEARACFLLARHYTHLKQPEEALPYLERL
FT                   LRLNRDAGSPQASWPEDCYLLLADIYGRKCLPHLALSCLRVSSLWTRCSLPGSLRSVDL
FT                   VLQNVPGPNSQRRAGHSLPSQIAYYLRQALASLAPGTGQALRGPLYASLAQLYSHHQQY
FT                   SQAIAFMSQAAEADTAAGVHPVVDRLVALAWLHMLCGNSLVAMDILKCISDAAVANKDQ
FT                   ECVMMNMVAMALKRMGRTRQAAEGYFRALHMAYAQGHLQSQAVVLANFGALCLQAGARS
FT                   LAQHYLREAVGLFSQVPSGVCGRDFTQVLLWLGQLCTRRALPQQAKCYYEWAFLVAVET
FT                   DHLESQLQAVQKLCLFYSKVMPNEVRCVIYHEFQLALARKTANKVLEGQLLEAISQLYL
FT                   SLGTERAYKSALDYTKRSLGIFIDLQQKEKEARAWLQAGKIYYILRQNELVDLYIQVAQ
FT                   NAALYTGDPKLGLELFEAAGDIFFNGTWEREKAVSFYRDRALPLAVTVGDQEVELRLCN
FT                   KLVALLSALEAPQEGLEFAHEALALSITLGDRLNERVAYHRLATLHHRLGHGELAEHFF
FT                   LKALSLCSSPLEFDEETLYYVKVYLVLGDIIFYDLKDPFDAAGYYQLALAAAVDLGHKK
FT                   AQLKIYTRLATIYHHFLVDREMSLFFYQKARTFASELNLRRTNLVPQRFCGRAPWLAPG
FT                   HPS"
FT   CDS             complement(join(9502093..9502350,9504493..9504689,
FT                   9505039..9505189,9505367..9505489,9506633..9506783,
FT                   9508133..9508313,9510644..9512323,9514423..9514464,
FT                   9515639..9515772,9518838..9519033,9519801..9519877,
FT                   9520884..9521094,9521705..9521851,9523046..9523151,
FT                   9526305..>9526319))
FT                   /codon_start=1
FT                   /gene="Sh3tc1"
FT                   /locus_tag="mCG_7089"
FT                   /product="SH3 domain and tetratricopeptide repeats 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG7089.1 transcript_id=mCT193605.0
FT                   protein_id=mCP114602.0 isoform=CRA_a"
FT                   /protein_id="EDL37493.1"
FT                   /translation="QCIQQELSARLLSIHSDQDRIVVTFKTFEEIWKFSTYHALGFTHH
FT                   CLENLLVDQTFWLLSPSEEEETAILMYVNKDALKQTHKNLLTQEGSIFVLCPDHRVRRT
FT                   IGPKGAGKGPQTLRRASGVPLGVAILETDSSSPTPNMSSNVEAAEAEPEPLTPFHQWTL
FT                   RVPWDPIDESMSGPGTPDAQLMRFGLASAIADFQGSGPEEMSFSVGDVIEILGAQVPGL
FT                   PWCVGRHMASGQVGFVRTGLVSMQGPASDLESAIFLSEEERSFFRSEGHFSDEDARRLL
FT                   SRTSGTDVCTTCSLDWLEEAEGEQLEQREMSLPHLNPEPHGTLQMVKNILEKCKACPDH
FT                   PEAPVSWSLGGVSRRASSLDLEEPRFCLDPEDDWTDPEPLDSLLQVLNAPGYGAHFRSL
FT                   YDISLPWLSTALYGFDDEEELAERLAQARGVAKKVDLSMALARLCLLLGRLCARKLKLS
FT                   QARVYFEEALGALEGSFGDLSLVAAVYSSLTTVYLKQKNAEKCVQVAPKAAALLLGTPG
FT                   HSCNADAELLKYALRRVICGLSPQAEARACFLLARHYTHLKQPEEALPYLERLLRLNRD
FT                   AGSPQASWPEDCYLLLADIYGRKCLPHLALSCLRVSSLWTRCSLPGSLRSVDLVLQNVP
FT                   GPNSQRRAGHSLPSQIAYYLRQALASLAPGTGQALRGPLYASLAQLYSHHQQYSQAIAF
FT                   MSQAAEADTAAGVHPVVDRLVALAWLHMLCGNSLVAMDILKCISDAAVANKDQECVMMN
FT                   MVAMALKRMGRTRQAAEGYFRALHMAYAQGHLQSQAVVLANFGALCLQAGARSLAQHYL
FT                   REAVGLFSQVPSGVCGRDFTQVLLWLGQLCTRRALPQQAKCYYEWAFLVAVETDHLESQ
FT                   LQAVQKLCLFYSKVMPNEVRCVIYHEFQLALARKTANKVLEGQLLEAISQLYLSLGTER
FT                   AYKSALDYTKRSLGIFIDLQQKEKEARAWLQAGKIYYILRQNELVDLYIQVAQNAALYT
FT                   GDPKLGLELFEAAGDIFFNGTWEREKAVSFYRDRALPLAVTVGDQEVELRLCNKLVALL
FT                   SALEAPQEGLEFAHEALALSITLGDRLNERVAYHRLATLHHRLGHGELAEHFFLKALSL
FT                   CSSPLEFDEETLYYVKVYLVLGDIIFYDLKDPFDAAGYYQLALAAAVDLGHKKAQLKIY
FT                   TRLATIYHHFLVDREMSLFFYQKARTFASELNLRRTNLVPQRFCGRAPWLAPGHPS"
FT   CDS             complement(join(9504537..9504577,9505039..9505189,
FT                   9505367..9505489,9506633..9506783,9508133..9508313,
FT                   9510644..9512323,9514423..9514464,9515639..9515772,
FT                   9518838..9519033,9519801..9519877,9520884..9521094,
FT                   9521705..9521851,9523046..9523151,9523748..9523875,
FT                   9526305..>9526377))
FT                   /codon_start=1
FT                   /gene="Sh3tc1"
FT                   /locus_tag="mCG_7089"
FT                   /product="SH3 domain and tetratricopeptide repeats 1,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG7089.1 transcript_id=mCT193606.0
FT                   protein_id=mCP114603.0 isoform=CRA_b"
FT                   /protein_id="EDL37494.1"
FT                   /translation="VAPPRIVVGLAAEPPPSQMTVYPTDLTLQLLAVRRKSGLRSPSLQ
FT                   QALRSRLRLLENDSREVARVLGELSARLLSIHSDQDRIVVTFKTFEEIWKFSTYHALGF
FT                   THHCLENLLVDQTFWLLSPSEEEETAILMYVNKDALKQTHKNLLTQEGSIFVLCPDHRV
FT                   RRTIGPKGAGKGPQTLRRASGVPLGVAILETDSSSPTPNMSSNVEAAEAEPEPLTPFHQ
FT                   WTLRVPWDPIDESMSGPGTPDAQLMRFGLASAIADFQGSGPEEMSFSVGDVIEILGAQV
FT                   PGLPWCVGRHMASGQVGFVRTGLVSMQGPASDLESAIFLSEEERSFFRSEGHFSDEDAR
FT                   RLLSRTSGTDVCTTCSLDWLEEAEGEQLEQREMSLPHLNPEPHGTLQMVKNILEKCKAC
FT                   PDHPEAPVSWSLGGVSRRASSLDLEEPRFCLDPEDDWTDPEPLDSLLQVLNAPGYGAHF
FT                   RSLYDISLPWLSTALYGFDDEEELAERLAQARGVAKKVDLSMALARLCLLLGRLCARKL
FT                   KLSQARVYFEEALGALEGSFGDLSLVAAVYSSLTTVYLKQKNAEKCVQVAPKAAALLLG
FT                   TPGHSCNADAELLKYALRRVICGLSPQAEARACFLLARHYTHLKQPEEALPYLERLLRL
FT                   NRDAGSPQASWPEDCYLLLADIYGRKCLPHLALSCLRVSSLWTRCSLPGSLRSVDLVLQ
FT                   NVPGPNSQRRAGHSLPSQIAYYLRQALASLAPGTGQALRGPLYASLAQLYSHHQQYSQA
FT                   IAFMSQAAEADTAAGVHPVVDRLVALAWLHMLCGNSLVAMDILKCISDAAVANKDQECV
FT                   MMNMVAMALKRMGRTRQAAEGYFRALHMAYAQGHLQSQAVVLANFGALCLQAGARSLAQ
FT                   HYLREAVGLFSQVPSGVCGRDFTQVLLWLGQLCTRRALPQQAKCYYEWAFLVAVETDHL
FT                   ESQLQAVQKLCLFYSKVMPNEVRCVIYHEFQLALARKTANKVLEGQLLEAISQLYLSLG
FT                   TERAYKSALDYTKRSLGIFIDLQQKEKEARAWLQAGKIYYILRQNELVDLYIQVAQNAA
FT                   LYTGDPKLGLELFEAAGDIFFNGTWEREKAVSFYRDRALPLAVTVGDQEVELRLCNKLV
FT                   ALLSALEAPQEGLEFAHEALALSITLARPWNSMRRPCTM"
FT   CDS             complement(join(9504941..9505189,9505367..9505489,
FT                   9506633..9506783,9508133..9508313,9510644..9512323,
FT                   9514423..9514464,9515639..9515772,9518838..9519033,
FT                   9519801..9519877,9520884..9521094,9521705..9521851,
FT                   9523046..>9523280))
FT                   /codon_start=1
FT                   /gene="Sh3tc1"
FT                   /locus_tag="mCG_7089"
FT                   /product="SH3 domain and tetratricopeptide repeats 1,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG7089.1 transcript_id=mCT193607.0
FT                   protein_id=mCP114604.0 isoform=CRA_c"
FT                   /protein_id="EDL37495.1"
FT                   /translation="GKAHSLALVTPTRAVLYILSRSTHLFSNGWIHNLVHSLSLPFKEL
FT                   SARLLSIHSDQDRIVVTFKTFEEIWKFSTYHALGFTHHCLENLLVDQTFWLLSPSEEEE
FT                   TAILMYVNKDALKQTHKNLLTQEGSIFVLCPDHRVRRTIGPKGAGKGPQTLRRASGVPL
FT                   GVAILETDSSSPTPNMSSNVEAAEAEPEPLTPFHQWTLRVPWDPIDESMSGPGTPDAQL
FT                   MRFGLASAIADFQGSGPEEMSFSVGDVIEILGAQVPGLPWCVGRHMASGQVGFVRTGLV
FT                   SMQGPASDLESAIFLSEEERSFFRSEGHFSDEDARRLLSRTSGTDVCTTCSLDWLEEAE
FT                   GEQLEQREMSLPHLNPEPHGTLQMVKNILEKCKACPDHPEAPVSWSLGGVSRRASSLDL
FT                   EEPRFCLDPEDDWTDPEPLDSLLQVLNAPGYGAHFRSLYDISLPWLSTALYGFDDEEEL
FT                   AERLAQARGVAKKVDLSMALARLCLLLGRLCARKLKLSQARVYFEEALGALEGSFGDLS
FT                   LVAAVYSSLTTVYLKQKNAEKCVQVAPKAAALLLGTPGHSCNADAELLKYALRRVICGL
FT                   SPQAEARACFLLARHYTHLKQPEEALPYLERLLRLNRDAGSPQASWPEDCYLLLADIYG
FT                   RKCLPHLALSCLRVSSLWTRCSLPGSLRSVDLVLQNVPGPNSQRRAGHSLPSQIAYYLR
FT                   QALASLAPGTGQALRGPLYASLAQLYSHHQQYSQAIAFMSQAAEADTAAGVHPVVDRLV
FT                   ALAWLHMLCGNSLVAMDILKCISDAAVANKDQECVMMNMVAMALKRMGRTRQAAEGYFR
FT                   ALHMAYAQGHLQSQAVVLANFGALCLQAGARSLAQHYLREAVGLFSQVPSGVCGRDFTQ
FT                   VLLWLGQLCTRRALPQQAKCYYEWAFLVAVETDHLESQLQAVQKLCLFYSKVMPNEVRC
FT                   VIYHEFQLALARKTANKVLEGQLLEAISQLYLSLGTERAYKSALDYTKRSLGIFIDLQQ
FT                   KEKEARAWLQAGKIYYILRQNELVDLYIQVAQNAALYTGDPKLGLELFEAAGDIFFNGT
FT                   WEREKAVSFYRDRALPLAVTVGDQEVELRLCNKLVALLSALEAPQEGLEFAHEALALSI
FT                   TLGESSALSSAWPPVPGVEAWLLPSPAGTAQQLC"
FT   gene            <9562753..9689739
FT                   /gene="Ablim2"
FT                   /locus_tag="mCG_120156"
FT                   /note="gene_id=mCG120156.2"
FT   mRNA            join(<9562753..9562905,9603216..9603359,9607124..9607307,
FT                   9611781..9611896,9613925..9614051,9616874..9616974,
FT                   9624884..9625053,9628766..9628853,9632860..9632918,
FT                   9638033..9638110,9641918..9642067,9646250..9646370,
FT                   9648131..9648229,9654463..9654516,9661996..9662048,
FT                   9662694..9662832,9671555..9671616,9677940..9678003,
FT                   9679577..9679683,9688074..9689738)
FT                   /gene="Ablim2"
FT                   /locus_tag="mCG_120156"
FT                   /product="actin-binding LIM protein 2, transcript variant
FT                   mCT121342"
FT                   /note="gene_id=mCG120156.2 transcript_id=mCT121342.1
FT                   created on 03-OCT-2002"
FT   CDS             join(<9562755..9562905,9603216..9603359,9607124..9607307,
FT                   9611781..9611896,9613925..9614051,9616874..9616974,
FT                   9624884..9625053,9628766..9628853,9632860..9632918,
FT                   9638033..9638110,9641918..9642067,9646250..9646370,
FT                   9648131..9648229,9654463..9654516,9661996..9662048,
FT                   9662694..9662832,9671555..9671616,9677940..9678003,
FT                   9679577..9679683,9688074..9688187)
FT                   /codon_start=1
FT                   /gene="Ablim2"
FT                   /locus_tag="mCG_120156"
FT                   /product="actin-binding LIM protein 2, isoform CRA_a"
FT                   /note="gene_id=mCG120156.2 transcript_id=mCT121342.1
FT                   protein_id=mCP65355.1 isoform=CRA_a"
FT                   /protein_id="EDL37497.1"
FT                   /translation="VALRAAGTVCAEPLASSVLRILPAPHLPARSSGCRSAGTTLLGAA
FT                   ADMSAVSQPQAAHAPLEKPASTAILCNTCGNVCKGEVLRVQNKYFHIRCFVCKACGCDL
FT                   AEGGFFVRQGEHICTRDYQRLYGTRCFSCDRFIEGEVVSALGKTYHPDCFVCAVCRLPF
FT                   PPGDRVTFNGKECMCQKCSPPTLLGNSAHVAQGLRSCGGCGLEIKNGQALVALDKHWHL
FT                   GCFKCKTCGKLLNAEYISKDGLPYCEADYHSKFGIRCDGCEKYITGRVLEVRATITTKL
FT                   IRAINTDAISTMVLEVSPMTKIVIVTQAICTATARVSRTTWAHMKPWPSQAGEKHYHPS
FT                   CALCVRCGQMFSEGEEMYLQGSSIWHPACRQAARTEDKSKETRTSSESIVSVPASSTSG
FT                   SPSRVIYAKLGDEILDYRDLAALPKNKAIYNIDRPDMISYSPYISHSAVGDRQSYGEGD
FT                   QDDRSYKQCRTSSPSSAGSVSLGHYTPTSRSPQHYSRPAGTVSVGTSSCLSLSQHPSPT
FT                   SVFRHHYIPYFRDTGVKDNIYRKPPIYKQHAARRLDVEDSSFDQDSRKKTTWLLLKGDA
FT                   DTRTNSPDLDSQSLSLSSGTDQEPLQRMAGDSLYSRFPYSKPDTLPGPRKDGLDLRNAN
FT                   LAPCGADPDASWGTRGTHNNPVVSFLQIYPYDSLIVTNRIRVKLPKDVDRTRLERHLSP
FT                   EEFQEVFGMSIEEFDRLALWKRNDLKKKALLF"
FT   mRNA            join(<9562776..9562905,9603216..9603359,9607124..9607307,
FT                   9611781..9611896,9613925..9614051,9616874..9616967,
FT                   9628766..9628853,9632860..9632918,9638033..9638110,
FT                   9641918..9642067,9644759..9644791,9646250..9646370,
FT                   9648131..9648229,9653751..9653852,9654463..9654516,
FT                   9661996..9662048,9662694..9662836,9679603..9679683,
FT                   9688074..9689739)
FT                   /gene="Ablim2"
FT                   /locus_tag="mCG_120156"
FT                   /product="actin-binding LIM protein 2, transcript variant
FT                   mCT193591"
FT                   /note="gene_id=mCG120156.2 transcript_id=mCT193591.0
FT                   created on 09-MAR-2004"
FT   CDS             join(<9562776..9562905,9603216..9603359,9607124..9607307,
FT                   9611781..9611896,9613925..9614051,9616874..9616967,
FT                   9628766..9628853,9632860..9632918,9638033..9638110,
FT                   9641918..9642067,9644759..9644791,9646250..9646370,
FT                   9648131..9648229,9653751..9653852,9654463..9654516,
FT                   9661996..9662048,9662694..9662836,9679603..9679630)
FT                   /codon_start=1
FT                   /gene="Ablim2"
FT                   /locus_tag="mCG_120156"
FT                   /product="actin-binding LIM protein 2, isoform CRA_c"
FT                   /note="gene_id=mCG120156.2 transcript_id=mCT193591.0
FT                   protein_id=mCP114560.0 isoform=CRA_c"
FT                   /protein_id="EDL37499.1"
FT                   /translation="TVCAEPLASSVLRILPAPHLPARSSGCRSAGTTLLGAAADMSAVS
FT                   QPQAAHAPLEKPASTAILCNTCGNVCKGEVLRVQNKYFHIRCFVCKACGCDLAEGGFFV
FT                   RQGEHICTRDYQRLYGTRCFSCDRFIEGEVVSALGKTYHPDCFVCAVCRLPFPPGDRVT
FT                   FNGKECMCQKCSPPTLLGNSAHVAQGLRSCGGCGLEIKNGQALVALDKHWHLGCFKCKT
FT                   CGKLLNAEYISKDGLPYCEADYHSKFGIRCDGCEKYITGRVLEAGEKHYHPSCALCVRC
FT                   GQMFSEGEEMYLQGSSIWHPACRQAARTEDKSKETRTSSESIVSVPASSTSGSPSRVIY
FT                   AKLGDEILDYRDLAALPKNKAIYNIDRPDMISYSPYISHSAVGDRQSYGESPQLLSPTP
FT                   TEGDQDDRSYKQCRTSSPSSAGSVSLGHYTPTSRSPQHYSRPAGTVSVGTSSCLSLSQH
FT                   PSPTSVFRHHYIPYFRGSESGRSTPSLSVHSDSRPPSSTYQQAPRHFHVPDTGVKDNIY
FT                   RKPPIYKQHAARRLDVEDSSFDQDSRKKTTWLLLKGDADTRTNSPDLDSQSLSLSSGTD
FT                   QEPLQRMAGDSLYSREYIPMIPSS"
FT   mRNA            join(<9562804..9562905,9603216..9603359,9607124..9607307,
FT                   9611781..9611896,9613925..9614051,9616874..9616967,
FT                   9628766..9628853,9632860..9632918,9638033..9638110,
FT                   9641918..9642067,9646250..9646370,9648131..9648229,
FT                   9653751..9653852,9654463..9654516,9661996..9662048,
FT                   9662694..9662836,9679603..9679683,9688074..9689234)
FT                   /gene="Ablim2"
FT                   /locus_tag="mCG_120156"
FT                   /product="actin-binding LIM protein 2, transcript variant
FT                   mCT193590"
FT                   /note="gene_id=mCG120156.2 transcript_id=mCT193590.0
FT                   created on 09-MAR-2004"
FT   CDS             join(<9562806..9562905,9603216..9603359,9607124..9607307,
FT                   9611781..9611896,9613925..9614051,9616874..9616967,
FT                   9628766..9628853,9632860..9632918,9638033..9638110,
FT                   9641918..9642067,9646250..9646370,9648131..9648229,
FT                   9653751..9653852,9654463..9654516,9661996..9662048,
FT                   9662694..9662836,9679603..9679630)
FT                   /codon_start=1
FT                   /gene="Ablim2"
FT                   /locus_tag="mCG_120156"
FT                   /product="actin-binding LIM protein 2, isoform CRA_b"
FT                   /note="gene_id=mCG120156.2 transcript_id=mCT193590.0
FT                   protein_id=mCP114559.0 isoform=CRA_b"
FT                   /protein_id="EDL37498.1"
FT                   /translation="VLRILPAPHLPARSSGCRSAGTTLLGAAADMSAVSQPQAAHAPLE
FT                   KPASTAILCNTCGNVCKGEVLRVQNKYFHIRCFVCKACGCDLAEGGFFVRQGEHICTRD
FT                   YQRLYGTRCFSCDRFIEGEVVSALGKTYHPDCFVCAVCRLPFPPGDRVTFNGKECMCQK
FT                   CSPPTLLGNSAHVAQGLRSCGGCGLEIKNGQALVALDKHWHLGCFKCKTCGKLLNAEYI
FT                   SKDGLPYCEADYHSKFGIRCDGCEKYITGRVLEAGEKHYHPSCALCVRCGQMFSEGEEM
FT                   YLQGSSIWHPACRQAARTEDKSKETRTSSESIVSVPASSTSGSPSRVIYAKLGDEILDY
FT                   RDLAALPKNKAIYNIDRPDMISYSPYISHSAVGDRQSYGEGDQDDRSYKQCRTSSPSSA
FT                   GSVSLGHYTPTSRSPQHYSRPAGTVSVGTSSCLSLSQHPSPTSVFRHHYIPYFRGSESG
FT                   RSTPSLSVHSDSRPPSSTYQQAPRHFHVPDTGVKDNIYRKPPIYKQHAARRLDVEDSSF
FT                   DQDSRKKTTWLLLKGDADTRTNSPDLDSQSLSLSSGTDQEPLQRMAGDSLYSREYIPMI
FT                   PSS"
FT   gene            <9697956..9812849
FT                   /gene="2600003E23Rik"
FT                   /locus_tag="mCG_120157"
FT                   /note="gene_id=mCG120157.1"
FT   mRNA            join(<9697956..9698104,9743342..9743470,9743828..9743922,
FT                   9754170..9754278,9757017..9757228,9759842..9760021,
FT                   9770771..9770872,9771230..9771311,9777584..9777733,
FT                   9783402..9783613,9785451..9785596,9793196..9793313,
FT                   9798572..9798686,9802471..9802635,9804887..9805077,
FT                   9806448..9806612,9808629..9812849)
FT                   /gene="2600003E23Rik"
FT                   /locus_tag="mCG_120157"
FT                   /product="RIKEN cDNA 2600003E23, transcript variant
FT                   mCT193592"
FT                   /note="gene_id=mCG120157.1 transcript_id=mCT193592.0
FT                   created on 09-MAR-2004"
FT   mRNA            join(9698054..9698104,9743342..9743470,9743828..9743922,
FT                   9754170..9754278,9757017..9757228,9759842..9760021,
FT                   9770771..9770872,9771230..9771311,9777584..9777733,
FT                   9783402..9783613,9785451..9785596,9798619..9798686,
FT                   9802471..9802635,9804887..9805077,9806448..9806612,
FT                   9810856..9812843)
FT                   /gene="2600003E23Rik"
FT                   /locus_tag="mCG_120157"
FT                   /product="RIKEN cDNA 2600003E23, transcript variant
FT                   mCT121343"
FT                   /note="gene_id=mCG120157.1 transcript_id=mCT121343.1
FT                   created on 26-SEP-2002"
FT   CDS             join(<9698104..9698104,9743342..9743470,9743828..9743922,
FT                   9754170..9754278,9757017..9757228,9759842..9760021,
FT                   9770771..9770872,9771230..9771311,9777584..9777733,
FT                   9783402..9783613,9785451..9785596,9793196..9793313,
FT                   9798572..9798686,9802471..9802635,9804887..9805077,
FT                   9806448..9806612,9808629..9808655)
FT                   /codon_start=1
FT                   /gene="2600003E23Rik"
FT                   /locus_tag="mCG_120157"
FT                   /product="RIKEN cDNA 2600003E23, isoform CRA_b"
FT                   /note="gene_id=mCG120157.1 transcript_id=mCT193592.0
FT                   protein_id=mCP114561.0 isoform=CRA_b"
FT                   /protein_id="EDL37501.1"
FT                   /translation="AMEELIVELRLFLELLDHEYLTSTVREKKAVLTNILLRLQSSKGF
FT                   EVKDHAQKAEANNLPAPPQMPLPEIPQPWLPPDSGPPPLPTSSLPEGYYEEAVPLSPGK
FT                   APEYITSNYDSDAMSSSYESYDEEEEDGKGKKTRHQWPSEEASMDLVKDAKICAFLLRK
FT                   KRFGQWTKLLCVIKDTKLLCYKSSKDQQPQMELPLQGCSITYIPRDSKKKKHELKITQQ
FT                   GTDPLVLAVQSKEQAEQWLKVIKEAYSGCSGPVDPECSPPPSTSAPVNKAELEKKLSSE
FT                   RPSSDGEGGVENGVTTCNGKEQAKRKKPSKSEAKGTVSKVTGKKITKIIGLGKKKPSTD
FT                   EQTSSAEEDVPTCGYLNVLSNSRWRERWCRVKDSKLILHKDRADLKTHLVSIPLRGCEV
FT                   IPGLDSKHPLTFRLLRNGQEVAVLEASSSEDMGRWIGILLAETGSSTDPGALHYDYIDV
FT                   EMSANVIQTAKQTFCFMNRRAVSTSPYLGSLSNGYAHPSGTALHYDDVPCVNGSLKNKK
FT                   PPASSNGVPVKGKAPSSQQKKVETAGGVKRTASNAEQYKYGKNRVEADAKRLQSKEEEL
FT                   LKRKEALRNRLAQLRKERKDLRAAIEVNAGRKTQAALEDKLKRLEEECKQREAERVSLE
FT                   LELTEVKESLKKALAGGVTLGLAIEPRSGTSSPQSPVFRHRTLENSPISSCDTSDAEGP
FT                   LPVNSAAVLKKSQPSSGSSPCRGHVLQKAKEWELKNGT"
FT   CDS             join(9743344..9743470,9743828..9743922,9754170..9754278,
FT                   9757017..9757228,9759842..9760021,9770771..9770872,
FT                   9771230..9771311,9777584..9777733,9783402..9783613,
FT                   9785451..9785596,9798619..9798686,9802471..9802635,
FT                   9804887..9805077,9806448..9806612,9810856..9810993)
FT                   /codon_start=1
FT                   /gene="2600003E23Rik"
FT                   /locus_tag="mCG_120157"
FT                   /product="RIKEN cDNA 2600003E23, isoform CRA_a"
FT                   /note="gene_id=mCG120157.1 transcript_id=mCT121343.1
FT                   protein_id=mCP64576.1 isoform=CRA_a"
FT                   /protein_id="EDL37500.1"
FT                   /translation="MEELIVELRLFLELLDHEYLTSTVREKKAVLTNILLRLQSSKGFE
FT                   VKDHAQKAEANNLPAPPQMPLPEIPQPWLPPDSGPPPLPTSSLPEGYYEEAVPLSPGKA
FT                   PEYITSNYDSDAMSSSYESYDEEEEDGKGKKTRHQWPSEEASMDLVKDAKICAFLLRKK
FT                   RFGQWTKLLCVIKDTKLLCYKSSKDQQPQMELPLQGCSITYIPRDSKKKKHELKITQQG
FT                   TDPLVLAVQSKEQAEQWLKVIKEAYSGCSGPVDPECSPPPSTSAPVNKAELEKKLSSER
FT                   PSSDGEGGVENGVTTCNGKEQAKRKKPSKSEAKGTVSKVTGKKITKIIGLGKKKPSTDE
FT                   QTSSAEEDVPTCGYLNVLSNSRWRERWCRVKDSKLILHKDRADLKTHLVSIPLRGCEVI
FT                   PGLDSKHPLTFRLLRNGQEVAVLEASSSEDMGRWIGILLAETGSSTDPGALHYDYIDVE
FT                   MSANVIQTAKQTFWGKAPSSQQKKVETAGGVKRTASNAEQYKYGKNRVEADAKRLQSKE
FT                   EELLKRKEALRNRLAQLRKERKDLRAAIEVNAGRKTQAALEDKLKRLEEECKQREAERV
FT                   SLELELTEVKESLKKALAGGVTLGLAIEPRSGTSSPQSPVFRHRTLENSPISSCDTSDA
FT                   EGPLPVNSAAVLKKSQPSSGSSPCRGHVLQKAKAPMILSGFSVFSFYDPPKATSMTPAI
FT                   DDTGLPCVEPGKQRAEPFL"
FT   gene            complement(9748260..9749594)
FT                   /pseudo
FT                   /locus_tag="mCG_50907"
FT                   /note="gene_id=mCG50907.2"
FT   mRNA            complement(9748260..9749594)
FT                   /pseudo
FT                   /locus_tag="mCG_50907"
FT                   /note="gene_id=mCG50907.2 transcript_id=mCT51090.2 created
FT                   on 03-OCT-2002"
FT   gene            complement(9826078..10209718)
FT                   /gene="Sorcs2"
FT                   /locus_tag="mCG_142529"
FT                   /note="gene_id=mCG142529.0"
FT   mRNA            complement(join(9826078..9828298,9830137..9830240,
FT                   9832902..9833004,9833477..9833576,9834718..9834843,
FT                   9835557..9835669,9836760..9836883,9837950..9838083,
FT                   9840050..9840236,9844593..9844764,9846321..9846449,
FT                   9847037..9847170,9848227..9848347,9851007..9851114,
FT                   9852371..9852462,9855410..9855486,9856729..9856831,
FT                   9859367..9859513,9864887..9865066,9871457..9871546,
FT                   9874258..9874376,9877011..9877075,9880272..9880345,
FT                   9886805..9886969,9963105..9963204,10041524..10041591,
FT                   10209147..10209718))
FT                   /gene="Sorcs2"
FT                   /locus_tag="mCG_142529"
FT                   /product="sortilin-related VPS10 domain containing receptor
FT                   2"
FT                   /note="gene_id=mCG142529.0 transcript_id=mCT180651.0
FT                   created on 19-FEB-2003"
FT   CDS             complement(join(9828234..9828298,9830137..9830240,
FT                   9832902..9833004,9833477..9833576,9834718..9834843,
FT                   9835557..9835669,9836760..9836883,9837950..9838083,
FT                   9840050..9840236,9844593..9844764,9846321..9846449,
FT                   9847037..9847170,9848227..9848347,9851007..9851114,
FT                   9852371..9852462,9855410..9855486,9856729..9856831,
FT                   9859367..9859513,9864887..9865066,9871457..9871546,
FT                   9874258..9874376,9877011..9877075,9880272..9880345,
FT                   9886805..9886969,9963105..9963204,10041524..10041591,
FT                   10209147..10209626))
FT                   /codon_start=1
FT                   /gene="Sorcs2"
FT                   /locus_tag="mCG_142529"
FT                   /product="sortilin-related VPS10 domain containing receptor
FT                   2"
FT                   /note="gene_id=mCG142529.0 transcript_id=mCT180651.0
FT                   protein_id=mCP103573.0"
FT                   /db_xref="GOA:Q9EPR5"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR006581"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="MGI:MGI:1932289"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9EPR5"
FT                   /protein_id="EDL37502.1"
FT                   /translation="MAHRGPPSAPKRPGPTAPDRSFQALLPPCWPRSWPLLLLLLVLVA
FT                   ACGAMGRSPQPGRQGPGVQITRLLPAGRTESGDRKDPQARESEPSVPGLGPGSASGPST
FT                   DGAPAPGKGRRARAVPVAGAASASRAQVSLISTSFVLKGDATHNQAMVHWTGENSSVIL
FT                   ILTKYYHADMGKVLESSLWRSSDFGTTYTKLTLQPGVTTVIDNFYICPANKRKIILVSS
FT                   SLGDREQSLFLSTDEGATFQKYPVPFLVEMLLFHPKEEDKVLAYTKDSKLYVSSDLGKK
FT                   WTLLQERVTKDHVFWAVSGVDDDPNLVHVEAQDLSGGYRYYTCLIYNCSAQPHIAPFSG
FT                   PIDRGSLTVQDEYIFLKATSTNRTKYYVSYRRSDFVLMKLPKYALPKDLQIISTDEQQV
FT                   FVAVQEWNQVDTYNLYQSDLRGVRYSLVLENVRSSRQAEENVVIDILEVRGVKGVFLAN
FT                   QKVDGKVTTVITYNKGRDWDYLRPPSTDMNGKPTNCQPPDCYLHLHLRWADNPYVSGTV
FT                   HTKDTAPGLIMGAGNLGSQLVEYKEEMYITSDCGHTWRQVFEEEHHVLYLDHGGVIAAI
FT                   KDTSIPLKILKFSVDEGHTWSTHNFTSTSVFVDGLLSEPGDETLVMTVFGHISFRSDWE
FT                   LVKVDFRPSFPRQCGEDDYSSWDLTDLQGDHCIMGQQRSYRKRKSTSWCVKGRSFTSAL
FT                   TSRVCKCRDSDFLCDYGFERSSSSESTANKCSANFWFNPLSPPEDCVLGQTYTSSLGYR
FT                   KVVSNVCEGGVDLQQSPVQLQCPLQAPRGLQVSIRGEAVAVRPREDVLFVVRQEQGDVL
FT                   TTKYQVDLGDGFKAMYVNLTLTGEPIRHHYESPGIYRVSVRAENMAGHDEAVLFVQVNS
FT                   PLQALYLEVVPVIGVNQEVNLTAVLLPLNPNLTVFYWWIGHSLQPLLSLDNSVTTKFTD
FT                   AGDVRVTVQAACGNSVLQDSRLVRVLDQFQVVPLRFSRELDTFNPNTPEWREDVGLVVT
FT                   RLLSKETSIPEELLVTVVKPGLPTIADLYVLLPLPRPTRKRSLTSDKRLAAVQQALNSH
FT                   RISFILRGGLRILVELRDTDTGPQRPGGSGGYWAVVVLFVIGLFAVGAFILYKFKRKRP
FT                   GRTVYAQMHNEKEQEMTSPVSHSEDAQSTMQGNHSGVVLSINSREMHSYLVG"
FT   gene            10016122..10018634
FT                   /gene="2310020A21Rik"
FT                   /locus_tag="mCG_56169"
FT                   /note="gene_id=mCG56169.1"
FT   mRNA            10016122..10018634
FT                   /gene="2310020A21Rik"
FT                   /locus_tag="mCG_56169"
FT                   /product="RIKEN cDNA 2310020A21"
FT                   /note="gene_id=mCG56169.1 transcript_id=mCT56352.1 created
FT                   on 01-OCT-2002"
FT   CDS             10016137..10017714
FT                   /codon_start=1
FT                   /gene="2310020A21Rik"
FT                   /locus_tag="mCG_56169"
FT                   /product="RIKEN cDNA 2310020A21"
FT                   /note="gene_id=mCG56169.1 transcript_id=mCT56352.1
FT                   protein_id=mCP26970.0"
FT                   /protein_id="EDL37503.1"
FT                   /translation="MGTMLCALILWSGLLGAARASPISVPRECAKGSEVWCQDLQAAAK
FT                   CRAVRHCQSAVWNKPTVKSLPCSVCQDVAAAAGNGVNPGATESDILTSVMKTCEWLPSQ
FT                   ESSAKCKWMVNNHSAAVLSMLSGAQETDLASVCTALTLCEPLQRHLAETTSERPLTQED
FT                   ANEVMAPFLSNGALSFHPSQMPEGAVCHDCVQLISLLQDALESNLTLAEVTVQNQCQSM
FT                   GPGLAALCENYIHRQFVPAKQTLQGLPPQEVCRKGGFCERESAHWLTRVAAVDGVPSLE
FT                   MEMPRTNELQMQLGLTCDVCLNLVQELDKWLVTNSTEALISHTLERVCTVVPEPLVQQC
FT                   ITLVDTYSPELVQLMSKVTPEKVCETIKLCGSKRRARSISRAVATTPSLPVDEENQGSF
FT                   CQGCKRLLGMSSQNLDHKSTKRDILNAFKGGCRILPLPYVMQCNRFVAEYEPVLIESLK
FT                   FMMNPTDLCKKMGACHGPKTPLLGTDQCVMGPSFWCKSPEAAEMCNALEHCQRLVWKKP
FT                   VSKINEQP"
FT   gene            complement(10270327..>10277127)
FT                   /locus_tag="mCG_1046120"
FT                   /note="gene_id=mCG1046120.1"
FT   mRNA            complement(join(10270327..10270676,10276790..>10277127))
FT                   /locus_tag="mCG_1046120"
FT                   /product="mCG1046120"
FT                   /note="gene_id=mCG1046120.1 transcript_id=mCT163824.1
FT                   created on 30-SEP-2002"
FT   CDS             complement(join(10270598..10270676,10276790..>10276914))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1046120"
FT                   /product="mCG1046120"
FT                   /note="gene_id=mCG1046120.1 transcript_id=mCT163824.1
FT                   protein_id=mCP65212.1"
FT                   /protein_id="EDL37504.1"
FT                   /translation="EKKTNSSVCRRASKIWVLMFGHCYGGGRRAESCRRTFSVLSRILE
FT                   LNLGSHACAAVSPQPPLILCLK"
FT   gene            10277271..10283970
FT                   /gene="Grpel1"
FT                   /locus_tag="mCG_7091"
FT                   /note="gene_id=mCG7091.1"
FT   mRNA            join(10277271..10277529,10281712..10281874,
FT                   10282876..10282957,10283330..10283970)
FT                   /gene="Grpel1"
FT                   /locus_tag="mCG_7091"
FT                   /product="GrpE-like 1, mitochondrial"
FT                   /note="gene_id=mCG7091.1 transcript_id=mCT6199.2 created on
FT                   18-SEP-2002"
FT   CDS             join(10277468..10277529,10281712..10281874,
FT                   10282876..10282957,10283330..10283676)
FT                   /codon_start=1
FT                   /gene="Grpel1"
FT                   /locus_tag="mCG_7091"
FT                   /product="GrpE-like 1, mitochondrial"
FT                   /note="gene_id=mCG7091.1 transcript_id=mCT6199.2
FT                   protein_id=mCP3957.1"
FT                   /protein_id="EDL37505.1"
FT                   /translation="MAARCVRLARRSLPALALSFRPSPRLLCTATKQKNNGQNLDEDLG
FT                   HCEPKTDPPSADKTLLEEKAKLEEQLRETMEKYKRALADTENLRQRSQKLVEEAKLYGI
FT                   QGFCKDLLEVADILEKATQSVPKEEISNNNPHLKSLYEGLVMTEVQIQKVFTKHGLLRL
FT                   DPIGAKFDPYEHEALFHTPVEGKEPGTVALVSKVGYKLHGRTLRPALVGVVKDA"
FT   gene            complement(10285917..10296369)
FT                   /locus_tag="mCG_49644"
FT                   /note="gene_id=mCG49644.2"
FT   mRNA            complement(join(10285917..10289236,10296074..10296369))
FT                   /locus_tag="mCG_49644"
FT                   /product="mCG49644"
FT                   /note="gene_id=mCG49644.2 transcript_id=mCT49827.2 created
FT                   on 03-OCT-2002"
FT   CDS             complement(join(10288244..10289236,10296074..10296343))
FT                   /codon_start=1
FT                   /locus_tag="mCG_49644"
FT                   /product="mCG49644"
FT                   /note="gene_id=mCG49644.2 transcript_id=mCT49827.2
FT                   protein_id=mCP26988.2"
FT                   /db_xref="GOA:D3Z4Z0"
FT                   /db_xref="InterPro:IPR000433"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR016827"
FT                   /db_xref="InterPro:IPR017884"
FT                   /db_xref="MGI:MGI:3035274"
FT                   /db_xref="UniProtKB/TrEMBL:D3Z4Z0"
FT                   /protein_id="EDL37506.1"
FT                   /translation="MAELGKKYCVYCLAEVSPLRFRCTECQDIELCPECFSAGAEIGHH
FT                   RRYHGYQLVDGGRFTLWGPEAEGGWTSREEQLLLDAIEQFGFGNWEDMAAHVGASRTPQ
FT                   EVMEHYVSMYIHGNLGKACIPDTIPNRVTDHTCPSGGPLSPSLTTPLPPLDISVAEQQQ
FT                   LGYMPLRDDYEIEYDQDAETLISGLSVNYDDDDVEIELKRAHVDMYVRKLKERQRRKNI
FT                   ARDYNLVPAFLGKDKKEKEKTLKRKITKEEKELRLKLRPLYQFMSCKEFDDLFENMHKE
FT                   KMLRAKIRELQRYRRNGITKMEESAEYEAARHKRERRKENKNLASSKRGKEDGKDSEFA
FT                   AIENLPGFELLSDREKVLCSSLNLSPARYVTVKTIIIKDHLQKRQGIPSKSRLPSYLDK
FT                   VLKKRILNFLTESGWISRDAS"
FT   gene            10296874..10299487
FT                   /gene="Ccdc96"
FT                   /locus_tag="mCG_7088"
FT                   /note="gene_id=mCG7088.1"
FT   mRNA            10296874..10299487
FT                   /gene="Ccdc96"
FT                   /locus_tag="mCG_7088"
FT                   /product="coiled-coil domain containing 96"
FT                   /note="gene_id=mCG7088.1 transcript_id=mCT6205.1 created on
FT                   18-SEP-2002"
FT   CDS             10296938..10298692
FT                   /codon_start=1
FT                   /gene="Ccdc96"
FT                   /locus_tag="mCG_7088"
FT                   /product="coiled-coil domain containing 96"
FT                   /note="gene_id=mCG7088.1 transcript_id=mCT6205.1
FT                   protein_id=mCP3956.1"
FT                   /db_xref="GOA:Q08AT2"
FT                   /db_xref="InterPro:IPR025254"
FT                   /db_xref="MGI:MGI:1913967"
FT                   /db_xref="UniProtKB/TrEMBL:Q08AT2"
FT                   /protein_id="EDL37507.1"
FT                   /translation="MDSHYGDIEGKDRAEEGLARQSLEIKVSSEPLTPANPVEQEPEPK
FT                   PEPEPTQGREPESETQPVSDSSKAKDSEGIDYAHVEVPESPGAAETAGEAVSREPESLP
FT                   QTQPKTKPESKEPEDKDEDEDEDEDEDEDEDEDEDEDEDEGEERDRPEKPKGKGKREKR
FT                   KESRFRPSLPLTTIVEEGAAPGPQAAKEKARESLKKRDSEEIEGTDRERHKSTEEQLHP
FT                   GEAKEEEKQKGASTEEFEWTADVQKLQEQQLRGELVEQYHSLLVERNRYQRYNMYLQQK
FT                   IHETLRKKGLEAAAEPGDKSAEPESPEKEQAYLRYLAMLEELKKQEADDLEWYRQEVRE
FT                   LKQQCQEKQTRVEKEWRRFQALKKQVVMQVMGSCRTRGGRQAALREVEQLQALEDKKEK
FT                   EMSAVRLENVQLKQSLVHFETRMKAQEDLAEGLLLIDFEQLKIENQTFNEKVEERNEEL
FT                   LKLRTKVTSNVQIITHVKEKLSFIDTENSCKKAQLSEVDAQVALGRDLLTKTKQARDSL
FT                   RIDNVKLSQKCGLLGKESLLRDLEEKVEKTEMLNRRLESLKRHHAGLALSCKGVKQKIR
FT                   EAKTFLPS"
FT   gene            complement(10304490..10399855)
FT                   /gene="Tbc1d14"
FT                   /locus_tag="mCG_7094"
FT                   /note="gene_id=mCG7094.1"
FT   mRNA            complement(join(10304490..10305071,10306975..10307233,
FT                   10316981..10317090,10319532..10319660,10320314..10320385,
FT                   10324408..10324502,10325993..10326073,10331225..10331331,
FT                   10332396..10332513,10334887..10334969,10336883..10337001,
FT                   10355239..10355359,10384934..10385675,10398422..10398476,
FT                   10399686..10399855))
FT                   /gene="Tbc1d14"
FT                   /locus_tag="mCG_7094"
FT                   /product="TBC1 domain family, member 14"
FT                   /note="gene_id=mCG7094.1 transcript_id=mCT6196.1 created on
FT                   03-APR-2003"
FT   CDS             complement(join(10305006..10305071,10306975..10307233,
FT                   10316981..10317090,10319532..10319660,10320314..10320385,
FT                   10324408..10324502,10325993..10326073,10331225..10331331,
FT                   10332396..10332513,10334887..10334969,10336883..10337001,
FT                   10355239..10355359,10384934..10385675,10398422..10398464))
FT                   /codon_start=1
FT                   /gene="Tbc1d14"
FT                   /locus_tag="mCG_7094"
FT                   /product="TBC1 domain family, member 14"
FT                   /note="gene_id=mCG7094.1 transcript_id=mCT6196.1
FT                   protein_id=mCP4017.2"
FT                   /db_xref="GOA:G3UVU5"
FT                   /db_xref="InterPro:IPR000195"
FT                   /db_xref="MGI:MGI:1098708"
FT                   /db_xref="UniProtKB/TrEMBL:G3UVU5"
FT                   /protein_id="EDL37508.1"
FT                   /translation="MRLYLDRFWGLMAKVSSGTKMTDGNLSTSMNGVALMGILDGRQGD
FT                   SLQDLQHLSIKAAPRSLSVPDYGPSLKLGALEDRHSLQSVDSGIPTLEIGNPEPVPCSV
FT                   VHVKRKQSESEIVPERAFQSACPLPSCTPSAPTCSEREQVVRKSSTFPRTGYDSVKLYS
FT                   PTSKALSRSDNVSVCSVSSLGTELSTTLSVSNEDILDLMVTSNSSAIVTLENDDDPQFT
FT                   DVTLSSINETSDLHQQDCVAETEEGRKLKLLHPFSHFFTRNLLARKQNARLDRQRDLGW
FT                   KLFGKVPLRETAQKDSKKTQKEYEDKAGRPSRPPSPKQNVRKNLDFEPLSTTALILEDR
FT                   PANLPAKPAEEAQKHRQQYEEMVLQAKKRELKEAQRRRKQLEERCKVEESIGNAVLTWN
FT                   NEILPNWETMWCSKKVRDLWWQGIPPSVRGKVWSLAIGNELNITHELFDICLARAKERW
FT                   RSLSTGGSEVENEDAGFSAADREASLELIKLDISRTFPNLCIFQQGGPYHDMLHSILGA
FT                   YTCYRPDVGYVQGMSFIAAVLILNLDTADAFIAFSNLLNKPCQMAFFRVDHGLMLTYFA
FT                   AFEVFFEENLPKLFAHFKKNNLTADIYLIDWIFTLYSKSLPLDLACRIWDVFCRDGEEF
FT                   LFRTALGILKLFEDILTRMDFIHSAQFLTRLPEDLPADEVFAAISTVQMQSRNKKWAQV
FT                   LSALQKDSREMEKGSPSLRH"
FT   gene            complement(10414115..10456225)
FT                   /locus_tag="mCG_7090"
FT                   /note="gene_id=mCG7090.1"
FT   mRNA            complement(join(10414115..10416430,10418138..10418235,
FT                   10421564..10421672,10426865..10430153,10432361..10432442,
FT                   10433282..10433348,10443285..10443419,10455730..10456225))
FT                   /locus_tag="mCG_7090"
FT                   /product="mCG7090, transcript variant mCT6198"
FT                   /note="gene_id=mCG7090.1 transcript_id=mCT6198.2 created on
FT                   26-SEP-2002"
FT   mRNA            complement(join(10414115..10416430,10421564..10421672,
FT                   10426865..10426970))
FT                   /locus_tag="mCG_7090"
FT                   /product="mCG7090, transcript variant mCT173730"
FT                   /note="gene_id=mCG7090.1 transcript_id=mCT173730.0 created
FT                   on 26-SEP-2002"
FT   CDS             complement(join(10416251..10416430,10418138..10418235,
FT                   10421564..10421672,10426865..10430153,10432361..10432442,
FT                   10433282..10433348,10443285..10443419,10455730..10455960))
FT                   /codon_start=1
FT                   /locus_tag="mCG_7090"
FT                   /product="mCG7090, isoform CRA_b"
FT                   /note="gene_id=mCG7090.1 transcript_id=mCT6198.2
FT                   protein_id=mCP3916.2 isoform=CRA_b"
FT                   /db_xref="GOA:B9EKS3"
FT                   /db_xref="InterPro:IPR027871"
FT                   /db_xref="MGI:MGI:1261849"
FT                   /db_xref="UniProtKB/TrEMBL:B9EKS3"
FT                   /protein_id="EDL37510.1"
FT                   /translation="MRPVCTVVVDGLPSESTSSSYPGPVSVSDMSLLHALGPVQTWLGQ
FT                   ELEKCGIDAMIYSRYILSLLLHDSYDYDLQEQENDILSWEKGAYKKWGRSKKKCSDLTL
FT                   EEMKKQAAVQCLRSASDESSGIETLVEELCCRLKDLQSEQEEKIHKKLEGSPSPEEELS
FT                   PTAKDQVEMYYEAFPPLSEKPVCLQEIMTVWNKSKPCSYSSSSSSSTVPPASTDTSSPK
FT                   DCNSESEAVRERSSVASVPMHEKAQSRSRHEKESKLSSSTIEEKPAFYKRQIRHKPEGK
FT                   TRPRSWSSGSSEAGSSSSGNQGELKASMKYVKVRHKAREIRNRKGRNGQNRHSLKHCGK
FT                   AERGVHAGSGGSSSSSSNGSIRQLCKRGKRPAKETGRSDSGNTAVKDLYVDSRNNKEYK
FT                   EEPLWYTEPIAEYFVPLSRKSKLETTYRNREDTSTLTAEAVEDLSDSVRGLCISNSNIH
FT                   RTYLAAGTFIDGHFVEMPAVINEDIDLAGTSLCSLPEDNKYLDDIHLSELTHFYEVDID
FT                   QSMLDPGASETMQGESRILNMIRQKSKENTDFEAECCIVLDGMELQGERAIWTDSTSSV
FT                   GAEGFFLQDLGNLAQFWECCSSSSGDADGESFGGDSPVRLSPILDSTMLSSHILAGNQE
FT                   PFSNINEGSGINSCFSVFEVQCSNSVLPFSFETLNLGSEHADSSANMLGKTQSRLLIWT
FT                   KNSAFEENEHCSNLSTRTCSPWSHSEEARSDNETLNIQFEESTQFTAEDINYVVPRVSS
FT                   DFVDEELLDFLQDETCQQNSRTLGEIPTLVFKKRSKLESVCGIQLEQKAESKNFETTHA
FT                   CSESSPHGDGYSSGVIKDIWTKMVGRSSVAAVETERTGEELFSTDVNNYCCCLDTEAKM
FT                   EALQEPSRAVQRSEYHLWEGQKENMEKRAFVSSELSKVDGGDYTTPSKPWDVAQDKENT
FT                   FILGGVYGELKTFNSDGEWAVVPPGHTKGSLLQCAASDVVTIAGTDVFMTPGNSFAPGH
FT                   RQLWKPFVSFEQSDMPKRGENGVNKGFSFIFHEDLLGACSNFQVEDPGLEYSLSSFDLS
FT                   NPFSQVLHVECSFEPEGIASFSPSFKPKSILCSDSDSEVFHPRICGVERTQYRAIRISP
FT                   RTHFRPISASELSPGGGSESEFESEKDEASVPIPSHVDVFEDPQADLKPLEEDAEKEGH
FT                   YYGKLELESGKFLPRLKKSGMEKSAQTSLDSQEEATGILPKQNQCLECNFNESLEINLE
FT                   SSAANCKIMTQCEEEMSEFCSCKAGCQFPACEDNPVSSGQLEEFPVLNTDVQEVTRNQE
FT                   KQSWWEKALYSPLFPTSECEECYTNAKGENGIEECPDAKETPSREERLLDFNRVSSVYE
FT                   ARCTGERGSETKPNGLHRKMCSSASSDTGDTGSEAGGEWVGPSREELFSRTHL"
FT   CDS             complement(join(10416414..10416430,10421564..10421672,
FT                   10426865..10426969))
FT                   /codon_start=1
FT                   /locus_tag="mCG_7090"
FT                   /product="mCG7090, isoform CRA_a"
FT                   /note="gene_id=mCG7090.1 transcript_id=mCT173730.0
FT                   protein_id=mCP96649.0 isoform=CRA_a"
FT                   /protein_id="EDL37509.1"
FT                   /translation="MTQCEEEMSEFCSCKAGCQFPACEDNPVSSGQLEEFPVLNTDVQE
FT                   VTRNQEKQSWWEKALYSPLFPTSECEGVFCL"
FT   gene            complement(10529736..10531198)
FT                   /gene="Cno"
FT                   /locus_tag="mCG_51007"
FT                   /note="gene_id=mCG51007.3"
FT   mRNA            complement(10529736..10531198)
FT                   /gene="Cno"
FT                   /locus_tag="mCG_51007"
FT                   /product="cappuccino"
FT                   /note="gene_id=mCG51007.3 transcript_id=mCT51190.3 created
FT                   on 02-JUL-2003"
FT   CDS             complement(10530531..10531178)
FT                   /codon_start=1
FT                   /gene="Cno"
FT                   /locus_tag="mCG_51007"
FT                   /product="cappuccino"
FT                   /note="gene_id=mCG51007.3 transcript_id=mCT51190.3
FT                   protein_id=mCP27229.3"
FT                   /protein_id="EDL37511.1"
FT                   /translation="MEEGPAVGTLSREVSTEEAEPLGAAWSGDSGHVSQSHSSASGPWD
FT                   DDGPEDAPGRDLPLLRRAASGYASSLLPSAGPRPEVEALDASLEELLAKVDEFVGMLDM
FT                   IRGDSSHVVGEGVPRIHAKAAEMRRIYGRIDKLEAFVRMIGSSVARMEEQVAKAEAELG
FT                   TFPRAFRRLLHTISVPALFRSAPSGPQRAAYEPPVLFRTEDHFPGCGDRPQL"
FT   gene            complement(10577446..10579284)
FT                   /locus_tag="mCG_20618"
FT                   /note="gene_id=mCG20618.0"
FT   mRNA            complement(join(10577446..10578523,10578782..10579284))
FT                   /locus_tag="mCG_20618"
FT                   /product="mCG20618"
FT                   /note="gene_id=mCG20618.0 transcript_id=mCT22274.0 created
FT                   on 18-SEP-2002"
FT   CDS             complement(10578795..10579172)
FT                   /codon_start=1
FT                   /locus_tag="mCG_20618"
FT                   /product="mCG20618"
FT                   /note="gene_id=mCG20618.0 transcript_id=mCT22274.0
FT                   protein_id=mCP4177.1"
FT                   /protein_id="EDL37512.1"
FT                   /translation="MRPLDAVELAEPEEVEVLEPEEDFEQFLLPVIHEMREDIASLTRE
FT                   RGRAPARNRGKLWEMDNMLIQIKTQVEASEESALNHLQGAGGAEPRGPRAEKADEKAQE
FT                   MAKMAEMLVQLVRRIEKSESS"
FT   gene            complement(10589371..10613254)
FT                   /gene="Man2b2"
FT                   /locus_tag="mCG_20620"
FT                   /note="gene_id=mCG20620.3"
FT   mRNA            complement(join(10589371..10589768,10590344..10590461,
FT                   10591563..10591675,10592851..10592967,10595570..10595783,
FT                   10595892..10596002,10596355..10596601,10596952..10597143,
FT                   10597942..10598216,10598682..10598866,10600179..10600320,
FT                   10601085..10601275,10603505..10603703,10604460..10604637,
FT                   10606715..10606830,10608663..10608835,10610487..10610592,
FT                   10612251..10612397,10613062..10613251))
FT                   /gene="Man2b2"
FT                   /locus_tag="mCG_20620"
FT                   /product="mannosidase 2, alpha B2, transcript variant
FT                   mCT22275"
FT                   /note="gene_id=mCG20620.3 transcript_id=mCT22275.2 created
FT                   on 17-JUN-2003"
FT   mRNA            complement(join(10589427..10589768,10590344..10590461,
FT                   10591563..10591675,10592851..10592967,10595570..10595783,
FT                   10595892..10596002,10596355..10596601,10596952..10597143,
FT                   10597942..10598216,10598682..10598866,10600179..10600320,
FT                   10601085..10601275,10603505..10603557,10610515..10610592,
FT                   10612251..10612397,10613062..10613254))
FT                   /gene="Man2b2"
FT                   /locus_tag="mCG_20620"
FT                   /product="mannosidase 2, alpha B2, transcript variant
FT                   mCT185801"
FT                   /note="gene_id=mCG20620.3 transcript_id=mCT185801.0 created
FT                   on 17-JUN-2003"
FT   CDS             complement(join(10589674..10589768,10590344..10590461,
FT                   10591563..10591675,10592851..10592967,10595570..10595783,
FT                   10595892..10596002,10596355..10596601,10596952..10597143,
FT                   10597942..10598216,10598682..10598866,10600179..10600320,
FT                   10601085..10601275,10603505..10603703,10604460..10604637,
FT                   10606715..10606830,10608663..10608835,10610487..10610592,
FT                   10612251..10612397,10613062..10613199))
FT                   /codon_start=1
FT                   /gene="Man2b2"
FT                   /locus_tag="mCG_20620"
FT                   /product="mannosidase 2, alpha B2, isoform CRA_c"
FT                   /note="gene_id=mCG20620.3 transcript_id=mCT22275.2
FT                   protein_id=mCP4179.1 isoform=CRA_c"
FT                   /protein_id="EDL37515.1"
FT                   /translation="MGPLRWLPLLGQLLLLWPRAAQPAGPIRAFVVPHSHMDVGWVFTV
FT                   QESMRAYAANVYTTVVAELVRGGQRRFIAVEQEFFRLWWDGVASEQQKQQVRQLLHEGR
FT                   LEFVLGGQVMHDEAVTHLDDQILQLTEGHGFLYETFGIRPQFSWHVDPFGASATTPTLF
FT                   ALAGFNAHLISRIDYDLKDAMQEAQMLQFVWHGSPSLSGQQEIFTHVMDHYSYCTPSHI
FT                   PFSNRSGFYWNGVAVFPEPPPDGVYPNMSEPVTGANIHLYAEALVANVKQRAAWFRTPH
FT                   VLWPWGCDKQFFNASVQFDNMDPLLDYINQRTAQFGISVQYATLNDYFQALHATNMTWG
FT                   IRDHQDFLPYSSEPLQAWTGFYTSRSTLKGLARQASALLYAGESMFTRYMWPDPSGTLD
FT                   PTWALQQLQQLRWAVSEVQHHDAITGTESPKVKNMYTEHLRMGMLGVRKLMVSIALGGP
FT                   PGSGTGAPKDIMGPQVTPVLSVDTRPVGYSASVYNPLAWKITTIITLTVAFPNVSVTDE
FT                   LGHPVSTQIQNSTKDPSAYDLLILTTIPGLNYRHYQVMHARGDQAGTRELVAPRANTLK
FT                   FSLKLRNQPSQEGKRLVPVMNDCYILLFDQDTNMLHSIQDRQSNRTVRMTQEFLEYQAN
FT                   WDVKQGPISDNYLFAPNNTAEPSWEAVGMEMVAGTLVTDIRQYFYRYITDQEYIYSIHT
FT                   RLAHPSLAGELLCQRIEQQYRVGPLDLNREAILRTSSDLNSQQVLYSDNNGYQMQRRPY
FT                   KAFKSNPIPRNYYPMVQSAFIEDDKSRLVLLAERPHGVSSQGNGQVEVMLHRRLWNNLA
FT                   WDLKYNLTLNDTSIVHPVLWLMLGPKSTMTALHPRSGVALQHGPVVLLKELADEETPVH
FT                   GPHNPWPVTLPPNLHLQILSVPGWTYSRSHAQHLRNLQRGHPEKPQANLQRVLLRLRHL
FT                   YEAGEDPVLSRPATVDLKVVLRGLGSVVAVEERSLTGTWDVQMLQRWHWSTKTDHLKGH
FT                   PTSPPRPPGGSIITVYPKEIRTFFIKFQQ"
FT   mRNA            complement(join(10591364..10591675,10592851..10592967,
FT                   10595570..10595783,10595892..10595939,10603644..10603703,
FT                   10604460..10604637,10606715..10606830,10608663..10608835,
FT                   10610487..10610592,10612251..10612397,10613062..10613254))
FT                   /gene="Man2b2"
FT                   /locus_tag="mCG_20620"
FT                   /product="mannosidase 2, alpha B2, transcript variant
FT                   mCT185800"
FT                   /note="gene_id=mCG20620.3 transcript_id=mCT185800.0 created
FT                   on 17-JUN-2003"
FT   mRNA            complement(join(10591373..10591675,10592851..10592917,
FT                   10595570..10595783,10595892..10596002,10596355..10596601,
FT                   10596952..10597143,10597942..10598216,10598682..10598866,
FT                   10600179..10600320,10601085..10601275,10603505..10603703,
FT                   10604460..10604637,10606715..10606830,10608663..10608835,
FT                   10610487..10610592,10612251..10612397,10613062..10613234))
FT                   /gene="Man2b2"
FT                   /locus_tag="mCG_20620"
FT                   /product="mannosidase 2, alpha B2, transcript variant
FT                   mCT173418"
FT                   /note="gene_id=mCG20620.3 transcript_id=mCT173418.1 created
FT                   on 17-JUN-2003"
FT   CDS             complement(join(10591497..10591675,10592851..10592967,
FT                   10595570..10595783,10595892..10595939,10603644..10603703,
FT                   10604460..10604637,10606715..10606830,10608663..10608835,
FT                   10610487..10610592,10612251..10612397,10613062..10613199))
FT                   /codon_start=1
FT                   /gene="Man2b2"
FT                   /locus_tag="mCG_20620"
FT                   /product="mannosidase 2, alpha B2, isoform CRA_b"
FT                   /note="gene_id=mCG20620.3 transcript_id=mCT185800.0
FT                   protein_id=mCP107058.0 isoform=CRA_b"
FT                   /protein_id="EDL37514.1"
FT                   /translation="MGPLRWLPLLGQLLLLWPRAAQPAGPIRAFVVPHSHMDVGWVFTV
FT                   QESMRAYAANVYTTVVAELVRGGQRRFIAVEQEFFRLWWDGVASEQQKQQVRQLLHEGR
FT                   LEFVLGGQVMHDEAVTHLDDQILQLTEGHGFLYETFGIRPQFSWHVDPFGASATTPTLF
FT                   ALAGFNAHLISRIDYDLKDAMQEAQMLQFVWHGSPSLSGQQEIFTHVMDHYSYCTPSHI
FT                   PFSNRSGFYWNGVAVFPEPPPDGVYPNMSEPVTGANIHLYAEALVANVKQRAAWFRTPH
FT                   VLWPWGCDKQFFNASVQFDNMDPLLAERPHGVSSQGNGQVEVMLHRRLWNNLAWDLKYN
FT                   LTLNDTSIVHPVLWLMLGPKSTMTALHPRSGVALQHGPVVLLKELADEETPVHGPHNPW
FT                   PVTLPPNLHLQILSVPGWTYSRSHAQHLRNLQRGHPEKPQANLQRVLLRLRHLYEAGED
FT                   PVLSRPATVDLKVNSPCLPHPSKNALPRGSNPA"
FT   CDS             complement(join(10591612..10591675,10592851..10592917,
FT                   10595570..10595783,10595892..10596002,10596355..10596601,
FT                   10596952..10597143,10597942..10598216,10598682..10598866,
FT                   10600179..10600320,10601085..10601275,10603505..10603703,
FT                   10604460..10604637,10606715..10606830,10608663..10608835,
FT                   10610487..10610592,10612251..10612397,10613062..10613199))
FT                   /codon_start=1
FT                   /gene="Man2b2"
FT                   /locus_tag="mCG_20620"
FT                   /product="mannosidase 2, alpha B2, isoform CRA_a"
FT                   /note="gene_id=mCG20620.3 transcript_id=mCT173418.1
FT                   protein_id=mCP96337.1 isoform=CRA_a"
FT                   /protein_id="EDL37513.1"
FT                   /translation="MGPLRWLPLLGQLLLLWPRAAQPAGPIRAFVVPHSHMDVGWVFTV
FT                   QESMRAYAANVYTTVVAELVRGGQRRFIAVEQEFFRLWWDGVASEQQKQQVRQLLHEGR
FT                   LEFVLGGQVMHDEAVTHLDDQILQLTEGHGFLYETFGIRPQFSWHVDPFGASATTPTLF
FT                   ALAGFNAHLISRIDYDLKDAMQEAQMLQFVWHGSPSLSGQQEIFTHVMDHYSYCTPSHI
FT                   PFSNRSGFYWNGVAVFPEPPPDGVYPNMSEPVTGANIHLYAEALVANVKQRAAWFRTPH
FT                   VLWPWGCDKQFFNASVQFDNMDPLLDYINQRTAQFGISVQYATLNDYFQALHATNMTWG
FT                   IRDHQDFLPYSSEPLQAWTGFYTSRSTLKGLARQASALLYAGESMFTRYMWPDPSGTLD
FT                   PTWALQQLQQLRWAVSEVQHHDAITGTESPKVKNMYTEHLRMGMLGVRKLMVSIALGGP
FT                   PGSGTGAPKDIMGPQVTPVLSVDTRPVGYSASVYNPLAWKITTIITLTVAFPNVSVTDE
FT                   LGHPVSTQIQNSTKDPSAYDLLILTTIPGLNYRHYQVMHARGDQAGTRELVAPRANTLK
FT                   FSLKLRNQPSQEGKRLVPVMNDCYILLFDQDTNMLHSIQDRQSNRTVRMTQEFLEYQAN
FT                   WDVKQGPISDNYLFAPNNTAEPSWEAVGMEMVAGTLVTDIRQYFYRYITDQEYIYSIHT
FT                   RLAHPSLAGELLCQRIEQQYRVGPLDLNREAILRTSSDLNSQQVLYSDNNGYQMQRRPY
FT                   KAFKSNPIPRNYYPMVQSAFIEDDKSRLVLLAERPHGVSSQGNGQVEVMLHRRLWNNLA
FT                   WDLKYNLTLNDTSIVHPVLWLMLGPKSTMTALHPRSGVALQHGPVVLLKELADEETPVH
FT                   DPQRTWLDVQQEPCPAPEEPSERPPGEATGQPAKGAAAPAPPV"
FT   CDS             complement(join(10603534..10603557,10610515..10610592,
FT                   10612251..10612397,10613062..10613199))
FT                   /codon_start=1
FT                   /gene="Man2b2"
FT                   /locus_tag="mCG_20620"
FT                   /product="mannosidase 2, alpha B2, isoform CRA_d"
FT                   /note="gene_id=mCG20620.3 transcript_id=mCT185801.0
FT                   protein_id=mCP107059.0 isoform=CRA_d"
FT                   /protein_id="EDL37516.1"
FT                   /translation="MGPLRWLPLLGQLLLLWPRAAQPAGPIRAFVVPHSHMDVGWVFTV
FT                   QESMRAYAANVYTTVVAELVRGGQRRFIAVEQEFFRLWWDGVASEQQKQQVRQLLHEGR
FT                   LEFVLGGQVMHDEAVTHQHDLGHP"
FT   gene            complement(10656417..>10659701)
FT                   /locus_tag="mCG_145579"
FT                   /note="gene_id=mCG145579.0"
FT   mRNA            complement(join(10656417..10656592,10657681..10657779,
FT                   10658486..>10659701))
FT                   /locus_tag="mCG_145579"
FT                   /product="mCG145579"
FT                   /note="gene_id=mCG145579.0 transcript_id=mCT185003.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(10658784..>10659137)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145579"
FT                   /product="mCG145579"
FT                   /note="gene_id=mCG145579.0 transcript_id=mCT185003.0
FT                   protein_id=mCP105610.0"
FT                   /protein_id="EDL37517.1"
FT                   /translation="ETCLEISRLDSIVRFAPQTWCRVLANCPGCAPQDQPCSQAWKTTG
FT                   PHAKLEKQLQSCLYNDITVVIKNRPRHGDRLSGSLQAAGMGSPEDLSPANSHLPHLLSS
FT                   QQNPREKARIRSR"
FT   gene            <10706212..10738159
FT                   /gene="Ppp2r2c"
FT                   /locus_tag="mCG_119862"
FT                   /note="gene_id=mCG119862.1"
FT   mRNA            join(<10706212..10706309,10709736..10709901,
FT                   10710982..10711094,10714695..10714872,10723171..10723335,
FT                   10730239..10730408,10732724..10732815,10735434..10738159)
FT                   /gene="Ppp2r2c"
FT                   /locus_tag="mCG_119862"
FT                   /product="protein phosphatase 2 (formerly 2A), regulatory
FT                   subunit B (PR 52), gamma isoform"
FT                   /note="gene_id=mCG119862.1 transcript_id=mCT121040.1
FT                   created on 03-OCT-2002"
FT   CDS             join(<10706214..10706309,10709736..10709901,
FT                   10710982..10711094,10714695..10714872,10723171..10723335,
FT                   10730239..10730408,10732724..10732815,10735434..10735725)
FT                   /codon_start=1
FT                   /gene="Ppp2r2c"
FT                   /locus_tag="mCG_119862"
FT                   /product="protein phosphatase 2 (formerly 2A), regulatory
FT                   subunit B (PR 52), gamma isoform"
FT                   /note="gene_id=mCG119862.1 transcript_id=mCT121040.1
FT                   protein_id=mCP64937.1"
FT                   /protein_id="EDL37518.1"
FT                   /translation="DVISTVEFNHTGELLATGDKGGRVVIFQREPESKNAPHSQGEYDV
FT                   YSTFQSHEPEFDYLKSLEIEEKINKIKWLPQQNAAHSLLSTNDKTIKLWKITERDKRPE
FT                   GYNLKDEEGKLKDLSTVTSLQVPVLKPMDLMVEVSPRRTFANGHTYHINSISVNSDCET
FT                   YMSADDLRINLWHLAITDRSFNIVDIKPANMEDLTEVITASEFHPHHCNLFVYSSSKGS
FT                   LRLCDMRAAALCDKHSKLFEEPEDPSNRSFFSEIISSVSDVKFSHSGRYMLTRDYLTVK
FT                   VWDLNMEARPIETYQVHDYLRSKLCSLYESDCIFDKFECAWNGSDSVIMTGAYNNFFRM
FT                   FDRNTKRDVTLEASRESSKPRAVLKPRRVCVGGKRRRDDISVDSLDFTKKILHTAWHPA
FT                   ENIIAIAATNNLYIFQDKVNSDMH"
FT   gene            complement(10749150..10772097)
FT                   /gene="Wfs1"
FT                   /locus_tag="mCG_20615"
FT                   /note="gene_id=mCG20615.2"
FT   mRNA            complement(join(10749150..10751722,10754602..10754753,
FT                   10756230..10756310,10756778..10756948,10758515..10758659,
FT                   10759930..10760012,10765246..10765485,10772054..10772097))
FT                   /gene="Wfs1"
FT                   /locus_tag="mCG_20615"
FT                   /product="Wolfram syndrome 1 homolog (human)"
FT                   /note="gene_id=mCG20615.2 transcript_id=mCT22270.2 created
FT                   on 18-SEP-2002"
FT   CDS             complement(join(10749917..10751722,10754602..10754753,
FT                   10756230..10756310,10756778..10756948,10758515..10758659,
FT                   10759930..10760012,10765246..10765480))
FT                   /codon_start=1
FT                   /gene="Wfs1"
FT                   /locus_tag="mCG_20615"
FT                   /product="Wolfram syndrome 1 homolog (human)"
FT                   /note="gene_id=mCG20615.2 transcript_id=mCT22270.2
FT                   protein_id=mCP4159.2"
FT                   /db_xref="GOA:Q3TDI2"
FT                   /db_xref="InterPro:IPR026208"
FT                   /db_xref="InterPro:IPR026209"
FT                   /db_xref="MGI:MGI:1328355"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TDI2"
FT                   /protein_id="EDL37519.1"
FT                   /translation="MNSGTPPPSPSGPPPPPAPQPQARARLNATASLEQDKIEPPRAPR
FT                   PQADPSAGRSAGEAAAPEPRAPQTGSREETDRAGPMKADVEIPFEEVLEKAKAGDPKAQ
FT                   TEVGKHYLRLANDADEELNSCSAVAWLILAAKQGRREAVKLLRRCLADRKGITSENEAE
FT                   VKQLSSETDLERAVRKAALVMYWKLNPKKKKQVAVSELLENVGQVNEQDGGAQPGPVPK
FT                   SLQKQRRMLERLVSSESKNYIALDDFVELTKKYAKGIIPTNLFLQDEDEDEDELAGKSP
FT                   EDLPLRQKVVKYPLHAIMEIKEYLIDVASKAGMHWLSTIVPTHHINALIFFFIISNLTI
FT                   DFFAFFIPLVVFYLSFVSMVICTLKVFQDSKAWENFRTLTDLLLRFEPNLDVEQAEVNF
FT                   GWNHLEPYIHFLLSVVFVIFSFPLASKDCIPCSELAVISTFFTVTSYMSLSSSAEPYTR
FT                   RALVTEVAAGLLSLLPTVPVDWRFLKVLGQTFFTVPVGHFIILNVSLPCLLYVYLFYLF
FT                   FRMAQLRNFKGTYCYLVPYLVCFMWCELSVVILLQSTGLGLVRASIGYFLFLFALPILV
FT                   AGLALMGTVQFARWFLSLDLTKIMVTTVICGVPLLFRWWTKANFSVMGMVKSLTKSSMV
FT                   KLILVWLTAILLFCWFYVYRSEGMKVYNSTLTWQQYGFLCGPRAWKETNMARTQILCSH
FT                   LEGHRVTWTGRFKYVRVTEIDNSAESAINMLPFFLGDWMRCLYGEAYPSCSSGNTSTAE
FT                   EELCRLKQLAKHPCHIKKFDRYKFEITVGMPFGTNGNRGHEEDDITKDIVLRASSEFKD
FT                   VLLNLRQGSLIEFSTILEGRLGSKWPVFELKAISCLNCMTQLSPARRHVKIEQDWRSTV
FT                   HGALKFAFDFFFFPFLSAA"
FT   gene            <10811240..10926289
FT                   /gene="Jakmip1"
FT                   /locus_tag="mCG_20624"
FT                   /note="gene_id=mCG20624.1"
FT   mRNA            join(<10811240..10811381,10811443..10811553,
FT                   10868298..10868381,10868427..10868560,10874212..10874706,
FT                   10883760..10883969,10884893..10885012,10887812..10887958,
FT                   10888619..10888759,10890265..10890324,10900442..10900570,
FT                   10901779..10901907,10903941..10904024,10906279..10906341,
FT                   10907875..10907973,10910382..10910483,10917242..10917310,
FT                   10918561..10918638,10924618..10924821,10925798..10926289)
FT                   /gene="Jakmip1"
FT                   /locus_tag="mCG_20624"
FT                   /product="janus kinase and microtubule interacting protein
FT                   1"
FT                   /note="gene_id=mCG20624.1 transcript_id=mCT22279.2 created
FT                   on 26-SEP-2002"
FT   CDS             join(10811240..10811381,10811443..10811553,
FT                   10868298..10868381,10868427..10868560,10874212..10874706,
FT                   10883760..10883969,10884893..10885012,10887812..10887958,
FT                   10888619..10888759,10890265..10890324,10900442..10900570,
FT                   10901779..10901907,10903941..10904024,10906279..10906341,
FT                   10907875..10907973,10910382..10910483,10917242..10917310,
FT                   10918561..10918638,10924618..10924821,10925798..10925914)
FT                   /codon_start=1
FT                   /gene="Jakmip1"
FT                   /locus_tag="mCG_20624"
FT                   /product="janus kinase and microtubule interacting protein
FT                   1"
FT                   /note="gene_id=mCG20624.1 transcript_id=mCT22279.2
FT                   protein_id=mCP4162.2"
FT                   /protein_id="EDL37520.1"
FT                   /translation="MREGAGPIREPAPGAHRSAAASVRRRSPPFPHRTRVPHGPSLLGY
FT                   GPGSGDGDSSVGARGEGAAGECGSPLLLGLCRSVKQVGTDSPVMVCTEDERSPVRLLST
FT                   AELVAVLAGNMSKKGRSKGDKPEAETDSVQMANEELRAKLTNIQIEFQQEKSKVGKLRE
FT                   RLQEAKLEREQEQRRHTAYISELKAKLHEEKTKELQALREALIRQHEQEAARTAKIKEG
FT                   ELQRLQATLNVLRDGAADKVKTALLADAREEARRTFDGERQRLQQEILELKAARKQAEE
FT                   ALSNCMQADKAKAADLRAAYQAHQDEVHRIKRECERDIRRLMDEIKGKERVILALEKEL
FT                   GVQTGQTQRLLLQKEALDEQLVQVKEAERHHSSPKRELPPGIGDMAELMGGQDQHMDER
FT                   DVRRFQLKIAELNSVIRKLEDRNTLLADERNELLKRSRETEVQLKPLVEKNKRMNKKNE
FT                   ELLHSIQRMEEKLKSLTRENVEMKEKLSAQASLKRHTSLNDLSLTRDEQEIEFLRLQVL
FT                   EQQHVIDDLSLERERLLRSKRHRGKSLKPPKKHVVETFFGFDEESVDSETLSETSYNTD
FT                   RTDRTPATPEEDLDETTTREEADLRFCQLTREYQALQRAYALLQEQVGGTLDAEREART
FT                   REQLQADLLRCQAKIEDLEKLLVEKGQDAAWVEEKQVLMRTNQDLLEKIYRLEMEENQL
FT                   KSEMQDAKDQNELLEFRVLELEERERRSPAFNLQITTFPENNSSALQLFCHQEGVKWLK
FT                   QIEGTEAALTQKMMDLEKEKDQFSRQKGYLEQELDYRKEALDQAYLKIQDLEATLYNAL
FT                   QQEPGRRASEALSASQREDLQAAVEKVRRQLLRQSREFDSQILRERMELLQQAQQKIRE
FT                   MEGKLELQRRQLKELEEKVGGPGVLRPDSCPVQL"
FT   gene            complement(10821202..10824713)
FT                   /locus_tag="mCG_148300"
FT                   /note="gene_id=mCG148300.0"
FT   mRNA            complement(join(10821202..10822364,10824621..10824713))
FT                   /locus_tag="mCG_148300"
FT                   /product="mCG148300"
FT                   /note="gene_id=mCG148300.0 transcript_id=mCT188563.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(10822134..10822316)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148300"
FT                   /product="mCG148300"
FT                   /note="gene_id=mCG148300.0 transcript_id=mCT188563.0
FT                   protein_id=mCP109215.0"
FT                   /protein_id="EDL37521.1"
FT                   /translation="MDSSSNGHRTPAAVQNACCQPPRLAHLRSSSGSPHQKAGRGPQVR
FT                   FMIDQGFTPRCGGGG"
FT   gene            <11020744..11073155
FT                   /gene="Crmp1"
FT                   /locus_tag="mCG_20622"
FT                   /note="gene_id=mCG20622.2"
FT   mRNA            join(11020744..11021181,11043898..11043986,
FT                   11047641..11047825,11049691..11049867,11054348..11054512,
FT                   11057278..11057339,11059085..11059165,11059863..11059931,
FT                   11060659..11060788,11061467..11061623,11063852..11063993,
FT                   11065028..11065198,11067390..11067569,11069827..11069992,
FT                   11072139..11073155)
FT                   /gene="Crmp1"
FT                   /locus_tag="mCG_20622"
FT                   /product="collapsin response mediator protein 1, transcript
FT                   variant mCT22277"
FT                   /note="gene_id=mCG20622.2 transcript_id=mCT22277.2 created
FT                   on 07-FEB-2003"
FT   mRNA            join(<11020744..11021181,11043898..11043986,
FT                   11047641..11047825,11054348..11054512,11057278..11057339,
FT                   11059085..11059165,11059863..11059931,11060659..11060779,
FT                   11061467..11061623,11063852..11063993,11065028..11065198,
FT                   11067390..11067569,11069827..11069992,11072139..11073153)
FT                   /gene="Crmp1"
FT                   /locus_tag="mCG_20622"
FT                   /product="collapsin response mediator protein 1, transcript
FT                   variant mCT193630"
FT                   /note="gene_id=mCG20622.2 transcript_id=mCT193630.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<11020786..11021181,11043898..11043986,
FT                   11047641..11047825,11054348..11054512,11057278..11057339,
FT                   11059085..11059165,11059863..11059931,11060659..11060779,
FT                   11061467..11061623,11063852..11063993,11065028..11065198,
FT                   11067390..11067569,11069827..11069992,11072139..11072230)
FT                   /codon_start=1
FT                   /gene="Crmp1"
FT                   /locus_tag="mCG_20622"
FT                   /product="collapsin response mediator protein 1, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG20622.2 transcript_id=mCT193630.0
FT                   protein_id=mCP114584.0 isoform=CRA_b"
FT                   /protein_id="EDL37523.1"
FT                   /translation="PPETGMAERRRAWNTEDDLPVYLARPGSAAQTPRQKYGGMFAAVE
FT                   GAYENKTIDFDAYSVGRRGSARTPRSAGRPDAVGLPCPGGSEDTASDVSEPSGSAVSSP
FT                   GDRDDRPPALRIRCPAPRDLPLGRDNGQSDRLLIRGGRIINDDQSFYADVYLEDGLIKQ
FT                   IGENLIVPGGVKTIEANGRMVIPGGIDVNTYLQKPSQGMTSADDFFQGTKAALAGGTTM
FT                   IIDHVVPEPGSSLLTSFEKWHEAADTKSCCDYSLHVDITSWYDGVREELEVLVQDKGVN
FT                   SFQVYMAYKDLYQMSDSQLYEAFTFLKGLGAVILVHAENGDLIAQEQKRILEMGITGPE
FT                   GHALSRPEELEAEAVFRAIAIAGRINCPVYITKVMSKSAADIIALARKKGPLVFGEPIA
FT                   ASLGTDGTHYWSKNWAKAAAFVTSPPLSPDPTTPDYLTSLLACGDLQVTGSGHCPYSTA
FT                   QKAVGKDNFTLIPEGVNGIEERMTVVWDKAVATGKMDENQFVAVTSTNAAKIFNLYPRK
FT                   GRIAVGSDADVVIWDPDKMKTITAKSHKSTVEYNIFEGMECHGSPLVVISQGKIVFEDG
FT                   NISVSKGMGRFIPRKPFPEHLYQRVRIRSKVFGLHSVSRGMYDGPVYEVPATPKHAAPA
FT                   PSAKSSPSKHQPPPIRNLHQSNFSLSGAQIDDNNPRRTGHRIVAPPGGRSNITSLG"
FT   CDS             join(11020801..11021181,11043898..11043986,
FT                   11047641..11047825,11049691..11049867,11054348..11054512,
FT                   11057278..11057339,11059085..11059165,11059863..11059931,
FT                   11060659..11060788,11061467..11061623,11063852..11063993,
FT                   11065028..11065198,11067390..11067569,11069827..11069992,
FT                   11072139..11072230)
FT                   /codon_start=1
FT                   /gene="Crmp1"
FT                   /locus_tag="mCG_20622"
FT                   /product="collapsin response mediator protein 1, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG20622.2 transcript_id=mCT22277.2
FT                   protein_id=mCP4196.2 isoform=CRA_c"
FT                   /protein_id="EDL37524.1"
FT                   /translation="MAERRRAWNTEDDLPVYLARPGSAAQTPRQKYGGMFAAVEGAYEN
FT                   KTIDFDAYSVGRRGSARTPRSAGRPDAVGLPCPGGSEDTASDVSEPSGSAVSSPGDRDD
FT                   RPPALRIRCPAPRDLPLGRDNGQSDRLLIRGGRIINDDQSFYADVYLEDGLIKQIGENL
FT                   IVPGGVKTIEANGRMVIPGGIDVNTYLQKPSQGMTSADDFFQGTKAALAGGTTMIRENL
FT                   IVPGGVKTIEANGRMVIPGGIDVNTYLQKPSQGMTSADDFFQGTKAALAGGTTMIIDHV
FT                   VPEPGSSLLTSFEKWHEAADTKSCCDYSLHVDITSWYDGVREELEVLVQDKGVNSFQVY
FT                   MAYKDLYQMSDSQLYEAFTFLKGLGAVILVHAENGDLIAQEQKRILEMGITGPEGHALS
FT                   RPEELEAEAVFRAIAIAGRINCPVYITKVMSKSAADIIALARKKGRWCPLVFGEPIAAS
FT                   LGTDGTHYWSKNWAKAAAFVTSPPLSPDPTTPDYLTSLLACGDLQVTGSGHCPYSTAQK
FT                   AVGKDNFTLIPEGVNGIEERMTVVWDKAVATGKMDENQFVAVTSTNAAKIFNLYPRKGR
FT                   IAVGSDADVVIWDPDKMKTITAKSHKSTVEYNIFEGMECHGSPLVVISQGKIVFEDGNI
FT                   SVSKGMGRFIPRKPFPEHLYQRVRIRSKVFGLHSVSRGMYDGPVYEVPATPKHAAPAPS
FT                   AKSSPSKHQPPPIRNLHQSNFSLSGAQIDDNNPRRTGHRIVAPPGGRSNITSLG"
FT   mRNA            join(11024446..11024753,11043898..11043986,
FT                   11047641..11047825,11054348..11054512,11057278..11057339,
FT                   11059085..11059165,11059863..11059931,11060659..11060779,
FT                   11061467..11061623,11063852..11063993,11065028..11065198,
FT                   11067390..11067569,11069827..11069992,11072139..11072538)
FT                   /gene="Crmp1"
FT                   /locus_tag="mCG_20622"
FT                   /product="collapsin response mediator protein 1, transcript
FT                   variant mCT179728"
FT                   /note="gene_id=mCG20622.2 transcript_id=mCT179728.0 created
FT                   on 07-FEB-2003"
FT   CDS             join(11024715..11024753,11043898..11043986,
FT                   11047641..11047825,11054348..11054512,11057278..11057339,
FT                   11059085..11059165,11059863..11059931,11060659..11060779,
FT                   11061467..11061623,11063852..11063993,11065028..11065198,
FT                   11067390..11067569,11069827..11069992,11072139..11072230)
FT                   /codon_start=1
FT                   /gene="Crmp1"
FT                   /locus_tag="mCG_20622"
FT                   /product="collapsin response mediator protein 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG20622.2 transcript_id=mCT179728.0
FT                   protein_id=mCP102650.0 isoform=CRA_a"
FT                   /protein_id="EDL37522.1"
FT                   /translation="MSHQGKKSIPHITSDRLLIRGGRIINDDQSFYADVYLEDGLIKQI
FT                   GENLIVPGGVKTIEANGRMVIPGGIDVNTYLQKPSQGMTSADDFFQGTKAALAGGTTMI
FT                   IDHVVPEPGSSLLTSFEKWHEAADTKSCCDYSLHVDITSWYDGVREELEVLVQDKGVNS
FT                   FQVYMAYKDLYQMSDSQLYEAFTFLKGLGAVILVHAENGDLIAQEQKRILEMGITGPEG
FT                   HALSRPEELEAEAVFRAIAIAGRINCPVYITKVMSKSAADIIALARKKGPLVFGEPIAA
FT                   SLGTDGTHYWSKNWAKAAAFVTSPPLSPDPTTPDYLTSLLACGDLQVTGSGHCPYSTAQ
FT                   KAVGKDNFTLIPEGVNGIEERMTVVWDKAVATGKMDENQFVAVTSTNAAKIFNLYPRKG
FT                   RIAVGSDADVVIWDPDKMKTITAKSHKSTVEYNIFEGMECHGSPLVVISQGKIVFEDGN
FT                   ISVSKGMGRFIPRKPFPEHLYQRVRIRSKVFGLHSVSRGMYDGPVYEVPATPKHAAPAP
FT                   SAKSSPSKHQPPPIRNLHQSNFSLSGAQIDDNNPRRTGHRIVAPPGGRSNITSLG"
FT   gene            complement(11080193..11118833)
FT                   /gene="Evc"
FT                   /locus_tag="mCG_20623"
FT                   /note="gene_id=mCG20623.2"
FT   mRNA            complement(join(11080193..11081522,11081834..11081945,
FT                   11082580..11082673,11084217..11084343,11088254..11088365,
FT                   11090073..11090217,11091202..11091408,11092595..11092805,
FT                   11094492..11094601,11095422..11095634,11097388..11097486,
FT                   11099234..11099382,11099961..11100177,11101308..11101466,
FT                   11103125..11103262,11104774..11104872,11105912..11105996,
FT                   11107413..11107660,11109537..11109620,11114845..11114970,
FT                   11118594..11118833))
FT                   /gene="Evc"
FT                   /locus_tag="mCG_20623"
FT                   /product="Ellis van Creveld gene homolog (human),
FT                   transcript variant mCT22278"
FT                   /note="gene_id=mCG20623.2 transcript_id=mCT22278.2 created
FT                   on 18-SEP-2002"
FT   mRNA            complement(join(11080195..11081522,11081834..11081945,
FT                   11082580..11082673,11084217..11084343,11088254..11088362,
FT                   11090069..11090217,11091202..11091408,11092595..11092805,
FT                   11094492..11094601,11095422..11095634,11097388..11097486,
FT                   11099234..11099382,11099961..11100177,11101308..11101466,
FT                   11103125..11103262,11104774..11104872,11105912..11105996,
FT                   11107413..11107660,11109537..11109620,11114845..11114970,
FT                   11118594..>11118820))
FT                   /gene="Evc"
FT                   /locus_tag="mCG_20623"
FT                   /product="Ellis van Creveld gene homolog (human),
FT                   transcript variant mCT193631"
FT                   /note="gene_id=mCG20623.2 transcript_id=mCT193631.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(11081399..11081522,11081834..11081945,
FT                   11082580..11082673,11084217..11084343,11088254..11088365,
FT                   11090073..11090217,11091202..11091408,11092595..11092805,
FT                   11094492..11094601,11095422..11095634,11097388..11097486,
FT                   11099234..11099382,11099961..11100177,11101308..11101466,
FT                   11103125..11103262,11104774..11104872,11105912..11105996,
FT                   11107413..11107660,11109537..11109620,11114845..11114970,
FT                   11118594..11118752))
FT                   /codon_start=1
FT                   /gene="Evc"
FT                   /locus_tag="mCG_20623"
FT                   /product="Ellis van Creveld gene homolog (human), isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG20623.2 transcript_id=mCT22278.2
FT                   protein_id=mCP4146.2 isoform=CRA_b"
FT                   /protein_id="EDL37526.1"
FT                   /translation="MTCTKDARLQLGREALQAAPTLLVPAVLLGGVLGLGLGLWLGCRA
FT                   SHLRARLQKDDRKRLLGSSEPPAQSLRDTGSQAKARRRQRETTRDEDAPEVCEPSLSGN
FT                   ITAFALKARVVYPINQKFRPLADGSSHPSLHENLTQAAAILPHLPHQPAEASPASSLGS
FT                   LSQAGKEDGSSSSSMRSTYSDDRILQCAFLRVGSFPEILACESVDIDLCVCSLHLKDLL
FT                   QVDTALRQEKHLMFIQILKACLLDFFPKKKPDDELCQKVLSKQEHDLEELEKGLQARLA
FT                   NTEMLGTGDSGYVSLADVERKERELSEQLIDNMGAFWKQMESIQPTLMDQFKCSSSKAR
FT                   QFMMTLTGRMIVAEGLLHDSQDLHVLDTLERTMGRAHLARMVEFLRTQIQEETKCRLAA
FT                   ISRGLELLTVQGQLSGRQKEELLTQQHKAFWEEAERFGREFMQRGKDLVQASQARQAEA
FT                   AAELTQTQEEERRSFLADSQLTSDPGEFLKAFHEVLERQRLTRSDQEGDEDTRITEAMA
FT                   ALCQELYCSTMGTFQKFVDSLFLKTLPEVTSLPVAECETLRQQVQEQAARQLGQADRFR
FT                   RRQWGLLCDLLEQDKRVWLEEGTLSTVLQRQLRDHHESTIHGVLSRFSGLSEESSRGIL
FT                   QGHELLLCSALRRLALRGTTITALAQMRLSGKKRLLQELHEQLALEQGVSPCLEEHQWQ
FT                   LLRALEARIQEEAARLEDEAQQTGLRLQQQLLAEAQEAGRLLQLHMERVIGQALLVHAR
FT                   NVASKGRTREKEDFKRTLVETVVESVYVTSTSVNRLVQAHYQAVGKLLQAHEEQLLQRL
FT                   KTLQGERINAYKLWKKQEFSDPSLESQTADGTHGASQGVQQRMLSQQKRLLDQFTKHQQ
FT                   GRLNSQRQKAQELDQLQAQLETQLQEAEQTLISELSTLARVPLPENKPFSNKRGLPEKP
FT                   VRTKRKKPPPREREDLGTPNDDHLALADHTTGPLSTTYSASPPIRVHSGGRLDQQDSEA
FT                   GDGESTSKILQKGSNL"
FT   CDS             complement(join(11088317..11088362,11090069..11090217,
FT                   11091202..11091408,11092595..11092805,11094492..11094601,
FT                   11095422..11095634,11097388..11097486,11099234..11099382,
FT                   11099961..11100177,11101308..11101466,11103125..11103262,
FT                   11104774..11104872,11105912..11105996,11107413..11107660,
FT                   11109537..11109620,11114845..11114970,11118594..>11118818))
FT                   /codon_start=1
FT                   /gene="Evc"
FT                   /locus_tag="mCG_20623"
FT                   /product="Ellis van Creveld gene homolog (human), isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG20623.2 transcript_id=mCT193631.0
FT                   protein_id=mCP114585.0 isoform=CRA_a"
FT                   /protein_id="EDL37525.1"
FT                   /translation="ERVQRRGPGRRRDAAGHPPEPSMTCTKDARLQLGREALQAAPTLL
FT                   VPAVLLGGVLGLGLGLWLGCRASHLRARLQKDDRKRLLGSSEPPAQSLRDTGSQAKARR
FT                   RQRETTRDEDAPEVCEPSLSGNITAFALKARVVYPINQKFRPLADGSSHPSLHENLTQA
FT                   AAILPHLPHQPAEASPASSLGSLSQAGKEDGSSSSSMRSTYSDDRILQCAFLRVGSFPE
FT                   ILACESVDIDLCVCSLHLKDLLQVDTALRQEKHLMFIQILKACLLDFFPKKKPDDELCQ
FT                   KVLSKQEHDLEELEKGLQARLANTEMLGTGDSGYVSLADVERKERELSEQLIDNMGAFW
FT                   KQMESIQPTLMDQFKCSSSKARQFMMTLTGRMIVAEGLLHDSQDLHVLDTLERTMGRAH
FT                   LARMVEFLRTQIQEETKCRLAAISRGLELLTVQGQLSGRQKEELLTQQHKAFWEEAERF
FT                   GREFMQRGKDLVQASQARQAEAAAELTQTQEEERRSFLADSQLTSDPGEFLKAFHEVLE
FT                   RQRLTRSDQEGDEDTRITEAMAALCQELYCSTMGTFQKFVDSLFLKTLPEVTSLPVAEC
FT                   ETLRQQVQEQAARQLGQADRFRRRQWGLLCDLLEQDKRVWLEEGTLSTVLQRQLRDHHE
FT                   STIHGVLSRFSGLSEESSRGILQGHELLLCSALRRLALRGTTITALAQMRLSGKKRLLQ
FT                   ELHEQLALEQGVSPCLEEHQWQLLRALEARIQEEAARLEDEAQQTGLRLQQQLLAEAQE
FT                   AGRLLQLHMERVIGQALLVHARNVASKGRTREKEDFKRTLVETVVESVYVTSTSVNRLV
FT                   QAHYQAVGKLLQAHEEQLLQRLKTLQGRENQCLQAVEEARIQ"
FT   gene            11120450..11207329
FT                   /gene="Evc2"
FT                   /locus_tag="mCG_141192"
FT                   /note="gene_id=mCG141192.0"
FT   mRNA            join(11120450..11120686,11129668..11129736,
FT                   11130810..11130996,11132561..11132670,11133563..11133616,
FT                   11139769..11139903,11145732..11145871,11152739..11153063,
FT                   11160413..11160652,11162640..11162815,11165309..11165468,
FT                   11168916..11169370,11174224..11174428,11175311..11175427,
FT                   11192520..11192747,11198012..11198223,11199681..11199768,
FT                   11201400..11201602,11204114..11204215,11206685..11207329)
FT                   /gene="Evc2"
FT                   /locus_tag="mCG_141192"
FT                   /product="Ellis van Creveld syndrome 2 homolog (human)"
FT                   /note="gene_id=mCG141192.0 transcript_id=mCT173711.0
FT                   created on 26-SEP-2002"
FT   CDS             join(11120507..11120686,11129668..11129736,
FT                   11130810..11130996,11132561..11132670,11133563..11133616,
FT                   11139769..11139903,11145732..11145871,11152739..11153063,
FT                   11160413..11160652,11162640..11162815,11165309..11165468,
FT                   11168916..11169370,11174224..11174428,11175311..11175427,
FT                   11192520..11192747,11198012..11198223,11199681..11199768,
FT                   11201400..11201602,11204114..11204215,11206685..11206952)
FT                   /codon_start=1
FT                   /gene="Evc2"
FT                   /locus_tag="mCG_141192"
FT                   /product="Ellis van Creveld syndrome 2 homolog (human)"
FT                   /note="gene_id=mCG141192.0 transcript_id=mCT173711.0
FT                   protein_id=mCP96630.0"
FT                   /protein_id="EDL37527.1"
FT                   /translation="MGATGPTGAGGRATWVLAGNILAAALVLGSGPRALPPSFPALGPG
FT                   SPSRPGPAGPWASSQYSDISREARGPFENGVIFQKCSLVSGQSESQTMHVQLSVNNTRT
FT                   PTSVNLSNLLVLDEITGLAVKESPGNNTQDGIQTFRKSFLQVGECYSVSYTASLDPTAL
FT                   GTGESLDLPARLIFQSPSQNRTQLKAPFTITVEEKIMVLPNHGLHAAGFMAAFLISLLL
FT                   TLAALFFLARGRCLQGGMLSRCRIQHPENKLEPSPFTSANGVSQDLSLNDQVVAILTSE
FT                   EPGSMLQALEELEIATLNQADADLEACRNQISKDIIALLMKNLVSGGHLSPQTERKMAA
FT                   AFKKQFLLLENEIQEEYERKMLALTAECDLEMRKKTENQYQREMVAMEEAEEVLKRVSE
FT                   RSAAECSSLLRTLHGLEQEDMQRSLTLDQAEDFAQAHRQLAVFQRNELHSIVYTQIQSA
FT                   VSKGELRPEVAKMMLQDYSKTQESVEELMDFFQATKRYHLSKRFGHREYLVQRLQAMET
FT                   RVQGLLNTAATQLTSLIHKHERAGYLDEDQMETLLERAQTETFSIKQKLDNDLKQEKKR
FT                   LHQRLITRRRRELLQKHKEQQKEQVSLGEASSTAEDAVQYLHQWRSVMAEHTAALEELQ
FT                   ERLDQAALDDLRVLTVSLSEKATEELRRLQSTAMTQELLKRSAPWLFLQQILEEHSRES
FT                   AARTTQLEAEERERGQELVQGVRQRLQQDALEAYTEEQAELRHWEHLVFMKLCCAAISL
FT                   SEEDLLRVRQEAQGCFSQLDRSLALPRVRARVLQQQAQMAWREAEFRKLDQALAAPELQ
FT                   SKARKLRSKGRGKADLLKKNLEDKIRLFEERAPVELADQVRGELLQERVQRLEAQEAHF
FT                   AESLVALQFQKVARAAETLSVYTALLSIQDLLLGELSESETLTKSACVQILESHRPELQ
FT                   ELERKLEDQLVQQEEAEQQRVLESWQRWAADGPGLSEPEEMDPERQVSAILRQALNKGQ
FT                   KLLEQHQQRVREEWQNGAVLEDSLESIEADTMASLCSQGLRLVSYLSRMTMVPGSTLLR
FT                   LLSVVLPAASQPQLLALLDAVSEKHSDHTAENESSGEQAQAEQSKRRKHQVWWKVLDSR
FT                   FRADLVSQGLERMLWARQKKERILKKIYVPVQERVMFPGKGSWPHLSLEPIGELAPIPI
FT                   TGADAMDILNTGEKIFVFRSPREPEISLRVPPRRKKNFLNAKKANRALGLD"
FT   gene            complement(11186631..11187233)
FT                   /pseudo
FT                   /locus_tag="mCG_1046061"
FT                   /note="gene_id=mCG1046061.1"
FT   mRNA            complement(11186631..11187233)
FT                   /pseudo
FT                   /locus_tag="mCG_1046061"
FT                   /note="gene_id=mCG1046061.1 transcript_id=mCT163765.1
FT                   created on 16-OCT-2002"
FT   gene            complement(11228943..11496777)
FT                   /gene="Stk32b"
FT                   /locus_tag="mCG_122045"
FT                   /note="gene_id=mCG122045.0"
FT   mRNA            complement(join(11228943..11230908,11237052..11237116,
FT                   11239239..11239370,11241719..11241844,11243467..11243583,
FT                   11250436..11250539,11274648..11274737,11283312..11283349,
FT                   11315992..11316165,11407131..11407282,11427270..11427325,
FT                   11496359..11496777))
FT                   /gene="Stk32b"
FT                   /locus_tag="mCG_122045"
FT                   /product="serine/threonine kinase 32B"
FT                   /note="gene_id=mCG122045.0 transcript_id=mCT123259.0
FT                   created on 26-SEP-2002"
FT   CDS             complement(join(11230770..11230908,11237052..11237116,
FT                   11239239..11239370,11241719..11241844,11243467..11243583,
FT                   11250436..11250539,11274648..11274737,11283312..11283349,
FT                   11315992..11316165,11407131..11407282,11427270..11427325,
FT                   11496359..11496410))
FT                   /codon_start=1
FT                   /gene="Stk32b"
FT                   /locus_tag="mCG_122045"
FT                   /product="serine/threonine kinase 32B"
FT                   /note="gene_id=mCG122045.0 transcript_id=mCT123259.0
FT                   protein_id=mCP65107.1"
FT                   /protein_id="EDL37528.1"
FT                   /translation="MGGNHSHKPPVFDENEEVNFDHFQILRAIGKGSFGKVCIVQKRDT
FT                   KKMYAMKYMNKQKCVERDEVRNVFRELQIMQGLEHPFLVNLWYSFQDEEDMFMVVDLLL
FT                   GGDLRYHLQQNVHFTEGTVKLYICELALALEYLQRYHIIHRDIKPDNILLDEHGHVHIT
FT                   DFNIATVLKGSEKASSMAGTKPYMAPEVFQVYVDGGPGYSYPVDWWSLGVTAYELLRGW
FT                   RPYEIHSATPIDEILNMFKVERVHYSSTWCEGMVSLLKKLLTKDPESRLSSLRDIQSMT
FT                   YLADMNWDAVFEKALMPGFVPNKGRLNCDPTFELEEMILESKPLHKKKKRLAKHRSRDS
FT                   TKDSCPLNGHLQQCLETVRKEFIIFNREKLRRQQGHNGQLSDLDGRIGSQTSSKLQDGR
FT                   NNNILTHTCPRGCSS"
FT   gene            <11522725..11526984
FT                   /locus_tag="mCG_3751"
FT                   /note="gene_id=mCG3751.1"
FT   mRNA            join(<11522725..11522889,11524554..11524616,
FT                   11524774..11524902,11526382..11526984)
FT                   /locus_tag="mCG_3751"
FT                   /product="mCG3751, transcript variant mCT2686"
FT                   /note="gene_id=mCG3751.1 transcript_id=mCT2686.1 created on
FT                   18-FEB-2003"
FT   CDS             join(11522725..11522889,11524554..11524616,
FT                   11524774..11524902,11526382..11526465)
FT                   /codon_start=1
FT                   /locus_tag="mCG_3751"
FT                   /product="mCG3751, isoform CRA_b"
FT                   /note="gene_id=mCG3751.1 transcript_id=mCT2686.1
FT                   protein_id=mCP4163.1 isoform=CRA_b"
FT                   /protein_id="EDL37530.1"
FT                   /translation="MSPKTLPLLLLLVVVVVIAWPLAVQSAPPTCYSRMLTLSREIMAD
FT                   FQSLQASEPEDSCVRYLPRLYLDIHVRERCLNYCVLAKLRDFVASPQCWKMAEVDTLKD
FT                   RVRKLYTIMNSFCRRDLVFLSDDCSALEDPIPEATGPPDWQS"
FT   mRNA            join(<11522729..11522889,11524554..11524598,
FT                   11524774..11524902,11526382..11526628)
FT                   /locus_tag="mCG_3751"
FT                   /product="mCG3751, transcript variant mCT180321"
FT                   /note="gene_id=mCG3751.1 transcript_id=mCT180321.0 created
FT                   on 18-FEB-2003"
FT   CDS             join(<11522731..11522889,11524554..11524598,
FT                   11524774..11524902,11526382..11526465)
FT                   /codon_start=1
FT                   /locus_tag="mCG_3751"
FT                   /product="mCG3751, isoform CRA_a"
FT                   /note="gene_id=mCG3751.1 transcript_id=mCT180321.0
FT                   protein_id=mCP103243.0 isoform=CRA_a"
FT                   /protein_id="EDL37529.1"
FT                   /translation="PKTLPLLLLLVVVVVIAWPLAVQSAPPTCYSRMLTLSREIMADFQ
FT                   SLQASEPEDSCVRYLPRLYLDIHNYCVLAKLRDFVASPQCWKMAEVDTLKDRVRKLYTI
FT                   MNSFCRRDLVFLSDDCSALEDPIPEATGPPDWQS"
FT   gene            complement(11607557..11611793)
FT                   /locus_tag="mCG_3750"
FT                   /note="gene_id=mCG3750.1"
FT   mRNA            complement(join(11607557..11608765,11610930..11611793))
FT                   /locus_tag="mCG_3750"
FT                   /product="mCG3750"
FT                   /note="gene_id=mCG3750.1 transcript_id=mCT2688.1 created on
FT                   18-SEP-2002"
FT   CDS             complement(join(11608323..11608765,11610930..11611398))
FT                   /codon_start=1
FT                   /locus_tag="mCG_3750"
FT                   /product="mCG3750"
FT                   /note="gene_id=mCG3750.1 transcript_id=mCT2688.1
FT                   protein_id=mCP4200.2"
FT                   /db_xref="GOA:P13297"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017970"
FT                   /db_xref="InterPro:IPR020479"
FT                   /db_xref="MGI:MGI:97168"
FT                   /db_xref="PDB:1IG7"
FT                   /db_xref="UniProtKB/Swiss-Prot:P13297"
FT                   /protein_id="EDL37531.1"
FT                   /translation="MAPAAAMTSLPLGVKVEDSAFAKPAGGGVGQAPGAAAATATAMGT
FT                   DEEGAKPKVPASLLPFSVEALMADHRKPGAKESVLVASEGAQAAGGSVQHLGTRPGSLG
FT                   APDAPSSPRPLGHFSVGGLLKLPEDALVKAESPEKLDRTPWMQSPRFSPPPARRLSPPA
FT                   CTLRKHKTNRKPRTPFTTAQLLALERKFRQKQYLSIAERAEFSSSLSLTETQVKIWFQN
FT                   RRAKAKRLQEAELEKLKMAAKPMLPPAAFGLSFPLGGPAAVAAAAGASLYSASGPFQRA
FT                   ALPVAPVGLYTAHVGYSMYHLT"
FT   gene            <11679811..11684095
FT                   /locus_tag="mCG_3755"
FT                   /note="gene_id=mCG3755.2"
FT   mRNA            join(<11679811..11679930,11682685..11683228)
FT                   /locus_tag="mCG_3755"
FT                   /product="mCG3755, transcript variant mCT174003"
FT                   /note="gene_id=mCG3755.2 transcript_id=mCT174003.0 created
FT                   on 03-OCT-2002"
FT   mRNA            join(<11680871..11680921,11682685..11682837,
FT                   11683008..11684095)
FT                   /locus_tag="mCG_3755"
FT                   /product="mCG3755, transcript variant mCT2674"
FT                   /note="gene_id=mCG3755.2 transcript_id=mCT2674.2 created on
FT                   03-OCT-2002"
FT   CDS             join(<11682766..11682837,11683008..11683148)
FT                   /codon_start=1
FT                   /locus_tag="mCG_3755"
FT                   /product="mCG3755, isoform CRA_b"
FT                   /note="gene_id=mCG3755.2 transcript_id=mCT2674.2
FT                   protein_id=mCP4178.0 isoform=CRA_b"
FT                   /protein_id="EDL37533.1"
FT                   /translation="ACFQSVVHLLPKPRPSSRTQIQAEVSWSFPAGQKVQMRGDQKPLH
FT                   TTSIAEASGIFSCHVLSHQKQLGHL"
FT   CDS             <11682785..11683120
FT                   /codon_start=1
FT                   /locus_tag="mCG_3755"
FT                   /product="mCG3755, isoform CRA_a"
FT                   /note="gene_id=mCG3755.2 transcript_id=mCT174003.0
FT                   protein_id=mCP96922.0 isoform=CRA_a"
FT                   /protein_id="EDL37532.1"
FT                   /translation="FTCFQNLDLHHEHRSKLRYSRVTPETPRQVEGRWTPGPRTVQSML
FT                   PPHSRPSLPVLWLPGPIFFSRKLMASILPGLLEFPSWTESSDERGPKAFTYNQHCRSLW
FT                   NLLLPCS"
FT   gene            complement(<11756058..11770071)
FT                   /locus_tag="mCG_1046235"
FT                   /note="gene_id=mCG1046235.0"
FT   mRNA            complement(join(<11756058..11756466,11769992..11770071))
FT                   /locus_tag="mCG_1046235"
FT                   /product="mCG1046235"
FT                   /note="gene_id=mCG1046235.0 transcript_id=mCT163939.0
FT                   created on 30-SEP-2002"
FT   CDS             complement(11756058..11756294)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1046235"
FT                   /product="mCG1046235"
FT                   /note="gene_id=mCG1046235.0 transcript_id=mCT163939.0
FT                   protein_id=mCP65173.0"
FT                   /protein_id="EDL37534.1"
FT                   /translation="MAVPVPSNLQLCSYFLWSSFLKATMWNLLHKFVIHFFLVNLCLVV
FT                   GCQPRPPMGEDTIFYPCTLRVKPGKHKQVLIVS"
FT   gene            11770158..11772539
FT                   /locus_tag="mCG_148317"
FT                   /note="gene_id=mCG148317.0"
FT   mRNA            join(11770158..11770470,11770581..11772539)
FT                   /locus_tag="mCG_148317"
FT                   /product="mCG148317"
FT                   /note="gene_id=mCG148317.0 transcript_id=mCT188580.0
FT                   created on 13-JAN-2004"
FT   CDS             11771516..11771866
FT                   /codon_start=1
FT                   /locus_tag="mCG_148317"
FT                   /product="mCG148317"
FT                   /note="gene_id=mCG148317.0 transcript_id=mCT188580.0
FT                   protein_id=mCP109231.0"
FT                   /protein_id="EDL37535.1"
FT                   /translation="MQLGEQQHPRLRGQHRDALGLRLVSWTYWEGFCQNGFQYRKNACC
FT                   FSRKFLLHHRKEKQMASNSVKLEAAFTLLFQEGLCCLGPVAMECQQPHLTSRTLGDCKE
FT                   LTVIKFFCPRFI"
FT   gene            11825397..11918021
FT                   /gene="Stx18"
FT                   /locus_tag="mCG_3747"
FT                   /note="gene_id=mCG3747.1"
FT   mRNA            join(11825397..11825666,11877800..11877867,
FT                   11890425..11890540,11892373..11892439,11901633..11901745,
FT                   11906765..11906853,11912486..11912544,11913598..11913667,
FT                   11916425..11916505,11917466..11918021)
FT                   /gene="Stx18"
FT                   /locus_tag="mCG_3747"
FT                   /product="syntaxin 18, transcript variant mCT2706"
FT                   /note="gene_id=mCG3747.1 transcript_id=mCT2706.1 created on
FT                   18-FEB-2003"
FT   mRNA            join(11825398..11825666,11877800..11877867,
FT                   11890425..11890540,11892111..11892188,11892373..11892439,
FT                   11901633..11901745,11906765..11906853,11912486..11912544,
FT                   11913598..11913667,11916425..11916505,11917558..11918020)
FT                   /gene="Stx18"
FT                   /locus_tag="mCG_3747"
FT                   /product="syntaxin 18, transcript variant mCT179733"
FT                   /note="gene_id=mCG3747.1 transcript_id=mCT179733.0 created
FT                   on 18-FEB-2003"
FT   mRNA            join(11825415..11825666,11890425..11890529)
FT                   /gene="Stx18"
FT                   /locus_tag="mCG_3747"
FT                   /product="syntaxin 18, transcript variant mCT173722"
FT                   /note="gene_id=mCG3747.1 transcript_id=mCT173722.0 created
FT                   on 18-FEB-2003"
FT   mRNA            join(11825455..11825666,11877800..11877867,
FT                   11890425..11890540,11892111..11892188,11892373..11892439,
FT                   11901633..11901745,11906765..11906853,11912486..11912544,
FT                   11913598..11913667,11916425..11916505,11917466..11917771)
FT                   /gene="Stx18"
FT                   /locus_tag="mCG_3747"
FT                   /product="syntaxin 18, transcript variant mCT180322"
FT                   /note="gene_id=mCG3747.1 transcript_id=mCT180322.0 created
FT                   on 18-FEB-2003"
FT   CDS             join(11825499..11825666,11877800..11877867,
FT                   11890425..11890540,11892111..11892188,11892373..11892439,
FT                   11901633..11901745,11906765..11906853,11912486..11912544,
FT                   11913598..11913667,11916425..11916505,11917558..11917575)
FT                   /codon_start=1
FT                   /gene="Stx18"
FT                   /locus_tag="mCG_3747"
FT                   /product="syntaxin 18, isoform CRA_b"
FT                   /note="gene_id=mCG3747.1 transcript_id=mCT179733.0
FT                   protein_id=mCP102655.0 isoform=CRA_b"
FT                   /protein_id="EDL37537.1"
FT                   /translation="MAVDITLLFRASVKTVKTRNKALGVAVGGGADGSRDELFRRSPRP
FT                   KGDFSSRAREVISHIGKLRDFLLEHRKEYINAYSHTMSDYGRMTDTERDQIDQDAQIFI
FT                   RTCSEAIHQLRTEAHKEIHSQQVKEHRTAVLDFVDDYLKRVCKLYSEQRAIRVKRVVDK
FT                   KRLSKLEPEPHTKRKDSTSEKAPQNASQDSEGKPAAEELPEKPLAESQPELGTWGDGKG
FT                   EDELSPEEIQMFEQENQRLIGEMNSLFDEVRQIEGKVVEISRLQEIFTEKVLQQETEID
FT                   SIHQLVVGATENIKEGNEDIRELAHQG"
FT   CDS             join(11825499..11825666,11877800..11877867,
FT                   11890425..11890540,11892111..11892188,11892373..11892439,
FT                   11901633..11901745,11906765..11906853,11912486..11912544,
FT                   11913598..11913667,11916425..11916505,11917466..11917561)
FT                   /codon_start=1
FT                   /gene="Stx18"
FT                   /locus_tag="mCG_3747"
FT                   /product="syntaxin 18, isoform CRA_c"
FT                   /note="gene_id=mCG3747.1 transcript_id=mCT180322.0
FT                   protein_id=mCP103244.0 isoform=CRA_c"
FT                   /protein_id="EDL37538.1"
FT                   /translation="MAVDITLLFRASVKTVKTRNKALGVAVGGGADGSRDELFRRSPRP
FT                   KGDFSSRAREVISHIGKLRDFLLEHRKEYINAYSHTMSDYGRMTDTERDQIDQDAQIFI
FT                   RTCSEAIHQLRTEAHKEIHSQQVKEHRTAVLDFVDDYLKRVCKLYSEQRAIRVKRVVDK
FT                   KRLSKLEPEPHTKRKDSTSEKAPQNASQDSEGKPAAEELPEKPLAESQPELGTWGDGKG
FT                   EDELSPEEIQMFEQENQRLIGEMNSLFDEVRQIEGKVVEISRLQEIFTEKVLQQETEID
FT                   SIHQLVVGATENIKEGNEDIREAIKNNAGFRVWILFFLVMCSFSLLFLDWYDS"
FT   CDS             join(11825499..11825666,11877800..11877867,
FT                   11890425..11890540,11892373..11892439,11901633..11901745,
FT                   11906765..11906853,11912486..11912544,11913598..11913667,
FT                   11916425..11916505,11917466..11917561)
FT                   /codon_start=1
FT                   /gene="Stx18"
FT                   /locus_tag="mCG_3747"
FT                   /product="syntaxin 18, isoform CRA_d"
FT                   /note="gene_id=mCG3747.1 transcript_id=mCT2706.1
FT                   protein_id=mCP4193.2 isoform=CRA_d"
FT                   /protein_id="EDL37539.1"
FT                   /translation="MAVDITLLFRASVKTVKTRNKALGVAVGGGADGSRDELFRRSPRP
FT                   KGDFSSRAREVISHIGKLRDFLLEHRKEYINAYSHTMSDYGRMTDTERDQIDQDAQIFI
FT                   RTCSEAIHQLRTEGVCKLYSEQRAIRVKRVVDKKRLSKLEPEPHTKRKDSTSEKAPQNA
FT                   SQDSEGKPAAEELPEKPLAESQPELGTWGDGKGEDELSPEEIQMFEQENQRLIGEMNSL
FT                   FDEVRQIEGKVVEISRLQEIFTEKVLQQETEIDSIHQLVVGATENIKEGNEDIREAIKN
FT                   NAGFRVWILFFLVMCSFSLLFLDWYDS"
FT   CDS             join(11825499..11825666,11890425..11890439)
FT                   /codon_start=1
FT                   /gene="Stx18"
FT                   /locus_tag="mCG_3747"
FT                   /product="syntaxin 18, isoform CRA_a"
FT                   /note="gene_id=mCG3747.1 transcript_id=mCT173722.0
FT                   protein_id=mCP96641.0 isoform=CRA_a"
FT                   /protein_id="EDL37536.1"
FT                   /translation="MAVDITLLFRASVKTVKTRNKALGVAVGGGADGSRDELFRRSPRP
FT                   KGDFSSRAREVPHHV"
FT   gene            complement(11918395..11940835)
FT                   /gene="Nsg1"
FT                   /locus_tag="mCG_3752"
FT                   /note="gene_id=mCG3752.2"
FT   mRNA            complement(join(11918395..11920075,11925912..11926022,
FT                   11936806..11936922,11940075..11940229,11940589..11940643,
FT                   11940721..11940835))
FT                   /gene="Nsg1"
FT                   /locus_tag="mCG_3752"
FT                   /product="neuron specific gene family member 1, transcript
FT                   variant mCT2681"
FT                   /note="gene_id=mCG3752.2 transcript_id=mCT2681.2 created on
FT                   18-SEP-2002"
FT   mRNA            complement(join(11918397..11920075,11936806..11936922,
FT                   11940075..11940229,11940589..11940643))
FT                   /gene="Nsg1"
FT                   /locus_tag="mCG_3752"
FT                   /product="neuron specific gene family member 1, transcript
FT                   variant mCT173435"
FT                   /note="gene_id=mCG3752.2 transcript_id=mCT173435.0 created
FT                   on 18-SEP-2002"
FT   CDS             complement(join(11919875..11920075,11936806..11936922,
FT                   11940075..11940203))
FT                   /codon_start=1
FT                   /gene="Nsg1"
FT                   /locus_tag="mCG_3752"
FT                   /product="neuron specific gene family member 1, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG3752.2 transcript_id=mCT173435.0
FT                   protein_id=mCP96354.0 isoform=CRA_b"
FT                   /protein_id="EDL37541.1"
FT                   /translation="MVKLGNNFAEKGTKQPLLEDGFDTIPLMTPLDVNQLQFPPPDKVV
FT                   VKTKTEYEPDRKKGKARPPKIAEFTVSITEGVTERFKNTQCIPEGLESYYTEQDSSARE
FT                   KFYTVINHYNVAKQSITRSVSPWMSVLSEEKLSEQETEAAEKSA"
FT   CDS             complement(join(11919875..11920075,11925912..11926022,
FT                   11936806..11936922,11940075..11940203))
FT                   /codon_start=1
FT                   /gene="Nsg1"
FT                   /locus_tag="mCG_3752"
FT                   /product="neuron specific gene family member 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG3752.2 transcript_id=mCT2681.2
FT                   protein_id=mCP4204.2 isoform=CRA_a"
FT                   /protein_id="EDL37540.1"
FT                   /translation="MVKLGNNFAEKGTKQPLLEDGFDTIPLMTPLDVNQLQFPPPDKVV
FT                   VKTKTEYEPDRKKGKARPPKIAEFTVSITEGVTERFKVSVLVLFALAFLTCVVFLVVYK
FT                   VYKYDRACPDGFVLKNTQCIPEGLESYYTEQDSSAREKFYTVINHYNVAKQSITRSVSP
FT                   WMSVLSEEKLSEQETEAAEKSA"
FT   gene            complement(11980666..12001482)
FT                   /gene="Zfp509"
FT                   /locus_tag="mCG_3746"
FT                   /note="gene_id=mCG3746.3"
FT   mRNA            complement(join(11980666..11982382,11984565..11984726,
FT                   11984814..11984896,11986958..11987031,11991687..11991733,
FT                   11994377..11995452,11997516..11997690))
FT                   /gene="Zfp509"
FT                   /locus_tag="mCG_3746"
FT                   /product="zinc finger protein 509, transcript variant
FT                   mCT2711"
FT                   /note="gene_id=mCG3746.3 transcript_id=mCT2711.1 created on
FT                   18-FEB-2003"
FT   mRNA            complement(join(11981317..11982382,11984565..11984726,
FT                   11984814..11984896,11986958..11987031,11994377..11995452,
FT                   11997516..11997682,12001392..12001482))
FT                   /gene="Zfp509"
FT                   /locus_tag="mCG_3746"
FT                   /product="zinc finger protein 509, transcript variant
FT                   mCT180323"
FT                   /note="gene_id=mCG3746.3 transcript_id=mCT180323.0 created
FT                   on 18-FEB-2003"
FT   mRNA            complement(join(11981319..11982382,11984565..11984726,
FT                   11984814..11984896,11986958..11987031,11997516..11997682,
FT                   12001392..12001433))
FT                   /gene="Zfp509"
FT                   /locus_tag="mCG_3746"
FT                   /product="zinc finger protein 509, transcript variant
FT                   mCT173723"
FT                   /note="gene_id=mCG3746.3 transcript_id=mCT173723.0 created
FT                   on 18-FEB-2003"
FT   CDS             complement(join(11981706..11982382,11984565..11984726,
FT                   11984814..11984896,11986958..11987031,11991687..11991733,
FT                   11994377..11995452,11997516..11997667))
FT                   /codon_start=1
FT                   /gene="Zfp509"
FT                   /locus_tag="mCG_3746"
FT                   /product="zinc finger protein 509, isoform CRA_a"
FT                   /note="gene_id=mCG3746.3 transcript_id=mCT2711.1
FT                   protein_id=mCP4171.1 isoform=CRA_a"
FT                   /protein_id="EDL37542.1"
FT                   /translation="MDPVAVHSCHLLQQLREQRIQGLLCDCMLVVRGVCFKAHKNVLAA
FT                   FSQYFRSLFQNSSSQKNDVFHLDVTNVSGIGQILDFMYTSRLDLNQDNIQVMLDTAQCL
FT                   QVQNVLNLCHTFLKSAPAAQLPGLPCAGGFSLQSVALDGTCAVSEHYPPPSLQECPVEG
FT                   PQAKVPAEVNARAPSANFSRPTEVSKPDAAGGSCPELPCKQPNHYYKLRTLYSKQYYKQ
FT                   TACPSQVPATQQPLTRSASTDLAAADSQPPVEGRPAVLETPEHLPSTFVAPPVRNSGND
FT                   SEADPLSEPPAKQMRLKKAMHLKKLNFLKSQQSAECTSHPEPDNGLARREESAAKEDAV
FT                   ERAGSQTAEEKGRGELGPESSREEELPGAPASWEDPSQALQPQKQYACELCGKPFKHPS
FT                   NLELHKRSHTGEKPFECNICGKHFSQAGNLQTHLRRHSGEKPYICEICGKRFAASGDVQ
FT                   RHIIIHSGEKPHLCDTCGRGFSNFSNLKEHKKTHTADKVFTCDECGKSFNMQRKLVKHR
FT                   VRHTGERPYSCPACGKCFGGSGDLRRHVRTHTGEKPYSCEVCSKCFTRSAVLRRHKRMH
FT                   GRADARSPVVLGELSRPIEPSDLDRSQSSDSFSQDVSVTLMPVSVKLPVQPVESSVAGF
FT                   DGHCSGSYCKLRSMLRPPGMSDQDRLSLEPSKLAKPPELQSQPQAYAYSDVEPSAGVEQ
FT                   PQADGMAVSRSSLATLDNHCTEPLGSRAPSVTYRNSEGQFFSSMTLWGLAMKTLQNEHE
FT                   LEQ"
FT   CDS             complement(join(11984703..11984726,11984814..11984896,
FT                   11986958..11987031,11997516..11997667))
FT                   /codon_start=1
FT                   /gene="Zfp509"
FT                   /locus_tag="mCG_3746"
FT                   /product="zinc finger protein 509, isoform CRA_b"
FT                   /note="gene_id=mCG3746.3 transcript_id=mCT173723.0
FT                   protein_id=mCP96642.0 isoform=CRA_b"
FT                   /db_xref="GOA:D6RGL5"
FT                   /db_xref="InterPro:IPR000210"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="InterPro:IPR013069"
FT                   /db_xref="MGI:MGI:1922329"
FT                   /db_xref="UniProtKB/TrEMBL:D6RGL5"
FT                   /protein_id="EDL37543.1"
FT                   /translation="MDPVAVHSCHLLQQLREQRIQGLLCDCMLVVRGVCFKAHKNVLAA
FT                   FSQYFRQATFRLTYAGTLGRSHTSVKSVERGLRPLVTSSATSSFTLERSHTCVTRAAEG
FT                   SAISAI"
FT   CDS             complement(join(11986973..11987031,11994377..11995452,
FT                   11997516..11997667))
FT                   /codon_start=1
FT                   /gene="Zfp509"
FT                   /locus_tag="mCG_3746"
FT                   /product="zinc finger protein 509, isoform CRA_c"
FT                   /note="gene_id=mCG3746.3 transcript_id=mCT180323.0
FT                   protein_id=mCP103245.0 isoform=CRA_c"
FT                   /db_xref="GOA:D6RGS0"
FT                   /db_xref="InterPro:IPR000210"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="InterPro:IPR013069"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="MGI:MGI:1922329"
FT                   /db_xref="UniProtKB/TrEMBL:D6RGS0"
FT                   /protein_id="EDL37544.1"
FT                   /translation="MDPVAVHSCHLLQQLREQRIQGLLCDCMLVVRGVCFKAHKNVLAA
FT                   FSQYFRSLFQNSSSQKNDVFHLDVTNVSGIGQILDFMYTSRLDLNQDNIQVMLDTAQCL
FT                   QVQNVLNLCHTFLKSAPAAQLPGLPCAGGFSLQSVALDGTCAVSEHYPPPSLQECPVEG
FT                   PQAKVPAEVNARAPSANFSRPTEVSKPDAAGGSCPELPCKQPNHYYKLRTLYSKQYYKQ
FT                   TACPSQVPATQQPLTRSASTDLAAADSQPPVEGRPAVLETPEHLPSTFVAPPVRNSGND
FT                   SEADPLSEPPAKQMRLKKAMHLKKLNFLKSQQSAECTSHPEPDNGLARREESAAKEDAV
FT                   ERAGSQTAEEKGRGELGPESSREEELPGAPASWEDPSQALQPQKQYACELCGKPFKHPS
FT                   NLELHKRSHTGRQPSDSLTPALWGEAIHL"
FT   gene            12001576..12015366
FT                   /gene="Lyar"
FT                   /locus_tag="mCG_3754"
FT                   /note="gene_id=mCG3754.2"
FT   mRNA            join(12001576..12001704,12005696..12005866,
FT                   12006958..12007072,12008924..12009031,12009119..12009202,
FT                   12011630..12012059,12012342..12012428,12014311..12014396,
FT                   12015060..12015366)
FT                   /gene="Lyar"
FT                   /locus_tag="mCG_3754"
FT                   /product="Ly1 antibody reactive clone, transcript variant
FT                   mCT2671"
FT                   /note="gene_id=mCG3754.2 transcript_id=mCT2671.2 created on
FT                   18-SEP-2002"
FT   mRNA            join(12001576..12001704,12004000..12004127,
FT                   12004203..12004300,12005696..12005866,12008924..12009018)
FT                   /gene="Lyar"
FT                   /locus_tag="mCG_3754"
FT                   /product="Ly1 antibody reactive clone, transcript variant
FT                   mCT173434"
FT                   /note="gene_id=mCG3754.2 transcript_id=mCT173434.0 created
FT                   on 18-SEP-2002"
FT   CDS             join(12005745..12005866,12006958..12007072,
FT                   12008924..12009031,12009119..12009202,12011630..12012059,
FT                   12012342..12012428,12014311..12014396,12015060..12015194)
FT                   /codon_start=1
FT                   /gene="Lyar"
FT                   /locus_tag="mCG_3754"
FT                   /product="Ly1 antibody reactive clone, isoform CRA_b"
FT                   /note="gene_id=mCG3754.2 transcript_id=mCT2671.2
FT                   protein_id=mCP4206.2 isoform=CRA_b"
FT                   /protein_id="EDL37546.1"
FT                   /translation="MVFFTCNACGESVKKIQVEKHVSNCRNCECLSCIDCGKDFWGDDY
FT                   KSHVKCISEGQKYGGKGYEAKTHKGDAKQQAWIQKINELIKKPNVSPKVRELLQQISAF
FT                   DNVPRKKAKFQNWMKNSLKVHSDSVLEQVWDIFSEASSSEQDQQQPPSHTAKPHAEMPI
FT                   TKVPSAKTNGTTEEQTEAKKNKRERKEERQKNRKKEKKELKLENHQENLRGQKPKKRKK
FT                   NQEAGHEAAGEEAAEASGPPEKKKAQGGQASEEGADRNGGPGEDAAEGQTKTAAGKRKR
FT                   PKHSGAESGYKKKKMKLPEQPEEGEAKDHEAPSKGKFNWKGTIKAVLKQAPDNEISVKK
FT                   LKKKVIAQYHAVMNDHHTSEEELLAIFNRKISRNPTFKVLKDRVKLLK"
FT   CDS             join(12005745..12005866,12008924)
FT                   /codon_start=1
FT                   /gene="Lyar"
FT                   /locus_tag="mCG_3754"
FT                   /product="Ly1 antibody reactive clone, isoform CRA_a"
FT                   /note="gene_id=mCG3754.2 transcript_id=mCT173434.0
FT                   protein_id=mCP96353.0 isoform=CRA_a"
FT                   /db_xref="GOA:D6RDT2"
FT                   /db_xref="MGI:MGI:107470"
FT                   /db_xref="UniProtKB/TrEMBL:D6RDT2"
FT                   /protein_id="EDL37545.1"
FT                   /translation="MVFFTCNACGESVKKIQVEKHVSNCRNCECLSCIDCGKDF"
FT   gene            12041199..12050660
FT                   /gene="Tmem128"
FT                   /locus_tag="mCG_3756"
FT                   /note="gene_id=mCG3756.2"
FT   mRNA            join(12041199..12041554,12043059..12043200,
FT                   12045872..12046030,12048239..12048344,12050101..12050660)
FT                   /gene="Tmem128"
FT                   /locus_tag="mCG_3756"
FT                   /product="transmembrane protein 128, transcript variant
FT                   mCT2669"
FT                   /note="gene_id=mCG3756.2 transcript_id=mCT2669.2 created on
FT                   18-SEP-2002"
FT   CDS             join(12041464..12041554,12043059..12043200,
FT                   12045872..12046030,12048239..12048338)
FT                   /codon_start=1
FT                   /gene="Tmem128"
FT                   /locus_tag="mCG_3756"
FT                   /product="transmembrane protein 128, isoform CRA_c"
FT                   /note="gene_id=mCG3756.2 transcript_id=mCT2669.2
FT                   protein_id=mCP4148.2 isoform=CRA_c"
FT                   /protein_id="EDL37549.1"
FT                   /translation="MDAPWAREQLRRRYLFPSEVELDCEDEAKPETPTAVEKKERPLPR
FT                   LNIHSGFWILASIVVTYYVDFFKTFKENFHTNSWFLFGGALLFVSLSIAFYCIVYLEWY
FT                   RGIEEYDVKYPTLVPITTATFIAAGICFNLALWNVWSFFTPLLLFTQFMGVVMFISLLG
FT                   "
FT   mRNA            join(<12043058..12043200,12045872..12046030,
FT                   12048239..12048344,12048757..12048962)
FT                   /gene="Tmem128"
FT                   /locus_tag="mCG_3756"
FT                   /product="transmembrane protein 128, transcript variant
FT                   mCT173433"
FT                   /note="gene_id=mCG3756.2 transcript_id=mCT173433.0 created
FT                   on 18-SEP-2002"
FT   CDS             join(<12043058..12043200,12045872..12046030,
FT                   12048239..12048338)
FT                   /codon_start=1
FT                   /gene="Tmem128"
FT                   /locus_tag="mCG_3756"
FT                   /product="transmembrane protein 128, isoform CRA_b"
FT                   /note="gene_id=mCG3756.2 transcript_id=mCT173433.0
FT                   protein_id=mCP96352.0 isoform=CRA_b"
FT                   /protein_id="EDL37548.1"
FT                   /translation="ETPTAVEKKERPLPRLNIHSGFWILASIVVTYYVDFFKTFKENFH
FT                   TNSWFLFGGALLFVSLSIAFYCIVYLEWYRGIEEYDVKYPTLVPITTATFIAAGICFNL
FT                   ALWNVWSFFTPLLLFTQFMGVVMFISLLG"
FT   mRNA            join(<12045984..12046030,12047578..12047610,
FT                   12048239..12048344,12048757..12048952)
FT                   /gene="Tmem128"
FT                   /locus_tag="mCG_3756"
FT                   /product="transmembrane protein 128, transcript variant
FT                   mCT173432"
FT                   /note="gene_id=mCG3756.2 transcript_id=mCT173432.0 created
FT                   on 18-SEP-2002"
FT   CDS             join(<12045984..12046030,12047578..12047610,
FT                   12048239..12048338)
FT                   /codon_start=1
FT                   /gene="Tmem128"
FT                   /locus_tag="mCG_3756"
FT                   /product="transmembrane protein 128, isoform CRA_a"
FT                   /note="gene_id=mCG3756.2 transcript_id=mCT173432.0
FT                   protein_id=mCP96351.0 isoform=CRA_a"
FT                   /protein_id="EDL37547.1"
FT                   /translation="TLVPITTATFIAAGICFACSWTLATVSFNLALWNVWSFFTPLLLF
FT                   TQFMGVVMFISLLG"
FT   gene            12056979..12089115
FT                   /gene="Otop1"
FT                   /locus_tag="mCG_141235"
FT                   /note="gene_id=mCG141235.2"
FT   mRNA            join(12056979..12057110,12058568..12058858,
FT                   12068930..12069066,12075522..12075580,12082793..12082923,
FT                   12084559..12085466,12087659..12089115)
FT                   /gene="Otop1"
FT                   /locus_tag="mCG_141235"
FT                   /product="otopetrin 1, transcript variant mCT182000"
FT                   /note="gene_id=mCG141235.2 transcript_id=mCT182000.1
FT                   created on 19-JUN-2003"
FT   CDS             join(12057014..12057110,12058568..12058858,
FT                   12068930..12069066,12075522..12075580,12082793..12082923,
FT                   12084559..12085466,12087659..12087829)
FT                   /codon_start=1
FT                   /gene="Otop1"
FT                   /locus_tag="mCG_141235"
FT                   /product="otopetrin 1, isoform CRA_a"
FT                   /note="gene_id=mCG141235.2 transcript_id=mCT182000.1
FT                   protein_id=mCP104922.1 isoform=CRA_a"
FT                   /protein_id="EDL37550.1"
FT                   /translation="MLTPPETLSAFLAGGFLGCLCLLEGLGCLRIAARGSPQASGPRRG
FT                   ASVPQKLAETLSSQYGLNVFVAGLLFLLAWAVHATGVGKSDLLCVLTALMLLQLLWMLW
FT                   YVGRSYMQRRLIRPKDTHAGARWLRGSITLFAFITVVLGCLKVAYFIGFSECLSATEGV
FT                   FPVTHAVHTLLQVYFLWGHAKDIIMSFKTLERFGVIHSVFTNLLLWANSVLNESKHQLN
FT                   EHKERLITLGFGNITIVLDDHTPQCNCTPPALCSALSHGIYYLYPFNIEYQILASTMLY
FT                   VLWKNIGRRVDSSQHQKMQCRFDGVLVGSVLGLTVLAATIAVVVVYMIHIGRSKSKSES
FT                   ALIMFYLYAITVLLLMGAAGLVGSWIYRVDEKSLDESKNPARKLDVDLLVATASGSWLL
FT                   SWGSILAIACAETRPPYTWYNLPYSVLVIVEKYVQNIFIIESVHLEPEGVPEDVRTLRV
FT                   VTVCSSEAAALAASTLGSQGMAQDGSPAVNGNLCLQQRCGKEDQESGWEGATGTTRCLD
FT                   FLQGGMKRRLLRNITAFLFLCNISLWIPPAFGCRPEYDNGLEEIVFGFEPWIIVVNLAM
FT                   PFSIFYRMHAAAALFEVYCKI"
FT   mRNA            join(<12058451..12058858,12068930..12069066,
FT                   12075522..12075580,12082793..12082923,12084559..12085466,
FT                   12087659..12089115)
FT                   /gene="Otop1"
FT                   /locus_tag="mCG_141235"
FT                   /product="otopetrin 1, transcript variant mCT193575"
FT                   /note="gene_id=mCG141235.2 transcript_id=mCT193575.0
FT                   created on 09-MAR-2004"
FT   CDS             join(<12058453..12058858,12068930..12069066,
FT                   12075522..12075580,12082793..12082923,12084559..12085466,
FT                   12087659..12087829)
FT                   /codon_start=1
FT                   /gene="Otop1"
FT                   /locus_tag="mCG_141235"
FT                   /product="otopetrin 1, isoform CRA_b"
FT                   /note="gene_id=mCG141235.2 transcript_id=mCT193575.0
FT                   protein_id=mCP114524.0 isoform=CRA_b"
FT                   /protein_id="EDL37551.1"
FT                   /translation="DWKMPGGPGAPSSPAASSGSSRAAPSGIAACPLSPPPLARGSPQA
FT                   SGPRRGASVPQKLAETLSSQYGLNVFVAGLLFLLAWAVHATGVGKSDLLCVLTALMLLQ
FT                   LLWMLWYVGRSYMQRRLIRPKDTHAGARWLRGSITLFAFITVVLGCLKVAYFIGFSECL
FT                   SATEGVFPVTHAVHTLLQVYFLWGHAKDIIMSFKTLERFGVIHSVFTNLLLWANSVLNE
FT                   SKHQLNEHKERLITLGFGNITIVLDDHTPQCNCTPPALCSALSHGIYYLYPFNIEYQIL
FT                   ASTMLYVLWKNIGRRVDSSQHQKMQCRFDGVLVGSVLGLTVLAATIAVVVVYMIHIGRS
FT                   KSKSESALIMFYLYAITVLLLMGAAGLVGSWIYRVDEKSLDESKNPARKLDVDLLVATA
FT                   SGSWLLSWGSILAIACAETRPPYTWYNLPYSVLVIVEKYVQNIFIIESVHLEPEGVPED
FT                   VRTLRVVTVCSSEAAALAASTLGSQGMAQDGSPAVNGNLCLQQRCGKEDQESGWEGATG
FT                   TTRCLDFLQGGMKRRLLRNITAFLFLCNISLWIPPAFGCRPEYDNGLEEIVFGFEPWII
FT                   VVNLAMPFSIFYRMHAAAALFEVYCKI"
FT   gene            complement(12102240..12105836)
FT                   /locus_tag="mCG_1046237"
FT                   /note="gene_id=mCG1046237.1"
FT   mRNA            complement(join(12102240..12102623,12103204..12103443,
FT                   12103810..12105836))
FT                   /locus_tag="mCG_1046237"
FT                   /product="mCG1046237"
FT                   /note="gene_id=mCG1046237.1 transcript_id=mCT163941.1
FT                   created on 18-APR-2003"
FT   gene            12104303..12107454
FT                   /gene="Drd5"
FT                   /locus_tag="mCG_61530"
FT                   /note="gene_id=mCG61530.1"
FT   mRNA            12104303..12107454
FT                   /gene="Drd5"
FT                   /locus_tag="mCG_61530"
FT                   /product="dopamine receptor 5"
FT                   /note="gene_id=mCG61530.1 transcript_id=mCT61713.1 created
FT                   on 18-OCT-2002"
FT   CDS             complement(12104418..12104996)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1046237"
FT                   /product="mCG1046237"
FT                   /note="gene_id=mCG1046237.1 transcript_id=mCT163941.1
FT                   protein_id=mCP65183.1"
FT                   /protein_id="EDL37552.1"
FT                   /translation="MIHRFRMEAVEHMMSKATQMSQNAPKGQYPATSATAFQGMTSNAT
FT                   KRSETARDTMKMLVILARRWRLRTIAAHTRTLPSKVQTIKRVRRPAVTTCAGPSGAAEP
FT                   PGASTCASCLCNPSRARCAVPLRPGGSMSRWVARAHCVRSQLRPCAPRKAPSGTPEGAP
FT                   GPAADRPQTRGALTLHCLGSFNGISLARL"
FT   CDS             12104602..12106038
FT                   /codon_start=1
FT                   /gene="Drd5"
FT                   /locus_tag="mCG_61530"
FT                   /product="dopamine receptor 5"
FT                   /note="gene_id=mCG61530.1 transcript_id=mCT61713.1
FT                   protein_id=mCP27250.1"
FT                   /db_xref="GOA:B2RQS5"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000497"
FT                   /db_xref="InterPro:IPR000929"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:94927"
FT                   /db_xref="UniProtKB/TrEMBL:B2RQS5"
FT                   /protein_id="EDL37553.1"
FT                   /translation="MLPPGRNGTAHRARLGLQRQLAQVDAPGGSAAPLGPAQVVTAGLL
FT                   TLLIVWTLLGNVLVCAAIVRSRHLRAKMTNIFIVSLAVSDLFVALLVMPWKAVAEVAGY
FT                   WPFGAFCDIWVAFDIMCSTASILNLCIISVDRYWAISRPFRYERKMTQRVALVMVALAW
FT                   TLSILISFIPVQLNWHRDKAGSQGREGLLSNETPWEEGWELDGRTENCDSSLNRTYAIS
FT                   SSLISFYIPVAIMIVTYTRIYRIAQVQIRRISSLERAAEHAQSCRSRGACEPDPSLRAS
FT                   IKKETKVFKTLSVIMGVFVCCWLPFFILNCMVPFCSSGDAQGPRTGFPCVSETTFDIFV
FT                   WFGWANSSLNPIIYAFNADFRKVFAQLLGCSHLCFRTPVQTVNISNELISYNQDTVFHR
FT                   EIAAAYVHMIPNAVSSGDREVGEEEEAEEEGPFDHMSQISPTTPDGDLAAESVWELDCE
FT                   EEVSLGKISPLTPNCFHKTA"
FT   gene            <12129322..12134132
FT                   /locus_tag="mCG_146321"
FT                   /note="gene_id=mCG146321.0"
FT   mRNA            join(<12129322..12129429,12130351..12130428,
FT                   12133976..12134132)
FT                   /locus_tag="mCG_146321"
FT                   /product="mCG146321"
FT                   /note="gene_id=mCG146321.0 transcript_id=mCT186424.0
FT                   created on 14-JUL-2003"
FT   CDS             join(<12129322..12129429,12130351..12130428,
FT                   12133976..12134032)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146321"
FT                   /product="mCG146321"
FT                   /note="gene_id=mCG146321.0 transcript_id=mCT186424.0
FT                   protein_id=mCP107485.0"
FT                   /protein_id="EDL37554.1"
FT                   /translation="LPCCAQKTLCPYSHPVPLLLILFPSSMTSKPLERHVLGGSVLPLE
FT                   PVHTTGFWWRTLWIWAQDPRNSFLCGEVSAAATSM"
FT   gene            complement(12134255..12281799)
FT                   /gene="Slc2a9"
FT                   /locus_tag="mCG_122706"
FT                   /note="gene_id=mCG122706.0"
FT   mRNA            complement(join(12134255..12134849,12136142..12136272,
FT                   12147640..12147767,12164724..12164799,12166849..12166950,
FT                   12176473..12176574,12178074..12178184,12179560..12179670,
FT                   12186546..12186733,12199119..12199251,12218440..12218585,
FT                   12222550..12222674,12235035..12235195,12255042..12255140,
FT                   12257543..12257680,12260821..12260889,12281582..12281799))
FT                   /gene="Slc2a9"
FT                   /locus_tag="mCG_122706"
FT                   /product="solute carrier family 2 (facilitated glucose
FT                   transporter), member 9, transcript variant mCT123929"
FT                   /note="gene_id=mCG122706.0 transcript_id=mCT123929.0
FT                   created on 03-OCT-2002"
FT   mRNA            complement(join(12134256..12136272,12147640..12147767,
FT                   12164724..12164799,12176473..12176574,12179560..12179670,
FT                   12218440..12218585,12222550..12222674,12235035..12235195,
FT                   12255042..12255140,12260821..12260889,12281582..12281775))
FT                   /gene="Slc2a9"
FT                   /locus_tag="mCG_122706"
FT                   /product="solute carrier family 2 (facilitated glucose
FT                   transporter), member 9, transcript variant mCT173995"
FT                   /note="gene_id=mCG122706.0 transcript_id=mCT173995.0
FT                   created on 03-OCT-2002"
FT   mRNA            complement(join(12134574..12136272,12147640..12147767,
FT                   12164724..12164799,12176473..12176574,12179560..12179670,
FT                   12199119..12199251,12218440..12218585,12222550..12222674,
FT                   12235035..12235195,12255042..12255140,12257543..>12257663))
FT                   /gene="Slc2a9"
FT                   /locus_tag="mCG_122706"
FT                   /product="solute carrier family 2 (facilitated glucose
FT                   transporter), member 9, transcript variant mCT193636"
FT                   /note="gene_id=mCG122706.0 transcript_id=mCT193636.0
FT                   created on 09-MAR-2004"
FT   CDS             complement(join(12134846..12134849,12136142..12136272,
FT                   12147640..12147767,12164724..12164799,12166849..12166950,
FT                   12176473..12176574,12178074..12178184,12179560..12179670,
FT                   12186546..12186733,12199119..12199251,12218440..12218585,
FT                   12222550..12222674,12235035..12235195,12255042..12255140,
FT                   12257543..12257680,12260821..12260868))
FT                   /codon_start=1
FT                   /gene="Slc2a9"
FT                   /locus_tag="mCG_122706"
FT                   /product="solute carrier family 2 (facilitated glucose
FT                   transporter), member 9, isoform CRA_a"
FT                   /note="gene_id=mCG122706.0 transcript_id=mCT123929.0
FT                   protein_id=mCP65036.1 isoform=CRA_a"
FT                   /protein_id="EDL37555.1"
FT                   /translation="MKLSEKNSAETKESQRRCPGKSRVLEPGRKKMDSRELALASLMCD
FT                   TGGPGELSVGHQQRRTKKWSFSLVVAALVGAFGSSFLYGYNLSVVNAPTPYIKAFYNGT
FT                   WYRRHGQPIDPDTLTLLWSVTVSIFAIGGLVGTLMVKMIGKFLGRKSTLLVNNGFAISA
FT                   ALLMACSLRAGTFEMLIVGRFIMGVDGGIALSALPMYLNEISPKEIRGSLGQVTAIFIC
FT                   IGVFSGQLLGLPELLGRESTWPYLFGVIIVPALVQLASLPFLPESPRYLLFEKHDEAGA
FT                   MKAFQTFLGKADVSQELEEALAESRVQRNLRLVSVLELLRAPFVRWQVITVIITMASYQ
FT                   LCGLNAIWFYTNSIFGKAGIPQDKIPYITLSTGGIETLAAIFSIWFYTNSIFGKAGIPQ
FT                   DKIPYITLSTGGIETLAAIFSGLVIERLGRRPLLIGGFGLMALFFGTLTATLTLQGLVI
FT                   ERLGRRPLLIGGFGLMALFFGTLTATLTLQDQAPWVPYLSIVCILAIIASFCSGPGGIP
FT                   FILTGEFFQQSERPAAFMIAGTVNWLSNFAVGLLFPFIQKSLDSYCFLVFATICIAGAT
FT                   YFYFVLPETKNRTHAEISQAFAKR"
FT   CDS             complement(join(12136018..12136272,12147640..12147767,
FT                   12164724..12164799,12176473..12176574,12179560..12179670,
FT                   12218440..12218585,12222550..12222674,12235035..12235195,
FT                   12255042..12255140,12260821..12260868))
FT                   /codon_start=1
FT                   /gene="Slc2a9"
FT                   /locus_tag="mCG_122706"
FT                   /product="solute carrier family 2 (facilitated glucose
FT                   transporter), member 9, isoform CRA_b"
FT                   /note="gene_id=mCG122706.0 transcript_id=mCT173995.0
FT                   protein_id=mCP96914.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q99JJ2"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="MGI:MGI:2152844"
FT                   /db_xref="UniProtKB/TrEMBL:Q99JJ2"
FT                   /protein_id="EDL37556.1"
FT                   /translation="MKLSEKNSAETKESQRKWSFSLVVAALVGAFGSSFLYGYNLSVVN
FT                   APTPYIKAFYNGTWYRRHGQPIDPDTLTLLWSVTVSIFAIGGLVGTLMVKMIGKFLGRK
FT                   STLLVNNGFAISAALLMACSLRAGTFEMLIVGRFIMGVDGGIALSALPMYLNEISPKEI
FT                   RGSLGQVTAIFICIGVFSGQLLGLPELLGRIWFYTNSIFGKAGIPQDKIPYITLSTGGI
FT                   ETLAAIFSGLVIERLGRRPLLIGGFGLMALFFGTLTATLTLQDQAPWVPYLSIVCILAI
FT                   IASFCSGPGGIPFILTGEFFQQSERPAAFMIAGTVNWLSNFAVGLLFPFIQKSLDSYCF
FT                   LVFATICIAGATYFYFVLPETKNRTHAEISQAFAKRNKAQPPEVKADSAMTEEKANSQT
FT                   EPDSSSTLDSYGQNKIV"
FT   CDS             complement(join(12179582..12179670,12199119..12199251,
FT                   12218440..12218585,12222550..12222674,12235035..12235195,
FT                   12255042..12255140,12257543..>12257662))
FT                   /codon_start=1
FT                   /gene="Slc2a9"
FT                   /locus_tag="mCG_122706"
FT                   /product="solute carrier family 2 (facilitated glucose
FT                   transporter), member 9, isoform CRA_c"
FT                   /note="gene_id=mCG122706.0 transcript_id=mCT193636.0
FT                   protein_id=mCP114611.0 isoform=CRA_c"
FT                   /protein_id="EDL37557.1"
FT                   /translation="RVLEPGRKKMDSRELALASLMCDTGGPGELSVGHQQRRTKKWSFS
FT                   LVVAALVGAFGSSFLYGYNLSVVNAPTPYIKAFYNGTWYRRHGQPIDPDTLTLLWSVTV
FT                   SIFAIGGLVGTLMVKMIGKFLGRKSTLLVNNGFAISAALLMACSLRAGTFEMLIVGRFI
FT                   MGVDGGIALSALPMYLNEISPKEIRGSLGQVTAIFICIGVFSGQLLGLPELLGRESTWP
FT                   YLFGVIIVPALVQLASLPFLPESPRYLLFEKHDEAGAMKDLVLHQQHLWESWDPSGQDP
FT                   IHHPEHGRN"
FT   gene            complement(12306832..12341790)
FT                   /gene="Wdr1"
FT                   /locus_tag="mCG_3745"
FT                   /note="gene_id=mCG3745.2"
FT   mRNA            complement(join(12306832..12307930,12309543..12309687,
FT                   12309955..12310128,12311033..12311143,12313502..12313589,
FT                   12315202..12315356,12317155..12317244,12320031..12320264,
FT                   12320522..12320602,12320819..12320896,12325692..12325872,
FT                   12326962..12327109,12331395..12331485,12341098..12341219,
FT                   12341534..12341790))
FT                   /gene="Wdr1"
FT                   /locus_tag="mCG_3745"
FT                   /product="WD repeat domain 1, transcript variant mCT2716"
FT                   /note="gene_id=mCG3745.2 transcript_id=mCT2716.2 created on
FT                   24-DEC-2002"
FT   CDS             complement(join(12307824..12307930,12309543..12309687,
FT                   12309955..12310128,12311033..12311143,12313502..12313589,
FT                   12315202..12315356,12317155..12317244,12320031..12320264,
FT                   12320522..12320602,12320819..12320896,12325692..12325872,
FT                   12326962..12327109,12331395..12331485,12341098..12341219,
FT                   12341534..12341549))
FT                   /codon_start=1
FT                   /gene="Wdr1"
FT                   /locus_tag="mCG_3745"
FT                   /product="WD repeat domain 1, isoform CRA_b"
FT                   /note="gene_id=mCG3745.2 transcript_id=mCT2716.2
FT                   protein_id=mCP4154.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q3TJY2"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011045"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="MGI:MGI:1337100"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TJY2"
FT                   /protein_id="EDL37559.1"
FT                   /translation="MPYEIKKVFASLPQVERGVSKILGGDPKGDHFLYTNGKCVILRNI
FT                   DNPAIADIYTEHAHQVVVAKYAPSGFYIASGDISGKLRIWDTTQKEHLLKYEYQPFAGK
FT                   IKDIAWTEDSKRIAVVGEGREKFGAVFLWDTGSSVGEITGHNKVINSVDIKQTRPYRLA
FT                   TGSDDNCAAFFEGPPFKFKFTIGDHSRFVNCVRFSPDGNRFATASADGQIFIYDGKTGE
FT                   KVCALGESKAHDGGIYAISWSPDSTHLLSASGDKTSKIWDVNVNSVVSTFPMGSNVLDQ
FT                   QLGCLWQKDHLLSISLSGYINYLDKNNPSKPLRVIKGHSKSIQCLTVHRNGGKSYIYSG
FT                   SHDGHINYWDSETGENDSFSGKGHTNQVSRMTVNESEQLVSCSMDDTVRYTNLTLRDYS
FT                   GQGVVKLDVQPKCVAVGPGGYTVVVCIGQIVLLKDQKKCFSIDNPGYEPEVVAVHPGGD
FT                   TVAVGGTDGNVRVYSILASTLKDEGKLLEAKGPVTDVAYSHDGAFLAVCDASKVVTVFS
FT                   VADGYSENNVFYGHHAKIVCLAWSPDNEHFASGGMDMMVYVWTLSDPETKVKIQDAHRL
FT                   HHVSSLAWLDEHTLVTTSHDASVKEWTITY"
FT   mRNA            complement(join(<12320206..12320264,12320522..12320602,
FT                   12320819..12320896,12325692..12325826,12341098..12341219,
FT                   12341534..12341620))
FT                   /gene="Wdr1"
FT                   /locus_tag="mCG_3745"
FT                   /product="WD repeat domain 1, transcript variant mCT173436"
FT                   /note="gene_id=mCG3745.2 transcript_id=mCT173436.0 created
FT                   on 24-DEC-2002"
FT   CDS             complement(join(<12320206..12320264,12320522..12320602,
FT                   12320819..12320896,12325692..12325826,12341098..12341219,
FT                   12341534..12341549))
FT                   /codon_start=1
FT                   /gene="Wdr1"
FT                   /locus_tag="mCG_3745"
FT                   /product="WD repeat domain 1, isoform CRA_a"
FT                   /note="gene_id=mCG3745.2 transcript_id=mCT173436.0
FT                   protein_id=mCP96355.0 isoform=CRA_a"
FT                   /protein_id="EDL37558.1"
FT                   /translation="MPYEIKKVFASLPQVERGVSKILGGDPKGDHFLYTNGKCVILRNI
FT                   DITGHNKVINSVDIKQTRPYRLATGSDDNCAAFFEGPPFKFKFTIGDHSRFVNCVRFSP
FT                   DGNRFATASADGQIFIYDGKTGEKVCALGESKAHDGGIYAISWSPDSTHLLSASGDKTS
FT                   "
FT   gene            complement(12354874..12355795)
FT                   /pseudo
FT                   /locus_tag="mCG_1046062"
FT                   /note="gene_id=mCG1046062.1"
FT   mRNA            complement(12354874..12355795)
FT                   /pseudo
FT                   /locus_tag="mCG_1046062"
FT                   /note="gene_id=mCG1046062.1 transcript_id=mCT163766.1
FT                   created on 16-OCT-2002"
FT   gene            complement(12461016..12477277)
FT                   /locus_tag="mCG_141317"
FT                   /note="gene_id=mCG141317.1"
FT   mRNA            complement(join(12461016..12467384,12475005..12475302,
FT                   12477199..12477277))
FT                   /locus_tag="mCG_141317"
FT                   /product="mCG141317"
FT                   /note="gene_id=mCG141317.1 transcript_id=mCT174536.1
FT                   created on 19-FEB-2003"
FT   CDS             complement(12463943..12467191)
FT                   /codon_start=1
FT                   /locus_tag="mCG_141317"
FT                   /product="mCG141317"
FT                   /note="gene_id=mCG141317.1 transcript_id=mCT174536.1
FT                   protein_id=mCP97455.1"
FT                   /db_xref="GOA:J3QPN0"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="InterPro:IPR027775"
FT                   /db_xref="InterPro:IPR028379"
FT                   /db_xref="MGI:MGI:2140750"
FT                   /db_xref="UniProtKB/TrEMBL:J3QPN0"
FT                   /protein_id="EDL37560.1"
FT                   /translation="MQIREMKDIGEQLYTTQVNGGPSSLTMSPKQPNRATRTERQEAQT
FT                   LLYQGSEAEAATMTIATCVQCKSVHKIPTQDLRKGPGQSQDTYVCFKCSLRAVPTQLHF
FT                   VNNNAGAAHVRNETETISSPVNKFKVRNFKPGKYYCDKCRFSTKDPLQYRKHTLQHEEI
FT                   RFICSHCSYISYTKGEFQRHLVKHTGIFPYRCEYCDYGAIRNDYIVKHRRRVHERAGAK
FT                   RPFKTVAKLEPKRTSIPKQSMELSKGPSPRAAFQNKLSDQLSRFSLHANKDKTHNLMLL
FT                   PELKKYQKDVVCIPNKVTLSEPREVSLLGNKNVEVEVLSPSKEPVHPGMPLTVMAPSEL
FT                   VVPTNCLAQLMDVKVVNGAQQLVLKLFPLEENARLETSRGDGGTSECLSTEKGSGGQKK
FT                   MLSPEASRSLAVEGNAGDFVGLDRLHSLVQKQLKNVKWVKSCNFFMPNSGVHSQQESFL
FT                   GSDTIKELQKSHSLCPPRALPSAAIKSHSPASVQNSVPYGPGATVSHFLSKAAVAFADD
FT                   RRGARSNSQQLLPLASLPSKVPFSGEKGLLPIGESDLEARNRISRPETLVSSDRKLEDK
FT                   QMESKAVGNTGQVSSVQNKEYLHINITGEDKPRSQQPGDQPGQPKTSETAGATFEGPII
FT                   SSVFSLSSGSENVPEAIKWNSSTTKIKSIELLRRKIAQLIESCGKPSSLSANSAQRRSI
FT                   GQAPKLTSKATPKAIQEMSVSLTGPGPTPGPSVGPLQKPPNEDSITGSRQLVPQQVCPQ
FT                   FISANDGKMENRVTRKTPVATPVLIPKGAVLRVLNSSEDAHIIEATCDTPVSIPCSEAQ
FT                   LAGTLPFCPMKQTGSGSQPLTCRSGPADMSPGLETSLRPKSRKEDTICSATAKKMVPVY
FT                   STAPGSSDSIRQGRPVSRNLTVSKNKTKQVNSTKKKNKMQANPGRYFKDPPSFFQVARQ
FT                   LRLIAAKPDQLIKCPRRNQPVIVLNHPDVDSPEVTNVMKVINKYKGNVLKVVLSERTRC
FT                   QLGVRRYHMRLTYQNVAETNHMKRQMMLKMKLKKVHKNNYQVVGSMPDDPAQCVFKCWF
FT                   CGRLYEDQEEWMSHGQRHLIEATRDWDVLSSKGK"
FT   gene            complement(12503875..>12672342)
FT                   /gene="Clnk"
FT                   /locus_tag="mCG_122703"
FT                   /note="gene_id=mCG122703.1"
FT   mRNA            complement(join(12503875..12504187,12510648..12510803,
FT                   12512516..12512593,12518475..12518602,12533624..12533664,
FT                   12536899..12536980,12539932..12539950,12542932..12542959,
FT                   12550890..12551003,12552411..12552430,12553262..12553287,
FT                   12564949..12564994,12568645..12568754,12570435..12570576,
FT                   12575150..12575187,12585129..12585157,12595521..12595592,
FT                   12657551..12657603,12672132..>12672223))
FT                   /gene="Clnk"
FT                   /locus_tag="mCG_122703"
FT                   /product="cytokine-dependent hematopoietic cell linker,
FT                   transcript variant mCT179718"
FT                   /note="gene_id=mCG122703.1 transcript_id=mCT179718.0
FT                   created on 07-FEB-2003"
FT   mRNA            complement(join(12503875..12504187,12510648..12510803,
FT                   12512516..12512593,12518475..12518602,12533624..12533664,
FT                   12536899..12536980,12539932..12539950,12542932..12542959,
FT                   12550890..12551003,12552411..12552430,12553262..12553287,
FT                   12564949..12564994,12568645..12568754,12570435..12570576,
FT                   12575150..12575187,12585129..12585157,12595521..12595592,
FT                   12672131..>12672223))
FT                   /gene="Clnk"
FT                   /locus_tag="mCG_122703"
FT                   /product="cytokine-dependent hematopoietic cell linker,
FT                   transcript variant mCT123926"
FT                   /note="gene_id=mCG122703.1 transcript_id=mCT123926.0
FT                   created on 07-FEB-2003"
FT   mRNA            complement(join(12503880..12504187,12510648..12510803,
FT                   12512516..12512593,12518475..12518602,12533624..12533664,
FT                   12536899..12536980,12542917..12542959,12550890..12551003,
FT                   12552411..12552430,12553262..12553287,12564949..12564994,
FT                   12568645..12568754,12570435..12570576,12575150..12575187,
FT                   12585129..12585157,12595521..12595592,12657551..12657603,
FT                   12672132..>12672342))
FT                   /gene="Clnk"
FT                   /locus_tag="mCG_122703"
FT                   /product="cytokine-dependent hematopoietic cell linker,
FT                   transcript variant mCT173397"
FT                   /note="gene_id=mCG122703.1 transcript_id=mCT173397.0
FT                   created on 07-FEB-2003"
FT   CDS             complement(join(12504020..12504187,12510648..12510803,
FT                   12512516..12512593,12518475..12518602,12533624..12533664,
FT                   12536899..12536980,12539932..12539950,12542932..12542959,
FT                   12550890..12551003,12552411..12552430,12553262..12553287,
FT                   12564949..12564994,12568645..12568754,12570435..12570576,
FT                   12575150..12575187,12585129..12585157,12595521..>12595591))
FT                   /codon_start=1
FT                   /gene="Clnk"
FT                   /locus_tag="mCG_122703"
FT                   /product="cytokine-dependent hematopoietic cell linker,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG122703.1 transcript_id=mCT123926.0
FT                   protein_id=mCP64953.1 isoform=CRA_a"
FT                   /protein_id="EDL37561.1"
FT                   /translation="GNKRTTKEGFGDLRFQNVSLLKNRSWPSLSSAKGRCRAVLEPLPD
FT                   HRRNLAGVPGGEKCNSNNDYEDPEFQLLKAWPSMKILPARPIQESEYADTRYFQDTMEA
FT                   PLLLPPKASVSTERQTRDVRMTHLEEVDKPTFKDVRSQRFKGFKYTKINKTPLPPPRPA
FT                   ITLPKKYQPLPPAPPEESSAYFAPKPTFPEVQRGPRQRSAKDFSRVLGAEEESHHQTKP
FT                   ESSCPSSNQNTQKSPPAIASSSYMPGKHSIQARDHTGSMQHCPAQRCQAAASHSPRMLP
FT                   YENTNSEKPDPTKPDEKDVWQNEWYIGEYSRQAVEDVLMKENKDGTFLVRDCSTKSKAE
FT                   PYVLVVFYGNKVYNVKIRFLESNQQFALGTGLRGNEMFDSVEDIIEHYTYFPILLIDGK
FT                   DKAARRKQCYLTQPLPLARLLLTQYSSQALHE"
FT   CDS             complement(join(12504020..12504187,12510648..12510803,
FT                   12512516..12512593,12518475..12518602,12533624..12533664,
FT                   12536899..12536980,12539932..12539950,12542932..12542959,
FT                   12550890..12551003,12552411..12552430,12553262..12553287,
FT                   12564949..12564994,12568645..12568754,12570435..12570576,
FT                   12575150..12575187,12585129..12585157,12595521..>12595591))
FT                   /codon_start=1
FT                   /gene="Clnk"
FT                   /locus_tag="mCG_122703"
FT                   /product="cytokine-dependent hematopoietic cell linker,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG122703.1 transcript_id=mCT179718.0
FT                   protein_id=mCP102640.0 isoform=CRA_a"
FT                   /protein_id="EDL37563.1"
FT                   /translation="GNKRTTKEGFGDLRFQNVSLLKNRSWPSLSSAKGRCRAVLEPLPD
FT                   HRRNLAGVPGGEKCNSNNDYEDPEFQLLKAWPSMKILPARPIQESEYADTRYFQDTMEA
FT                   PLLLPPKASVSTERQTRDVRMTHLEEVDKPTFKDVRSQRFKGFKYTKINKTPLPPPRPA
FT                   ITLPKKYQPLPPAPPEESSAYFAPKPTFPEVQRGPRQRSAKDFSRVLGAEEESHHQTKP
FT                   ESSCPSSNQNTQKSPPAIASSSYMPGKHSIQARDHTGSMQHCPAQRCQAAASHSPRMLP
FT                   YENTNSEKPDPTKPDEKDVWQNEWYIGEYSRQAVEDVLMKENKDGTFLVRDCSTKSKAE
FT                   PYVLVVFYGNKVYNVKIRFLESNQQFALGTGLRGNEMFDSVEDIIEHYTYFPILLIDGK
FT                   DKAARRKQCYLTQPLPLARLLLTQYSSQALHE"
FT   CDS             complement(join(12512530..12512593,12518475..12518602,
FT                   12533624..12533664,12536899..12536980,12542917..12542959,
FT                   12550890..12551003,12552411..12552430,12553262..12553287,
FT                   12564949..12564994,12568645..12568754,12570435..12570576,
FT                   12575150..12575187,12585129..12585157,12595521..>12595591))
FT                   /codon_start=1
FT                   /gene="Clnk"
FT                   /locus_tag="mCG_122703"
FT                   /product="cytokine-dependent hematopoietic cell linker,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG122703.1 transcript_id=mCT173397.0
FT                   protein_id=mCP96316.0 isoform=CRA_b"
FT                   /protein_id="EDL37562.1"
FT                   /translation="GNKRTTKEGFGDLRFQNVSLLKNRSWPSLSSAKGRCRAVLEPLPD
FT                   HRRNLAGVPGGEKCNSNNDYEDPEFQLLKAWPSMKILPARPIQESEYADTRYFQDTMEA
FT                   PLLLPPKASVSTERQTRDVRMTHLEEVDKPTFKDVRSQRFKGFKYTKINKTPLPPPRPA
FT                   ITLPKKYQPLPPAPPEESSAYFAPKPTFPEVQRGPRQRSAKDFSRVSSYFNLTTRQSQN
FT                   LLAHHQTKTHRRVHLPLPALPTCQESTVYKPETIQVACSTVLLRDAKLQPATALECCPM
FT                   KTQTRRNLTPQSLMRRMSGRMNGTLENTVARQWKMC"
FT   gene            <12536604..12548481
FT                   /locus_tag="mCG_14725"
FT                   /note="gene_id=mCG14725.1"
FT   mRNA            join(<12536604..12536650,12542376..12542570,
FT                   12544726..12544806,12548361..12548481)
FT                   /locus_tag="mCG_14725"
FT                   /product="mCG14725, transcript variant mCT19622"
FT                   /note="gene_id=mCG14725.1 transcript_id=mCT19622.2 created
FT                   on 18-FEB-2003"
FT   mRNA            join(<12536605..12536650,12542376..12542566,
FT                   12544726..12544806,12548361..12548481)
FT                   /locus_tag="mCG_14725"
FT                   /product="mCG14725, transcript variant mCT180278"
FT                   /note="gene_id=mCG14725.1 transcript_id=mCT180278.0 created
FT                   on 18-FEB-2003"
FT   CDS             join(<12536618..12536650,12542376..12542570,
FT                   12544726..12544806,12548361..12548432)
FT                   /codon_start=1
FT                   /locus_tag="mCG_14725"
FT                   /product="mCG14725, isoform CRA_a"
FT                   /note="gene_id=mCG14725.1 transcript_id=mCT19622.2
FT                   protein_id=mCP4192.2 isoform=CRA_a"
FT                   /protein_id="EDL37564.1"
FT                   /translation="EQLEMTHFFCKAESQLKGADQDDGISWHGPLFCQLGRSDSGFLPR
FT                   LSLLRAMSRPHGIQSALTWKIGIPPELESRQNGSKGIHPDGLLEEEHETEVRICGMQWK
FT                   GFYPDSKCDLKQLVLELFMVGM"
FT   CDS             join(<12536618..12536650,12542376..12542566,
FT                   12544726..12544806,12548361..12548394)
FT                   /codon_start=1
FT                   /locus_tag="mCG_14725"
FT                   /product="mCG14725, isoform CRA_b"
FT                   /note="gene_id=mCG14725.1 transcript_id=mCT180278.0
FT                   protein_id=mCP103200.0 isoform=CRA_b"
FT                   /protein_id="EDL37565.1"
FT                   /translation="EQLEMTHFFCKAESQLKGADQDDGISWHGPLFCQLGRSDSGFLPR
FT                   LSLLRAMSRPHGIQSALTWKIGIPPELESRMAARAFTLTGYWKKSMRQKCESVACNGKD
FT                   FIQIQSVI"
FT   gene            complement(12767715..>12768558)
FT                   /locus_tag="mCG_1046239"
FT                   /note="gene_id=mCG1046239.1"
FT   mRNA            complement(join(12767715..12768128,12768175..>12768558))
FT                   /locus_tag="mCG_1046239"
FT                   /product="mCG1046239"
FT                   /note="gene_id=mCG1046239.1 transcript_id=mCT163943.1
FT                   created on 15-OCT-2002"
FT   CDS             complement(12767807..>12768073)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1046239"
FT                   /product="mCG1046239"
FT                   /note="gene_id=mCG1046239.1 transcript_id=mCT163943.1
FT                   protein_id=mCP65208.0"
FT                   /protein_id="EDL37566.1"
FT                   /translation="QPLGADNTEEQGSQGAPRITALQACRCKANETVSEPQSCKSLWWL
FT                   LTPAPGVSVCFSASLEPPDRPYNCFSLMRAAFPSKRPDLVISP"
FT   gene            <13101893..13108058
FT                   /locus_tag="mCG_145580"
FT                   /note="gene_id=mCG145580.0"
FT   mRNA            join(<13101893..13101977,13105277..13105408,
FT                   13107731..13108058)
FT                   /locus_tag="mCG_145580"
FT                   /product="mCG145580"
FT                   /note="gene_id=mCG145580.0 transcript_id=mCT185004.0
FT                   created on 05-JUN-2003"
FT   CDS             <13107816..13108034
FT                   /codon_start=1
FT                   /locus_tag="mCG_145580"
FT                   /product="mCG145580"
FT                   /note="gene_id=mCG145580.0 transcript_id=mCT185004.0
FT                   protein_id=mCP105605.0"
FT                   /protein_id="EDL37567.1"
FT                   /translation="EDMWMTAKWMERCWTPFAPGIDRLNHHGICEVSANVFQPNDDSKC
FT                   CQTYGEPGTSDILPRRKSGVTILDIIC"
FT   gene            complement(13132126..13132542)
FT                   /pseudo
FT                   /locus_tag="mCG_1046124"
FT                   /note="gene_id=mCG1046124.1"
FT   mRNA            complement(13132126..13132542)
FT                   /pseudo
FT                   /locus_tag="mCG_1046124"
FT                   /note="gene_id=mCG1046124.1 transcript_id=mCT163828.1
FT                   created on 11-OCT-2002"
FT   gene            complement(13195588..13196795)
FT                   /pseudo
FT                   /locus_tag="mCG_14721"
FT                   /note="gene_id=mCG14721.1"
FT   mRNA            complement(13195588..13196795)
FT                   /pseudo
FT                   /locus_tag="mCG_14721"
FT                   /note="gene_id=mCG14721.1 transcript_id=mCT19620.2 created
FT                   on 03-OCT-2002"
FT   gene            complement(13256912..>13397976)
FT                   /locus_tag="mCG_146111"
FT                   /note="gene_id=mCG146111.0"
FT   mRNA            complement(join(13256912..13257220,13271347..13271478,
FT                   13299094..13299270,13329104..13329210,13397885..>13397976))
FT                   /locus_tag="mCG_146111"
FT                   /product="mCG146111"
FT                   /note="gene_id=mCG146111.0 transcript_id=mCT186214.0
FT                   created on 14-JUL-2003"
FT   CDS             complement(join(13329105..13329210,13397885..>13397976))
FT                   /codon_start=1
FT                   /locus_tag="mCG_146111"
FT                   /product="mCG146111"
FT                   /note="gene_id=mCG146111.0 transcript_id=mCT186214.0
FT                   protein_id=mCP107476.0"
FT                   /protein_id="EDL37568.1"
FT                   /translation="HRGNRWRGLEQWLRTHILNHKWEAERISSKWNFEHLSDALVINPF
FT                   PPWKRWSLLIYAWTVKFFSS"
FT   gene            complement(13408243..13439591)
FT                   /locus_tag="mCG_14724"
FT                   /note="gene_id=mCG14724.3"
FT   mRNA            complement(join(13408243..13409790,13439454..13439591))
FT                   /locus_tag="mCG_14724"
FT                   /product="mCG14724, transcript variant mCT180280"
FT                   /note="gene_id=mCG14724.3 transcript_id=mCT180280.0 created
FT                   on 13-FEB-2003"
FT   mRNA            complement(join(13408321..13409790,13438552..13438931))
FT                   /locus_tag="mCG_14724"
FT                   /product="mCG14724, transcript variant mCT19624"
FT                   /note="gene_id=mCG14724.3 transcript_id=mCT19624.2 created
FT                   on 13-FEB-2003"
FT   mRNA            complement(join(13408552..13409790,13438751..13438931))
FT                   /locus_tag="mCG_14724"
FT                   /product="mCG14724, transcript variant mCT180279"
FT                   /note="gene_id=mCG14724.3 transcript_id=mCT180279.0 created
FT                   on 13-FEB-2003"
FT   CDS             complement(13408749..13409684)
FT                   /codon_start=1
FT                   /locus_tag="mCG_14724"
FT                   /product="mCG14724, isoform CRA_a"
FT                   /note="gene_id=mCG14724.3 transcript_id=mCT180279.0
FT                   protein_id=mCP103201.0 isoform=CRA_a"
FT                   /protein_id="EDL37569.1"
FT                   /translation="MTLLLLGAVLLVAQPQLVHSHPAAPGPGLKQQELLRKVIILPEDT
FT                   GEGTASNGSTQQLPQTIIIGVRKGGTRALLEMLSLHPDVAAAENEVHFFDWEEHYSQGL
FT                   GWYLTQMPFSSPHQLTVEKTPAYFTSPKVPERIHSMNPTIRLLLILRDPSERVLSDYTQ
FT                   VLYNHLQKHKPYPPIEDLLMRDGRLNLDYKALNRSLYHAHMLNWLRFFPLGHIHIVDGD
FT                   RLIRDPFPEIQKVERFLKLSPQINASNFYFNKTKGFYCLRDSGKDRCLHESKGRAHPQV
FT                   DPKLLDKLHEYFHEPNKKFFKLVGRTFDWH"
FT   CDS             complement(13408749..13409684)
FT                   /codon_start=1
FT                   /locus_tag="mCG_14724"
FT                   /product="mCG14724, isoform CRA_a"
FT                   /note="gene_id=mCG14724.3 transcript_id=mCT180280.0
FT                   protein_id=mCP103202.0 isoform=CRA_a"
FT                   /protein_id="EDL37570.1"
FT                   /translation="MTLLLLGAVLLVAQPQLVHSHPAAPGPGLKQQELLRKVIILPEDT
FT                   GEGTASNGSTQQLPQTIIIGVRKGGTRALLEMLSLHPDVAAAENEVHFFDWEEHYSQGL
FT                   GWYLTQMPFSSPHQLTVEKTPAYFTSPKVPERIHSMNPTIRLLLILRDPSERVLSDYTQ
FT                   VLYNHLQKHKPYPPIEDLLMRDGRLNLDYKALNRSLYHAHMLNWLRFFPLGHIHIVDGD
FT                   RLIRDPFPEIQKVERFLKLSPQINASNFYFNKTKGFYCLRDSGKDRCLHESKGRAHPQV
FT                   DPKLLDKLHEYFHEPNKKFFKLVGRTFDWH"
FT   CDS             complement(13408749..13409684)
FT                   /codon_start=1
FT                   /locus_tag="mCG_14724"
FT                   /product="mCG14724, isoform CRA_a"
FT                   /note="gene_id=mCG14724.3 transcript_id=mCT19624.2
FT                   protein_id=mCP4191.1 isoform=CRA_a"
FT                   /protein_id="EDL37571.1"
FT                   /translation="MTLLLLGAVLLVAQPQLVHSHPAAPGPGLKQQELLRKVIILPEDT
FT                   GEGTASNGSTQQLPQTIIIGVRKGGTRALLEMLSLHPDVAAAENEVHFFDWEEHYSQGL
FT                   GWYLTQMPFSSPHQLTVEKTPAYFTSPKVPERIHSMNPTIRLLLILRDPSERVLSDYTQ
FT                   VLYNHLQKHKPYPPIEDLLMRDGRLNLDYKALNRSLYHAHMLNWLRFFPLGHIHIVDGD
FT                   RLIRDPFPEIQKVERFLKLSPQINASNFYFNKTKGFYCLRDSGKDRCLHESKGRAHPQV
FT                   DPKLLDKLHEYFHEPNKKFFKLVGRTFDWH"
FT   gene            14118258..14119536
FT                   /pseudo
FT                   /locus_tag="mCG_5166"
FT                   /note="gene_id=mCG5166.2"
FT   mRNA            14118258..14119536
FT                   /pseudo
FT                   /locus_tag="mCG_5166"
FT                   /note="gene_id=mCG5166.2 transcript_id=mCT4685.2 created on
FT                   26-SEP-2002"
FT   gene            <15130752..15131661
FT                   /locus_tag="mCG_22728"
FT                   /note="gene_id=mCG22728.2"
FT   mRNA            <15130752..15131661
FT                   /locus_tag="mCG_22728"
FT                   /product="mCG22728"
FT                   /note="gene_id=mCG22728.2 transcript_id=mCT22182.2 created
FT                   on 03-OCT-2002"
FT   CDS             <15131046..15131588
FT                   /codon_start=1
FT                   /locus_tag="mCG_22728"
FT                   /product="mCG22728"
FT                   /note="gene_id=mCG22728.2 transcript_id=mCT22182.2
FT                   protein_id=mCP4150.1"
FT                   /protein_id="EDL37572.1"
FT                   /translation="DQMARMAREAGSFYVPEEPKLAFVIRIRGINGVSPKVRKVLQLLR
FT                   LRQIFNGTFAKLNKASINMLRIVEPYIAWGYPNLKSVNEFIYKRGYGKINKKPIALTDN
FT                   SLIARSLGKFGIICMEDLIHEIYTVGKRFKEANNFLWPFKLSSPRGGMKKKTTHVVEGG
FT                   DTGMREDQINRLIRRMN"
FT   gene            complement(15205529..15206069)
FT                   /pseudo
FT                   /locus_tag="mCG_1046127"
FT                   /note="gene_id=mCG1046127.1"
FT   mRNA            complement(15205529..15206069)
FT                   /pseudo
FT                   /locus_tag="mCG_1046127"
FT                   /note="gene_id=mCG1046127.1 transcript_id=mCT163831.1
FT                   created on 04-OCT-2002"
FT   gene            complement(15410903..15497055)
FT                   /gene="Rab28"
FT                   /locus_tag="mCG_22723"
FT                   /note="gene_id=mCG22723.1"
FT   mRNA            complement(join(15410903..15411405,15419100..15419177,
FT                   15421778..15421881,15476584..15476713,15487253..15487341,
FT                   15492292..15492388,15496759..15496886,15497029..15497055))
FT                   /gene="Rab28"
FT                   /locus_tag="mCG_22723"
FT                   /product="RAB28, member RAS oncogene family, transcript
FT                   variant mCT22177"
FT                   /note="gene_id=mCG22723.1 transcript_id=mCT22177.2 created
FT                   on 13-FEB-2003"
FT   mRNA            complement(join(15410904..15411016,15419100..15419177,
FT                   15421778..15421881,15476584..15476713,15487253..15487341,
FT                   15492292..15492388,15496759..15496911))
FT                   /gene="Rab28"
FT                   /locus_tag="mCG_22723"
FT                   /product="RAB28, member RAS oncogene family, transcript
FT                   variant mCT180283"
FT                   /note="gene_id=mCG22723.1 transcript_id=mCT180283.0 created
FT                   on 13-FEB-2003"
FT   mRNA            complement(join(15410954..15411077,15419100..15419177,
FT                   15421778..15421881,15476584..15476713,15487253..15487341,
FT                   15492292..>15492309))
FT                   /gene="Rab28"
FT                   /locus_tag="mCG_22723"
FT                   /product="RAB28, member RAS oncogene family, transcript
FT                   variant mCT180284"
FT                   /note="gene_id=mCG22723.1 transcript_id=mCT180284.0 created
FT                   on 13-FEB-2003"
FT   CDS             complement(join(15410985..15411077,15419100..15419177,
FT                   15421778..15421881,15476584..15476713,15487253..15487341,
FT                   15492292..>15492307))
FT                   /codon_start=1
FT                   /gene="Rab28"
FT                   /locus_tag="mCG_22723"
FT                   /product="RAB28, member RAS oncogene family, isoform CRA_d"
FT                   /note="gene_id=mCG22723.1 transcript_id=mCT180284.0
FT                   protein_id=mCP103206.0 isoform=CRA_d"
FT                   /protein_id="EDL37576.1"
FT                   /translation="RITLPGNLNVTLQVWDIGGQTIGGKMLDKYIYGAQGILLVYDITN
FT                   YQSFENLEDWYSVVKTVSEESETQPLVALVGNKIDLEHMRTVKADKHLRFCQENGFSSH
FT                   FVSAKTGDSVFLCFQKVAAEILGIKLNKAEIEQSQMALWILINGSADPPHGISPTDCMR
FT                   VLPDES"
FT   CDS             complement(join(15411008..15411016,15419100..15419177,
FT                   15421778..15421881,15476584..15476713,15487253..15487341,
FT                   15492292..15492388,15496759..15496833))
FT                   /codon_start=1
FT                   /gene="Rab28"
FT                   /locus_tag="mCG_22723"
FT                   /product="RAB28, member RAS oncogene family, isoform CRA_c"
FT                   /note="gene_id=mCG22723.1 transcript_id=mCT180283.0
FT                   protein_id=mCP103205.0 isoform=CRA_c"
FT                   /db_xref="GOA:Q9CZQ8"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1917285"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CZQ8"
FT                   /protein_id="EDL37575.1"
FT                   /translation="MSDSEEESQDRQLKIVVLGDGTSGKTSLATCFAQETFGKQYKQTI
FT                   GLDFFLRRITLPGNLNVTLQVWDIGGQTIGGKMLDKYIYGAQGILLVYDITNYQSFENL
FT                   EDWYSVVKTVSEESETQPLVALVGNKIDLEHMRTVKADKHLRFCQENGFSSHFVSAKTG
FT                   DSVFLCFQKVAAEILGIKLNKAEIEQSQTV"
FT   CDS             complement(join(15411400..15411405,15419100..15419177,
FT                   15421778..15421881,15476584..15476713,15487253..15487341,
FT                   15492292..15492388,15496759..15496833))
FT                   /codon_start=1
FT                   /gene="Rab28"
FT                   /locus_tag="mCG_22723"
FT                   /product="RAB28, member RAS oncogene family, isoform CRA_e"
FT                   /note="gene_id=mCG22723.1 transcript_id=mCT22177.2
FT                   protein_id=mCP4172.2 isoform=CRA_e"
FT                   /protein_id="EDL37577.1"
FT                   /translation="MSDSEEESQDRQLKIVVLGDGTSGKTSLATCFAQETFGKQYKQTI
FT                   GLDFFLRRITLPGNLNVTLQVWDIGGQTIGGKMLDKYIYGAQGILLVYDITNYQSFENL
FT                   EDWYSVVKTVSEESETQPLVALVGNKIDLEHMRTVKADKHLRFCQENGFSSHFVSAKTG
FT                   DSVFLCFQKVAAEILGIKLNKAEIEQSQI"
FT   mRNA            complement(join(15419100..15419177,15421778..15421881,
FT                   15433242..15433273,15476584..15476713,15487253..15487341,
FT                   15492292..15492388,15496759..15496926,15496972..15497052))
FT                   /gene="Rab28"
FT                   /locus_tag="mCG_22723"
FT                   /product="RAB28, member RAS oncogene family, transcript
FT                   variant mCT173709"
FT                   /note="gene_id=mCG22723.1 transcript_id=mCT173709.0 created
FT                   on 13-FEB-2003"
FT   CDS             complement(join(15421855..15421881,15433242..15433273,
FT                   15476584..15476713,15487253..15487341,15492292..15492388,
FT                   15496759..15496833))
FT                   /codon_start=1
FT                   /gene="Rab28"
FT                   /locus_tag="mCG_22723"
FT                   /product="RAB28, member RAS oncogene family, isoform CRA_a"
FT                   /note="gene_id=mCG22723.1 transcript_id=mCT173709.0
FT                   protein_id=mCP96629.0 isoform=CRA_a"
FT                   /protein_id="EDL37573.1"
FT                   /translation="MSDSEEESQDRQLKIVVLGDGTSGKTSLATCFAQETFGKQYKQTI
FT                   GLDFFLRRITLPGNLNVTLQVWDIGGQTIGGKMLDKYIYGAQGILLVYDITNYQSFENL
FT                   EDWYSVVKTVSEESETQPLVALVGNKMPKDVMELELQLTWSICEQ"
FT   mRNA            complement(join(<15476591..15476713,15496759..15496885))
FT                   /gene="Rab28"
FT                   /locus_tag="mCG_22723"
FT                   /product="RAB28, member RAS oncogene family, transcript
FT                   variant mCT173710"
FT                   /note="gene_id=mCG22723.1 transcript_id=mCT173710.0 created
FT                   on 13-FEB-2003"
FT   CDS             complement(join(<15476591..15476713,15496759..15496833))
FT                   /codon_start=1
FT                   /gene="Rab28"
FT                   /locus_tag="mCG_22723"
FT                   /product="RAB28, member RAS oncogene family, isoform CRA_b"
FT                   /note="gene_id=mCG22723.1 transcript_id=mCT173710.0
FT                   protein_id=mCP96628.0 isoform=CRA_b"
FT                   /protein_id="EDL37574.1"
FT                   /translation="MSDSEEESQDRQLKIVVLGDGTSGKGILLVYDITNYQSFENLEDW
FT                   YSVVKTVSEESETQPLVALVG"
FT   gene            15505064..15507267
FT                   /pseudo
FT                   /locus_tag="mCG_1046063"
FT                   /note="gene_id=mCG1046063.1"
FT   mRNA            join(15505064..15505176,15506462..15507267)
FT                   /pseudo
FT                   /locus_tag="mCG_1046063"
FT                   /note="gene_id=mCG1046063.1 transcript_id=mCT163767.1
FT                   created on 16-OCT-2002"
FT   gene            complement(15551923..15555253)
FT                   /gene="Bapx1"
FT                   /locus_tag="mCG_22729"
FT                   /note="gene_id=mCG22729.2"
FT   mRNA            complement(join(15551923..15552177,15552210..15552939,
FT                   15554241..15555253))
FT                   /gene="Bapx1"
FT                   /locus_tag="mCG_22729"
FT                   /product="bagpipe homeobox gene 1 homolog (Drosophila)"
FT                   /note="gene_id=mCG22729.2 transcript_id=mCT22183.2 created
FT                   on 18-SEP-2002"
FT   CDS             complement(join(15552404..15552939,15554241..15554706))
FT                   /codon_start=1
FT                   /gene="Bapx1"
FT                   /locus_tag="mCG_22729"
FT                   /product="bagpipe homeobox gene 1 homolog (Drosophila)"
FT                   /note="gene_id=mCG22729.2 transcript_id=mCT22183.2
FT                   protein_id=mCP4153.1"
FT                   /db_xref="GOA:P97503"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017970"
FT                   /db_xref="InterPro:IPR020479"
FT                   /db_xref="MGI:MGI:108015"
FT                   /db_xref="UniProtKB/Swiss-Prot:P97503"
FT                   /protein_id="EDL37578.1"
FT                   /translation="MAVRGSGTLTPFSIQAILNKKEERGGLATPEGRPAPGGTEVAVTA
FT                   APAVCCWRIFGETEAGALGGAEDSLLASPARTRTAVGQSAESPGGWDSDSALSEENEGR
FT                   RRCADVPGASGTGRARVTLGLDQPGCELHAAKDLEEEAPVRSDSEMSASVSGDHSPRGE
FT                   DDSVSPGGARVPGLRGAAGSGASGGQAGGVEEEEEPAAPKPRKKRSRAAFSHAQVFELE
FT                   RRFNHQRYLSGPERADLAASLKLTETQVKIWFQNRRYKTKRRQMAADLLASAPAAKKVA
FT                   VKVLVRDDQRQYLPGEVLRPPSLLPLQPSYYYPYYCLPGWALSTCAAAAGTQ"
FT   gene            complement(15579311..>15610295)
FT                   /locus_tag="mCG_145575"
FT                   /note="gene_id=mCG145575.0"
FT   mRNA            complement(join(15579311..15579679,15582527..15582667,
FT                   15584957..15585110,15585612..15585693,15585800..15585849,
FT                   15588769..15588814,15590503..15590537,15590621..15590696,
FT                   15591491..15591567,15591893..15591971,15595883..15595962,
FT                   15597420..15597492,15597903..15597973,15599435..15599495,
FT                   15600786..15600829,15603862..15603946,15604871..15604935,
FT                   15606947..>15610295))
FT                   /locus_tag="mCG_145575"
FT                   /product="mCG145575"
FT                   /note="gene_id=mCG145575.0 transcript_id=mCT184999.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(15579562..15579679,15582527..15582667,
FT                   15584957..15585110,15585612..15585693,15585800..15585849,
FT                   15588769..15588814,15590503..15590537,15590621..15590696,
FT                   15591491..15591567,15591893..15591971,15595883..15595962,
FT                   15597420..15597492,15597903..15597973,15599435..15599495,
FT                   15600786..15600829,15603862..15603946,15604871..15604935,
FT                   15606947..>15610295))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145575"
FT                   /product="mCG145575"
FT                   /note="gene_id=mCG145575.0 transcript_id=mCT184999.0
FT                   protein_id=mCP105604.0"
FT                   /protein_id="EDL37579.1"
FT                   /translation="PVPQQRHGKMERGAAGSGRRDKAFIATSTEGTDKGIMLNTVKTGD
FT                   ATTTSSEVGEKGTALPCTSIEADEGFMMGACPKKHPLQVGAEASECTVFAAAEEGKGVV
FT                   TEGFAESEILLTSSKEGESGECAVAESEDRVAGPLAAHTVQAEANVNSITTEEKDDAVT
FT                   SAGSEEKCGGSACTVEGTATFIGEVESDGAVTSAGTEIRAGSLSSEDVDGSQENRIQVG
FT                   PKKETEGTVTCTETKGRNDNFICLVTRVETQEQRVVTGADVVQVNAAKPQEANANQGDG
FT                   SGTDGAEGESAVTSTGITEEDGEASANCTGSEDNREGCAISSETEESAESAMDSTEAKD
FT                   ITNAPLVAAGPCDDEGIVTSTGAKEEDDEDEGVVTSTGRGNEPGHASACTGIEESEGMM
FT                   VCESGEGGAQIGPTIDHVNAEAGAATVNTNDSNVDSMSGAEKEIKDTNICSSAKGIVES
FT                   SVTSALAGNSDRPPVLCGSEGPMASASSHHSDSQLTRKETVEDTTISTGLVKGSDDVLV
FT                   SGEVPECEVGHMSPRKNEECDGLMASTASCDVSNKDSLAGSKSQGNGLMISTSTNACTP
FT                   QISAVIDVRGGHLSTLSTEEIRDGVRVHREGFEAPMPSAVSGENSQLTASRSEEKDECA
FT                   MISTSIGEEFELPISSAVTVTCAERQQPVAAVEESTTGPALVSTEDFEVPMPSAPTEAE
FT                   SPLASTSKEEKDECALISTSIAEECEASVFGVSRNAPSVTDGNAVISTSSVEDCEGSVS
FT                   SAVPQESVCPSVIPVEETGDTAMISTSTSEGREAVMVGTIPTDDDQATTVRGEDLSDAA
FT                   IISTSTAECVLTCTSLSRHEENQQATHNPEGNGGHLATKQSKCELPMPSLVAERNCKCP
FT                   GPFRMGKGVGPLMAVGTRGEHDRLPVCEPSVGQGQPGTALCLGEEESHGMDCPGQDLNA
FT                   KERNTLLSSVQRESKSAEAEAAGDSSTARRTVRKDSERNANSLSETNCLREPEQKPAED
FT                   TSGSTHCLTAVNPGAEADGMLPITHAALEYPDHQEPESNLKTTTKCITGQESQMPSSHT
FT                   GVLSAVCHVAPCASEQEGGLPTKSDHSGTWTSEGSPEKMGHVAGARQSFHREGNLDVTL
FT                   PPEDNGCGVGNEESPPKGIGGLELSTGLTTEISVSSEEDTSHGVVAAPENPCVGRRRGA
FT                   AELQMEALLMRESLNVEKSESRINEEIHFESQNKEEICCGRKGSTEALSGCSVEADPEE
FT                   VEEEEKQISQRNRKPDYSSSEEELDDSPDVLDSRIETAQRQYSETEPHDTKEENSGDVE
FT                   EFSSVTSKTNSSTGLEDRDEFSSSEGTGEKTEPNEDDGSIKSQEDDHPIIIKRRRGRPR
FT                   KYPAETAFKSKEDSKTETDITTVEQSSPSGKLKVSQADESNKEIANLEEKSTSNDDSEE
FT                   KTASMRLRGRKPKRSLTSSDDAESSEPERKRQKSVSETSEDKKDEESDEEEEEEEEEEP
FT                   LGATTRSATRSEAQRKNHSKPSTRATSKLGIPETISPRNRQKLAKEKLSTSEKVSKSPP
FT                   LGRSKAQLSPSVKRKREVSPPGARTRGQQKVDENPLKKAKR"
FT   gene            complement(<15612770..>15635054)
FT                   /locus_tag="mCG_145571"
FT                   /note="gene_id=mCG145571.0"
FT   mRNA            complement(join(<15612770..15612899,15614708..15614780,
FT                   15617202..15617340,15617848..15617959,15619492..15619658,
FT                   15622184..15622333,15622950..15623564,15624397..15624587,
FT                   15628779..15628903,15634670..>15635054))
FT                   /locus_tag="mCG_145571"
FT                   /product="mCG145571"
FT                   /note="gene_id=mCG145571.0 transcript_id=mCT184995.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(<15612770..15612899,15614708..15614780,
FT                   15617202..15617340,15617848..15617959,15619492..15619658,
FT                   15622184..15622333,15622950..15623564,15624397..15624587,
FT                   15628779..15628903,15634670..>15635023))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145571"
FT                   /product="mCG145571"
FT                   /note="gene_id=mCG145571.0 transcript_id=mCT184995.0
FT                   protein_id=mCP105601.0"
FT                   /protein_id="EDL37580.1"
FT                   /translation="IRWFRNNIPLASLRRRDLCSRLPRSACPPGLAGSPVRDAMATNPQ
FT                   PQPPPPAPPPPPPQPQPPPPPPGPGAGPGASGPGSAGAGAGDPQLVAMIVNHLKSQGLF
FT                   DQFRRDCLADVDTKPAYQNLRQRVDNFVANHLATHTWSPHLNKNQLRNNIRQQVLKSGM
FT                   LESGIDRIISQVVDPKINHTFRPQVEKAVHEFLATLNHKEEAAGSTAPDDEKPESSVIT
FT                   QGAPAPGPSANVASDAMSILETITSLNQEANAARASTEMSNAKVSERTSRKLSSQPSTD
FT                   VSTDKERGSEDATEREKATSDSGGDGLEAALKSEEPSDLPCPVEETKNHMKENNSLLLL
FT                   SKDAQQESTDPKIKSMDKGEKKPDGNEKGERKKEKKEKTEKKIDHSKRNEDTQKVKDER
FT                   QAKDKEVESTKLPSEKSNSRARAAEGTKEDCSLLDSDVDGLTDITVSSVHTSDLSSFEE
FT                   DTEEEVVVSESMEEGEITSEDEEKNKQNKAKVQPGDSSDGKARGVRHAYVHKPYLYSKY
FT                   YSDSDDELTVEQRRQSIAKEKEERLLRRRINREKLEEKRKQKAEKTKSSKVKSQGKSTV
FT                   DLEDSSAKTLEPKAPRIKEVLKERKVLEKKVALSKRRRKDSRNVDENSKKKPQAEEESK
FT                   EALKTTEYCEKEKASSKDLRHTHGKGEPSRPARRLSESLHSADENKTESK"
FT   gene            complement(15643960..15645188)
FT                   /pseudo
FT                   /locus_tag="mCG_49626"
FT                   /note="gene_id=mCG49626.2"
FT   mRNA            complement(15643960..15645188)
FT                   /pseudo
FT                   /locus_tag="mCG_49626"
FT                   /note="gene_id=mCG49626.2 transcript_id=mCT49809.2 created
FT                   on 18-OCT-2002"
FT   gene            complement(15724577..15726006)
FT                   /pseudo
FT                   /locus_tag="mCG_1046028"
FT                   /note="gene_id=mCG1046028.1"
FT   mRNA            complement(15724577..15726006)
FT                   /pseudo
FT                   /locus_tag="mCG_1046028"
FT                   /note="gene_id=mCG1046028.1 transcript_id=mCT163732.1
FT                   created on 18-OCT-2002"
FT   gene            <15843830..15995997
FT                   /locus_tag="mCG_145574"
FT                   /note="gene_id=mCG145574.0"
FT   mRNA            join(<15843830..15843948,15983986..15984194,
FT                   15993810..15995997)
FT                   /locus_tag="mCG_145574"
FT                   /product="mCG145574"
FT                   /note="gene_id=mCG145574.0 transcript_id=mCT184998.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<15843830..15843948,15983986..15984194,
FT                   15993810..15993835)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145574"
FT                   /product="mCG145574"
FT                   /note="gene_id=mCG145574.0 transcript_id=mCT184998.0
FT                   protein_id=mCP105606.0"
FT                   /db_xref="GOA:Q8CBM3"
FT                   /db_xref="MGI:MGI:3648966"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CBM3"
FT                   /protein_id="EDL37581.1"
FT                   /translation="CSALSSFPQRFWRQTLPSGDLQVWSCSPRGFGGERTGLTGEGGQE
FT                   TGVRTCLLTEDEGLKQGLSQNLCSFCSPHSHLCRLVSAESGNQDGSPRCCGKAFLGGAD
FT                   TYPLAACCFHLMV"
FT   gene            <16179683..16300072
FT                   /locus_tag="mCG_1046128"
FT                   /note="gene_id=mCG1046128.1"
FT   mRNA            join(<16179683..16179749,16207635..16207791,
FT                   16299870..16300072)
FT                   /locus_tag="mCG_1046128"
FT                   /product="mCG1046128"
FT                   /note="gene_id=mCG1046128.1 transcript_id=mCT163832.1
FT                   created on 04-OCT-2002"
FT   CDS             join(<16179685..16179749,16207635..16207770)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1046128"
FT                   /product="mCG1046128"
FT                   /note="gene_id=mCG1046128.1 transcript_id=mCT163832.1
FT                   protein_id=mCP64833.1"
FT                   /protein_id="EDL37582.1"
FT                   /translation="QTRRMKWSLERAGSAGFLSSLVLEDAAASLCRYPYPREITGNLYQ
FT                   RNRWLGPSWSESISGCHVVIL"
FT   gene            complement(16737146..16739201)
FT                   /pseudo
FT                   /locus_tag="mCG_122366"
FT                   /note="gene_id=mCG122366.1"
FT   mRNA            complement(16737146..16739201)
FT                   /pseudo
FT                   /locus_tag="mCG_122366"
FT                   /note="gene_id=mCG122366.1 transcript_id=mCT123583.1
FT                   created on 03-OCT-2002"
FT   gene            complement(16813092..16817412)
FT                   /locus_tag="mCG_148296"
FT                   /note="gene_id=mCG148296.0"
FT   mRNA            complement(join(16813092..16814853,16816877..16817412))
FT                   /locus_tag="mCG_148296"
FT                   /product="mCG148296"
FT                   /note="gene_id=mCG148296.0 transcript_id=mCT188559.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(16814387..16814692)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148296"
FT                   /product="mCG148296"
FT                   /note="gene_id=mCG148296.0 transcript_id=mCT188559.0
FT                   protein_id=mCP109210.0"
FT                   /protein_id="EDL37583.1"
FT                   /translation="MESHQRTTTKWVPPHTFPINLLSPLPLVARLERKLRCLITLNKVG
FT                   LEKSKPTEVTIQDRVSHGLSVWPYMWTSWPKSEKQGWKYQHYWICCSWTCRLRKRP"
FT   gene            complement(16920022..>16995309)
FT                   /locus_tag="mCG_146113"
FT                   /note="gene_id=mCG146113.0"
FT   mRNA            complement(join(16920022..16920115,16922723..16922817,
FT                   16933894..16934003,16955448..16955520,16956746..16956858,
FT                   16958186..16958257,16959209..16959319,16994906..>16995309))
FT                   /locus_tag="mCG_146113"
FT                   /product="mCG146113"
FT                   /note="gene_id=mCG146113.0 transcript_id=mCT186216.0
FT                   created on 14-JUL-2003"
FT   gene            <16994840..17050234
FT                   /gene="Cpeb2"
FT                   /locus_tag="mCG_141234"
FT                   /note="gene_id=mCG141234.0"
FT   mRNA            join(<16994840..16995042,16997276..16997542,
FT                   16998281..16998370,17004540..17004630,17021717..17021767,
FT                   17037414..17037584,17038587..17038676,17041594..17041739,
FT                   17041882..17041996,17044448..17044629,17046230..17050234)
FT                   /gene="Cpeb2"
FT                   /locus_tag="mCG_141234"
FT                   /product="cytoplasmic polyadenylation element binding
FT                   protein 2, transcript variant mCT174004"
FT                   /note="gene_id=mCG141234.0 transcript_id=mCT174004.0
FT                   created on 03-OCT-2002"
FT   mRNA            join(<16994841..16995042,16997261..16997542,
FT                   17004540..17004630,17021717..17021767,17028852..17028875,
FT                   17037414..17037584,17038587..17038676,17041621..17041739,
FT                   17041882..17041996,17044448..17044629,17046230..17047533)
FT                   /gene="Cpeb2"
FT                   /locus_tag="mCG_141234"
FT                   /product="cytoplasmic polyadenylation element binding
FT                   protein 2, transcript variant mCT193569"
FT                   /note="gene_id=mCG141234.0 transcript_id=mCT193569.0
FT                   created on 09-MAR-2004"
FT   mRNA            join(<16994841..16995042,16997261..16997542,
FT                   16998281..16998370,17004540..17004630,17021717..17021767,
FT                   17037414..17037584,17038587..17038676,17041621..17041739,
FT                   17041882..17041996,17044448..17044629,17046230..17046701)
FT                   /gene="Cpeb2"
FT                   /locus_tag="mCG_141234"
FT                   /product="cytoplasmic polyadenylation element binding
FT                   protein 2, transcript variant mCT193568"
FT                   /note="gene_id=mCG141234.0 transcript_id=mCT193568.0
FT                   created on 09-MAR-2004"
FT   CDS             join(<16994842..16995042,16997261..16997542,
FT                   16998281..16998370,17004540..17004630,17021717..17021767,
FT                   17037414..17037584,17038587..17038676,17041621..17041739,
FT                   17041882..17041996,17044448..17044629,17046230..17046457)
FT                   /codon_start=1
FT                   /gene="Cpeb2"
FT                   /locus_tag="mCG_141234"
FT                   /product="cytoplasmic polyadenylation element binding
FT                   protein 2, isoform CRA_a"
FT                   /note="gene_id=mCG141234.0 transcript_id=mCT193568.0
FT                   protein_id=mCP114522.0 isoform=CRA_a"
FT                   /protein_id="EDL37585.1"
FT                   /translation="GGGFGGPFSAPTVPAPPAMNLPQQQPPAAAPQQPQSRRSPVSPQL
FT                   QQQHQAAAAAFLQQRNSYNHHQPLLKQSPWSNHQNSGWGTASMSWGAMHGRDHRRSGNM
FT                   GIPGTMNQISPLKKPFSGNVIAPPKFTRSTPSLTPKSWIEDNVFRTDNNSNTLLPLQVR
FT                   SSLQLPAWGSDSLQDSWCTAAGTSRIDQDRSRMYDSLNMHSLENSLIDIMRAEHDPLKG
FT                   RLSYPHPGTDNLLMLNGRSSLFPIDDSLLDDGHSDQVGVLNSPTCYSAHQNGERIERFS
FT                   RKVFVGGLPPDIDEDEITASFRRFGPLVVDWPHKAESKSYFPPKGYAFLLFQEESSVQA
FT                   LIDACIEEDGKLYLCVSSPTIKDKPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVGGVPR
FT                   PLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQH
FT                   GDIDKRVEVKPYVLDDQMCDECQGARCGGKFAPFFCANVTCLQYYCEFCWANIHSRAGR
FT                   EFHKPLVKEGADRPRQIHFRWN"
FT   CDS             join(<16994842..16995042,16997261..16997542,
FT                   17004540..17004630,17021717..17021767,17028852..17028875,
FT                   17037414..17037584,17038587..17038676,17041621..17041739,
FT                   17041882..17041996,17044448..17044629,17046230..17046457)
FT                   /codon_start=1
FT                   /gene="Cpeb2"
FT                   /locus_tag="mCG_141234"
FT                   /product="cytoplasmic polyadenylation element binding
FT                   protein 2, isoform CRA_b"
FT                   /note="gene_id=mCG141234.0 transcript_id=mCT193569.0
FT                   protein_id=mCP114523.0 isoform=CRA_b"
FT                   /protein_id="EDL37586.1"
FT                   /translation="GGGFGGPFSAPTVPAPPAMNLPQQQPPAAAPQQPQSRRSPVSPQL
FT                   QQQHQAAAAAFLQQRNSYNHHQPLLKQSPWSNHQNSGWGTASMSWGAMHGRDHRRSGNM
FT                   GIPGTMNQISPLKKPFSGNVIAPPKFTRSTPSLTPKSWIEDNVFRTDNNSNTLLPLQDR
FT                   SRMYDSLNMHSLENSLIDIMRAEHDPLKGRLSYPHPGTDNLLMLNARSYGRRRGRSSLF
FT                   PIDDSLLDDGHSDQVGVLNSPTCYSAHQNGERIERFSRKVFVGGLPPDIDEDEITASFR
FT                   RFGPLVVDWPHKAESKSYFPPKGYAFLLFQEESSVQALIDACIEEDGKLYLCVSSPTIK
FT                   DKPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAG
FT                   IDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGDIDKRVEVKPYVLDDQMCDEC
FT                   QGARCGGKFAPFFCANVTCLQYYCEFCWANIHSRAGREFHKPLVKEGADRPRQIHFRWN
FT                   "
FT   CDS             join(<16994842..16995042,16997276..16997542,
FT                   16998281..16998370,17004540..17004630,17021717..17021767,
FT                   17037414..17037584,17038587..17038676,17041594..17041739,
FT                   17041882..17041996,17044448..17044629,17046230..17046457)
FT                   /codon_start=1
FT                   /gene="Cpeb2"
FT                   /locus_tag="mCG_141234"
FT                   /product="cytoplasmic polyadenylation element binding
FT                   protein 2, isoform CRA_c"
FT                   /note="gene_id=mCG141234.0 transcript_id=mCT174004.0
FT                   protein_id=mCP96923.0 isoform=CRA_c"
FT                   /protein_id="EDL37587.1"
FT                   /translation="GGGFGGPFSAPTVPAPPAMNLPQQQPPAAAPQQPQSRRSPVSPQL
FT                   QQQHQAAAAAFLQQRNSYNHHQSPWSNHQNSGWGTASMSWGAMHGRDHRRSGNMGIPGT
FT                   MNQISPLKKPFSGNVIAPPKFTRSTPSLTPKSWIEDNVFRTDNNSNTLLPLQVRSSLQL
FT                   PAWGSDSLQDSWCTAAGTSRIDQDRSRMYDSLNMHSLENSLIDIMRAEHDPLKGRLSYP
FT                   HPGTDNLLMLNGRSSLFPIDDSLLDDGHSDQVGVLNSPTCYSAHQNGERIERFSRKVFV
FT                   GGLPPDIDEDEITASFRRFGPLVVDWPHKAESKSYFPPKVLKFFTVIPGYAFLLFQEES
FT                   SVQALIDACIEEDGKLYLCVSSPTIKDKPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVG
FT                   GVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFV
FT                   QLQHGDIDKRVEVKPYVLDDQMCDECQGARCGGKFAPFFCANVTCLQYYCEFCWANIHS
FT                   RAGREFHKPLVKEGADRPRQIHFRWN"
FT   CDS             complement(16994956..>16995306)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146113"
FT                   /product="mCG146113"
FT                   /note="gene_id=mCG146113.0 transcript_id=mCT186216.0
FT                   protein_id=mCP107478.0"
FT                   /db_xref="GOA:G3UWB4"
FT                   /db_xref="MGI:MGI:3648234"
FT                   /db_xref="UniProtKB/TrEMBL:G3UWB4"
FT                   /protein_id="EDL37584.1"
FT                   /translation="QFLPALTARGCGCRCRLGFISPAQDKLQKGTTPVLVPSVTPGKDP
FT                   ALAAHSPPAFPRVLPRPRVRRQAGAPGAFEGAWRLLFPPRTPYLVVVVRVPLLQEGGCG
FT                   SLVLLLQLRADG"
FT   gene            complement(17134165..>17136379)
FT                   /locus_tag="mCG_1046256"
FT                   /note="gene_id=mCG1046256.1"
FT   mRNA            complement(join(17134165..17134536,17136031..17136144,
FT                   17136310..>17136379))
FT                   /locus_tag="mCG_1046256"
FT                   /product="mCG1046256"
FT                   /note="gene_id=mCG1046256.1 transcript_id=mCT163960.1
FT                   created on 15-OCT-2002"
FT   CDS             complement(join(17134466..17134536,17136031..>17136124))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1046256"
FT                   /product="mCG1046256"
FT                   /note="gene_id=mCG1046256.1 transcript_id=mCT163960.1
FT                   protein_id=mCP64896.1"
FT                   /protein_id="EDL37588.1"
FT                   /translation="CFLLCVMDVIRICTAPFGVSFGASNTHSPNGGFFYNSRNSIKFIK
FT                   NIIPRWMAF"
FT   gene            complement(<17311355..>17362888)
FT                   /locus_tag="mCG_1046257"
FT                   /note="gene_id=mCG1046257.1"
FT   mRNA            complement(join(<17311355..17311812,17318873..17319337,
FT                   17360307..17360380,17362488..17362560,17362653..17362770,
FT                   17362864..>17362888))
FT                   /locus_tag="mCG_1046257"
FT                   /product="mCG1046257"
FT                   /note="gene_id=mCG1046257.1 transcript_id=mCT163961.1
FT                   created on 15-OCT-2002"
FT   CDS             complement(<17311355..>17311759)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1046257"
FT                   /product="mCG1046257"
FT                   /note="gene_id=mCG1046257.1 transcript_id=mCT163961.1
FT                   protein_id=mCP64903.0"
FT                   /protein_id="EDL37589.1"
FT                   /translation="TPRSIKEAHRECKTTEAKTLLQGGNSLKMSAWMRKRAVYFQHFQE
FT                   RSTAGCLELCTDVDFSVKPLFSGSKKHSLPFPPHLCLASVYFPDLLFKSILLSFKGWQI
FT                   EAAWKGRVSSGAGVSAECLTIGRGFTNKEKR"
FT   gene            17363079..17377824
FT                   /gene="C1qtnf7"
FT                   /locus_tag="mCG_4158"
FT                   /note="gene_id=mCG4158.2"
FT   mRNA            join(17363079..17363139,17370210..17370455,
FT                   17376795..17377824)
FT                   /gene="C1qtnf7"
FT                   /locus_tag="mCG_4158"
FT                   /product="C1q and tumor necrosis factor related protein 7"
FT                   /note="gene_id=mCG4158.2 transcript_id=mCT3294.1 created on
FT                   26-SEP-2002"
FT   CDS             join(17370218..17370455,17376795..17377426)
FT                   /codon_start=1
FT                   /gene="C1qtnf7"
FT                   /locus_tag="mCG_4158"
FT                   /product="C1q and tumor necrosis factor related protein 7"
FT                   /note="gene_id=mCG4158.2 transcript_id=mCT3294.1
FT                   protein_id=mCP4168.1"
FT                   /db_xref="GOA:Q5BKS0"
FT                   /db_xref="InterPro:IPR001073"
FT                   /db_xref="InterPro:IPR008160"
FT                   /db_xref="InterPro:IPR008983"
FT                   /db_xref="MGI:MGI:1925911"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BKS0"
FT                   /protein_id="EDL37590.1"
FT                   /translation="MIVLLYVTSLAICASGQPRANQAKGESYSPRYICSIPGLPGPPGP
FT                   PGANGSPGPHGRIGLPGRDGRDGRKGEKGEKGTAGLKGKTGPLGLAGEKGDQGETGKKG
FT                   PIGPEGEKGEVGPAGPPGPKGDRGDQGDPGLPGVCRCGSIVLKSAFSVGITTSYPEERL
FT                   PIIFNKVLFNEGEHYNPATGKFICAFPGIYYFSYDITLANKHLAIGLVHNGQYRIRTFD
FT                   ANTGNHDVASGSTVIYLQPEDEVWLEIFFNDQNGLFSDPGWADSLFSGFLLYVDTDYLD
FT                   SISEDDEL"
FT   gene            17423319..17501574
FT                   /gene="5730509K17Rik"
FT                   /locus_tag="mCG_124147"
FT                   /note="gene_id=mCG124147.1"
FT   mRNA            join(17423319..17423498,17426989..17427216,
FT                   17429585..17429645,17432160..17432243,17434617..17434740,
FT                   17442235..17442302,17444018..17444119,17444958..17445152,
FT                   17446176..17446338,17449042..17449178,17449836..17449967,
FT                   17455685..17455894,17457138..17457244,17460558..17460698,
FT                   17463811..17463967,17464421..17464722,17466677..17466854,
FT                   17467363..17467519,17469664..17469811,17471125..17471263,
FT                   17472860..17473063,17475129..17475221,17476374..17476465,
FT                   17479173..17479340,17480961..17481066,17483048..17483157,
FT                   17484360..17484456,17484934..17485032,17490518..17490721,
FT                   17492983..17493072,17494433..17494546,17495921..17496055,
FT                   17496639..17496761,17498101..17498159,17499960..17500080,
FT                   17501271..17501574)
FT                   /gene="5730509K17Rik"
FT                   /locus_tag="mCG_124147"
FT                   /product="RIKEN cDNA 5730509K17"
FT                   /note="gene_id=mCG124147.1 transcript_id=mCT125385.1
FT                   created on 26-SEP-2002"
FT   CDS             join(17429607..17429645,17432160..17432243,
FT                   17434617..17434740,17442235..17442302,17444018..17444119,
FT                   17444958..17445152,17446176..17446338,17449042..17449178,
FT                   17449836..17449967,17455685..17455894,17457138..17457244,
FT                   17460558..17460698,17463811..17463967,17464421..17464722,
FT                   17466677..17466854,17467363..17467519,17469664..17469811,
FT                   17471125..17471263,17472860..17473063,17475129..17475221,
FT                   17476374..17476465,17479173..17479340,17480961..17481066,
FT                   17483048..17483157,17484360..17484456,17484934..17485032,
FT                   17490518..17490721,17492983..17493072,17494433..17494546,
FT                   17495921..17496055,17496639..17496761,17498101..17498159,
FT                   17499960..17500080,17501271..17501459)
FT                   /codon_start=1
FT                   /gene="5730509K17Rik"
FT                   /locus_tag="mCG_124147"
FT                   /product="RIKEN cDNA 5730509K17"
FT                   /note="gene_id=mCG124147.1 transcript_id=mCT125385.1
FT                   protein_id=mCP64835.1"
FT                   /protein_id="EDL37591.1"
FT                   /translation="MNTNDEKMKIISEDFTGDGVDTEAGRRKKNSKVRRQQRKKKPPAS
FT                   PPEEMVSDKFQDGGQQEVVEEEPETNLLSLTARRGPRTSRTGFAEFSMRERMREKLQAA
FT                   RPSTEVQDTQKEDDTKSYSRIKFRDSVRKIKSKPQLPPGFPSAEEAYNFFTFNFDPEPE
FT                   ESEEKSPVKGGERAHHEDQEGEEGTQAQERAKKTVSDTVTVEEEELLNGKDAEDFLLGL
FT                   DPTAHDFVAVRAAEYKSARIQLQKEKEILFTPSRLTVPTYKKLPENIQPRFLEDEGLYI
FT                   GARPEVARTNENIMENRLLIQEPGSKWFGDDGRILALPSPIKPFPSRPSLTTREQSPKA
FT                   GLETLYKKAEKYVHSRQHMIGSGDPPGNFQLDIDISGLIFTHHPCFSREHVLASKLAQL
FT                   YDQYLARQQRNKTKFLTDKLQALRKAVQTSLNPEKPHQSLDTTQKTINEYKSEIRQTRK
FT                   LRDAEQEKDRTLLKTIIKVWKEMKSLREFQRFTNTPLKLVLRKEKVDPKLDEDAYEAEI
FT                   QAEIHELLEEHMEEYATKMEEYRTSHQQWKAWRKAQCHAAESQSRRLETRSPSTQQRAK
FT                   KKKKKQTTEEHLEEEEAEESFPEEEVTKPIPPEPTDPAVIEQQVRERAAHSRRRPGEPT
FT                   LIPELSLAGNVTPNDQCPRVEVSRREDVRRRSVYLKVVFNSKEVSRTVSRPLGADFRVH
FT                   FGQIFNLQIFNWPESLMLQVYETIGHSGTTLLAEVFLPIPETTLVTGRAPIEEVEFSSN
FT                   QHVTLDHEGVGSGVPFSFEADGSNQLTLMTSGKVSHSVAWAVGENGIPLIPPLSQQNIG
FT                   FRSALRRADAISSIGTSGLTDMKKLAKWAAESKLDPNDPNHAPLMQLISVATSGESYVP
FT                   DFFRLEQLQQEFNFVSEEELNRSKRFRLLHLRSQEVPEFRNYKQIPAYDREIMEKVFQD
FT                   YEKRLRDRNVIETKDHLDMHRATVAKYLQQVREAVVNRFLTAKHHFLLTDLVVEEEVPN
FT                   ISILGLSLFKLAEQKRPLRPRRKGRKKVTAQNLSDGDIKLLVNIIRAYDIPVRKPVVSK
FT                   FQQPSRSSRTFSEKQTASPSTHSPLHNADYPLGQVLVRPFVEVSFQRTICHTTTAEGPN
FT                   PSWNEELELPFRAPNGDYSTASLQSVKDDVYINIFDEVLYDILEDDRERGSGIHTRIER
FT                   HWLGCVKIPFSTIYFQARFDTQEDEKLLQATEKFQAECALKFPQRQCLTTVTDMTGKTV
FT                   FITRYLKPLNPPQELLHVYPNNPQATAELVARYVSLIPFLPDSVSFAGVCDLWSTSDQF
FT                   LDLLAGDEEEHAVLLCNYFLFLGKKAWLVMGSAIPEGPTAYVLTWEKNYYLIWNPCSGH
FT                   CYGQFDAFCPLKSVGCLIGPDNIWFNIQHHDSPLRINFDVTKPKLWKSFFSRSLPYPGL
FT                   SSVQPEELIYQHTDKAVAAELQDRWNRYCTSTLRHFLPLLERSQGEDIEDDHRAELLKQ
FT                   LGDYRFSGFPLHMPYSEVKPLVEAVYSTGVHNIDLPNVEFALAVYIHPYPKNVLSVWIY
FT                   VASLVRNR"
FT   gene            complement(17505221..>17542642)
FT                   /gene="Fbxl5"
FT                   /locus_tag="mCG_4162"
FT                   /note="gene_id=mCG4162.1"
FT   mRNA            complement(join(17505221..17505980,17511467..17511615,
FT                   17518823..17519520,17521308..17521456,17523418..17523543,
FT                   17525910..17526092,17528665..17528851,17531338..17531433,
FT                   17534045..17534260,17542566..17542642))
FT                   /gene="Fbxl5"
FT                   /locus_tag="mCG_4162"
FT                   /product="F-box and leucine-rich repeat protein 5,
FT                   transcript variant mCT3293"
FT                   /note="gene_id=mCG4162.1 transcript_id=mCT3293.1 created on
FT                   09-APR-2003"
FT   mRNA            complement(join(17505223..17505980,17511467..17511615,
FT                   17518823..17519545,17520344..17520426,17521308..17521456,
FT                   17523418..17523543,17525910..17526092,17528665..17528851,
FT                   17531338..17531433,17534045..17534260,17542566..>17542642))
FT                   /gene="Fbxl5"
FT                   /locus_tag="mCG_4162"
FT                   /product="F-box and leucine-rich repeat protein 5,
FT                   transcript variant mCT193555"
FT                   /note="gene_id=mCG4162.1 transcript_id=mCT193555.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(17505904..17505980,17511467..17511615,
FT                   17518823..17519545,17520344..17520426,17521308..17521456,
FT                   17523418..17523543,17525910..17526092,17528665..17528851,
FT                   17531338..17531433,17534045..17534260,17542566..>17542640))
FT                   /codon_start=1
FT                   /gene="Fbxl5"
FT                   /locus_tag="mCG_4162"
FT                   /product="F-box and leucine-rich repeat protein 5, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG4162.1 transcript_id=mCT193555.0
FT                   protein_id=mCP114548.0 isoform=CRA_a"
FT                   /protein_id="EDL37592.1"
FT                   /translation="FPDEVDVFTAPHWRMKQLVGRYCDKLSKTNFSNNNDFRALLQSLY
FT                   ATFKEFKMHEQIENEYIIGLLQQRSQTIYNVHSDNKLSEMLSLFEKGLKNVKNEYEQLN
FT                   YAKQLKERLEAFTRDFLPHMKEEEEVFQPMLMEYFTYEELKDIKKKVIAQHCSQKDTAE
FT                   LLRGLSLWNQAEERQKVLKYSVDEKADTEAEVSEHSTGITHLPPEVMLSIFSYLNPQEL
FT                   CRCSQVSTKWSQLAKTGSLWKHLYPVHWARGDWYSGPATELDTEPDEEWVRNRKDESRA
FT                   FQEWDEDADIDESEESAEESVAISIAQMEKRVLHGLIHNVLPYVGTSVKTLVLAYSSAV
FT                   SSKMVRQILELCPNLEHLDLTQTDISDSAFDSWSWLGCCQSLRHLDLSGCEKITDMALE
FT                   KISRALGVLTSHQSGFLKSAGKAASTPWTSKDITMPSTTQYACLHNLTDKGIGEEIDNE
FT                   HSWTEPVSSESLTSPYVWMLDAEDLADIEDAVEWRHRNVESLCVMETASNFGCSSSGCY
FT                   SKDIVGLRTSVCWQQHCASPAFAYCGHSFCCTGTALRTMTTLPATSAMCRKALRTTLPR
FT                   GKDLIYFGSEKSDQETGRVLLFLSLSGCYQITDHGLRALTLGGGLPYLEHLNLSGCLTV
FT                   TGAGLQDLVSACPSLNDEYFYYCDNINGPHADTASGCQNLQCGFRACCRSGE"
FT   CDS             complement(join(17505904..17505980,17511467..17511615,
FT                   17518823..17519520,17521308..17521456,17523418..17523543,
FT                   17525910..17526092,17528665..17528851,17531338..17531433,
FT                   17534045..17534260,17542566..17542598))
FT                   /codon_start=1
FT                   /gene="Fbxl5"
FT                   /locus_tag="mCG_4162"
FT                   /product="F-box and leucine-rich repeat protein 5, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG4162.1 transcript_id=mCT3293.1
FT                   protein_id=mCP4208.2 isoform=CRA_b"
FT                   /protein_id="EDL37593.1"
FT                   /translation="MKQLVGRYCDKLSKTNFSNNNDFRALLQSLYATFKEFKMHEQIEN
FT                   EYIIGLLQQRSQTIYNVHSDNKLSEMLSLFEKGLKNVKNEYEQLNYAKQLKERLEAFTR
FT                   DFLPHMKEEEEVFQPMLMEYFTYEELKDIKKKVIAQHCSQKDTAELLRGLSLWNQAEER
FT                   QKVLKYSVDEKADTEAEVSEHSTGITHLPPEVMLSIFSYLNPQELCRCSQVSTKWSQLA
FT                   KTGSLWKHLYPVHWARGDWYSGPATELDTEPDEEWVRNRKDESRAFQEWDEDADIDESE
FT                   ESAEESVAISIAQMEKRVLHGLIHNVLPYVGTSVKTLVLAYSSAVSSKMSLRHLDLSGC
FT                   EKITDMALEKISRALGVLTSHQSGFLKSAGKAASTPWTSKDITMPSTTQYACLHNLTDK
FT                   GIGEEIDNEHSWTEPVSSESLTSPYVWMLDAEDLADIEDAVEWRHRNVESLCVMETASN
FT                   FGCSSSGCYSKDIVGLRTSVCWQQHCASPAFAYCGHSFCCTGTALRTMTTLPATSAMCR
FT                   KALRTTLPRGKDLIYFGSEKSDQETGRVLLFLSLSGCYQITDHGLRALTLGGGLPYLEH
FT                   LNLSGCLTVTGAGLQDLVSACPSLNDEYFYYCDNINGPHADTASGCQNLQCGFRACCRS
FT                   GE"
FT   gene            complement(17513514..17514872)
FT                   /locus_tag="mCG_148303"
FT                   /note="gene_id=mCG148303.0"
FT   mRNA            complement(17513514..17514872)
FT                   /locus_tag="mCG_148303"
FT                   /product="mCG148303"
FT                   /note="gene_id=mCG148303.0 transcript_id=mCT188566.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(17513709..17514062)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148303"
FT                   /product="mCG148303"
FT                   /note="gene_id=mCG148303.0 transcript_id=mCT188566.0
FT                   protein_id=mCP109217.0"
FT                   /protein_id="EDL37594.1"
FT                   /translation="MREIFLEYIFLLYVIIPQSFIDWVILPLAKDSILTFDIPLLFLTL
FT                   IIALKRRVCVCVCVCVCVCVYVCVCMYTHTHSGILAHTYIHTYTHTYALAVNSCFLLFY
FT                   GTVLLMSFCIFSL"
FT   gene            17579660..17604033
FT                   /gene="Bst1"
FT                   /locus_tag="mCG_4156"
FT                   /note="gene_id=mCG4156.1"
FT   mRNA            join(17579660..17579845,17581209..17581335,
FT                   17582341..17582476,17582998..17583080,17586059..17586135,
FT                   17586995..17587087,17598193..17598279,17601163..17601222,
FT                   17602719..17604033)
FT                   /gene="Bst1"
FT                   /locus_tag="mCG_4156"
FT                   /product="bone marrow stromal cell antigen 1"
FT                   /note="gene_id=mCG4156.1 transcript_id=mCT3303.1 created on
FT                   18-SEP-2002"
FT   CDS             join(17579679..17579845,17581209..17581335,
FT                   17582341..17582476,17582998..17583080,17586059..17586135,
FT                   17586995..17587087,17598193..17598279,17601163..17601222,
FT                   17602719..17602824)
FT                   /codon_start=1
FT                   /gene="Bst1"
FT                   /locus_tag="mCG_4156"
FT                   /product="bone marrow stromal cell antigen 1"
FT                   /note="gene_id=mCG4156.1 transcript_id=mCT3303.1
FT                   protein_id=mCP4151.2"
FT                   /protein_id="EDL37595.1"
FT                   /translation="MAVQGGLLSLWLWLWLSLLTVLLGARARWRGEGTTPHLQSIFLGR
FT                   CAEYTTLLSLGNKNCTAIWEAFKGVLDKDPCSVLPSDYDLFINLSRHPIPRDKSLFWEN
FT                   NHLLVMSYGENTRRLVALCDVLYGKVGDFLSWCRQENASGLDYQSCPTSEDCENNAVDS
FT                   YWKSASMQYSRDSSGVINVMLNGSEPKGAYPTRGFFADFEIPYLQKDKVTRIEIWVMHD
FT                   VGGPNVESCGEGSVKILEDRLEALGFQHSCINDYRPVKFLMCVDHSTHPDCIMNSASAS
FT                   MRRESASLHAIGDASLLISLLVALASSSQA"
FT   gene            17629638..17673166
FT                   /gene="Cd38"
FT                   /locus_tag="mCG_4157"
FT                   /note="gene_id=mCG4157.2"
FT   mRNA            join(17629638..17629912,17661125..17661254,
FT                   17662213..17662348,17664387..17664472,17666956..17667029,
FT                   17668310..17668402,17668720..17668806,17671077..17673166)
FT                   /gene="Cd38"
FT                   /locus_tag="mCG_4157"
FT                   /product="CD38 antigen"
FT                   /note="gene_id=mCG4157.2 transcript_id=mCT3298.2 created on
FT                   18-SEP-2002"
FT   CDS             join(17629668..17629912,17661125..17661254,
FT                   17662213..17662348,17664387..17664472,17666956..17667029,
FT                   17668310..17668402,17668720..17668806,17671077..17671140)
FT                   /codon_start=1
FT                   /gene="Cd38"
FT                   /locus_tag="mCG_4157"
FT                   /product="CD38 antigen"
FT                   /note="gene_id=mCG4157.2 transcript_id=mCT3298.2
FT                   protein_id=mCP4160.2"
FT                   /protein_id="EDL37596.1"
FT                   /translation="MANYEFSQVSGDRPGCRLSRKAQIGLGVGLLVLIALVVGIVVILL
FT                   RPRSLLVWTGEPTTKHFSDIFLGRCLIYTQILRPEMRDQNCQEILSTFKGAFVSKNPCN
FT                   ITREDYAPLVKLVTQTIPCNKTLFWSKSKHLAHQYTWIQGKMFTLEDTLLGYIADDLRW
FT                   CGDPSTSDMNYVSCPHWSENCPNNPITMFWKVISQKFAEDACGVVQVMLNGSLREPFYK
FT                   NSTFGSVEVFSLDPNKVHKLQAWVMHDIEGASSNACSSSSLNELKMIVQKRNMIFACVD
FT                   NYRPARFLQCVKNPEHPSCRLNT"
FT   gene            complement(17670014..>17670682)
FT                   /locus_tag="mCG_146116"
FT                   /note="gene_id=mCG146116.0"
FT   mRNA            complement(join(17670014..17670237,17670323..17670393,
FT                   17670590..>17670682))
FT                   /locus_tag="mCG_146116"
FT                   /product="mCG146116"
FT                   /note="gene_id=mCG146116.0 transcript_id=mCT186219.0
FT                   created on 14-JUL-2003"
FT   CDS             complement(17670018..>17670221)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146116"
FT                   /product="mCG146116"
FT                   /note="gene_id=mCG146116.0 transcript_id=mCT186219.0
FT                   protein_id=mCP107481.0"
FT                   /protein_id="EDL37597.1"
FT                   /translation="SVFTVSTKRASGWSLPPYRSATPTATTCRLAVPELSRGHLKLKLQ
FT                   FGGNGPLPLLHNPVSGNSKIEP"
FT   gene            17673947..17674835
FT                   /locus_tag="mCG_1046030"
FT                   /note="gene_id=mCG1046030.1"
FT   mRNA            17673947..17674835
FT                   /locus_tag="mCG_1046030"
FT                   /product="mCG1046030"
FT                   /note="gene_id=mCG1046030.1 transcript_id=mCT163734.1
FT                   created on 18-OCT-2002"
FT   CDS             17673969..17674502
FT                   /codon_start=1
FT                   /locus_tag="mCG_1046030"
FT                   /product="mCG1046030"
FT                   /note="gene_id=mCG1046030.1 transcript_id=mCT163734.1
FT                   protein_id=mCP65025.0"
FT                   /db_xref="GOA:Q4G0C5"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="MGI:MGI:106499"
FT                   /db_xref="UniProtKB/TrEMBL:Q4G0C5"
FT                   /protein_id="EDL37598.1"
FT                   /translation="MAVANSSPVNPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQ
FT                   FCTGEFRKDGVPIGYKGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENFKLRH
FT                   SAPGLLSMANSGPSTNGCQFFITCSKCDWLDGKHVVFGKIIDGLLVMRKIENVPTGPNN
FT                   KPKLPVVISQCGEM"
FT   gene            17677549..17679022
FT                   /pseudo
FT                   /locus_tag="mCG_1046130"
FT                   /note="gene_id=mCG1046130.1"
FT   mRNA            17677549..17679022
FT                   /pseudo
FT                   /locus_tag="mCG_1046130"
FT                   /note="gene_id=mCG1046130.1 transcript_id=mCT163834.1
FT                   created on 11-OCT-2002"
FT   gene            complement(17683303..17683937)
FT                   /pseudo
FT                   /locus_tag="mCG_1046065"
FT                   /note="gene_id=mCG1046065.1"
FT   mRNA            complement(17683303..17683937)
FT                   /pseudo
FT                   /locus_tag="mCG_1046065"
FT                   /note="gene_id=mCG1046065.1 transcript_id=mCT163769.1
FT                   created on 16-OCT-2002"
FT   gene            complement(17704527..17705306)
FT                   /pseudo
FT                   /locus_tag="mCG_124142"
FT                   /note="gene_id=mCG124142.1"
FT   mRNA            complement(17704527..17705306)
FT                   /pseudo
FT                   /locus_tag="mCG_124142"
FT                   /note="gene_id=mCG124142.1 transcript_id=mCT125380.1
FT                   created on 03-OCT-2002"
FT   gene            complement(17739089..17742001)
FT                   /gene="Fgfbp1"
FT                   /locus_tag="mCG_14740"
FT                   /note="gene_id=mCG14740.2"
FT   mRNA            complement(join(17739089..17740194,17741939..17742001))
FT                   /gene="Fgfbp1"
FT                   /locus_tag="mCG_14740"
FT                   /product="fibroblast growth factor binding protein 1"
FT                   /note="gene_id=mCG14740.2 transcript_id=mCT19752.2 created
FT                   on 28-SEP-2004"
FT   CDS             complement(17739419..17740174)
FT                   /codon_start=1
FT                   /gene="Fgfbp1"
FT                   /locus_tag="mCG_14740"
FT                   /product="fibroblast growth factor binding protein 1"
FT                   /note="gene_id=mCG14740.2 transcript_id=mCT19752.2
FT                   protein_id=mCP4188.1"
FT                   /protein_id="EDL37599.1"
FT                   /translation="MRLHSLILLSFLLLATQAFSEKVRKRAKNAPHSTAEEGVEGSAPS
FT                   LGKAQNKQRSRTSKSLTHGKFVTKDQATCRWAVTEEEQGISLKVQCTQADQEFSCVFAG
FT                   DPTDCLKHDKDQIYWKQVARTLRKQKNICRNAKSVLKTRVCRKRFPESNLKLVNPNARG
FT                   NTKPRKEKAEVSAREHNKVQEAVSTEPNRVKEDITLNPAATQTMAIRDPECLEDPDVLN
FT                   QRKTALEFCGESWSSICTFFLNMLQATSC"
FT   gene            complement(17753863..17861845)
FT                   /gene="Prom1"
FT                   /locus_tag="mCG_124143"
FT                   /note="gene_id=mCG124143.1"
FT   mRNA            complement(join(17753863..17754738,17755317..17755356,
FT                   17760977..17761045,17761470..17761493,17761986..17762101,
FT                   17765086..17765178,17766365..17766433,17767223..17767303,
FT                   17771395..17771448,17773076..17773168,17774296..17774367,
FT                   17774958..17775104,17776766..17776850,17778493..17778596,
FT                   17781008..17781131,17786883..17787035,17789810..17789969,
FT                   17793144..17793207,17794547..17794621,17797625..17797842,
FT                   17804542..17804631,17805745..17805808,17807727..17807847,
FT                   17816079..17816284,17818863..17818889,17823375..17823433,
FT                   17854619..17854992,17861775..17861845))
FT                   /gene="Prom1"
FT                   /locus_tag="mCG_124143"
FT                   /product="prominin 1, transcript variant mCT173401"
FT                   /note="gene_id=mCG124143.1 transcript_id=mCT173401.0
FT                   created on 20-SEP-2002"
FT   mRNA            complement(join(17753864..17754738,17755317..17755356,
FT                   17760977..17761045,17761470..17761493,17761986..17762101,
FT                   17765086..17765178,17766365..17766433,17767223..17767303,
FT                   17771395..17771448,17773076..17773168,17774296..17774367,
FT                   17774958..17775104,17776766..17776850,17778493..17778596,
FT                   17781008..17781131,17786883..17787035,17789810..17789969,
FT                   17793144..17793207,17794547..17794621,17797625..17797842,
FT                   17804542..17804631,17805745..17805808,17807727..17807847,
FT                   17816079..17816284,17823375..17823433,17854619..17854992,
FT                   17861775..17861808))
FT                   /gene="Prom1"
FT                   /locus_tag="mCG_124143"
FT                   /product="prominin 1, transcript variant mCT125381"
FT                   /note="gene_id=mCG124143.1 transcript_id=mCT125381.1
FT                   created on 20-SEP-2002"
FT   mRNA            complement(join(17754546..17754738,17755317..17755356,
FT                   17761986..17762101,17765086..17765178,17766365..17766433,
FT                   17767223..17767303,17771395..17771448,17773076..17773168,
FT                   17774296..17774367,17774958..17775104,17776766..17776850,
FT                   17778493..17778596,17781008..17781131,17786883..17787035,
FT                   17789810..17789969,17793144..17793207,17794547..17794621,
FT                   17797625..17797842,17804542..17804631,17805745..17805808,
FT                   17807727..17807847,17816079..17816284,17823375..17823433,
FT                   17854619..17854992,17858898..>17859449))
FT                   /gene="Prom1"
FT                   /locus_tag="mCG_124143"
FT                   /product="prominin 1, transcript variant mCT193570"
FT                   /note="gene_id=mCG124143.1 transcript_id=mCT193570.0
FT                   created on 09-MAR-2004"
FT   CDS             complement(join(17755341..17755356,17761986..17762101,
FT                   17765086..17765178,17766365..17766433,17767223..17767303,
FT                   17771395..17771448,17773076..17773168,17774296..17774367,
FT                   17774958..17775104,17776766..17776850,17778493..17778596,
FT                   17781008..17781131,17786883..17787035,17789810..17789969,
FT                   17793144..17793207,17794547..17794621,17797625..17797842,
FT                   17804542..17804631,17805745..17805808,17807727..17807847,
FT                   17816079..17816284,17823375..17823433,17854619..>17854856))
FT                   /codon_start=1
FT                   /gene="Prom1"
FT                   /locus_tag="mCG_124143"
FT                   /product="prominin 1, isoform CRA_b"
FT                   /note="gene_id=mCG124143.1 transcript_id=mCT193570.0
FT                   protein_id=mCP114514.0 isoform=CRA_b"
FT                   /protein_id="EDL37601.1"
FT                   /translation="EIRPTTMALVFSALLLLGLCGKISSEGQPAFHNTPGAMNYELPTT
FT                   KYETQDTFNAGIVGPLYKMVHIFLNVVQPNDFPLDLIKKLIQNKNFDISVDSKEIALYE
FT                   IGVLICAILGLLFIILMPLVGCFFCMCRCCNKCGGEMHQRQKQNAPCRRKCLGLSLLVI
FT                   CLLMSLGIIYGFVANQQTRTRIKGTQKLAKSNFRDFQTLLTETPKQIDYVVEQYTNTKN
FT                   KAFSDLDGIGSVLGGRIKDQLKPKVTPVLEEIKAMATAIKQTKDALQNMSSSLKSLQDA
FT                   ATQLNTNLSSVRNSIENSLSSSDCTSDPASKICDSIRPSLSSLGSSLNSSQLPSVDREL
FT                   NTVTEVDKTDLESLVKRGYTTIDEIPNTIQNQTVDVIKDVKNTLDSISSNIKDMSQSIP
FT                   IEDMLLQVSHYLNNSNRYLNQELPKLEEYDSYWWLGGLIVCFLLTLIVTFFFLGLLCGV
FT                   FGYDKHATPTRRGCVSNTGGIFLMAGVGFGFLFCWILMILVVLTFVVGANVEKLLCEPY
FT                   ENKKLLQVLDTPYLLKEQWQFYLSGMLFNNPDINMTFEQVYRDCKRGRGIYAAFQLENV
FT                   VNVSDHFNIDQISENINTELENLNVNIDSIELLDNTGRKSLEDFAHSGIDTIDYSTYLK
FT                   ETEKSPTEVNLLTFASTLEAKANQLPEGKLKQAFLLDVQNIRAIHQHLLPPVQQSLNTL
FT                   RQSVWTLQQTSNKLPEKVKKILASLDSVQHFLTNNVSLIVIGETKKFGKTILGYFEHYL
FT                   HWVFYAITEKMTSCKPMATAMDSAVNGILCGYVADPLNLFWFGIGKATVLLLPAVIIAI
FT                   KLAKYYRRMDSEDVYDDPSRY"
FT   CDS             complement(join(17755341..17755356,17760977..17761045,
FT                   17761470..17761493,17761986..17762101,17765086..17765178,
FT                   17766365..17766433,17767223..17767303,17771395..17771448,
FT                   17773076..17773168,17774296..17774367,17774958..17775104,
FT                   17776766..17776850,17778493..17778596,17781008..17781131,
FT                   17786883..17787035,17789810..17789969,17793144..17793207,
FT                   17794547..17794621,17797625..17797842,17804542..17804631,
FT                   17805745..17805808,17807727..17807847,17816079..17816284,
FT                   17823375..17823433,17854619..17854838))
FT                   /codon_start=1
FT                   /gene="Prom1"
FT                   /locus_tag="mCG_124143"
FT                   /product="prominin 1, isoform CRA_g"
FT                   /note="gene_id=mCG124143.1 transcript_id=mCT125381.1
FT                   protein_id=mCP65233.1 isoform=CRA_g"
FT                   /db_xref="GOA:G3X9J8"
FT                   /db_xref="InterPro:IPR008795"
FT                   /db_xref="MGI:MGI:1100886"
FT                   /db_xref="UniProtKB/TrEMBL:G3X9J8"
FT                   /protein_id="EDL37606.1"
FT                   /translation="MALVFSALLLLGLCGKISSEGQPAFHNTPGAMNYELPTTKYETQD
FT                   TFNAGIVGPLYKMVHIFLNVVQPNDFPLDLIKKLIQNKNFDISVDSKEIALYEIGVLIC
FT                   AILGLLFIILMPLVGCFFCMCRCCNKCGGEMHQRQKQNAPCRRKCLGLSLLVICLLMSL
FT                   GIIYGFVANQQTRTRIKGTQKLAKSNFRDFQTLLTETPKQIDYVVEQYTNTKNKAFSDL
FT                   DGIGSVLGGRIKDQLKPKVTPVLEEIKAMATAIKQTKDALQNMSSSLKSLQDAATQLNT
FT                   NLSSVRNSIENSLSSSDCTSDPASKICDSIRPSLSSLGSSLNSSQLPSVDRELNTVTEV
FT                   DKTDLESLVKRGYTTIDEIPNTIQNQTVDVIKDVKNTLDSISSNIKDMSQSIPIEDMLL
FT                   QVSHYLNNSNRYLNQELPKLEEYDSYWWLGGLIVCFLLTLIVTFFFLGLLCGVFGYDKH
FT                   ATPTRRGCVSNTGGIFLMAGVGFGFLFCWILMILVVLTFVVGANVEKLLCEPYENKKLL
FT                   QVLDTPYLLKEQWQFYLSGMLFNNPDINMTFEQVYRDCKRGRGIYAAFQLENVVNVSDH
FT                   FNIDQISENINTELENLNVNIDSIELLDNTGRKSLEDFAHSGIDTIDYSTYLKETEKSP
FT                   TEVNLLTFASTLEAKANQLPEGKLKQAFLLDVQNIRAIHQHLLPPVQQSLNTLRQSVWT
FT                   LQQTSNKLPEKVKKILASLDSVQHFLTNNVSLIVIGETKKFGKTILGYFEHYLHWVFYA
FT                   ITEKMTSCKPMATAMDSAVNGILCGYVADPLNLFWFGIGKATVLLLPAVIIAIKLAKYY
FT                   RRMDSEDVYDDVETVPMKNLEIGSNGYHKDHLYGVHNPVMTSPSRY"
FT   CDS             complement(join(17755341..17755356,17760977..17761045,
FT                   17761470..17761493,17761986..17762101,17765086..17765178,
FT                   17766365..17766433,17767223..17767303,17771395..17771448,
FT                   17773076..17773168,17774296..17774367,17774958..17775104,
FT                   17776766..17776850,17778493..17778596,17781008..17781131,
FT                   17786883..17787035,17789810..17789969,17793144..17793207,
FT                   17794547..17794621,17797625..17797842,17804542..17804631,
FT                   17805745..17805808,17807727..17807847,17816079..17816284,
FT                   17818863..17818889,17823375..17823433,17854619..17854838))
FT                   /codon_start=1
FT                   /gene="Prom1"
FT                   /locus_tag="mCG_124143"
FT                   /product="prominin 1, isoform CRA_a"
FT                   /note="gene_id=mCG124143.1 transcript_id=mCT173401.0
FT                   protein_id=mCP96320.0 isoform=CRA_a"
FT                   /db_xref="GOA:G5E8G5"
FT                   /db_xref="InterPro:IPR008795"
FT                   /db_xref="MGI:MGI:1100886"
FT                   /db_xref="UniProtKB/TrEMBL:G5E8G5"
FT                   /protein_id="EDL37600.1"
FT                   /translation="MALVFSALLLLGLCGKISSEGQPAFHNTPGAMNYELPTTKYETQD
FT                   TFNAGIVGPLYKMVHIFLNVVQPNDFPLDLIKKLIQNKNFDISVDSKEPEIIVLALKIA
FT                   LYEIGVLICAILGLLFIILMPLVGCFFCMCRCCNKCGGEMHQRQKQNAPCRRKCLGLSL
FT                   LVICLLMSLGIIYGFVANQQTRTRIKGTQKLAKSNFRDFQTLLTETPKQIDYVVEQYTN
FT                   TKNKAFSDLDGIGSVLGGRIKDQLKPKVTPVLEEIKAMATAIKQTKDALQNMSSSLKSL
FT                   QDAATQLNTNLSSVRNSIENSLSSSDCTSDPASKICDSIRPSLSSLGSSLNSSQLPSVD
FT                   RELNTVTEVDKTDLESLVKRGYTTIDEIPNTIQNQTVDVIKDVKNTLDSISSNIKDMSQ
FT                   SIPIEDMLLQVSHYLNNSNRYLNQELPKLEEYDSYWWLGGLIVCFLLTLIVTFFFLGLL
FT                   CGVFGYDKHATPTRRGCVSNTGGIFLMAGVGFGFLFCWILMILVVLTFVVGANVEKLLC
FT                   EPYENKKLLQVLDTPYLLKEQWQFYLSGMLFNNPDINMTFEQVYRDCKRGRGIYAAFQL
FT                   ENVVNVSDHFNIDQISENINTELENLNVNIDSIELLDNTGRKSLEDFAHSGIDTIDYST
FT                   YLKETEKSPTEVNLLTFASTLEAKANQLPEGKLKQAFLLDVQNIRAIHQHLLPPVQQSL
FT                   NTLRQSVWTLQQTSNKLPEKVKKILASLDSVQHFLTNNVSLIVIGETKKFGKTILGYFE
FT                   HYLHWVFYAITEKMTSCKPMATAMDSAVNGILCGYVADPLNLFWFGIGKATVLLLPAVI
FT                   IAIKLAKYYRRMDSEDVYDDVETVPMKNLEIGSNGYHKDHLYGVHNPVMTSPSRY"
FT   mRNA            complement(join(17761481..17761748,17761986..17762101,
FT                   17765086..17765178,17766365..17766433,17767223..17767303,
FT                   17771395..17771448,17773076..17773168,17774296..17774367,
FT                   17774958..17775104,17776766..17776850,17778493..17778596,
FT                   17781008..17781131,17786883..17787035,17789810..17789969,
FT                   17793144..17793207,17794547..17794621,17797625..17797842,
FT                   17804542..17804631,17805745..17805808,17807727..17807847,
FT                   17816079..17816284,17823375..17823433,17854619..17854992,
FT                   17858898..>17859416))
FT                   /gene="Prom1"
FT                   /locus_tag="mCG_124143"
FT                   /product="prominin 1, transcript variant mCT193571"
FT                   /note="gene_id=mCG124143.1 transcript_id=mCT193571.0
FT                   created on 09-MAR-2004"
FT   mRNA            complement(join(17761643..17761748,17761986..17762101,
FT                   17765086..17765178,17766365..17766433,17767223..17767303,
FT                   17771395..17771448,17773076..17773168,17774296..17774367,
FT                   17774958..17775104,17776766..17776850,17778493..17778596,
FT                   17781008..17781131,17786883..17787035,17789810..17789969,
FT                   17793144..17793207,17797625..17797842,17804542..17804631,
FT                   17805745..17805808,17807727..17807847,17816079..17816269,
FT                   17823375..17823433,17854619..>17854937))
FT                   /gene="Prom1"
FT                   /locus_tag="mCG_124143"
FT                   /product="prominin 1, transcript variant mCT193572"
FT                   /note="gene_id=mCG124143.1 transcript_id=mCT193572.0
FT                   created on 09-MAR-2004"
FT   mRNA            complement(join(17761643..17761748,17761986..17762101,
FT                   17765086..17765178,17766365..17766433,17767223..17767303,
FT                   17771395..17771448,17773076..17773168,17774296..17774367,
FT                   17774958..17775104,17776766..17776850,17778493..17778596,
FT                   17781008..17781131,17786883..17787035,17789810..17789969,
FT                   17793144..17793207,17797625..17797842,17804542..17804631,
FT                   17805745..17805808,17807727..17807847,17816079..17816284,
FT                   17823375..17823433,17854619..>17854937))
FT                   /gene="Prom1"
FT                   /locus_tag="mCG_124143"
FT                   /product="prominin 1, transcript variant mCT193574"
FT                   /note="gene_id=mCG124143.1 transcript_id=mCT193574.0
FT                   created on 09-MAR-2004"
FT   mRNA            complement(join(17761643..17762101,17765086..17765178,
FT                   17766365..17766433,17767223..17767303,17771395..17771448,
FT                   17773076..17773168,17774296..17774367,17774958..17775104,
FT                   17776766..17776850,17778493..17778596,17781008..17781131,
FT                   17786883..17787035,17789810..17789969,17793144..17793207,
FT                   17794547..17794621,17797625..17797842,17804542..17804631,
FT                   17805745..17805808,17807727..17807847,17816079..17816284,
FT                   17823375..17823433,17854619..>17854937))
FT                   /gene="Prom1"
FT                   /locus_tag="mCG_124143"
FT                   /product="prominin 1, transcript variant mCT193573"
FT                   /note="gene_id=mCG124143.1 transcript_id=mCT193573.0
FT                   created on 09-MAR-2004"
FT   CDS             complement(join(17761712..17761748,17761986..17762101,
FT                   17765086..17765178,17766365..17766433,17767223..17767303,
FT                   17771395..17771448,17773076..17773168,17774296..17774367,
FT                   17774958..17775104,17776766..17776850,17778493..17778596,
FT                   17781008..17781131,17786883..17787035,17789810..17789969,
FT                   17793144..17793207,17797625..17797842,17804542..17804631,
FT                   17805745..17805808,17807727..17807847,17816079..17816269,
FT                   17823375..17823433,17854619..>17854856))
FT                   /codon_start=1
FT                   /gene="Prom1"
FT                   /locus_tag="mCG_124143"
FT                   /product="prominin 1, isoform CRA_d"
FT                   /note="gene_id=mCG124143.1 transcript_id=mCT193572.0
FT                   protein_id=mCP114516.0 isoform=CRA_d"
FT                   /protein_id="EDL37603.1"
FT                   /translation="EIRPTTMALVFSALLLLGLCGKISSEGQPAFHNTPGAMNYELPTT
FT                   KYETQDTFNAGIVGPLYKMVHIFLNVVQPNDFPLDLIKKLIQNKNFDISVDSKEIGVLI
FT                   CAILGLLFIILMPLVGCFFCMCRCCNKCGGEMHQRQKQNAPCRRKCLGLSLLVICLLMS
FT                   LGIIYGFVANQQTRTRIKGTQKLAKSNFRDFQTLLTETPKQIDYVVEQYTNTKNKAFSD
FT                   LDGIGSVLGGRIKDQLKPKVTPVLEEIKAMATAIKQTKDALQNMSSSLKSLQDAATQLN
FT                   TNLSSVRNSIENSLSSSDCTSDPASKICDSIRPSLSSLGSSLNSSQGYTTIDEIPNTIQ
FT                   NQTVDVIKDVKNTLDSISSNIKDMSQSIPIEDMLLQVSHYLNNSNRYLNQELPKLEEYD
FT                   SYWWLGGLIVCFLLTLIVTFFFLGLLCGVFGYDKHATPTRRGCVSNTGGIFLMAGVGFG
FT                   FLFCWILMILVVLTFVVGANVEKLLCEPYENKKLLQVLDTPYLLKEQWQFYLSGMLFNN
FT                   PDINMTFEQVYRDCKRGRGIYAAFQLENVVNVSDHFNIDQISENINTELENLNVNIDSI
FT                   ELLDNTGRKSLEDFAHSGIDTIDYSTYLKETEKSPTEVNLLTFASTLEAKANQLPEGKL
FT                   KQAFLLDVQNIRAIHQHLLPPVQQSLNTLRQSVWTLQQTSNKLPEKVKKILASLDSVQH
FT                   FLTNNVSLIVIGETKKFGKTILGYFEHYLHWVFYAITEKMTSCKPMATAMDSAVNGILC
FT                   GYVADPLNLFWFGIGKATVLLLPAVIIAIKLAKYYRRMDSEDVYDDSSVSGMWHFTL"
FT   CDS             complement(join(17761712..17761748,17761986..17762101,
FT                   17765086..17765178,17766365..17766433,17767223..17767303,
FT                   17771395..17771448,17773076..17773168,17774296..17774367,
FT                   17774958..17775104,17776766..17776850,17778493..17778596,
FT                   17781008..17781131,17786883..17787035,17789810..17789969,
FT                   17793144..17793207,17797625..17797842,17804542..17804631,
FT                   17805745..17805808,17807727..17807847,17816079..17816284,
FT                   17823375..17823433,17854619..>17854856))
FT                   /codon_start=1
FT                   /gene="Prom1"
FT                   /locus_tag="mCG_124143"
FT                   /product="prominin 1, isoform CRA_f"
FT                   /note="gene_id=mCG124143.1 transcript_id=mCT193574.0
FT                   protein_id=mCP114518.0 isoform=CRA_f"
FT                   /protein_id="EDL37605.1"
FT                   /translation="EIRPTTMALVFSALLLLGLCGKISSEGQPAFHNTPGAMNYELPTT
FT                   KYETQDTFNAGIVGPLYKMVHIFLNVVQPNDFPLDLIKKLIQNKNFDISVDSKEIALYE
FT                   IGVLICAILGLLFIILMPLVGCFFCMCRCCNKCGGEMHQRQKQNAPCRRKCLGLSLLVI
FT                   CLLMSLGIIYGFVANQQTRTRIKGTQKLAKSNFRDFQTLLTETPKQIDYVVEQYTNTKN
FT                   KAFSDLDGIGSVLGGRIKDQLKPKVTPVLEEIKAMATAIKQTKDALQNMSSSLKSLQDA
FT                   ATQLNTNLSSVRNSIENSLSSSDCTSDPASKICDSIRPSLSSLGSSLNSSQGYTTIDEI
FT                   PNTIQNQTVDVIKDVKNTLDSISSNIKDMSQSIPIEDMLLQVSHYLNNSNRYLNQELPK
FT                   LEEYDSYWWLGGLIVCFLLTLIVTFFFLGLLCGVFGYDKHATPTRRGCVSNTGGIFLMA
FT                   GVGFGFLFCWILMILVVLTFVVGANVEKLLCEPYENKKLLQVLDTPYLLKEQWQFYLSG
FT                   MLFNNPDINMTFEQVYRDCKRGRGIYAAFQLENVVNVSDHFNIDQISENINTELENLNV
FT                   NIDSIELLDNTGRKSLEDFAHSGIDTIDYSTYLKETEKSPTEVNLLTFASTLEAKANQL
FT                   PEGKLKQAFLLDVQNIRAIHQHLLPPVQQSLNTLRQSVWTLQQTSNKLPEKVKKILASL
FT                   DSVQHFLTNNVSLIVIGETKKFGKTILGYFEHYLHWVFYAITEKMTSCKPMATAMDSAV
FT                   NGILCGYVADPLNLFWFGIGKATVLLLPAVIIAIKLAKYYRRMDSEDVYDDSSVSGMWH
FT                   FTL"
FT   CDS             complement(join(17761712..17761748,17761986..17762101,
FT                   17765086..17765178,17766365..17766433,17767223..17767303,
FT                   17771395..17771448,17773076..17773168,17774296..17774367,
FT                   17774958..17775104,17776766..17776850,17778493..17778596,
FT                   17781008..17781131,17786883..17787035,17789810..17789969,
FT                   17793144..17793207,17794547..17794621,17797625..17797842,
FT                   17804542..17804631,17805745..17805808,17807727..17807847,
FT                   17816079..17816284,17823375..17823433,17854619..>17854856))
FT                   /codon_start=1
FT                   /gene="Prom1"
FT                   /locus_tag="mCG_124143"
FT                   /product="prominin 1, isoform CRA_c"
FT                   /note="gene_id=mCG124143.1 transcript_id=mCT193571.0
FT                   protein_id=mCP114515.0 isoform=CRA_c"
FT                   /protein_id="EDL37602.1"
FT                   /translation="EIRPTTMALVFSALLLLGLCGKISSEGQPAFHNTPGAMNYELPTT
FT                   KYETQDTFNAGIVGPLYKMVHIFLNVVQPNDFPLDLIKKLIQNKNFDISVDSKEIALYE
FT                   IGVLICAILGLLFIILMPLVGCFFCMCRCCNKCGGEMHQRQKQNAPCRRKCLGLSLLVI
FT                   CLLMSLGIIYGFVANQQTRTRIKGTQKLAKSNFRDFQTLLTETPKQIDYVVEQYTNTKN
FT                   KAFSDLDGIGSVLGGRIKDQLKPKVTPVLEEIKAMATAIKQTKDALQNMSSSLKSLQDA
FT                   ATQLNTNLSSVRNSIENSLSSSDCTSDPASKICDSIRPSLSSLGSSLNSSQLPSVDREL
FT                   NTVTEVDKTDLESLVKRGYTTIDEIPNTIQNQTVDVIKDVKNTLDSISSNIKDMSQSIP
FT                   IEDMLLQVSHYLNNSNRYLNQELPKLEEYDSYWWLGGLIVCFLLTLIVTFFFLGLLCGV
FT                   FGYDKHATPTRRGCVSNTGGIFLMAGVGFGFLFCWILMILVVLTFVVGANVEKLLCEPY
FT                   ENKKLLQVLDTPYLLKEQWQFYLSGMLFNNPDINMTFEQVYRDCKRGRGIYAAFQLENV
FT                   VNVSDHFNIDQISENINTELENLNVNIDSIELLDNTGRKSLEDFAHSGIDTIDYSTYLK
FT                   ETEKSPTEVNLLTFASTLEAKANQLPEGKLKQAFLLDVQNIRAIHQHLLPPVQQSLNTL
FT                   RQSVWTLQQTSNKLPEKVKKILASLDSVQHFLTNNVSLIVIGETKKFGKTILGYFEHYL
FT                   HWVFYAITEKMTSCKPMATAMDSAVNGILCGYVADPLNLFWFGIGKATVLLLPAVIIAI
FT                   KLAKYYRRMDSEDVYDDSSVSGMWHFTL"
FT   CDS             complement(join(17761982..17762101,17765086..17765178,
FT                   17766365..17766433,17767223..17767303,17771395..17771448,
FT                   17773076..17773168,17774296..17774367,17774958..17775104,
FT                   17776766..17776850,17778493..17778596,17781008..17781131,
FT                   17786883..17787035,17789810..17789969,17793144..17793207,
FT                   17794547..17794621,17797625..17797842,17804542..17804631,
FT                   17805745..17805808,17807727..17807847,17816079..17816284,
FT                   17823375..17823433,17854619..>17854856))
FT                   /codon_start=1
FT                   /gene="Prom1"
FT                   /locus_tag="mCG_124143"
FT                   /product="prominin 1, isoform CRA_e"
FT                   /note="gene_id=mCG124143.1 transcript_id=mCT193573.0
FT                   protein_id=mCP114517.0 isoform=CRA_e"
FT                   /protein_id="EDL37604.1"
FT                   /translation="EIRPTTMALVFSALLLLGLCGKISSEGQPAFHNTPGAMNYELPTT
FT                   KYETQDTFNAGIVGPLYKMVHIFLNVVQPNDFPLDLIKKLIQNKNFDISVDSKEIALYE
FT                   IGVLICAILGLLFIILMPLVGCFFCMCRCCNKCGGEMHQRQKQNAPCRRKCLGLSLLVI
FT                   CLLMSLGIIYGFVANQQTRTRIKGTQKLAKSNFRDFQTLLTETPKQIDYVVEQYTNTKN
FT                   KAFSDLDGIGSVLGGRIKDQLKPKVTPVLEEIKAMATAIKQTKDALQNMSSSLKSLQDA
FT                   ATQLNTNLSSVRNSIENSLSSSDCTSDPASKICDSIRPSLSSLGSSLNSSQLPSVDREL
FT                   NTVTEVDKTDLESLVKRGYTTIDEIPNTIQNQTVDVIKDVKNTLDSISSNIKDMSQSIP
FT                   IEDMLLQVSHYLNNSNRYLNQELPKLEEYDSYWWLGGLIVCFLLTLIVTFFFLGLLCGV
FT                   FGYDKHATPTRRGCVSNTGGIFLMAGVGFGFLFCWILMILVVLTFVVGANVEKLLCEPY
FT                   ENKKLLQVLDTPYLLKEQWQFYLSGMLFNNPDINMTFEQVYRDCKRGRGIYAAFQLENV
FT                   VNVSDHFNIDQISENINTELENLNVNIDSIELLDNTGRKSLEDFAHSGIDTIDYSTYLK
FT                   ETEKSPTEVNLLTFASTLEAKANQLPEGKLKQAFLLDVQNIRAIHQHLLPPVQQSLNTL
FT                   RQSVWTLQQTSNKLPEKVKKILASLDSVQHFLTNNVSLIVIGETKKFGKTILGYFEHYL
FT                   HWVFYAITEKMTSCKPMATAMDSAVNGILCGYVADPLNLFWFGIGKATVLLLPAVIIAI
FT                   KLAKYYRRMDSEDVYDE"
FT   gene            complement(17859879..>17862086)
FT                   /locus_tag="mCG_146110"
FT                   /note="gene_id=mCG146110.0"
FT   mRNA            complement(join(17859879..17860121,17860218..17860457,
FT                   17860563..17860704,17862061..>17862086))
FT                   /locus_tag="mCG_146110"
FT                   /product="mCG146110"
FT                   /note="gene_id=mCG146110.0 transcript_id=mCT186213.0
FT                   created on 14-JUL-2003"
FT   CDS             complement(join(17860038..17860121,17860218..>17860337))
FT                   /codon_start=1
FT                   /locus_tag="mCG_146110"
FT                   /product="mCG146110"
FT                   /note="gene_id=mCG146110.0 transcript_id=mCT186213.0
FT                   protein_id=mCP107475.0"
FT                   /protein_id="EDL37607.1"
FT                   /translation="PVNPMQKPTSQSEATVTVTGLVSGSRDLVPFETVFLLFSKFSEVN
FT                   RSKDGLTTLGAGEKAQLLGALD"
FT   gene            complement(17926214..>17977601)
FT                   /gene="4932414K18Rik"
FT                   /locus_tag="mCG_124149"
FT                   /note="gene_id=mCG124149.0"
FT   mRNA            complement(join(17926214..17928233,17929912..17930072,
FT                   17933739..17933815,17935622..17935690,17935996..17936055,
FT                   17937273..17937382,17939660..17939740,17943106..17943175,
FT                   17943393..17943490,17944141..17944348,17945274..17945408,
FT                   17969119..17969249,17977428..>17977601))
FT                   /gene="4932414K18Rik"
FT                   /locus_tag="mCG_124149"
FT                   /product="RIKEN cDNA 4932414K18, transcript variant
FT                   mCT125387"
FT                   /note="gene_id=mCG124149.0 transcript_id=mCT125387.1
FT                   created on 03-OCT-2002"
FT   CDS             complement(join(17928004..17928233,17929912..17930072,
FT                   17933739..17933815,17935622..17935690,17935996..17936055,
FT                   17937273..17937382,17939660..17939740,17943106..17943175,
FT                   17943393..17943490,17944141..17944348,17945274..17945408,
FT                   17969119..17969249,17977428..>17977599))
FT                   /codon_start=1
FT                   /gene="4932414K18Rik"
FT                   /locus_tag="mCG_124149"
FT                   /product="RIKEN cDNA 4932414K18, isoform CRA_b"
FT                   /note="gene_id=mCG124149.0 transcript_id=mCT125387.1
FT                   protein_id=mCP64878.1 isoform=CRA_b"
FT                   /protein_id="EDL37609.1"
FT                   /translation="AAAPGEGGGGGADGPERTGRGEAEQPGGGGHGPAPQHTETLGFYE
FT                   SDRRREKRRGRAELSLLRFLSAELTRGYFLEHNEAKYTERRERVYTCMRIPRELEKVCD
FT                   ILKGVILVICYFMMHYVDYSMMYHLIRGQSVIKLYIIYNMLEVADRLFSSFGQDILDAL
FT                   YWTATEPKERKRAHIGVIPHFFMAVLYVCILLGLEGTPATRAALFAHPCTEWVLHAILI
FT                   MVQATTLNVAFNSHNKSLLTIMMSNNFVEIKGSVFKKFEKNNLFQMSNSDIKERFTNYV
FT                   LLLIVCLRNMEQFSWNPDHLWVLFPDVCMVIASEIAVDIVKHAFITKFNDITADVYSEY
FT                   RASLAFDLVSSRQKNAYTDYSDSVARRMGFIPLPLAVLLIRVVTSSIKVQGILSYACVI
FT                   LFYFGLISLKILNSIVLLGKSCQYVKEAKMEEKLFNPPPASTPGKPSSKSQSKGKPSQG
FT                   LSTEENLSASVTSQPGHQKENVIPLLVTSNSDQFLTTPDGDEKDITQENSELKHRSSKK
FT                   DLLEIDRFTICGNRID"
FT   mRNA            complement(join(17944273..17944348,17945274..17945436,
FT                   17950327..17950392,17955224..17955342,17969119..>17969227))
FT                   /gene="4932414K18Rik"
FT                   /locus_tag="mCG_124149"
FT                   /product="RIKEN cDNA 4932414K18, transcript variant
FT                   mCT174526"
FT                   /note="gene_id=mCG124149.0 transcript_id=mCT174526.0
FT                   created on 03-OCT-2002"
FT   CDS             complement(join(17945401..17945436,17950327..17950392,
FT                   17955224..17955342,17969119..>17969185))
FT                   /codon_start=1
FT                   /gene="4932414K18Rik"
FT                   /locus_tag="mCG_124149"
FT                   /product="RIKEN cDNA 4932414K18, isoform CRA_a"
FT                   /note="gene_id=mCG124149.0 transcript_id=mCT174526.0
FT                   protein_id=mCP97445.0 isoform=CRA_a"
FT                   /protein_id="EDL37608.1"
FT                   /translation="SQVYRAKRKGVHLYANTKRIGKAHVLWNIFVPRCLSVCVHPASFK
FT                   SLSGAIQAPHSALLWLKTEGRSTFTSFIGWSVVAQGLLVGPTSASARTGV"
FT   gene            <17970698..17975017
FT                   /locus_tag="mCG_144988"
FT                   /note="gene_id=mCG144988.0"
FT   mRNA            join(<17970698..17970755,17971662..17971747,
FT                   17974475..17975017)
FT                   /locus_tag="mCG_144988"
FT                   /product="mCG144988"
FT                   /note="gene_id=mCG144988.0 transcript_id=mCT184412.0
FT                   created on 05-JUN-2003"
FT   CDS             <17974581..17974730
FT                   /codon_start=1
FT                   /locus_tag="mCG_144988"
FT                   /product="mCG144988"
FT                   /note="gene_id=mCG144988.0 transcript_id=mCT184412.0
FT                   protein_id=mCP105597.0"
FT                   /protein_id="EDL37610.1"
FT                   /translation="SRAKWIKQAVYEVQQQNQVKKTEFRILSPTWTCSSLTARAIHGYA
FT                   ESFT"
FT   gene            complement(18160672..18162177)
FT                   /pseudo
FT                   /locus_tag="mCG_123612"
FT                   /note="gene_id=mCG123612.1"
FT   mRNA            complement(18160672..18162177)
FT                   /pseudo
FT                   /locus_tag="mCG_123612"
FT                   /note="gene_id=mCG123612.1 transcript_id=mCT124845.1
FT                   created on 03-OCT-2002"
FT   gene            complement(<18168226..>18183000)
FT                   /locus_tag="mCG_144987"
FT                   /note="gene_id=mCG144987.0"
FT   mRNA            complement(join(<18168226..18168473,18169030..18169114,
FT                   18182121..18182464,18182758..>18183000))
FT                   /locus_tag="mCG_144987"
FT                   /product="mCG144987"
FT                   /note="gene_id=mCG144987.0 transcript_id=mCT184411.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(<18168226..>18168379)
FT                   /codon_start=1
FT                   /locus_tag="mCG_144987"
FT                   /product="mCG144987"
FT                   /note="gene_id=mCG144987.0 transcript_id=mCT184411.0
FT                   protein_id=mCP105596.0"
FT                   /protein_id="EDL37611.1"
FT                   /translation="RFSYSNAKICCLIPRLTCIPNVHTLLYSYSNLYLYFINVFSLFII
FT                   KFTPEA"
FT   gene            complement(18226584..18565380)
FT                   /gene="Ldb2"
FT                   /locus_tag="mCG_14734"
FT                   /note="gene_id=mCG14734.2"
FT   mRNA            complement(join(18226584..18227403,18233062..18233213,
FT                   18234195..18234318,18293491..18293574,18295868..18295990,
FT                   18302513..18302685,18429730..18429832,18565123..18565380))
FT                   /gene="Ldb2"
FT                   /locus_tag="mCG_14734"
FT                   /product="LIM domain binding 2"
FT                   /note="gene_id=mCG14734.2 transcript_id=mCT19746.1 created
FT                   on 20-SEP-2002"
FT   CDS             complement(join(18227173..18227403,18233062..18233213,
FT                   18234195..18234318,18293491..18293574,18295868..18295990,
FT                   18302513..18302685,18429730..18429832,18565123..18565254))
FT                   /codon_start=1
FT                   /gene="Ldb2"
FT                   /locus_tag="mCG_14734"
FT                   /product="LIM domain binding 2"
FT                   /note="gene_id=mCG14734.2 transcript_id=mCT19746.1
FT                   protein_id=mCP4190.1"
FT                   /protein_id="EDL37612.1"
FT                   /translation="MSSTPHDPFYSSPFGPFYRRHTPYMVQPEYRIYEMNKRLQSRTED
FT                   SDNLWWDAFATEFFEDDATLTLSFCLEDGPKRYTIGRTLIPRYFSTVFEGGVTDLYYIL
FT                   KHSKESYHNSSITVDCDQCAMVTQHGKPMFTKVCTEGRLILEFTFDDLMRIKTWHFTIR
FT                   QYRELVPRSILAMHAQDPQVLDQLSKNITRMGLTNFTLNYLRLCVILEPMQELMSRHKT
FT                   YNLSPRDCLKTCLFQKWQRMVAPPAEPTRQPTTKRRKRKNSTSSTSNSSAGNTTNSAGS
FT                   KKKTPAASLSLATQVPDVMVVGEPTLMGGEFGDEDERLITRLENTQYDAANGMDDEEDF
FT                   NNSPALGNNSPWNSKPPATQETKSENAPPQASQ"
FT   gene            <18402180..18422548
FT                   /locus_tag="mCG_145578"
FT                   /note="gene_id=mCG145578.0"
FT   mRNA            join(<18402180..18402258,18412375..18412463,
FT                   18419451..18419583,18420821..18422548)
FT                   /locus_tag="mCG_145578"
FT                   /product="mCG145578"
FT                   /note="gene_id=mCG145578.0 transcript_id=mCT185002.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<18402180..18402258,18412375..18412463,
FT                   18419451..18419573)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145578"
FT                   /product="mCG145578"
FT                   /note="gene_id=mCG145578.0 transcript_id=mCT185002.0
FT                   protein_id=mCP105609.0"
FT                   /protein_id="EDL37613.1"
FT                   /translation="SLNNTEDPLLRGLPLAFQTGSLQKAICIVEMALWVKDSPSSKVTR
FT                   GGAIIIHVSTRRLFPMKKRPENTSSQVTDDQKLVFQNNSNKMYIWRCEFHF"
FT   gene            complement(18466849..18472747)
FT                   /locus_tag="mCG_148298"
FT                   /note="gene_id=mCG148298.0"
FT   mRNA            complement(join(18466849..18467194,18471877..18472747))
FT                   /locus_tag="mCG_148298"
FT                   /product="mCG148298"
FT                   /note="gene_id=mCG148298.0 transcript_id=mCT188561.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(join(18467155..18467194,18471877..18472112))
FT                   /codon_start=1
FT                   /locus_tag="mCG_148298"
FT                   /product="mCG148298"
FT                   /note="gene_id=mCG148298.0 transcript_id=mCT188561.0
FT                   protein_id=mCP109212.0"
FT                   /protein_id="EDL37614.1"
FT                   /translation="MVSFTSSFIYSDNIELDYILYHIFCLELGMNTQGSQSKAVLALPS
FT                   LHAVKCGLQQLSRLVTRGKDYVTQSSRAFWEPSGCAVFQPCSVRSQ"
FT   gene            18727106..18739723
FT                   /locus_tag="mCG_65884"
FT                   /note="gene_id=mCG65884.1"
FT   mRNA            join(18727106..18727217,18727442..18727495,
FT                   18727697..18728041,18728688..18728857,18732466..18732501,
FT                   18732977..18733176,18733538..18733666,18734403..18734526,
FT                   18737976..18738080,18738736..18739723)
FT                   /locus_tag="mCG_65884"
FT                   /product="mCG65884"
FT                   /note="gene_id=mCG65884.1 transcript_id=mCT66067.1 created
FT                   on 01-OCT-2002"
FT   CDS             join(18727490..18727495,18727697..18728041,
FT                   18728688..18728765)
FT                   /codon_start=1
FT                   /locus_tag="mCG_65884"
FT                   /product="mCG65884"
FT                   /note="gene_id=mCG65884.1 transcript_id=mCT66067.1
FT                   protein_id=mCP27190.2"
FT                   /protein_id="EDL37615.1"
FT                   /translation="MMGRCTVIWCLDLLLAEDEGPKQDLSQKLCCFGQEGGGLSGAEDG
FT                   AASEALWLSPGPEKAGLCIPHRHPCSLPSAESRRQGGSRQGLRQKLLGPGGPLCSHQEG
FT                   GQLSGAEEWRCPVKLVYELSQMLGPSKGAEKAETEDSS"
FT   gene            complement(18878346..18943443)
FT                   /locus_tag="mCG_1046133"
FT                   /note="gene_id=mCG1046133.0"
FT   mRNA            complement(join(18878346..18878555,18879369..18879479,
FT                   18922659..18922826,18931063..18931220,18937116..18937352,
FT                   18943295..18943443))
FT                   /locus_tag="mCG_1046133"
FT                   /product="mCG1046133"
FT                   /note="gene_id=mCG1046133.0 transcript_id=mCT163837.0
FT                   created on 01-OCT-2002"
FT   CDS             complement(join(18931111..18931220,18937116..18937314))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1046133"
FT                   /product="mCG1046133"
FT                   /note="gene_id=mCG1046133.0 transcript_id=mCT163837.0
FT                   protein_id=mCP65182.1"
FT                   /protein_id="EDL37616.1"
FT                   /translation="MGAGSMWQRKLLTFWKPGNKEWDRKGWDPKCRFMNMLHGHAHSDL
FT                   FPMMLLVEAEGSEIQSSSQRHTNGGTCIDSWLLKMMRVVTFLPGPCCWGRPLCGLLL"
FT   gene            complement(19191229..19207419)
FT                   /gene="Qdpr"
FT                   /locus_tag="mCG_21480"
FT                   /note="gene_id=mCG21480.1"
FT   mRNA            complement(join(19191229..19191857,19195021..19195104,
FT                   19196463..19196571,19200622..19200762,19201843..19201939,
FT                   19204772..19204864,19207203..19207419))
FT                   /gene="Qdpr"
FT                   /locus_tag="mCG_21480"
FT                   /product="quininoid dihydropteridine reductase, transcript
FT                   variant mCT22133"
FT                   /note="gene_id=mCG21480.1 transcript_id=mCT22133.1 created
FT                   on 18-FEB-2003"
FT   mRNA            complement(join(19191229..19191857,19196463..19196571,
FT                   19200622..19200762,19201843..19201939,19204772..19204864,
FT                   19207203..19207370))
FT                   /gene="Qdpr"
FT                   /locus_tag="mCG_21480"
FT                   /product="quininoid dihydropteridine reductase, transcript
FT                   variant mCT173708"
FT                   /note="gene_id=mCG21480.1 transcript_id=mCT173708.0 created
FT                   on 18-FEB-2003"
FT   mRNA            complement(join(19191621..19191857,19195021..19195104,
FT                   19196463..19196571,19200622..19200762,19201843..19201939,
FT                   19204772..19204864,19207286..>19207367))
FT                   /gene="Qdpr"
FT                   /locus_tag="mCG_21480"
FT                   /product="quininoid dihydropteridine reductase, transcript
FT                   variant mCT193579"
FT                   /note="gene_id=mCG21480.1 transcript_id=mCT193579.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(19191701..19191857,19195021..19195104,
FT                   19196463..19196571,19200622..19200762,19201843..19201939,
FT                   19204772..19204864,19207078..>19207161))
FT                   /gene="Qdpr"
FT                   /locus_tag="mCG_21480"
FT                   /product="quininoid dihydropteridine reductase, transcript
FT                   variant mCT180255"
FT                   /note="gene_id=mCG21480.1 transcript_id=mCT180255.0 created
FT                   on 18-FEB-2003"
FT   CDS             complement(join(19191752..19191857,19195021..19195104,
FT                   19196463..19196571,19200622..19200762,19201843..19201939,
FT                   19204772..19204864,19207286..>19207366))
FT                   /codon_start=1
FT                   /gene="Qdpr"
FT                   /locus_tag="mCG_21480"
FT                   /product="quininoid dihydropteridine reductase, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG21480.1 transcript_id=mCT193579.0
FT                   protein_id=mCP114535.0 isoform=CRA_c"
FT                   /protein_id="EDL37619.1"
FT                   /translation="GSCEPRSAFGLAVQYRASLSGAGWRLQWVASIDVVENEEASASVV
FT                   VKMTDSFTEQADQVTADVGKLLGDQKVDAILCVAGGWAGGNAKSKSLFKNCDMMWKQSM
FT                   WTSTISSHLATKHLKEGGLLTLAGAKAALDGTPGMIGYGMAKGAVHQLCQSLAGKNSGM
FT                   PPGAAAIAVLPVTLDTPMNRKSMPEADFSSWTPLEFLVETFHDWITGNKRPNSGSLIQV
FT                   VTTDGKTELTPAYF"
FT   CDS             complement(join(19191752..19191857,19196463..19196571,
FT                   19200622..19200762,19201843..19201939,19204772..19204864,
FT                   19207203..19207298))
FT                   /codon_start=1
FT                   /gene="Qdpr"
FT                   /locus_tag="mCG_21480"
FT                   /product="quininoid dihydropteridine reductase, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG21480.1 transcript_id=mCT173708.0
FT                   protein_id=mCP96627.0 isoform=CRA_a"
FT                   /protein_id="EDL37617.1"
FT                   /translation="MAASGEARRVLVYGGRGALGSRCVQAFRARNWWVASIDVVENEEA
FT                   SASVVVKMTDSFTEQADQVTADVGKLLGDQKVDAILCVAGGWAGGNAKSKSLFKNCDMM
FT                   WKQSMWTSTISSHLATKHLKEGGLLTLAGAKAALDGTPGMIGYGMAKGAVHQLCQSLAG
FT                   KNSGMPPGAAAIAVLPTFHDWITGNKRPNSGSLIQVVTTDGKTELTPAYF"
FT   CDS             complement(join(19191752..19191857,19195021..19195104,
FT                   19196463..19196571,19200622..19200762,19201843..19201939,
FT                   19204772..19204864,19207203..19207298))
FT                   /codon_start=1
FT                   /gene="Qdpr"
FT                   /locus_tag="mCG_21480"
FT                   /product="quininoid dihydropteridine reductase, isoform
FT                   CRA_d"
FT                   /note="gene_id=mCG21480.1 transcript_id=mCT22133.1
FT                   protein_id=mCP4164.2 isoform=CRA_d"
FT                   /protein_id="EDL37620.1"
FT                   /translation="MAASGEARRVLVYGGRGALGSRCVQAFRARNWWVASIDVVENEEA
FT                   SASVVVKMTDSFTEQADQVTADVGKLLGDQKVDAILCVAGGWAGGNAKSKSLFKNCDMM
FT                   WKQSMWTSTISSHLATKHLKEGGLLTLAGAKAALDGTPGMIGYGMAKGAVHQLCQSLAG
FT                   KNSGMPPGAAAIAVLPVTLDTPMNRKSMPEADFSSWTPLEFLVETFHDWITGNKRPNSG
FT                   SLIQVVTTDGKTELTPAYF"
FT   CDS             complement(join(19191752..19191857,19195021..19195104,
FT                   19196463..19196571,19200622..19200762,19201843..19201939,
FT                   19204772..19204864,19207078..>19207161))
FT                   /codon_start=1
FT                   /gene="Qdpr"
FT                   /locus_tag="mCG_21480"
FT                   /product="quininoid dihydropteridine reductase, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG21480.1 transcript_id=mCT180255.0
FT                   protein_id=mCP103177.0 isoform=CRA_b"
FT                   /protein_id="EDL37618.1"
FT                   /translation="SSGEIGDCRPCARVTRLHAHAPVCSGSQWVASIDVVENEEASASV
FT                   VVKMTDSFTEQADQVTADVGKLLGDQKVDAILCVAGGWAGGNAKSKSLFKNCDMMWKQS
FT                   MWTSTISSHLATKHLKEGGLLTLAGAKAALDGTPGMIGYGMAKGAVHQLCQSLAGKNSG
FT                   MPPGAAAIAVLPVTLDTPMNRKSMPEADFSSWTPLEFLVETFHDWITGNKRPNSGSLIQ
FT                   VVTTDGKTELTPAYF"
FT   gene            19250605..19269883
FT                   /gene="Lap3"
FT                   /locus_tag="mCG_21481"
FT                   /note="gene_id=mCG21481.2"
FT   mRNA            join(19250605..19250771,19252376..19252491,
FT                   19254130..19254184,19254539..19254644,19255644..19255803,
FT                   19257613..19257777,19260589..19260747,19261932..19262056,
FT                   19263383..19263471,19264316..19264418,19266646..19266725,
FT                   19268316..19268425,19269089..19269883)
FT                   /gene="Lap3"
FT                   /locus_tag="mCG_21481"
FT                   /product="leucine aminopeptidase 3"
FT                   /note="gene_id=mCG21481.2 transcript_id=mCT22134.1 created
FT                   on 20-SEP-2002"
FT   CDS             join(19250670..19250771,19252376..19252491,
FT                   19254130..19254184,19254539..19254644,19255644..19255803,
FT                   19257613..19257777,19260589..19260747,19261932..19262056,
FT                   19263383..19263471,19264316..19264418,19266646..19266725,
FT                   19268316..19268425,19269089..19269278)
FT                   /codon_start=1
FT                   /gene="Lap3"
FT                   /locus_tag="mCG_21481"
FT                   /product="leucine aminopeptidase 3"
FT                   /note="gene_id=mCG21481.2 transcript_id=mCT22134.1
FT                   protein_id=mCP4158.1"
FT                   /protein_id="EDL37621.1"
FT                   /translation="MYLLPLPAAARVALRRLGVRGLWDRGLSTADMTKGLVLGIYAKDK
FT                   DDDLPQFTSAGESFNKLVSGKLREMLNISGPPLKAGKTRTFYGLHQDFPSVVVVGLGKR
FT                   SAGVDDQENWHEGKENIRAAVAAGCRQVQDLELPSVEVDPCGDAQAAAEGAVLGLYEYD
FT                   DLKQKKKVAVSAKLHGSGDLEAWEKGVLFASGQNLARHLMESPANEMTPTRFAEIIEKN
FT                   LKSASSKTKVHIRPKSWIEEQEMGSFLSVAKGSEEPPVFLEIHYMGSPNATEAPLVFVG
FT                   KGITFDSGGISIKASANMDLMRADMGGAATICSAIVSAAKLNLPINIIGLAPLCENMPS
FT                   GKANKPGDVVRARNGKTIQVDNTDAEGRLILADALCYAHTFNPKVIINAATLTGAMDVA
FT                   LGSGATGVFTNSSWLWNKLFEASVETGDRVWRMPLFEHYTRQVIDCQLADVNNLGKYRS
FT                   AGACTAAAFLREFVTHTKWAHLDIAGVMTNKDEIPYLRKGMSGRPTRTLIEFLLRFSKD
FT                   SS"
FT   gene            complement(19274984..19276034)
FT                   /pseudo
FT                   /locus_tag="mCG_1046134"
FT                   /note="gene_id=mCG1046134.0"
FT   mRNA            complement(join(19274984..19275102,19275862..19276034))
FT                   /pseudo
FT                   /locus_tag="mCG_1046134"
FT                   /note="gene_id=mCG1046134.0 transcript_id=mCT163838.0
FT                   created on 11-OCT-2002"
FT   gene            19277514..19284223
FT                   /gene="Med28"
FT                   /locus_tag="mCG_21482"
FT                   /note="gene_id=mCG21482.2"
FT   mRNA            join(19277514..19277714,19279666..19279732,
FT                   19280652..19280764,19282384..19284223)
FT                   /gene="Med28"
FT                   /locus_tag="mCG_21482"
FT                   /product="mediator of RNA polymerase II transcription,
FT                   subunit 28 homolog (yeast)"
FT                   /note="gene_id=mCG21482.2 transcript_id=mCT22261.2 created
FT                   on 20-SEP-2002"
FT   CDS             join(19277556..19277714,19279666..19279732,
FT                   19280652..19280764,19282384..19282581)
FT                   /codon_start=1
FT                   /gene="Med28"
FT                   /locus_tag="mCG_21482"
FT                   /product="mediator of RNA polymerase II transcription,
FT                   subunit 28 homolog (yeast)"
FT                   /note="gene_id=mCG21482.2 transcript_id=mCT22261.2
FT                   protein_id=mCP4170.1"
FT                   /protein_id="EDL37622.1"
FT                   /translation="MAASLGGMFTGQPPGPPPPPPGLPGQASLLQAAPGAPRPSNSTLV
FT                   DELESSFEACFASLVSQDYVNGTDQEEIRTGVDQCIQKFLDIARQTECFFLQKRLQLSV
FT                   QKPDQVIKEDVSELRSELQRKDALVQKHLTKLRHWQQVLEDINVQHKKPADMPQGSLAF
FT                   LEQASANIPAPLKQT"
FT   gene            complement(19286937..19291475)
FT                   /locus_tag="mCG_148306"
FT                   /note="gene_id=mCG148306.0"
FT   mRNA            complement(join(19286937..19288061,19288989..19291475))
FT                   /locus_tag="mCG_148306"
FT                   /product="mCG148306"
FT                   /note="gene_id=mCG148306.0 transcript_id=mCT188569.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(19287242..19287646)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148306"
FT                   /product="mCG148306"
FT                   /note="gene_id=mCG148306.0 transcript_id=mCT188569.0
FT                   protein_id=mCP109221.0"
FT                   /protein_id="EDL37623.1"
FT                   /translation="MVCFKNIFSLVISTQSYDYIYMHMYICICIYNSKCTSNLKMKRNK
FT                   IKVQYKRKANENKTPNLPGMDCSTLGLHVLTSKVWHRPQTAEGHHLPQTALHKIKQHTI
FT                   KSDLECSVNNCASCYTSQLRCIMLSLCKGF"
FT   gene            complement(19309899..19394032)
FT                   /locus_tag="mCG_21476"
FT                   /note="gene_id=mCG21476.1"
FT   mRNA            complement(join(19309899..19310544,19312423..19312514,
FT                   19327566..19327676,19334882..19335085,19335851..19335978,
FT                   19337139..19337274,19338320..19339078,19393700..19394032))
FT                   /locus_tag="mCG_21476"
FT                   /product="mCG21476"
FT                   /note="gene_id=mCG21476.1 transcript_id=mCT22129.1 created
FT                   on 20-SEP-2002"
FT   CDS             complement(join(19310331..19310544,19312423..19312514,
FT                   19327566..19327676,19334882..19335085,19335851..19335978,
FT                   19337139..19337274,19338320..19339078,19393700..19393846))
FT                   /codon_start=1
FT                   /locus_tag="mCG_21476"
FT                   /product="mCG21476"
FT                   /note="gene_id=mCG21476.1 transcript_id=mCT22129.1
FT                   protein_id=mCP4174.2"
FT                   /protein_id="EDL37624.1"
FT                   /translation="MASALNSKIHPPGTCASSKADARGGSGWRMDCDPEMHVKMCKKIA
FT                   QLTKVIYALNTRQDEVEVSVESIREAHQEDLQDTGAETRTRLPQEQSRTSEDAETLLKR
FT                   IQTLENALELQKRLTQEALAESASCKLETKERELRVEAEHAERVLILSKEMLELKADYE
FT                   KRLQLLTSHEGPQWGQLSQESPDATAESSQRPEMHQVLLEVERLRAENKQLSQDYARKA
FT                   EELQATYERENEAIRQAMQQSVSEALWQWQEKESGLRKNFQVQESALQAQVRKLEGDLE
FT                   HRGRKISDLKKYAQKLKERIQDLDVQLREARQENSELKSTARKLGEKLAIAKDRLMLQE
FT                   CHVTQKTDDMKTEDGVLGKRDDLEACSLHPQQEQGFPKLCHCRNGGSETQTKKEASGEM
FT                   ENMKQQYEEDLRKVRHQTEEEKQQLREQLGKRLEDLVKKHTMEMKSVCSTVEVERKKLK
FT                   EVEAQLEEVKTKSEREIQQLQEEKAALSTKLQNSLLEDPCSRPKKPARDEGLEKLTDEE
FT                   ESSSDEEERTGESVKGKSDLQPPFESVMKEKAVEIGHRPEDWQSQRTKLQTQVDGQLWI
FT                   EYISPFTKCNCASYRYPRKT"
FT   gene            <19393326..19400084
FT                   /locus_tag="mCG_146327"
FT                   /note="gene_id=mCG146327.1"
FT   mRNA            join(<19393326..19394143,19396216..19398383)
FT                   /locus_tag="mCG_146327"
FT                   /product="mCG146327, transcript variant mCT193595"
FT                   /note="gene_id=mCG146327.1 transcript_id=mCT193595.0
FT                   created on 09-MAR-2004"
FT   CDS             <19393336..19393704
FT                   /codon_start=1
FT                   /locus_tag="mCG_146327"
FT                   /product="mCG146327, isoform CRA_b"
FT                   /note="gene_id=mCG146327.1 transcript_id=mCT193595.0
FT                   protein_id=mCP114573.0 isoform=CRA_b"
FT                   /protein_id="EDL37626.1"
FT                   /translation="TGLAREHDVSLSLSLSLSLSHTHTHTHTHTHTHTHPLALGKHSPP
FT                   AKQAGCGSFLGKESCLLLPNAVSRRSLHSDTEQLPLVSVTKFVGIQCGPPLGCFYTPTP
FT                   TLGACGTQLVCPQHPALP"
FT   mRNA            join(<19393894..19394143,19394904..19394961,
FT                   19396216..19396397,19397776..19400084)
FT                   /locus_tag="mCG_146327"
FT                   /product="mCG146327, transcript variant mCT186430"
FT                   /note="gene_id=mCG146327.1 transcript_id=mCT186430.0
FT                   created on 14-JUL-2003"
FT   CDS             <19398311..19398790
FT                   /codon_start=1
FT                   /locus_tag="mCG_146327"
FT                   /product="mCG146327, isoform CRA_a"
FT                   /note="gene_id=mCG146327.1 transcript_id=mCT186430.0
FT                   protein_id=mCP107493.0 isoform=CRA_a"
FT                   /protein_id="EDL37625.1"
FT                   /translation="SNVGLCHAFCILQKAGAFFLDYLYEKKNNISRNALPTISFHMNLL
FT                   ITIKTSDVFVFLQTFRNYFSYQSSIINMRSNIAIFPVHSSIGSDVALKGLIAPLHSELA
FT                   FSKAKDLINICLTSESDTILFTAEVNLCKKKIVKADFGPCIISVNDTALFPGSST"
FT   gene            19423885..19454175
FT                   /locus_tag="mCG_21477"
FT                   /note="gene_id=mCG21477.1"
FT   mRNA            join(19423885..19424097,19424984..19425187,
FT                   19426239..19426467,19428324..19428469,19428734..19428818,
FT                   19429914..19430106,19430557..19430706,19432314..19432454,
FT                   19433816..19433939,19435355..19435438,19435710..19435889,
FT                   19441291..19441401,19442601..19442720,19445643..19445867,
FT                   19447198..19447379,19447793..19447967,19449696..19449857,
FT                   19450075..19450210,19450515..19450586,19452885..19452954,
FT                   19453898..19454175)
FT                   /locus_tag="mCG_21477"
FT                   /product="mCG21477"
FT                   /note="gene_id=mCG21477.1 transcript_id=mCT22131.2 created
FT                   on 26-SEP-2002"
FT   CDS             join(19423987..19424097,19424984..19425187,
FT                   19426239..19426467,19428324..19428469,19428734..19428818,
FT                   19429914..19430106,19430557..19430706,19432314..19432454,
FT                   19433816..19433939,19435355..19435438,19435710..19435889,
FT                   19441291..19441401,19442601..19442720,19445643..19445867,
FT                   19447198..19447379,19447793..19447967,19449696..19449857,
FT                   19450075..19450210,19450515..19450586,19452885..19452954,
FT                   19453898..19454012)
FT                   /codon_start=1
FT                   /locus_tag="mCG_21477"
FT                   /product="mCG21477"
FT                   /note="gene_id=mCG21477.1 transcript_id=mCT22131.2
FT                   protein_id=mCP4198.1"
FT                   /protein_id="EDL37627.1"
FT                   /translation="MAAQKKRLSVKEAFQLAQQPHQNQAKLVVALSRTYGAMDDKTAFQ
FT                   EEFIHYLKYAMVVYKREPAVERVMDFTAKFVTSFHQSDEEEEEEENDGGILNYLFTFLL
FT                   QSHEANSSAVRFRVCQLTNKLLGNMPENAQIDDDLFDKINEAMLIRLKDKIPNVRIQAV
FT                   LALSRLQDPKDDDCPVVDAYVNVIENDSNPEVRRAVLSCIAPSAKTLSKIVGRTKDIKD
FT                   TVRKLAYQVLAEKVHMRAMSIAQRVLLLQQGLNDRSDAVKQAVQKHLLQGWLRFTEGNI
FT                   LEFLHRLDVENSSDVAVSVLHSLFSMTPLSELVGICKNDDGRKLIPVETLTPEIALYWC
FT                   TLCEYLKSKGDEGEEFLEQILPEPAVYAEYLLSYIQGFPVVNEEQKGDFTFIGDLMKRE
FT                   FIGQQLILIMKSLDTSEEGGRKRLLAILQETLILPTTPISLVSLIVERLLHIIRDDNER
FT                   IQIVTEIISEIRAPIVNVVVDPSDTRKKELKMAEIKVKLIEAKEALENCIAVQDFDQAS
FT                   KLKEEIKILEDAKINLLKETEQLEIKEVHTEKNDAETLQKCLVLCYELLKQMSTSTGIT
FT                   ATMNGIIESLILPGIISVHPIVRNLAVLCLGCCGLQNRDFASKHFMLFLQVLQIDDVTI
FT                   KISALKAIIDQLMMFGIEPFKTQKVKGVQCEGEEINCHDKQEENDAGETDPAKSVLKLL
FT                   SDFLDSEVSELRTGAAEGLAKLMFSGLLVSSRILSRLILLWYNPVTEEDVRLRHCLGVF
FT                   FPMFAYANRTNQECFEEAFIPTVQTLANAPVSSPLAEVDVTNVVELLVDLTRPSRLNPK
FT                   AKNSQDYQALTVHDNLAIKICNEILTSPCSPENRVYTKALSLVELSSNVTKDLLLLLDE
FT                   ILEHVTDRTCLRALEKIKSQLGKGGKESDPGVVTQDVNTTTAVLQNENEYMTPVRDGKG
FT                   TQTSKSTQGKSKRGCRKAPVSSKTNRRRQIAGPDSESDHEPPSEMKMRLPRRAKTAALQ
FT                   KSKLNLAEFLNEDTS"
FT   gene            complement(19451223..>19604915)
FT                   /gene="Lcorl"
FT                   /locus_tag="mCG_21479"
FT                   /note="gene_id=mCG21479.3"
FT   mRNA            complement(join(19451223..19456047,19476996..19477616,
FT                   19488001..19488509,19489755..19489848,19501069..19501320,
FT                   19530005..19530134,19604708..>19604900))
FT                   /gene="Lcorl"
FT                   /locus_tag="mCG_21479"
FT                   /product="ligand dependent nuclear receptor
FT                   corepressor-like, transcript variant mCT22132"
FT                   /note="gene_id=mCG21479.3 transcript_id=mCT22132.2 created
FT                   on 04-OCT-2002"
FT   mRNA            complement(join(19454490..19456047,19489755..19489848,
FT                   19501069..19501320,19530005..19530134,19531033..19531112,
FT                   19550562..19550627,19604708..>19604915))
FT                   /gene="Lcorl"
FT                   /locus_tag="mCG_21479"
FT                   /product="ligand dependent nuclear receptor
FT                   corepressor-like, transcript variant mCT193548"
FT                   /note="gene_id=mCG21479.3 transcript_id=mCT193548.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(19455873..19456047,19489755..19489848,
FT                   19501069..19501320,19530005..19530134,19531033..19531112,
FT                   19550562..19550627,19604708..>19604855))
FT                   /codon_start=1
FT                   /gene="Lcorl"
FT                   /locus_tag="mCG_21479"
FT                   /product="ligand dependent nuclear receptor
FT                   corepressor-like, isoform CRA_a"
FT                   /note="gene_id=mCG21479.3 transcript_id=mCT193548.0
FT                   protein_id=mCP114534.0 isoform=CRA_a"
FT                   /protein_id="EDL37628.1"
FT                   /translation="SVLLQTCALRAVIQWAAPGSGKYWDSLTLLRSLLFLTQSATCAHS
FT                   CYPAGFESILEGLYGPRLRRDLSLFEDCEPEELTDWSMDEKCSFCNLQREAVSDCIPSL
FT                   DSSQSTPTEELSSQGQSHTDKIECQAESYLNALFRKKDLPQNCDPNIPLVAQELMKKMI
FT                   RQFAIEYISKSGKIQENRNGSIGASLVCKSIQMNQADNCLQDEQEGPLDLTVTRTQEQT
FT                   AQQGDGVLDLSTKKTSIKSEESSISDPSSENAVAGMLQMKTDEKVDLSDGNTASCPLSP
FT                   IKMCLNHPIEWNLTAASLASCTVHNQNLKSEEN"
FT   CDS             complement(join(19456034..19456047,19476996..19477616,
FT                   19488001..19488509,19489755..19489848,19501069..19501320,
FT                   19530005..19530134,19604708..>19604899))
FT                   /codon_start=1
FT                   /gene="Lcorl"
FT                   /locus_tag="mCG_21479"
FT                   /product="ligand dependent nuclear receptor
FT                   corepressor-like, isoform CRA_b"
FT                   /note="gene_id=mCG21479.3 transcript_id=mCT22132.2
FT                   protein_id=mCP4161.2 isoform=CRA_b"
FT                   /protein_id="EDL37629.1"
FT                   /translation="SCSNAVQFSVSVGSDRFCFKLARSGLSFSGLLRVAGSTGTPLPCC
FT                   GRCFSSLRVRRVPTAVTQQDCIPSLDSSQSTPTEELSSQGQSHTDKIECQAESYLNALF
FT                   RKKDLPQNCDPNIPLVAQELMKKMIRQFAIEYISKSGKIQENRNGSIGASLVCKSIQMN
FT                   QADNCLQDEQEGPLDLTVTRTQEQTAQQGDGVLDLSTKKTSIKSEESSISDPSSENAVA
FT                   GRLHRNREDYVERSAEFADGLLSKALKDIQSGALDINKAGILYGIPQKTLLLHLEALPA
FT                   GKPASFKNKTRDFNDSYSYNESKETCAVLQKVALWARAQTERTEKSKLNLLETSEFKFP
FT                   TASSYLHQLTLQKMVTQFKEKNESLQYETSNPPVQLKIPQLRVNSVSKSQADVGNQWAS
FT                   PPEPRVTFAKKRVAVHDFRTHASLESKFNGTGGGQTDSEKEQIMESVSSHNWRSKTLKD
FT                   CRIFLRKINCLEHRNTFKLNTIIYSPESVDSGGSQAQPEESKRFSLRSHSARQNSFKKQ
FT                   NEERANPKANSPASSRLTGELDSSHLSKHVNFDKNPDHSEALSKLSKRKRPPWKTTEMS
FT                   AKRHKRQSCNSGQMANYCTKSQVACYK"
FT   gene            complement(19674832..>19680413)
FT                   /locus_tag="mCG_144989"
FT                   /note="gene_id=mCG144989.0"
FT   mRNA            complement(join(19674832..19675216,19675593..19675720,
FT                   19680346..>19680413))
FT                   /locus_tag="mCG_144989"
FT                   /product="mCG144989"
FT                   /note="gene_id=mCG144989.0 transcript_id=mCT184413.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(19675012..19675216,19675593..>19675612))
FT                   /codon_start=1
FT                   /locus_tag="mCG_144989"
FT                   /product="mCG144989"
FT                   /note="gene_id=mCG144989.0 transcript_id=mCT184413.0
FT                   protein_id=mCP105598.0"
FT                   /protein_id="EDL37630.1"
FT                   /translation="FPRYNGSLLCETASLTGTWSSPVRGHLLTREHPQFLLSPFCPPRI
FT                   EISSVPRCQAFYMGAEELNPGPHTCTAGM"
FT   gene            20114143..20114703
FT                   /pseudo
FT                   /locus_tag="mCG_54325"
FT                   /note="gene_id=mCG54325.2"
FT   mRNA            20114143..20114703
FT                   /pseudo
FT                   /locus_tag="mCG_54325"
FT                   /note="gene_id=mCG54325.2 transcript_id=mCT54508.2 created
FT                   on 11-OCT-2002"
FT   gene            20145349..20146539
FT                   /pseudo
FT                   /locus_tag="mCG_2754"
FT                   /note="gene_id=mCG2754.2"
FT   mRNA            20145349..20146539
FT                   /pseudo
FT                   /locus_tag="mCG_2754"
FT                   /note="gene_id=mCG2754.2 transcript_id=mCT2444.2 created on
FT                   04-OCT-2002"
FT   gene            21417893..21418631
FT                   /pseudo
FT                   /locus_tag="mCG_49760"
FT                   /note="gene_id=mCG49760.2"
FT   mRNA            21417893..21418631
FT                   /pseudo
FT                   /locus_tag="mCG_49760"
FT                   /note="gene_id=mCG49760.2 transcript_id=mCT49943.2 created
FT                   on 16-OCT-2002"
FT   gene            21704818..21705910
FT                   /pseudo
FT                   /locus_tag="mCG_1046136"
FT                   /note="gene_id=mCG1046136.1"
FT   mRNA            21704818..21705910
FT                   /pseudo
FT                   /locus_tag="mCG_1046136"
FT                   /note="gene_id=mCG1046136.1 transcript_id=mCT163840.1
FT                   created on 04-OCT-2002"
FT   gene            21714351..22040218
FT                   /gene="Slit2"
FT                   /locus_tag="mCG_141236"
FT                   /note="gene_id=mCG141236.0"
FT   mRNA            join(21714351..21715021,21717644..21717715,
FT                   21718925..21718996,21730159..21730230,21902753..21902824,
FT                   21914872..21914943,21919123..21919194,21922052..21922215,
FT                   21924817..21924955,21944580..21944651,21945107..21945178,
FT                   21951276..21951347,21953462..21953605,21953717..21953880,
FT                   21958437..21958587,21963973..21964047,21965627..21965770,
FT                   21969030..21969173,21970948..21971114,21972068..21972200,
FT                   21976178..21976246,21978199..21978270,21979145..21979216,
FT                   21980718..21980789,21983365..21983528,21990363..21990487,
FT                   21990612..21990709,21993150..21993289,22009189..22009282,
FT                   22015327..22015464,22015555..22015795,22016999..22017129,
FT                   22030014..22030168,22035920..22036208,22036407..22036618,
FT                   22037654..22037867,22038927..22040218)
FT                   /gene="Slit2"
FT                   /locus_tag="mCG_141236"
FT                   /product="slit homolog 2 (Drosophila), transcript variant
FT                   mCT174007"
FT                   /note="gene_id=mCG141236.0 transcript_id=mCT174007.0
FT                   created on 04-OCT-2002"
FT   mRNA            join(<21714596..21715021,21717644..21717715,
FT                   21718925..21718996,21730159..21730230,21902753..21902824,
FT                   21914872..21914943,21919123..21919194,21922052..21922215,
FT                   21924817..21924955,21944580..21944651,21945107..21945178,
FT                   21951276..21951347,21953462..21953605,21953717..21953880,
FT                   21958437..21958587,21963973..21964047,21965627..21965770,
FT                   21969030..21969173,21970948..21971114,21972068..21972200,
FT                   21976178..21976246,21978199..21978270,21979145..21979216,
FT                   21980718..21980789,21983365..21983528,21990363..21990487,
FT                   21990612..21990709,21993150..21993289,22009189..22009282,
FT                   22015327..22015464,22015555..22015795,22016999..22017129,
FT                   22030014..22030168,22035920..22036208,22036407..22036618,
FT                   22037654..22039165)
FT                   /gene="Slit2"
FT                   /locus_tag="mCG_141236"
FT                   /product="slit homolog 2 (Drosophila), transcript variant
FT                   mCT193577"
FT                   /note="gene_id=mCG141236.0 transcript_id=mCT193577.0
FT                   created on 09-MAR-2004"
FT   CDS             join(<21714639..21715021,21717644..21717715,
FT                   21718925..21718996,21730159..21730230,21902753..21902824,
FT                   21914872..21914943,21919123..21919194,21922052..21922215,
FT                   21924817..21924955,21944580..21944651,21945107..21945178,
FT                   21951276..21951347,21953462..21953605,21953717..21953880,
FT                   21958437..21958587,21963973..21964047,21965627..21965770,
FT                   21969030..21969173,21970948..21971114,21972068..21972200,
FT                   21976178..21976246,21978199..21978270,21979145..21979216,
FT                   21980718..21980789,21983365..21983528,21990363..21990487,
FT                   21990612..21990709,21993150..21993289,22009189..22009282,
FT                   22015327..22015464,22015555..22015795,22016999..22017129,
FT                   22030014..22030168,22035920..22036208,22036407..22036618,
FT                   22037654..22037895)
FT                   /codon_start=1
FT                   /gene="Slit2"
FT                   /locus_tag="mCG_141236"
FT                   /product="slit homolog 2 (Drosophila), isoform CRA_a"
FT                   /note="gene_id=mCG141236.0 transcript_id=mCT193577.0
FT                   protein_id=mCP114525.0 isoform=CRA_a"
FT                   /protein_id="EDL37631.1"
FT                   /translation="KGLKSRGKTCASVSSPAPYHCSRLLCEHLPGCCGLQAQRQALGLG
FT                   HCPVFTQPKAQEKSFKARSLLGKMSGIGWQTLSLSLGLVLSILNKVAPQACPAQCSCSG
FT                   STVDCHGLALRSVPRNIPRNTERLDLNGNNITRITKIDFAGLRHLRVLQLMENRISTIE
FT                   RGAFQDLKELERLRLNRNNLQLFPELLFLGTAKLYRLDLSENQIQAIPRKAFRGAVDIK
FT                   NLQLDYNQISCIEDGAFRALRDLEVLTLNNNNITRLSVASFNHMPKLRTFRLHSNNLYC
FT                   DCHLAWLSDWLRQRPRVGLYTQCMGPSHLRGHNVAEVQKREFVCSGHQSFMAPSCSVLH
FT                   CPAACTCSNNIVDCRGKGLTEIPTNLPETITEIRLEQNSIRVIPPGAFSPYKKLRRLDL
FT                   SNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINCLRVD
FT                   AFQDLHNLNLLSLYDNKLQTVAKGTFSALRAIQTMHLAQNPFICDCHLKWLADYLHTNP
FT                   IETSGARCTSPRRLANKRIGQIKSKKFRCSGTEDYRSKLSGDCFADLACPEKCRCEGTT
FT                   VDCSNQRLNKIPDHIPQYTAELRLNNNEFTVLEATGIFKKLPQLRKINFSNNKITDIEE
FT                   GAFEGASGVNEILLTSNRLENVQHKMFKGLESLKTLMLRSNRISCVGNDSFIGLGSVRL
FT                   LSLYDNQITTVAPGAFDSLHSLSTLNLLANPFNCNCHLAWLGEWLRRKRIVTGNPRCQK
FT                   PYFLKEIPIQDVAIQDFTCDDGNDDNSCSPLSRCPSECTCLDTVVRCSNKGLKVLPKGI
FT                   PKDVTELYLDGNQFTLVPKELSNYKHLTLIDLSNNRISTLSNQSFSNMTQLLTLILSYN
FT                   RLRCIPPRTFDGLKSLRLLSLHGNDISVVPEGAFNDLSALSHLAIGANPLYCDCNMQWL
FT                   SDWVKSEYKEPGIARCAGPGEMADKLLLTTPSKKFTCQGPMDITIQAKCNPCLSNPCKN
FT                   DGTCNNDPVDFYRCTCPYGFKGQDCDVPIHACISNPCKHGGTCHLKEGENAGFWCTCAD
FT                   GFEGENCEVNIDDCEDNDCENNSTCVDGINNYTCLCPPEYTGELCEEKLDFCAQDLNPC
FT                   QHDSKCILTPKGFKCDCTPGYIGEHCDIDFDDCQDNKCKNGAHCTDAVNGYTCVCPEGY
FT                   SGLFCEFSPPMVLPRTSPCDNFDCQNGAQCIIRINEPICQCLPGYLGEKCEKLVSVNFV
FT                   NKESYLQIPSAKVRPQTNITLQIATDEDSGILLYKGDKDHIAVELYRGRVRASYDTGSH
FT                   PASAIYSVETINDGNFHIVELLTLDSSLSLSVDGGSPKVITNLSKQSTLNFDSPLYVGG
FT                   MPGKNNVASLRQAPGQNGTSFHGCIRNLYINSELQDFRKMPMQTGILPGCEPCHKKVCA
FT                   HGMCQPSSQSGFTCECEEGWMGPLCDQRTNDPCLGNKCVHGTCLPINAFSYSCKCLEGH
FT                   GGVLCDEEEDLFNPCQMIKCKHGKCRLSGVGQPYCECNSGFTGDSCDREISCRGERIRD
FT                   YYQKQQGYAACQTTKKVSRLECRGGCAGGQCCGPLRSKRRKYSFECTDGSSFVDEVEKV
FT                   VKCGCARCAS"
FT   CDS             join(21714843..21715021,21717644..21717715,
FT                   21718925..21718996,21730159..21730230,21902753..21902824,
FT                   21914872..21914943,21919123..21919194,21922052..21922215,
FT                   21924817..21924955,21944580..21944651,21945107..21945178,
FT                   21951276..21951347,21953462..21953605,21953717..21953880,
FT                   21958437..21958587,21963973..21964047,21965627..21965770,
FT                   21969030..21969173,21970948..21971114,21972068..21972200,
FT                   21976178..21976246,21978199..21978270,21979145..21979216,
FT                   21980718..21980789,21983365..21983528,21990363..21990487,
FT                   21990612..21990709,21993150..21993289,22009189..22009282,
FT                   22015327..22015464,22015555..22015795,22016999..22017129,
FT                   22030014..22030168,22035920..22036208,22036407..22036618,
FT                   22037654..22037867,22038927..22039020)
FT                   /codon_start=1
FT                   /gene="Slit2"
FT                   /locus_tag="mCG_141236"
FT                   /product="slit homolog 2 (Drosophila), isoform CRA_b"
FT                   /note="gene_id=mCG141236.0 transcript_id=mCT174007.0
FT                   protein_id=mCP96926.0 isoform=CRA_b"
FT                   /protein_id="EDL37632.1"
FT                   /translation="MSGIGWQTLSLSLGLVLSILNKVAPQACPAQCSCSGSTVDCHGLA
FT                   LRSVPRNIPRNTERLDLNGNNITRITKIDFAGLRHLRVLQLMENRISTIERGAFQDLKE
FT                   LERLRLNRNNLQLFPELLFLGTAKLYRLDLSENQIQAIPRKAFRGAVDIKNLQLDYNQI
FT                   SCIEDGAFRALRDLEVLTLNNNNITRLSVASFNHMPKLRTFRLHSNNLYCDCHLAWLSD
FT                   WLRQRPRVGLYTQCMGPSHLRGHNVAEVQKREFVCSGHQSFMAPSCSVLHCPAACTCSN
FT                   NIVDCRGKGLTEIPTNLPETITEIRLEQNSIRVIPPGAFSPYKKLRRLDLSNNQISELA
FT                   PDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINCLRVDAFQDLHNLN
FT                   LLSLYDNKLQTVAKGTFSALRAIQTMHLAQNPFICDCHLKWLADYLHTNPIETSGARCT
FT                   SPRRLANKRIGQIKSKKFRCSGTEDYRSKLSGDCFADLACPEKCRCEGTTVDCSNQRLN
FT                   KIPDHIPQYTAELRLNNNEFTVLEATGIFKKLPQLRKINFSNNKITDIEEGAFEGASGV
FT                   NEILLTSNRLENVQHKMFKGLESLKTLMLRSNRISCVGNDSFIGLGSVRLLSLYDNQIT
FT                   TVAPGAFDSLHSLSTLNLLANPFNCNCHLAWLGEWLRRKRIVTGNPRCQKPYFLKEIPI
FT                   QDVAIQDFTCDDGNDDNSCSPLSRCPSECTCLDTVVRCSNKGLKVLPKGIPKDVTELYL
FT                   DGNQFTLVPKELSNYKHLTLIDLSNNRISTLSNQSFSNMTQLLTLILSYNRLRCIPPRT
FT                   FDGLKSLRLLSLHGNDISVVPEGAFNDLSALSHLAIGANPLYCDCNMQWLSDWVKSEYK
FT                   EPGIARCAGPGEMADKLLLTTPSKKFTCQGPMDITIQAKCNPCLSNPCKNDGTCNNDPV
FT                   DFYRCTCPYGFKGQDCDVPIHACISNPCKHGGTCHLKEGENAGFWCTCADGFEGENCEV
FT                   NIDDCEDNDCENNSTCVDGINNYTCLCPPEYTGELCEEKLDFCAQDLNPCQHDSKCILT
FT                   PKGFKCDCTPGYIGEHCDIDFDDCQDNKCKNGAHCTDAVNGYTCVCPEGYSGLFCEFSP
FT                   PMVLPRTSPCDNFDCQNGAQCIIRINEPICQCLPGYLGEKCEKLVSVNFVNKESYLQIP
FT                   SAKVRPQTNITLQIATDEDSGILLYKGDKDHIAVELYRGRVRASYDTGSHPASAIYSVE
FT                   TINDGNFHIVELLTLDSSLSLSVDGGSPKVITNLSKQSTLNFDSPLYVGGMPGKNNVAS
FT                   LRQAPGQNGTSFHGCIRNLYINSELQDFRKMPMQTGILPGCEPCHKKVCAHGMCQPSSQ
FT                   SGFTCECEEGWMGPLCDQRTNDPCLGNKCVHGTCLPINAFSYSCKCLEGHGGVLCDEEE
FT                   DLFNPCQMIKCKHGKCRLSGVGQPYCECNSGFTGDSCDREISCRGERIRDYYQKQQGYA
FT                   ACQTTKKVSRLECRGGCAGGQCCGPLRSKRRKYSFECTDGSSFVDEVEKVVKTLAEGLQ
FT                   SLRVETASESICHMSSQEERTYL"
FT   gene            complement(21732918..>21735559)
FT                   /locus_tag="mCG_1046276"
FT                   /note="gene_id=mCG1046276.0"
FT   mRNA            complement(join(21732918..21733174,21735340..>21735559))
FT                   /locus_tag="mCG_1046276"
FT                   /product="mCG1046276"
FT                   /note="gene_id=mCG1046276.0 transcript_id=mCT163980.0
FT                   created on 04-OCT-2002"
FT   CDS             complement(21732925..>21733107)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1046276"
FT                   /product="mCG1046276"
FT                   /note="gene_id=mCG1046276.0 transcript_id=mCT163980.0
FT                   protein_id=mCP64924.0"
FT                   /protein_id="EDL37633.1"
FT                   /translation="RLLLNVDFKTFSISYNTHFKWATRSHEGEKYGTCSLGLHRYSRPP
FT                   VPVSLTSSVLLTKDS"
FT   gene            22106013..22122532
FT                   /gene="4933428G09Rik"
FT                   /locus_tag="mCG_8312"
FT                   /note="gene_id=mCG8312.1"
FT   mRNA            join(22106013..22106211,22108070..22108224,
FT                   22113019..22113153,22113813..22113920,22115476..22115556,
FT                   22121792..22122532)
FT                   /gene="4933428G09Rik"
FT                   /locus_tag="mCG_8312"
FT                   /product="RIKEN cDNA 4933428G09, transcript variant
FT                   mCT7661"
FT                   /note="gene_id=mCG8312.1 transcript_id=mCT7661.1 created on
FT                   18-FEB-2003"
FT   mRNA            join(<22106014..22107933,22108070..22108224,
FT                   22109229..22109296,22110761..22110851,22113019..22113153,
FT                   22113813..22113920,22115476..22115556,22121792..22122428)
FT                   /gene="4933428G09Rik"
FT                   /locus_tag="mCG_8312"
FT                   /product="RIKEN cDNA 4933428G09, transcript variant
FT                   mCT193600"
FT                   /note="gene_id=mCG8312.1 transcript_id=mCT193600.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(22106028..22106180,22107866..22107933,
FT                   22108070..22108224,22109229..22109296,22110761..22110851,
FT                   22113019..22113153,22113813..22113920,22115476..22115556,
FT                   22121792..22122036)
FT                   /gene="4933428G09Rik"
FT                   /locus_tag="mCG_8312"
FT                   /product="RIKEN cDNA 4933428G09, transcript variant
FT                   mCT173731"
FT                   /note="gene_id=mCG8312.1 transcript_id=mCT173731.0 created
FT                   on 18-FEB-2003"
FT   CDS             join(<22107702..22107933,22108070..22108224,
FT                   22109229..22109296,22110761..22110851,22113019..22113153,
FT                   22113813..22113920,22115476..22115556,22121792..22121848)
FT                   /codon_start=1
FT                   /gene="4933428G09Rik"
FT                   /locus_tag="mCG_8312"
FT                   /product="RIKEN cDNA 4933428G09, isoform CRA_b"
FT                   /note="gene_id=mCG8312.1 transcript_id=mCT193600.0
FT                   protein_id=mCP114607.0 isoform=CRA_b"
FT                   /protein_id="EDL37635.1"
FT                   /translation="PIRGALGSVRDPVPIHRKGAIEKDGNLGPPHPHLYITVFIFGRST
FT                   DSEIVFFNCRGEGEAMQRSECSGGVQLRNRATGSNDQRTSSSTQMKHRTTVQRSKSSSL
FT                   TSSPEAARRARPRPSDKLNPKTINPFGEQPRAPTAFAAIYSQGGIPCRLVHGSVKHRLQ
FT                   WECPPEILPFDPLLITLAEGLRETKHPYTFVSKEGFRELLLVKGAPEKAIPLLPRLIPV
FT                   LKAALVHSDDEVFERGLSALVQLSVVVGPSLNGHLKLLLTSLSKRLMDKKFKEPITSAL
FT                   QKLEQHGGNASLIIIKSKIPTYCSICC"
FT   CDS             join(22107882..22107933,22108070..22108224,
FT                   22109229..22109296,22110761..22110851,22113019..22113153,
FT                   22113813..22113920,22115476..22115556,22121792..22121848)
FT                   /codon_start=1
FT                   /gene="4933428G09Rik"
FT                   /locus_tag="mCG_8312"
FT                   /product="RIKEN cDNA 4933428G09, isoform CRA_c"
FT                   /note="gene_id=mCG8312.1 transcript_id=mCT173731.0
FT                   protein_id=mCP96650.0 isoform=CRA_c"
FT                   /protein_id="EDL37636.1"
FT                   /translation="MQRSECSGGVQLRNRATGSNDQRTSSSTQMKHRTTVQRSKSSSLT
FT                   SSPEAARRARPRPSDKLNPKTINPFGEQPRAPTAFAAIYSQGGIPCRLVHGSVKHRLQW
FT                   ECPPEILPFDPLLITLAEGLRETKHPYTFVSKEGFRELLLVKGAPEKAIPLLPRLIPVL
FT                   KAALVHSDDEVFERGLSALVQLSVVVGPSLNGHLKLLLTSLSKRLMDKKFKEPITSALQ
FT                   KLEQHGGNASLIIIKSKIPTYCSICC"
FT   mRNA            join(22107889..22107933,22108070..22108224,
FT                   22109229..22109296,22113019..22113153,22113813..22113920,
FT                   22115476..22115556,22121792..22121906)
FT                   /gene="4933428G09Rik"
FT                   /locus_tag="mCG_8312"
FT                   /product="RIKEN cDNA 4933428G09, transcript variant
FT                   mCT180359"
FT                   /note="gene_id=mCG8312.1 transcript_id=mCT180359.0 created
FT                   on 18-FEB-2003"
FT   CDS             join(22108105..22108224,22113019..22113153,
FT                   22113813..22113920,22115476..22115556,22121792..22121848)
FT                   /codon_start=1
FT                   /gene="4933428G09Rik"
FT                   /locus_tag="mCG_8312"
FT                   /product="RIKEN cDNA 4933428G09, isoform CRA_d"
FT                   /note="gene_id=mCG8312.1 transcript_id=mCT7661.1
FT                   protein_id=mCP16496.2 isoform=CRA_d"
FT                   /protein_id="EDL37637.1"
FT                   /translation="MKHRTTVQRSKSSSLTSSPEAARRARPRPSDKLNPKTINPGLRET
FT                   KHPYTFVSKEGFRELLLVKGAPEKAIPLLPRLIPVLKAALVHSDDEVFERGLSALVQLS
FT                   VVVGPSLNGHLKLLLTSLSKRLMDKKFKEPITSALQKLEQHGGNASLIIIKSKIPTYCS
FT                   ICC"
FT   CDS             join(22108105..22108224,22109229..22109296,
FT                   22113019..22113025)
FT                   /codon_start=1
FT                   /gene="4933428G09Rik"
FT                   /locus_tag="mCG_8312"
FT                   /product="RIKEN cDNA 4933428G09, isoform CRA_a"
FT                   /note="gene_id=mCG8312.1 transcript_id=mCT180359.0
FT                   protein_id=mCP103281.0 isoform=CRA_a"
FT                   /protein_id="EDL37634.1"
FT                   /translation="MKHRTTVQRSKSSSLTSSPEAARRARPRPSDKLNPKTINPFGEQP
FT                   RAPTAFAAIYSQGGIPCRV"
FT   gene            complement(22123192..22481648)
FT                   /gene="Kcnip4"
FT                   /locus_tag="mCG_8314"
FT                   /note="gene_id=mCG8314.3"
FT   mRNA            complement(join(22123192..22124645,22129694..22129756,
FT                   22130340..22130444,22132168..22132275,22143500..22143570,
FT                   22152886..22152955,22216402..22216526,22481537..22481648))
FT                   /gene="Kcnip4"
FT                   /locus_tag="mCG_8314"
FT                   /product="Kv channel interacting protein 4, transcript
FT                   variant mCT175875"
FT                   /note="gene_id=mCG8314.3 transcript_id=mCT175875.1 created
FT                   on 19-MAR-2004"
FT   mRNA            complement(join(22123192..22124645,22129694..22129756,
FT                   22130340..22130444,22132168..22132275,22143500..22143570,
FT                   22152886..22152955,22216402..22216526,22328238..22328497))
FT                   /gene="Kcnip4"
FT                   /locus_tag="mCG_8314"
FT                   /product="Kv channel interacting protein 4, transcript
FT                   variant mCT194217"
FT                   /note="gene_id=mCG8314.3 transcript_id=mCT194217.0 created
FT                   on 19-MAR-2004"
FT   mRNA            complement(join(22123192..22124645,22129694..22129756,
FT                   22130340..22130444,22132168..22132275,22143500..22143570,
FT                   22152886..22152955,22216402..22216526,22243488..>22243589))
FT                   /gene="Kcnip4"
FT                   /locus_tag="mCG_8314"
FT                   /product="Kv channel interacting protein 4, transcript
FT                   variant mCT7663"
FT                   /note="gene_id=mCG8314.3 transcript_id=mCT7663.2 created on
FT                   19-MAR-2004"
FT   CDS             complement(join(22124598..22124645,22129694..22129756,
FT                   22130340..22130444,22132168..22132275,22143500..22143570,
FT                   22152886..22152955,22216402..22216526,22328238..22328349))
FT                   /codon_start=1
FT                   /gene="Kcnip4"
FT                   /locus_tag="mCG_8314"
FT                   /product="Kv channel interacting protein 4, isoform CRA_b"
FT                   /note="gene_id=mCG8314.3 transcript_id=mCT194217.0
FT                   protein_id=mCP115246.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q3YAA5"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR028846"
FT                   /db_xref="MGI:MGI:1933131"
FT                   /db_xref="UniProtKB/TrEMBL:Q3YAA5"
FT                   /protein_id="EDL37639.1"
FT                   /translation="MLTLEWESEGLQTVGIVVIICASLKLLHLLGLIDFSEDSVEDELE
FT                   MATVRHRPEALELLEAQSKFTKKELQILYRGFKNECPSGVVNEETFKEIYSQFFPQGDS
FT                   TTYAHFLFNAFDTDHNGAVSFEDFIKGLSILLRGTVQEKLNWAFNLYDINKDGYITKEE
FT                   MLDIMKAIYDMMGKCTYPVLKEDAPRQHVETFFQKMDKNKDGVVTIDEFIESCQKDENI
FT                   MRSMQLFENVI"
FT   CDS             complement(join(22124598..22124645,22129694..22129756,
FT                   22130340..22130444,22132168..22132275,22143500..22143570,
FT                   22152886..22152955,22216402..22216526,22243488..>22243587))
FT                   /codon_start=1
FT                   /gene="Kcnip4"
FT                   /locus_tag="mCG_8314"
FT                   /product="Kv channel interacting protein 4, isoform CRA_c"
FT                   /note="gene_id=mCG8314.3 transcript_id=mCT7663.2
FT                   protein_id=mCP16498.2 isoform=CRA_c"
FT                   /protein_id="EDL37640.1"
FT                   /translation="FLYAQNNTKRSIKERLMKLLPCSAAKTSSPAIQNSVEDELEMATV
FT                   RHRPEALELLEAQSKFTKKELQILYRGFKNECPSGVVNEETFKEIYSQFFPQGDSTTYA
FT                   HFLFNAFDTDHNGAVSFEDFIKGLSILLRGTVQEKLNWAFNLYDINKDGYITKEEMLDI
FT                   MKAIYDMMGKCTYPVLKEDAPRQHVETFFQKMDKNKDGVVTIDEFIESCQKDENIMRSM
FT                   QLFENVI"
FT   CDS             complement(join(22124598..22124645,22129694..22129756,
FT                   22130340..22130444,22132168..22132275,22143500..22143570,
FT                   22152886..22152955,22216402..22216503))
FT                   /codon_start=1
FT                   /gene="Kcnip4"
FT                   /locus_tag="mCG_8314"
FT                   /product="Kv channel interacting protein 4, isoform CRA_a"
FT                   /note="gene_id=mCG8314.3 transcript_id=mCT175875.1
FT                   protein_id=mCP98797.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q3V060"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR028846"
FT                   /db_xref="MGI:MGI:1933131"
FT                   /db_xref="UniProtKB/TrEMBL:Q3V060"
FT                   /protein_id="EDL37638.1"
FT                   /translation="MATVRHRPEALELLEAQSKFTKKELQILYRGFKNECPSGVVNEET
FT                   FKEIYSQFFPQGDSTTYAHFLFNAFDTDHNGAVSFEDFIKGLSILLRGTVQEKLNWAFN
FT                   LYDINKDGYITKEEMLDIMKAIYDMMGKCTYPVLKEDAPRQHVETFFQKMDKNKDGVVT
FT                   IDEFIESCQKDENIMRSMQLFENVI"
FT   gene            <22129262..22147998
FT                   /locus_tag="mCG_146328"
FT                   /note="gene_id=mCG146328.0"
FT   mRNA            join(<22129262..22130390,22131404..22131509,
FT                   22136131..22136178,22147547..22147998)
FT                   /locus_tag="mCG_146328"
FT                   /product="mCG146328"
FT                   /note="gene_id=mCG146328.0 transcript_id=mCT186431.0
FT                   created on 14-JUL-2003"
FT   CDS             <22129595..22129897
FT                   /codon_start=1
FT                   /locus_tag="mCG_146328"
FT                   /product="mCG146328"
FT                   /note="gene_id=mCG146328.0 transcript_id=mCT186431.0
FT                   protein_id=mCP107494.0"
FT                   /protein_id="EDL37641.1"
FT                   /translation="LIHLIFIFPNLYWLIGCAHLELMLTKRIVVLTYFLATFNELIYGN
FT                   DTIFIFVHLLLRKKRIKHCIESPFDSLPIPSRFKEIRMKLIILCYMGQFHSRRNY"
FT   gene            22319703..22328809
FT                   /locus_tag="mCG_148295"
FT                   /note="gene_id=mCG148295.0"
FT   mRNA            join(22319703..22321497,22328399..22328809)
FT                   /locus_tag="mCG_148295"
FT                   /product="mCG148295"
FT                   /note="gene_id=mCG148295.0 transcript_id=mCT188558.0
FT                   created on 13-JAN-2004"
FT   CDS             join(22321439..22321497,22328399..22328552)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148295"
FT                   /product="mCG148295"
FT                   /note="gene_id=mCG148295.0 transcript_id=mCT188558.0
FT                   protein_id=mCP109209.0"
FT                   /protein_id="EDL37642.1"
FT                   /translation="MAAATYVAEDDLFWHQWEGRELIRESEQCLAWNKDLPGGKVSSGS
FT                   SLKNRAKRVAPRGEDRPGLKSSLSC"
FT   gene            22387757..22389296
FT                   /pseudo
FT                   /locus_tag="mCG_1046138"
FT                   /note="gene_id=mCG1046138.1"
FT   mRNA            join(22387757..22389171,22389196..22389296)
FT                   /pseudo
FT                   /locus_tag="mCG_1046138"
FT                   /note="gene_id=mCG1046138.1 transcript_id=mCT163842.1
FT                   created on 17-OCT-2002"
FT   gene            23155035..23155882
FT                   /pseudo
FT                   /locus_tag="mCG_1046068"
FT                   /note="gene_id=mCG1046068.1"
FT   mRNA            join(23155035..23155711,23155733..23155882)
FT                   /pseudo
FT                   /locus_tag="mCG_1046068"
FT                   /note="gene_id=mCG1046068.1 transcript_id=mCT163772.1
FT                   created on 16-OCT-2002"
FT   gene            23289541..23290985
FT                   /pseudo
FT                   /locus_tag="mCG_50129"
FT                   /note="gene_id=mCG50129.2"
FT   mRNA            23289541..23290985
FT                   /pseudo
FT                   /locus_tag="mCG_50129"
FT                   /note="gene_id=mCG50129.2 transcript_id=mCT50312.2 created
FT                   on 04-OCT-2002"
FT   gene            complement(23622949..23624906)
FT                   /pseudo
FT                   /locus_tag="mCG_66691"
FT                   /note="gene_id=mCG66691.1"
FT   mRNA            complement(23622949..23624906)
FT                   /pseudo
FT                   /locus_tag="mCG_66691"
FT                   /note="gene_id=mCG66691.1 transcript_id=mCT66874.1 created
FT                   on 11-OCT-2002"
FT   gene            complement(23682870..>23781669)
FT                   /locus_tag="mCG_123902"
FT                   /note="gene_id=mCG123902.1"
FT   mRNA            complement(join(23682870..23684423,23684557..23684652,
FT                   23686600..23686745,23693608..23693731,23694869..23694993,
FT                   23701859..23702067,23702276..23702489,23710412..23710615,
FT                   23713040..23713201,23721088..23721243,23722006..23722207,
FT                   23729603..23729816,23732187..23732347,23736244..23736315,
FT                   23739678..23739749,23748545..23748616,23781395..23781668))
FT                   /locus_tag="mCG_123902"
FT                   /product="mCG123902, transcript variant mCT125138"
FT                   /note="gene_id=mCG123902.1 transcript_id=mCT125138.0
FT                   created on 26-SEP-2002"
FT   mRNA            complement(join(23682941..23684423,23684557..23684652,
FT                   23686600..23686745,23693608..23693731,23694869..23694993,
FT                   23701859..23702067,23702276..23702489,23710412..23710615,
FT                   23713040..23713201,23721088..23721243,23722006..23722207,
FT                   23724726..23724890,23729603..23729816,23732187..23732347,
FT                   23734342..23734413,23736244..23736315,23739678..23739749,
FT                   23748545..23748616,23781395..>23781669))
FT                   /locus_tag="mCG_123902"
FT                   /product="mCG123902, transcript variant mCT193639"
FT                   /note="gene_id=mCG123902.1 transcript_id=mCT193639.0
FT                   created on 09-MAR-2004"
FT   CDS             complement(join(23683181..23684423,23684557..23684652,
FT                   23686600..23686745,23693608..23693731,23694869..23694993,
FT                   23701859..23702067,23702276..23702489,23710412..23710615,
FT                   23713040..23713201,23721088..23721243,23722006..23722207,
FT                   23724726..23724890,23729603..23729816,23732187..23732347,
FT                   23734342..23734413,23736244..23736315,23739678..23739749,
FT                   23748545..23748616,23781395..>23781669))
FT                   /codon_start=1
FT                   /locus_tag="mCG_123902"
FT                   /product="mCG123902, isoform CRA_a"
FT                   /note="gene_id=mCG123902.1 transcript_id=mCT193639.0
FT                   protein_id=mCP114612.0 isoform=CRA_a"
FT                   /protein_id="EDL37643.1"
FT                   /translation="PPARPVPSLGPAGPVSGMEPPPPLLLLPLALLALLWGGERGAAAL
FT                   PAGCKHDGRARGTGRAAAAAEGKVVCSSLELAQVLPPDTLPNRTVTLILSNNKISELKN
FT                   GSFSGLSLLERLDLRNNLISRIAPGAFWGLSSLKRLDLTNNRIGCLNADVFRGLTNLVR
FT                   LNLSGNLFTSLSQGTFDYLGSLRSLEFQTEYLLCDCNILWMHRWVKERNITVRDTRCVY
FT                   PKSLQAQPVTGVKQELLTCDPPLELPSFYMTPSHRQVVFEGDSLPFQCMASYIDQDMQV
FT                   LWYQDGRIVETDESQGIFVEKSMIHNCSLIASALTISNIQAGSTGNWGCHVQTKRGNNT
FT                   RTVDIVVLESSAQYCPPERVVNNKGDFRWPRTLAGITAYLQCTRNTHSSGIYPGSAQDE
FT                   RKAWRRCDRGGFWADDDYSRCQYANDVTRVLYMFNQMPLNLTNAVATARQLLAYTVEAA
FT                   NFSDKMDVIFVAEMIEKFGRFTREEKSKELGDVMVDVASNIMLADERVLWLAQREAKAC
FT                   SRIVQCLQRIATHRLASGAHVYSTYSPNIALEAYVIKAAGFTGMTCSVFQKVAASDRAG
FT                   LSDYGRRDPDGNLDKQLSFKCNVSSTFSSLALKNTIMEASIQLPSSLLSPKHKREARAA
FT                   DDALYKLQLIAFRNGKLFPATGNSTKLADDGKRRTVVTPVILTKIDGATVDTHHIPVNV
FT                   TLRRIAHGADAVAAQWDFDLLNGQGGWKSDGCCILYSDENITTIQCGSLGNYAVLMDLT
FT                   GTELYTPAASLLHPVVYTTAITLLLCLLAVIISYMYHHSLIRISLKSWHMLVNLCFHIL
FT                   LTCVVFVGGITQTRNASVCQAVGIILHYSTLATVLWVGVTARNIYKQVTKKAKRCQDPD
FT                   EPPAPPRPMLRFYLIGGGIPIIVCGITAAANIKNYGSRPSAPYCWMAWEPSLGAFYGPA
FT                   SFITFVNCMYFLSIFIQLKRHPERKYELKEPTEEQQRLAANENGEINHQDSMSLSLIST
FT                   STLENEHSFQSQLLGASLTLLLYVILWMFGAMAVSLYYPLDLVFSFFFGATCLSFSAFM
FT                   MVHHCINREDVRLAWIMMCCPGRSSYSVQVNVQPPNSSATNGEAPKCTNSSAESSCTNK
FT                   SASSFKNSSQGCKLTNLQAAAAQYHSNALPVNATPQLDNSLTEHSMDNDIKMHVAPLDV
FT                   QFRTNVHPSRHHKNRSKGHRASRLTVLREYAYDVPTSVEGSVQNGLPKSRPGSNEGHSR
FT                   SRRAYLAYRERQYNPPQQDSSDACSTLPKSSRNVEKPVSTSSKKDAPRKPAAADLESQQ
FT                   KSYGLNLAVQNGPVKSNGQEGPLLATDVTGNVRTGLWKHETTV"
FT   CDS             complement(join(23683181..23684423,23684557..23684652,
FT                   23686600..23686745,23693608..23693731,23694869..23694993,
FT                   23701859..23702067,23702276..23702489,23710412..23710615,
FT                   23713040..23713201,23721088..23721243,23722006..23722207,
FT                   23729603..23729816,23732187..23732347,23736244..23736315,
FT                   23739678..23739749,23748545..23748616,23781395..23781618))
FT                   /codon_start=1
FT                   /locus_tag="mCG_123902"
FT                   /product="mCG123902, isoform CRA_b"
FT                   /note="gene_id=mCG123902.1 transcript_id=mCT125138.0
FT                   protein_id=mCP64694.1 isoform=CRA_b"
FT                   /protein_id="EDL37644.1"
FT                   /translation="MEPPPPLLLLPLALLALLWGGERGAAALPAGCKHDGRARGTGRAA
FT                   AAAEGKVVCSSLELAQVLPPDTLPNRTVTLILSNNKISELKNGSFSGLSLLERLDLRNN
FT                   LISRIAPGAFWGLSSLKRLDLTNNRIGCLNADVFRGLTNLVRLEFQTEYLLCDCNILWM
FT                   HRWVKERNITVRDTRCVYPKSLQAQPVTGVKQELLTCDPPLELPSFYMTPSHRQVVFEG
FT                   DSLPFQCMASYIDQDMQVLWYQDGRIVETDESQGIFVEKSMIHNCSLIARWPRTLAGIT
FT                   AYLQCTRNTHSSGIYPGSAQDERKAWRRCDRGGFWADDDYSRCQYANDVTRVLYMFNQM
FT                   PLNLTNAVATARQLLAYTVEAANFSDKMDVIFVAEMIEKFGRFTREEKSKELGDVMVDV
FT                   ASNIMLADERVLWLAQREAKACSRIVQCLQRIATHRLASGAHVYSTYSPNIALEAYVIK
FT                   AAGFTGMTCSVFQKVAASDRAGLSDYGRRDPDGNLDKQLSFKCNVSSTFSSLALKNTIM
FT                   EASIQLPSSLLSPKHKREARAADDALYKLQLIAFRNGKLFPATGNSTKLADDGKRRTVV
FT                   TPVILTKIDGATVDTHHIPVNVTLRRIAHGADAVAAQWDFDLLNGQGGWKSDGCCILYS
FT                   DENITTIQCGSLGNYAVLMDLTGTELYTPAASLLHPVVYTTAITLLLCLLAVIISYMYH
FT                   HSLIRISLKSWHMLVNLCFHILLTCVVFVGGITQTRNASVCQAVGIILHYSTLATVLWV
FT                   GVTARNIYKQVTKKAKRCQDPDEPPAPPRPMLRFYLIGGGIPIIVCGITAAANIKNYGS
FT                   RPSAPYCWMAWEPSLGAFYGPASFITFVNCMYFLSIFIQLKRHPERKYELKEPTEEQQR
FT                   LAANENGEINHQDSMSLSLISTSTLENEHSFQSQLLGASLTLLLYVILWMFGAMAVSLY
FT                   YPLDLVFSFFFGATCLSFSAFMMVHHCINREDVRLAWIMMCCPGRSSYSVQVNVQPPNS
FT                   SATNGEAPKCTNSSAESSCTNKSASSFKNSSQGCKLTNLQAAAAQYHSNALPVNATPQL
FT                   DNSLTEHSMDNDIKMHVAPLDVQFRTNVHPSRHHKNRSKGHRASRLTVLREYAYDVPTS
FT                   VEGSVQNGLPKSRPGSNEGHSRSRRAYLAYRERQYNPPQQDSSDACSTLPKSSRNVEKP
FT                   VSTSSKKDAPRKPAAADLESQQKSYGLNLAVQNGPVKSNGQEGPLLATDVTGNVRTGLW
FT                   KHETTV"
FT   gene            23868978..23873780
FT                   /locus_tag="mCG_58282"
FT                   /note="gene_id=mCG58282.1"
FT   mRNA            join(23868978..23869358,23871880..23872002,
FT                   23873509..23873780)
FT                   /locus_tag="mCG_58282"
FT                   /product="mCG58282"
FT                   /note="gene_id=mCG58282.1 transcript_id=mCT58465.1 created
FT                   on 30-SEP-2002"
FT   CDS             join(23869210..23869358,23871880..23871967)
FT                   /codon_start=1
FT                   /locus_tag="mCG_58282"
FT                   /product="mCG58282"
FT                   /note="gene_id=mCG58282.1 transcript_id=mCT58465.1
FT                   protein_id=mCP26626.1"
FT                   /protein_id="EDL37645.1"
FT                   /translation="MTTSCHSTNVCMLLLFVLTCGFRLTVVGNFLLPCRHKESKWHHGR
FT                   YVCSWFLVQITRLLQKTLTVMLRNSHKHTRLNL"
FT   gene            24012925..24098181
FT                   /pseudo
FT                   /locus_tag="mCG_51017"
FT                   /note="gene_id=mCG51017.2"
FT   mRNA            join(24012925..24013697,24014394..24014517,
FT                   24098037..24098181)
FT                   /pseudo
FT                   /locus_tag="mCG_51017"
FT                   /note="gene_id=mCG51017.2 transcript_id=mCT51200.2 created
FT                   on 16-OCT-2002"
FT   gene            complement(24155427..>24254036)
FT                   /locus_tag="mCG_146115"
FT                   /note="gene_id=mCG146115.0"
FT   mRNA            complement(join(24155427..24155793,24211921..24212008,
FT                   24213963..24214036,24225263..24225360,24227423..24227646,
FT                   24236804..24237120,24238164..24238339,24249379..24249488,
FT                   24252374..24252460,24253012..24253144,24253957..>24254036))
FT                   /locus_tag="mCG_146115"
FT                   /product="mCG146115"
FT                   /note="gene_id=mCG146115.0 transcript_id=mCT186218.0
FT                   created on 14-JUL-2003"
FT   gene            24227034..24227841
FT                   /pseudo
FT                   /locus_tag="mCG_62101"
FT                   /note="gene_id=mCG62101.2"
FT   mRNA            24227034..24227841
FT                   /pseudo
FT                   /locus_tag="mCG_62101"
FT                   /note="gene_id=mCG62101.2 transcript_id=mCT62284.2 created
FT                   on 11-OCT-2002"
FT   CDS             complement(join(24237051..24237120,24238164..24238339,
FT                   24249379..24249488,24252374..>24252416))
FT                   /codon_start=1
FT                   /locus_tag="mCG_146115"
FT                   /product="mCG146115"
FT                   /note="gene_id=mCG146115.0 transcript_id=mCT186218.0
FT                   protein_id=mCP107480.0"
FT                   /protein_id="EDL37646.1"
FT                   /translation="IELSLNSEIYLLLPQWVSLCSPGCPGTHSVDQARLKLRNLPASIS
FT                   QVLGLKREHLGSSLGNCYSLFSGVCCFNGPIRRGVPSLLVKEQPRDPSYDNPNLSSGDL
FT                   ILSVRSSSRQSGRYRLLLNMLTMARPDF"
FT   gene            24389496..24392646
FT                   /pseudo
FT                   /locus_tag="mCG_51716"
FT                   /note="gene_id=mCG51716.2"
FT   mRNA            join(24389496..24391262,24391287..24392646)
FT                   /pseudo
FT                   /locus_tag="mCG_51716"
FT                   /note="gene_id=mCG51716.2 transcript_id=mCT51899.2 created
FT                   on 04-OCT-2002"
FT   gene            24630334..24630879
FT                   /pseudo
FT                   /locus_tag="mCG_62102"
FT                   /note="gene_id=mCG62102.2"
FT   mRNA            24630334..24630879
FT                   /pseudo
FT                   /locus_tag="mCG_62102"
FT                   /note="gene_id=mCG62102.2 transcript_id=mCT62285.2 created
FT                   on 16-OCT-2002"
FT   gene            24760280..24760826
FT                   /pseudo
FT                   /locus_tag="mCG_50617"
FT                   /note="gene_id=mCG50617.1"
FT   mRNA            24760280..24760826
FT                   /pseudo
FT                   /locus_tag="mCG_50617"
FT                   /note="gene_id=mCG50617.1 transcript_id=mCT50800.1 created
FT                   on 16-OCT-2002"
FT   gene            complement(25162108..>25274162)
FT                   /gene="Ppargc1a"
FT                   /locus_tag="mCG_10800"
FT                   /note="gene_id=mCG10800.2"
FT   mRNA            complement(join(25162108..25166148,25170574..25170725,
FT                   25171074..25171195,25180466..25180586,25180747..25180851,
FT                   25181364..25182279,25197880..25197953,25198063..25198108,
FT                   25202465..25202669,25203534..25203659,25205898..25206092,
FT                   25254949..25255128,25260168..25260300))
FT                   /gene="Ppargc1a"
FT                   /locus_tag="mCG_10800"
FT                   /product="peroxisome proliferative activated receptor,
FT                   gamma, coactivator 1 alpha, transcript variant mCT10791"
FT                   /note="gene_id=mCG10800.2 transcript_id=mCT10791.2 created
FT                   on 20-SEP-2002"
FT   CDS             complement(join(25166045..25166148,25170574..25170725,
FT                   25171074..25171195,25180466..25180586,25180747..25180851,
FT                   25181364..25182279,25197880..25197953,25198063..25198108,
FT                   25202465..25202669,25203534..25203659,25205898..25206092,
FT                   25254949..25255128,25260168..25260215))
FT                   /codon_start=1
FT                   /gene="Ppargc1a"
FT                   /locus_tag="mCG_10800"
FT                   /product="peroxisome proliferative activated receptor,
FT                   gamma, coactivator 1 alpha, isoform CRA_a"
FT                   /note="gene_id=mCG10800.2 transcript_id=mCT10791.2
FT                   protein_id=mCP3563.1 isoform=CRA_a"
FT                   /db_xref="GOA:O70343"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="MGI:MGI:1342774"
FT                   /db_xref="PDB:3F7D"
FT                   /db_xref="UniProtKB/Swiss-Prot:O70343"
FT                   /protein_id="EDL37647.1"
FT                   /translation="MAWDMCSQDSVWSDIECAALVGEDQPLCPDLPELDLSELDVNDLD
FT                   TDSFLGGLKWCSDQSEIISNQYNNEPANIFEKIDEENEANLLAVLTETLDSLPVDEDGL
FT                   PSFDALTDGAVTTDNEASPSSMPDGTPPPQEAEEPSLLKKLLLAPANTQLSYNECSGLS
FT                   TQNHAANHTHRIRTNPAIVKTENSWSNKAKSICQQQKPQRRPCSELLKYLTTNDDPPHT
FT                   KPTENRNSSRDKCASKKKSHTQPQSQHAQAKPTTLSLPLTPESPNDPKGSPFENKTIER
FT                   TLSVELSGTAGLTPPTTPPHKANQDNPFKASPKLKPSCKTVVPPPTKRARYSECSGTQG
FT                   SHSTKKGPEQSELYAQLSKSSGLSRGHEERKTKRPSLRLFGDHDYCQSLNSKTDILINI
FT                   SQELQDSRQLDFKDASCDWQGHICSSTDSGQCYLRETLEASKQVSPCSTRKQLQDQEIR
FT                   AELNKHFGHPCQAVFDDKSDKTSELRDGDFSNEQFSKLPVFINSGLAMDGLFDDSEDES
FT                   DKLSYPWDGTQPYSLFDVSPSCSSFNSPCRDSVSPPKSLFSQRPQRMRSRSRSFSRHRS
FT                   CSRSPYSRSRSRSPGSRSSSRSCYYYESSHYRHRTHRNSPLYVRSRSRSPYSRRPRYDS
FT                   YEAYEHERLKRDEYRKEHEKRESERAKQRERQKQKAIEERRVIYVGKIRPDTTRTELRD
FT                   RFEVFGEIEECTVNLRDDGDSYGFITYRYTCDAFAALENGYTLRRSNETDFELYFCGRK
FT                   QFFKSNYADLDTNSDDFDPASTKSKYDSLDFDSLLKEAQRSLRR"
FT   mRNA            complement(join(<25182203..25182279,25197880..25197928,
FT                   25205997..25206092,25254949..25255128,25274018..>25274162))
FT                   /gene="Ppargc1a"
FT                   /locus_tag="mCG_10800"
FT                   /product="peroxisome proliferative activated receptor,
FT                   gamma, coactivator 1 alpha, transcript variant mCT173391"
FT                   /note="gene_id=mCG10800.2 transcript_id=mCT173391.0 created
FT                   on 20-SEP-2002"
FT   CDS             complement(join(<25182203..25182279,25197880..25197928,
FT                   25205997..25206092,25254949..25255128,25274018..>25274059))
FT                   /codon_start=1
FT                   /gene="Ppargc1a"
FT                   /locus_tag="mCG_10800"
FT                   /product="peroxisome proliferative activated receptor,
FT                   gamma, coactivator 1 alpha, isoform CRA_b"
FT                   /note="gene_id=mCG10800.2 transcript_id=mCT173391.0
FT                   protein_id=mCP96310.0 isoform=CRA_b"
FT                   /protein_id="EDL37648.1"
FT                   /translation="PEAFSPHLRPTMLLCAALVGEDQPLCPDLPELDLSELDVNDLDTD
FT                   SFLGGLKWCSDQSEIISNQYNNEPANIFEKIDEENEANLLAVLTETLDSLPVDEDGLPS
FT                   FDNKTIERTLSVELSGTAGLTPPTTPPHKANQDNPFKASPKLKP"
FT   gene            25818408..25819620
FT                   /locus_tag="mCG_148291"
FT                   /note="gene_id=mCG148291.0"
FT   mRNA            join(25818408..25819003,25819109..25819620)
FT                   /locus_tag="mCG_148291"
FT                   /product="mCG148291"
FT                   /note="gene_id=mCG148291.0 transcript_id=mCT188554.0
FT                   created on 13-JAN-2004"
FT   CDS             25819162..25819407
FT                   /codon_start=1
FT                   /locus_tag="mCG_148291"
FT                   /product="mCG148291"
FT                   /note="gene_id=mCG148291.0 transcript_id=mCT188554.0
FT                   protein_id=mCP109204.0"
FT                   /protein_id="EDL37649.1"
FT                   /translation="MDVFIPTSLEGFISITHNGETDSVMSWAMQLGRVRNGMQGWLMHL
FT                   PPPHRCSCGHLCTSYITRVYSQMEIPPSPLSPVDNK"
FT   gene            complement(25851500..25891860)
FT                   /gene="Dhx15"
FT                   /locus_tag="mCG_18794"
FT                   /note="gene_id=mCG18794.3"
FT   mRNA            complement(join(25851500..25852067,25853099..25853268,
FT                   25855326..25855516,25858744..25858866,25861519..25861710,
FT                   25862182..25862290,25862876..25863025,25863818..25863904,
FT                   25867990..25868157,25871188..25871406,25872691..25872850,
FT                   25882327..25882520,25885813..25886248,25891623..25891860))
FT                   /gene="Dhx15"
FT                   /locus_tag="mCG_18794"
FT                   /product="DEAH (Asp-Glu-Ala-His) box polypeptide 15,
FT                   transcript variant mCT15257"
FT                   /note="gene_id=mCG18794.3 transcript_id=mCT15257.3 created
FT                   on 23-NOV-2004"
FT   CDS             complement(join(25851950..25852067,25853099..25853268,
FT                   25855326..25855516,25858744..25858866,25861519..25861710,
FT                   25862182..25862290,25862876..25863025,25863818..25863904,
FT                   25867990..25868157,25871188..25871406,25872691..25872850,
FT                   25882327..25882520,25885813..25886248,25891623..25891693))
FT                   /codon_start=1
FT                   /gene="Dhx15"
FT                   /locus_tag="mCG_18794"
FT                   /product="DEAH (Asp-Glu-Ala-His) box polypeptide 15,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG18794.3 transcript_id=mCT15257.3
FT                   protein_id=mCP3558.3 isoform=CRA_a"
FT                   /db_xref="GOA:Q3UKJ6"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1099786"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UKJ6"
FT                   /protein_id="EDL37650.1"
FT                   /translation="MSKRHRLDLGEDYPSGKKRAGTDGKDRERDRDREDRSKDRDRERD
FT                   RGDREREREKEKEKELRASTNAMLISAGLPPLKASHSAHSTHSAHSTHSTHSAHSTHTG
FT                   HTGHTSLPQCINPFTNLPHTPRYYDILKKRLQLPVWEYKDRFTDILVRHQSFVLVGETG
FT                   SGKTTQIPQWCVEYMRSLPGPKRGVACTQPRRVAAMSVAQRVADEMDVMLGQEVGYSIR
FT                   FEDCSSAKTILKYMTDGMLLREAMNDPLLERYGVIILDEAHERTLATDILMGVLKEVVR
FT                   QRSDLKVIVMSATLDAGKFQIYFDNCPLLTIPGRTHPVEIFYTPEPERDYLEAAIRTVI
FT                   QIHMCEEEEGDLLLFLTGQEEIDEACKRIKREVDDLGPEVGDIKIIPLYSTLPPQQQQR
FT                   IFEPPPPKKQNGAIGRKVVVSTNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESLLV
FT                   TAISKASAQQRAGRAGRTRPGKCFRLYTEKAYKTEMQDNTYPEILRSNLGSVVLQLKKL
FT                   GIDDLVHFDFMDPPAPETLMRALELLNYLAALNDDGDLTELGSMMAEFPLDPQLAKMVI
FT                   ASCDYNCSNEVLSITAMLSVPQCFVRPTEAKKAADEAKMRFAHIDGDHLTLLNVYHAFK
FT                   QNHESVQWCYDNFINYRSLMSADNVRQQLSRIMDRFNLPRRSTDFTSRDYYINIRKALV
FT                   TGYFMQVAHLERTGHYLTVKDNQVVQLHPSTVLDHKPEWVLYNEFVLTTKNYIRTCTDI
FT                   KPEWLVKIAPQYYDMSNFPQCEAKRQLDRIIAKLQSKEYSQY"
FT   mRNA            complement(join(25854613..25855516,25858744..25858866,
FT                   25861519..25861710,25862182..25862290,25862876..25863025,
FT                   25863818..25863904,25867990..25868157,25871188..25871406,
FT                   25872691..25872850,25882327..25882520,25885813..25886248,
FT                   25891623..25891860))
FT                   /gene="Dhx15"
FT                   /locus_tag="mCG_18794"
FT                   /product="DEAH (Asp-Glu-Ala-His) box polypeptide 15,
FT                   transcript variant mCT173404"
FT                   /note="gene_id=mCG18794.3 transcript_id=mCT173404.1 created
FT                   on 23-NOV-2004"
FT   CDS             complement(join(25855314..25855516,25858744..25858866,
FT                   25861519..25861710,25862182..25862290,25862876..25863025,
FT                   25863818..25863904,25867990..25868157,25871188..25871406,
FT                   25872691..25872850,25882327..25882520,25885813..25886248,
FT                   25891623..25891693))
FT                   /codon_start=1
FT                   /gene="Dhx15"
FT                   /locus_tag="mCG_18794"
FT                   /product="DEAH (Asp-Glu-Ala-His) box polypeptide 15,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG18794.3 transcript_id=mCT173404.1
FT                   protein_id=mCP96323.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q497W9"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1099786"
FT                   /db_xref="UniProtKB/TrEMBL:Q497W9"
FT                   /protein_id="EDL37651.1"
FT                   /translation="MSKRHRLDLGEDYPSGKKRAGTDGKDRERDRDREDRSKDRDRERD
FT                   RGDREREREKEKEKELRASTNAMLISAGLPPLKASHSAHSTHSAHSTHSTHSAHSTHTG
FT                   HTGHTSLPQCINPFTNLPHTPRYYDILKKRLQLPVWEYKDRFTDILVRHQSFVLVGETG
FT                   SGKTTQIPQWCVEYMRSLPGPKRGVACTQPRRVAAMSVAQRVADEMDVMLGQEVGYSIR
FT                   FEDCSSAKTILKYMTDGMLLREAMNDPLLERYGVIILDEAHERTLATDILMGVLKEVVR
FT                   QRSDLKVIVMSATLDAGKFQIYFDNCPLLTIPGRTHPVEIFYTPEPERDYLEAAIRTVI
FT                   QIHMCEEEEGDLLLFLTGQEEIDEACKRIKREVDDLGPEVGDIKIIPLYSTLPPQQQQR
FT                   IFEPPPPKKQNGAIGRKVVVSTNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESLLV
FT                   TAISKASAQQRAGRAGRTRPGKCFRLYTEKAYKTEMQDNTYPEILRSNLGSVVLQLKKL
FT                   GIDDLVHFDFMDPPAPETLMRALELLNYLAALNDDGDLTELGSMMAEFPLDPQLAKMVI
FT                   ASCDYNCSNEVLSITAMLSVPQCFVRPTEAKKAADEAKMRFAHIDGDHLTLLNVYHAFK
FT                   QNHESVQWCYDNFINYRSLMSADNVRQQLSRIMDRFNLPRRSTDFTSRDYYINIRKALV
FT                   TGYFMQVSS"
FT   gene            <25892056..25947212
FT                   /locus_tag="mCG_144983"
FT                   /note="gene_id=mCG144983.0"
FT   mRNA            join(<25892056..25892281,25894289..25894349,
FT                   25896172..25896261,25898264..25898394,25913438..25913547,
FT                   25946993..25947212)
FT                   /locus_tag="mCG_144983"
FT                   /product="mCG144983"
FT                   /note="gene_id=mCG144983.0 transcript_id=mCT184407.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<25892168..25892281,25894289..25894349,
FT                   25896172..25896261,25898264..25898394,25913438..25913461)
FT                   /codon_start=1
FT                   /locus_tag="mCG_144983"
FT                   /product="mCG144983"
FT                   /note="gene_id=mCG144983.0 transcript_id=mCT184407.0
FT                   protein_id=mCP105591.0"
FT                   /protein_id="EDL37652.1"
FT                   /translation="SSGRIRKTRSHSWQVAKQDTIYNSRTRICSCCARCPVAGLPPRRW
FT                   KNTFNSSTQDTEAGPLCIAMTIPGTHYVNQRSACHCLSSAGIKVARLGSGKYSSSLVFL
FT                   WIIDCTQDQKRKQLDHLQLKNGDRNVIQKSDPLNT"
FT   gene            complement(25901355..>25917829)
FT                   /locus_tag="mCG_144984"
FT                   /note="gene_id=mCG144984.0"
FT   mRNA            complement(join(25901355..25902544,25903025..25903248,
FT                   25903400..25903461,25903761..25903888,25904355..25904468,
FT                   25911801..25911912,25916062..25916151,25917678..>25917829))
FT                   /locus_tag="mCG_144984"
FT                   /product="mCG144984"
FT                   /note="gene_id=mCG144984.0 transcript_id=mCT184408.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(25904389..25904468,25911801..25911912,
FT                   25916062..25916151,25917678..>25917698))
FT                   /codon_start=1
FT                   /locus_tag="mCG_144984"
FT                   /product="mCG144984"
FT                   /note="gene_id=mCG144984.0 transcript_id=mCT184408.0
FT                   protein_id=mCP105593.0"
FT                   /protein_id="EDL37653.1"
FT                   /translation="YAAPPILQWELRVLKIRTPHAFIHKAISPSWTSPISQVEFLLHGA
FT                   FRISSLHSLISVARAQVTFLKMPTLIIWHVSLDLLCVRDTPSRLICVSRASLNKF"
FT   gene            complement(25975299..25975893)
FT                   /pseudo
FT                   /locus_tag="mCG_50962"
FT                   /note="gene_id=mCG50962.2"
FT   mRNA            complement(25975299..25975893)
FT                   /pseudo
FT                   /locus_tag="mCG_50962"
FT                   /note="gene_id=mCG50962.2 transcript_id=mCT51145.2 created
FT                   on 16-OCT-2002"
FT   gene            26067790..26069591
FT                   /locus_tag="mCG_18796"
FT                   /note="gene_id=mCG18796.2"
FT   mRNA            26067790..26069591
FT                   /locus_tag="mCG_18796"
FT                   /product="mCG18796"
FT                   /note="gene_id=mCG18796.2 transcript_id=mCT15256.2 created
FT                   on 20-SEP-2002"
FT   CDS             26067814..26068569
FT                   /codon_start=1
FT                   /locus_tag="mCG_18796"
FT                   /product="mCG18796"
FT                   /note="gene_id=mCG18796.2 transcript_id=mCT15256.2
FT                   protein_id=mCP3562.2"
FT                   /db_xref="GOA:O88592"
FT                   /db_xref="InterPro:IPR001424"
FT                   /db_xref="InterPro:IPR018152"
FT                   /db_xref="InterPro:IPR024141"
FT                   /db_xref="MGI:MGI:103181"
FT                   /db_xref="UniProtKB/TrEMBL:O88592"
FT                   /protein_id="EDL37654.1"
FT                   /translation="MLAFLFYGLLLAACGSVTMSDPGESSFDLADRLDPVEKIDRLDLV
FT                   EKIGDTHAKVLEIWMELGRRREVDAAEMHAICRVQPSATLPPDQPQITGLVLFRQLGPG
FT                   SRLEAYFSLEGFPAEQNASNRAIHVHEFGDLSQGCDSTGPHYNPMEVPHPQHPGDFGNF
FT                   VVRNGQLWRHRVGLTASLAGPHAILGRSVVVHAGEDDLGKGGNQASLQNGNAGRRLACC
FT                   VVGTSSSAAWESQTKERKKRRRESECKTT"
FT   gene            complement(<26072682..>26171217)
FT                   /locus_tag="mCG_125596"
FT                   /note="gene_id=mCG125596.1"
FT   mRNA            complement(join(<26072682..26072730,26072990..26073068,
FT                   26076154..26076531,26084932..26085048,26088629..26088673,
FT                   26092497..26092573,26099912..26100056,26102534..26102618,
FT                   26103944..26104016,26104115..26104146,26104859..26105035,
FT                   26105803..26105919,26120558..26120665,26135522..26135560,
FT                   26138883..26139044,26155970..26156012,26157122..26157299,
FT                   26160601..26160754,26171074..>26171217))
FT                   /locus_tag="mCG_125596"
FT                   /product="mCG125596"
FT                   /note="gene_id=mCG125596.1 transcript_id=mCT126859.1
FT                   created on 04-OCT-2002"
FT   CDS             complement(join(26072682..26072730,26072990..26073068,
FT                   26076154..26076531,26084932..26085048,26088629..26088673,
FT                   26092497..26092573,26099912..26100056,26102534..26102618,
FT                   26103944..26104016,26104115..26104146,26104859..26105035,
FT                   26105803..26105919,26120558..26120665,26135522..26135560,
FT                   26138883..26139044,26155970..26156012,26157122..26157299,
FT                   26160601..26160754,26171074..26171217))
FT                   /codon_start=1
FT                   /locus_tag="mCG_125596"
FT                   /product="mCG125596"
FT                   /note="gene_id=mCG125596.1 transcript_id=mCT126859.1
FT                   protein_id=mCP64847.1"
FT                   /protein_id="EDL37655.1"
FT                   /translation="MDGDRTESDWQGLVSEVRPGLRIGLLSRCSRSPSPVSPGSRWPRQ
FT                   DLQMTTLNSYEGGLWELGQSAGIPNQESQVLFILPRDGLSTAEQQAVLYYGIETGCRKT
FT                   LPQGIRDASANGGDVSAAAVNTMPLKMHADRAQIDVPACSAICKFTRKAILEVVGASDF
FT                   QTIICDLSEAYLVCKRKLESKKEALLILSKELDTCQQERDQYKLMANQLRERHQSLKKK
FT                   YRELIDGDPSLPPEKRKQANLAQLLRESQDRTKHLGEEIKELRQRLGEVQGDNKLLRMT
FT                   IAKQRLGDEEIGMRHFAAHEREDLVEQLERAKEQIESLEHDLQASADELQDVKEERASY
FT                   QDKVDRLNQELNHILGGHENRIIDVDALCMENRQGEKEVVTYKRRYLQERLKQLHEEVS
FT                   LLKSNIAKYKNALERRKNSKSQGKSSSSALTGVLSAKQVQDLLSEDHGCSLPATPQSIA
FT                   DLKSLATALLETIHEKNMVIQHQRQTNRILGNRVAELEKKLRTLEVSGLWSLPDILKSR
FT                   SVAVRSVVPGGKDTILLNDQTLPTIQRSKSPLLKFVEQSTDNKESARDGEIQKQEDESC
FT                   AAAEALAEPEDAGKPAVSSTAPLSHANQQHLDFHHPPVPQPPSEEVNTVGRESIQLTDG
FT                   QQAADLEEVPREAPTEEQKCEPGLPPSSLASQEECTTTFQDHLPSTQPEVKASSVGEIS
FT                   AGKFRKMCLETSFLILSTPSGGSRASPHNTEKFHFGKSV"
FT   gene            complement(26074505..26075494)
FT                   /gene="LOC433886"
FT                   /locus_tag="mCG_148301"
FT                   /note="gene_id=mCG148301.0"
FT   mRNA            complement(26074505..26075494)
FT                   /gene="LOC433886"
FT                   /locus_tag="mCG_148301"
FT                   /product="hypothetical protein LOC433886"
FT                   /note="gene_id=mCG148301.0 transcript_id=mCT188564.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(26074969..26075304)
FT                   /codon_start=1
FT                   /gene="LOC433886"
FT                   /locus_tag="mCG_148301"
FT                   /product="hypothetical protein LOC433886"
FT                   /note="gene_id=mCG148301.0 transcript_id=mCT188564.0
FT                   protein_id=mCP109214.0"
FT                   /db_xref="GOA:Q8K1B2"
FT                   /db_xref="MGI:MGI:2685293"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K1B2"
FT                   /protein_id="EDL37656.1"
FT                   /translation="MVWLSEVWEKLNIAPVPYITEEAESIHSINRILHLGLQGPELISE
FT                   TPARKNAEEKCIPIHRKPCLCPGTLRDKDKPDGSPNVLFISISVCPLPLKANPLGKEAL
FT                   RLQVYTG"
FT   gene            complement(26238149..>26271438)
FT                   /gene="Lgi2"
FT                   /locus_tag="mCG_18790"
FT                   /note="gene_id=mCG18790.2"
FT   mRNA            complement(join(26238149..26243642,26251322..26251582,
FT                   26259286..26259455,26260545..26260616,26265091..26265162,
FT                   26267094..26267165,26268934..26269005,26270887..26271215,
FT                   26271382..>26271438))
FT                   /gene="Lgi2"
FT                   /locus_tag="mCG_18790"
FT                   /product="leucine-rich repeat LGI family, member 2,
FT                   transcript variant mCT15250"
FT                   /note="gene_id=mCG18790.2 transcript_id=mCT15250.2 created
FT                   on 13-NOV-2002"
FT   mRNA            complement(join(26238380..26243642,26251322..26251486,
FT                   26259286..26259455,26260545..26260616,26265091..26265162,
FT                   26267094..26267165,26268934..26269005,26270887..>26271214))
FT                   /gene="Lgi2"
FT                   /locus_tag="mCG_18790"
FT                   /product="leucine-rich repeat LGI family, member 2,
FT                   transcript variant mCT193543"
FT                   /note="gene_id=mCG18790.2 transcript_id=mCT193543.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(26242825..26243642,26251322..26251486,
FT                   26259286..26259455,26260545..26260616,26265091..26265162,
FT                   26267094..26267165,26268934..26269005,26270887..>26271212))
FT                   /codon_start=1
FT                   /gene="Lgi2"
FT                   /locus_tag="mCG_18790"
FT                   /product="leucine-rich repeat LGI family, member 2, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG18790.2 transcript_id=mCT193543.0
FT                   protein_id=mCP114533.0 isoform=CRA_b"
FT                   /protein_id="EDL37658.1"
FT                   /translation="PASSPAALAADRQAAPASAAALGPSARRGAAAAAGVRARAGTRGP
FT                   GMALWRGGGALGLLLLSAACLIPPSAQVRRLARCPATCSCTKESIICVGSSWVPRIVPG
FT                   DISSLSLVNGTFLEIKDRMFSHLPSLQLLLLNSNSFTVIRDDAFAGLFHLEYLFIEGNK
FT                   IETISRNAFRGLRDLTHLSLANNHIKALPRDVFSDLDSLIELDLRGNKFECDCKAKWLY
FT                   LWLKMTNSTVSDVLCIGPPEYQEKKLNEVTSFDYECTTTDFVVHQTLPYQSVSVDTFNS
FT                   KNDVYVAIAQPSMENCMVLEWDHIEMNFRSYDNITGQSIVGCKAILIDDQVFVVVAQLF
FT                   GGSHIYKYDESWTKFVKFQDIEVSRISKPNDIELFEIDDETFFIIADSSKAGLSTVYKW
FT                   NSKGFYSYQSLHEWFRDTDAEFVDIDGKSHLILSSRSQVPIILQWNKSSKKFVPHGDIP
FT                   NMEDVLAVKSFRMQNTLYLSLTRFIGDSRVMRWNSKQFVEVQALPSRGAMTLQPFSFKD
FT                   NHYLALGSDYTFSQIYQWDKEKQQFKKFKEIYVQAPRSFTAVSTDRRDFFFASSFKGKT
FT                   KIFEHIIVDLSL"
FT   CDS             complement(join(26242825..26243642,26251322..26251582,
FT                   26259286..26259455,26260545..26260616,26265091..26265162,
FT                   26267094..26267165,26268934..26269005,26270887..>26271062))
FT                   /codon_start=1
FT                   /gene="Lgi2"
FT                   /locus_tag="mCG_18790"
FT                   /product="leucine-rich repeat LGI family, member 2, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG18790.2 transcript_id=mCT15250.2
FT                   protein_id=mCP3567.2 isoform=CRA_a"
FT                   /protein_id="EDL37657.1"
FT                   /translation="RGGGALGLLLLSAACLIPPSAQVRRLARCPATCSCTKESIICVGS
FT                   SWVPRIVPGDISSLSLVNGTFLEIKDRMFSHLPSLQLLLLNSNSFTVIRDDAFAGLFHL
FT                   EYLFIEGNKIETISRNAFRGLRDLTHLSLANNHIKALPRDVFSDLDSLIELDLRGNKFE
FT                   CDCKAKWLYLWLKMTNSTVSDVLCIGPPEYQEKKLNEVTSFDYECTTTGPQTDEAKQRG
FT                   WQLELSLGFCELIFVFQHPLSDFVVHQTLPYQSVSVDTFNSKNDVYVAIAQPSMENCMV
FT                   LEWDHIEMNFRSYDNITGQSIVGCKAILIDDQVFVVVAQLFGGSHIYKYDESWTKFVKF
FT                   QDIEVSRISKPNDIELFEIDDETFFIIADSSKAGLSTVYKWNSKGFYSYQSLHEWFRDT
FT                   DAEFVDIDGKSHLILSSRSQVPIILQWNKSSKKFVPHGDIPNMEDVLAVKSFRMQNTLY
FT                   LSLTRFIGDSRVMRWNSKQFVEVQALPSRGAMTLQPFSFKDNHYLALGSDYTFSQIYQW
FT                   DKEKQQFKKFKEIYVQAPRSFTAVSTDRRDFFFASSFKGKTKIFEHIIVDLSL"
FT   gene            26286470..26288931
FT                   /pseudo
FT                   /locus_tag="mCG_18786"
FT                   /note="gene_id=mCG18786.1"
FT   mRNA            26286470..26288931
FT                   /pseudo
FT                   /locus_tag="mCG_18786"
FT                   /note="gene_id=mCG18786.1 transcript_id=mCT15246.1 created
FT                   on 04-OCT-2002"
FT   gene            complement(26314020..>26325548)
FT                   /locus_tag="mCG_145581"
FT                   /note="gene_id=mCG145581.0"
FT   mRNA            complement(join(26314020..26316576,26319632..26319790,
FT                   26325423..>26325548))
FT                   /locus_tag="mCG_145581"
FT                   /product="mCG145581"
FT                   /note="gene_id=mCG145581.0 transcript_id=mCT185005.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(26316181..>26316558)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145581"
FT                   /product="mCG145581"
FT                   /note="gene_id=mCG145581.0 transcript_id=mCT185005.0
FT                   protein_id=mCP105611.0"
FT                   /protein_id="EDL37659.1"
FT                   /translation="SRCLAACSKCSCYSPVTDGLKCAAELLTEPFLPGSITTPEKTEGT
FT                   DLDLASRTSCQDGCGAVLLTHVCVGGGSHPEACQQSLGSFVQQKPEVTPASCLAIFVLL
FT                   LGRGLPCRMWKPIGAHGSLQG"
FT   gene            complement(26346480..26376117)
FT                   /gene="D5Ertd135e"
FT                   /locus_tag="mCG_18791"
FT                   /note="gene_id=mCG18791.1"
FT   mRNA            complement(join(26346480..26350494,26353500..26353590,
FT                   26353982..26354075,26362424..26362515,26362636..26362765,
FT                   26367039..26367141,26370577..26370730,26371645..26371803,
FT                   26372397..26372515,26375302..26375456,26375984..26376117))
FT                   /gene="D5Ertd135e"
FT                   /locus_tag="mCG_18791"
FT                   /product="DNA segment, Chr 5, ERATO Doi 135, expressed"
FT                   /note="gene_id=mCG18791.1 transcript_id=mCT15251.1 created
FT                   on 07-OCT-2002"
FT   CDS             complement(join(26350191..26350494,26353500..26353590,
FT                   26353982..26354075,26362424..26362515,26362636..26362765,
FT                   26367039..26367141,26370577..26370730,26371645..26371803,
FT                   26372397..26372515,26375302..26375456,26375984..26376097))
FT                   /codon_start=1
FT                   /gene="D5Ertd135e"
FT                   /locus_tag="mCG_18791"
FT                   /product="DNA segment, Chr 5, ERATO Doi 135, expressed"
FT                   /note="gene_id=mCG18791.1 transcript_id=mCT15251.1
FT                   protein_id=mCP3569.2"
FT                   /protein_id="EDL37660.1"
FT                   /translation="MNPESFAAGERRVSPAYVRQGCEARRAHEHLIRLLLEQGKCPEDG
FT                   WDESTLELFLHELAVMDSNNFLGNCGVGEREGRVASALVARRHYRFIHGIGRSGDISAV
FT                   QPKAAGSSLLNKITNSLVLNVIKLAGVHSVASCFVVPMATGMSLTLCFLTLRHKRPKAK
FT                   YIIWPRIDQKSCFKSMVTAGFEPVVIENVLEGDELRTDLKAVEAKIQELGPEHILCLHS
FT                   TTACFAPRVPDRLEELAVICANYDIPHVVNNAYGLQSSKCMHLIQQGARVGRIDAFVQS
FT                   LDKNFMVPVGGAIIAGFNEPFIQDISKMYPGRASASPSLDVLITLLSLGCSGYRKLLKE
FT                   RKEMFVYLSTQLKKLAEAHNERLLQTPHNPISLAMTLKTIDGHHDKAVTQLGSMLFTRQ
FT                   VSGARAVPLGNVQTVSGHTFRGFMSHADNYPCAYLNAAAAIGMKMQDVDLFIKRLDKCL
FT                   NIVRKEQTRASVVSGADRNKAEDADIEEMALKLDDVLGDVGQGPAL"
FT   gene            26450028..26477741
FT                   /gene="Pi4k2b"
FT                   /locus_tag="mCG_18792"
FT                   /note="gene_id=mCG18792.2"
FT   mRNA            join(26450028..26450388,26451908..26451975,
FT                   26459005..26459205,26459819..26459950,26461493..26461646,
FT                   26463036..26463103,26465265..26465364,26469260..26469393,
FT                   26470817..26470876,26475979..26477741)
FT                   /gene="Pi4k2b"
FT                   /locus_tag="mCG_18792"
FT                   /product="phosphatidylinositol 4-kinase type 2 beta,
FT                   transcript variant mCT15253"
FT                   /note="gene_id=mCG18792.2 transcript_id=mCT15253.2 created
FT                   on 20-SEP-2002"
FT   mRNA            join(26450031..26450388,26456766..26456902,
FT                   26459005..26459205,26459819..26459950,26461493..26461646,
FT                   26463036..26463103,26465265..26465364,26469260..26469393,
FT                   26470817..26470876,26475979..26477741)
FT                   /gene="Pi4k2b"
FT                   /locus_tag="mCG_18792"
FT                   /product="phosphatidylinositol 4-kinase type 2 beta,
FT                   transcript variant mCT15252"
FT                   /note="gene_id=mCG18792.2 transcript_id=mCT15252.2 created
FT                   on 20-SEP-2002"
FT   CDS             join(26450139..26450388,26451908..26451975,
FT                   26459005..26459205,26459819..26459950,26461493..26461646,
FT                   26463036..26463103,26465265..26465364,26469260..26469393,
FT                   26470817..26470876,26475979..26476152)
FT                   /codon_start=1
FT                   /gene="Pi4k2b"
FT                   /locus_tag="mCG_18792"
FT                   /product="phosphatidylinositol 4-kinase type 2 beta,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG18792.2 transcript_id=mCT15253.2
FT                   protein_id=mCP3571.2 isoform=CRA_b"
FT                   /protein_id="EDL37662.1"
FT                   /translation="MAEVCEPTRPSEDEDEEREPLLPRVAWAQPRRVAPGSAVRMQADE
FT                   GADVLREPATDEPPAVSGEGSISASLSTELDRTRTTSSGPELCPFYSRSLCYKTTTALG
FT                   YYNIIGVFKPKSEEPYGQLNPKWTKYVHKVCCPCCFGRGCLLPNQGYLSEAGAYLVDVK
FT                   LNLGIVPKTKVVWLVSETFNYSAIDRAKSRGKKYALEKVPKVGRKFHRIGLPPKVGSFQ
FT                   LFVKDYKEAEYWLRRFEAEPLPENIRKQFQSQFEKLVILDYIIRNTDRGNDNWLVKYDE
FT                   MKYAKKIESEESNWIDNKQLLIKIAAIDNGLAFPFKHPDEWRAYPFHWAWLPQAKVPFS
FT                   EETRNLILPYISDMNFVQDLCEDLYELFKTDKGFDRAAFENQMSVMRGQILNLTQALRD
FT                   GKSPMQLAQMPCVIVECSKSGSQGRVVHLGSSFTQTVHCRKPFFSSW"
FT   CDS             join(26450139..26450388,26456766..26456902,
FT                   26459005..26459205,26459819..26459950,26461493..26461646,
FT                   26463036..26463103,26465265..26465364,26469260..26469393,
FT                   26470817..26470876,26475979..26476152)
FT                   /codon_start=1
FT                   /gene="Pi4k2b"
FT                   /locus_tag="mCG_18792"
FT                   /product="phosphatidylinositol 4-kinase type 2 beta,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG18792.2 transcript_id=mCT15252.2
FT                   protein_id=mCP3566.2 isoform=CRA_a"
FT                   /protein_id="EDL37661.1"
FT                   /translation="MAEVCEPTRPSEDEDEEREPLLPRVAWAQPRRVAPGSAVRMQADE
FT                   GADVLREPATDEPPAVSGEGSISASLSTELDRTRTTSSETNTFLEDPEFADIVLKAEQA
FT                   IEIGVFPERISQGSSGSYFVKDSKRNIIGVFKPKSEEPYGQLNPKWTKYVHKVCCPCCF
FT                   GRGCLLPNQGYLSEAGAYLVDVKLNLGIVPKTKVVWLVSETFNYSAIDRAKSRGKKYAL
FT                   EKVPKVGRKFHRIGLPPKVGSFQLFVKDYKEAEYWLRRFEAEPLPENIRKQFQSQFEKL
FT                   VILDYIIRNTDRGNDNWLVKYDEMKYAKKIESEESNWIDNKQLLIKIAAIDNGLAFPFK
FT                   HPDEWRAYPFHWAWLPQAKVPFSEETRNLILPYISDMNFVQDLCEDLYELFKTDKGFDR
FT                   AAFENQMSVMRGQILNLTQALRDGKSPMQLAQMPCVIVECSKSGSQGRVVHLGSSFTQT
FT                   VHCRKPFFSSW"
FT   gene            26491388..26533071
FT                   /locus_tag="mCG_18787"
FT                   /note="gene_id=mCG18787.1"
FT   mRNA            join(26491388..26491605,26492380..26492498,
FT                   26493486..26493568,26504368..26504643,26504973..26505050,
FT                   26512743..26512815,26515321..26515471,26516624..26516724,
FT                   26524205..26524326,26524566..26524641,26527013..26527064,
FT                   26527527..26527671,26532287..26533071)
FT                   /locus_tag="mCG_18787"
FT                   /product="mCG18787, transcript variant mCT15247"
FT                   /note="gene_id=mCG18787.1 transcript_id=mCT15247.2 created
FT                   on 18-FEB-2003"
FT   mRNA            join(<26491456..26491605,26492380..26492498,
FT                   26493486..26493568,26504368..26504643,26504973..26505050,
FT                   26512743..26512815,26515321..26515471,26516624..26516724,
FT                   26524205..26524326,26524566..26524641,26527013..26527064,
FT                   26527527..26528171)
FT                   /locus_tag="mCG_18787"
FT                   /product="mCG18787, transcript variant mCT193640"
FT                   /note="gene_id=mCG18787.1 transcript_id=mCT193640.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<26491458..26491605,26492380..26492498,
FT                   26493486..26493568,26504368..26504643,26504973..26505050,
FT                   26512743..26512815,26515321..26515471,26516624..26516724,
FT                   26524205..26524326,26524566..26524641,26527013..26527064,
FT                   26527527..26527810)
FT                   /codon_start=1
FT                   /locus_tag="mCG_18787"
FT                   /product="mCG18787, isoform CRA_c"
FT                   /note="gene_id=mCG18787.1 transcript_id=mCT193640.0
FT                   protein_id=mCP114615.0 isoform=CRA_c"
FT                   /protein_id="EDL37665.1"
FT                   /translation="GFRDFGRKMAAPMDCLESLEGDGDAGRRASGVEVALPSNPTAPAP
FT                   LCPHGPTLLFVKVNQGKEETRKFYACSACRDRKDCNFFQWEDEKLSEARLAAREIHNQK
FT                   CQPPLSRAQCIERYLSFIQLPLAQRKFCQSCQQLLLPADWREHGTHQLSADISVAQLGR
FT                   PSQLLYPLENKKTHAQYLFADRSCQFLAGLLATLGFSRVLCVGAPRLHEQIRLTASGER
FT                   SGMRSLLLDIDFRYSQFYLEGSFCRYNMFNHHFFDGKAALEVCKEFLQEEEGKGVIMVT
FT                   DPPFGGLVEPLAITFKKLIAMWKEGQSQDDSHKELPIFWIFPYFFESRICQFFPSFCML
FT                   DYQVDYDNHALYKHGKTGRKQSPVRIFTNVPPNKIILPSEEGYRFCSLCQRYVSRENQH
FT                   CVHCNSCTSKDGRKWSHCFLCKKCVKPSWIHCNTCNRCALPDHSCLGPKDGCFICGALD
FT                   HKRSNCPNIGTSWRANKLVEFFGFLEKRLLMSSFLGAIYRSTKLSEDSEFFRVLNRSSH
FT                   HYV"
FT   mRNA            join(26491464..26491605,26492380..26492498,
FT                   26493486..26493568,26504368..26504643,26504973..26505050,
FT                   26512743..26512815,26515321..26515471,26516624..26516724,
FT                   26524205..26524326,26524566..26524641,26527013..26527064,
FT                   26527527..26527671,26532024..26533070)
FT                   /locus_tag="mCG_18787"
FT                   /product="mCG18787, transcript variant mCT180188"
FT                   /note="gene_id=mCG18787.1 transcript_id=mCT180188.0 created
FT                   on 18-FEB-2003"
FT   CDS             join(26491482..26491605,26492380..26492498,
FT                   26493486..26493568,26504368..26504643,26504973..26505050,
FT                   26512743..26512815,26515321..26515471,26516624..26516724,
FT                   26524205..26524326,26524566..26524641,26527013..26527064,
FT                   26527527..26527671,26532287..26532521)
FT                   /codon_start=1
FT                   /locus_tag="mCG_18787"
FT                   /product="mCG18787, isoform CRA_a"
FT                   /note="gene_id=mCG18787.1 transcript_id=mCT15247.2
FT                   protein_id=mCP3555.2 isoform=CRA_a"
FT                   /protein_id="EDL37663.1"
FT                   /translation="MAAPMDCLESLEGDGDAGRRASGVEVALPSNPTAPAPLCPHGPTL
FT                   LFVKVNQGKEETRKFYACSACRDRKDCNFFQWEDEKLSEARLAAREIHNQKCQPPLSRA
FT                   QCIERYLSFIQLPLAQRKFCQSCQQLLLPADWREHGTHQLSADISVAQLGRPSQLLYPL
FT                   ENKKTHAQYLFADRSCQFLAGLLATLGFSRVLCVGAPRLHEQIRLTASGERSGMRSLLL
FT                   DIDFRYSQFYLEGSFCRYNMFNHHFFDGKAALEVCKEFLQEEEGKGVIMVTDPPFGGLV
FT                   EPLAITFKKLIAMWKEGQSQDDSHKELPIFWIFPYFFESRICQFFPSFCMLDYQVDYDN
FT                   HALYKHGKTGRKQSPVRIFTNVPPNKIILPSEEGYRFCSLCQRYVSRENQHCVHCNSCT
FT                   SKDGRKWSHCFLCKKCVKPSWIHCNTCNRCALPDHSCLGPKDGCFICGALDHKRSNCPN
FT                   IGTSWRANKWHLLAMSLQLPLQTGEPSVGSRLPGSLSTLFHPLTPHQCLFWPLLTEKLT
FT                   DVQYLFTSIPDRNANESLPLTCLPRVR"
FT   CDS             join(26491482..26491605,26492380..26492498,
FT                   26493486..26493568,26504368..26504643,26504973..26505050,
FT                   26512743..26512815,26515321..26515471,26516624..26516724,
FT                   26524205..26524326,26524566..26524641,26527013..26527064,
FT                   26527527..26527671,26532024..26532093)
FT                   /codon_start=1
FT                   /locus_tag="mCG_18787"
FT                   /product="mCG18787, isoform CRA_b"
FT                   /note="gene_id=mCG18787.1 transcript_id=mCT180188.0
FT                   protein_id=mCP103110.0 isoform=CRA_b"
FT                   /protein_id="EDL37664.1"
FT                   /translation="MAAPMDCLESLEGDGDAGRRASGVEVALPSNPTAPAPLCPHGPTL
FT                   LFVKVNQGKEETRKFYACSACRDRKDCNFFQWEDEKLSEARLAAREIHNQKCQPPLSRA
FT                   QCIERYLSFIQLPLAQRKFCQSCQQLLLPADWREHGTHQLSADISVAQLGRPSQLLYPL
FT                   ENKKTHAQYLFADRSCQFLAGLLATLGFSRVLCVGAPRLHEQIRLTASGERSGMRSLLL
FT                   DIDFRYSQFYLEGSFCRYNMFNHHFFDGKAALEVCKEFLQEEEGKGVIMVTDPPFGGLV
FT                   EPLAITFKKLIAMWKEGQSQDDSHKELPIFWIFPYFFESRICQFFPSFCMLDYQVDYDN
FT                   HALYKHGKTGRKQSPVRIFTNVPPNKIILPSEEGYRFCSLCQRYVSRENQHCVHCNSCT
FT                   SKDGRKWSHCFLCKKCVKPSWIHCNTCNRCALPDHSCLGPKDGCFICGALDHKRSNCPN
FT                   IGTSWRANKAVRKQKQRKRNKIRREALKDNP"
FT   gene            26542491..26575539
FT                   /gene="Anapc4"
FT                   /locus_tag="mCG_18789"
FT                   /note="gene_id=mCG18789.1"
FT   mRNA            join(26542491..26542801,26544087..26544192,
FT                   26548029..26548161,26550124..26550198,26550313..26550339,
FT                   26550432..26550476,26551229..26551313,26551895..26551999,
FT                   26553732..26553815,26555040..26555126,26556399..26556463,
FT                   26557002..26557044,26557163..26557239,26558866..26558966,
FT                   26559051..26559102,26564045..26564100,26564305..26564351,
FT                   26565218..26565325,26565632..26565688,26567595..26567688,
FT                   26569725..26569822,26570431..26570492,26570573..26570611,
FT                   26570704..26570805,26572077..26572151,26572969..26573142,
FT                   26574384..26574507,26574885..26575539)
FT                   /gene="Anapc4"
FT                   /locus_tag="mCG_18789"
FT                   /product="anaphase promoting complex subunit 4, transcript
FT                   variant mCT15249"
FT                   /note="gene_id=mCG18789.1 transcript_id=mCT15249.2 created
FT                   on 07-FEB-2003"
FT   mRNA            join(26542544..26542801,26544087..26544192,
FT                   26548029..26548161,26550124..26550198,26550313..26550339,
FT                   26550432..26550476,26551229..26551313,26551895..26551999,
FT                   26553732..26553815,26555040..26555126,26556399..26556463,
FT                   26557002..26557044,26557163..26557239,26558866..26558966,
FT                   26559051..26559102,26564045..26564100,26564305..26564351,
FT                   26565269..26565325,26565632..26565688,26567595..26567688,
FT                   26569725..26569822,26570431..26570492,26570573..26570611,
FT                   26570704..26570805,26572077..26572151,26572969..26573142,
FT                   26574384..26574507,26574885..26575223)
FT                   /gene="Anapc4"
FT                   /locus_tag="mCG_18789"
FT                   /product="anaphase promoting complex subunit 4, transcript
FT                   variant mCT179711"
FT                   /note="gene_id=mCG18789.1 transcript_id=mCT179711.0 created
FT                   on 07-FEB-2003"
FT   CDS             join(26542673..26542801,26544087..26544192,
FT                   26548029..26548161,26550124..26550198,26550313..26550339,
FT                   26550432..26550476,26551229..26551313,26551895..26551999,
FT                   26553732..26553815,26555040..26555126,26556399..26556463,
FT                   26557002..26557044,26557163..26557239,26558866..26558966,
FT                   26559051..26559102,26564045..26564100,26564305..26564351,
FT                   26565218..26565325,26565632..26565688,26567595..26567688,
FT                   26569725..26569822,26570431..26570492,26570573..26570611,
FT                   26570704..26570805,26572077..26572151,26572969..26573142,
FT                   26574384..26574507,26574885..26575109)
FT                   /codon_start=1
FT                   /gene="Anapc4"
FT                   /locus_tag="mCG_18789"
FT                   /product="anaphase promoting complex subunit 4, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG18789.1 transcript_id=mCT15249.2
FT                   protein_id=mCP3557.2 isoform=CRA_a"
FT                   /protein_id="EDL37666.1"
FT                   /translation="MLRFPTCFPSFRVVGEKQLPQEIIFLAWSPKRDLIALANTTGEVL
FT                   LHRLASFHRVWSFPPNESTGKEVTCLAWRPDGKLLAFALADTKKIILCDVEKPESLHSF
FT                   SVEAPVSCMHWTEVTVESSVLTSFYNAEDESNLLLPKLPTLPKNYNSTSKIFSEENSDE
FT                   IIKLLGDVRLNILVLGGSSGFIELYAYGMFKIARVTGIAGTCIALCLSSDLKSLSVVTE
FT                   VSSGGESEVSYFQLETNLLYSFLPEVTRMARKFTHISALLQYINLSLTCMCEAWEEILM
FT                   QMDSRLTKFVQEKPTTTSVQDEFMHLLLWGKASAELQTLLMNQLTVKGLKKLGQSIESS
FT                   YSSIQKLVISHLQSGSESLLYHLSELKGMASWKQKYEPLGLDAAGIEDAITAVGSFILK
FT                   ANELLQVIDSSMKNFKAFFRWLYVAMLRMTEDHVLPELNKTVGKRSWFDWFCLTWLQMT
FT                   QKDITFVAEFLTEHFNEAPDLYNRKGKYFNVERVGQYLKDEDDDLVSPPNTEGNQWYDF
FT                   LQNSTHLKESPLLFPYYPRKSLHFVKRRMENVIDQCLQKPADVIGRSMNQAICIPLYKD
FT                   ARSMDCARRLLKFPFLWNNKTSNLHYLLFTILEDSVYKMCILRRHTDISQSVSNGLIGI
FT                   KFGSFTSASADKVRRSSYSCLDAQFYDDETVTVILKDSMGREGRDRILVQLSLSLVYNS
FT                   EDSDEYEFTGSYSTRLDEQGSIIPTRTMHFEKHWRLLESMRAQYVAGNGLRKVSCVLSS
FT                   NLRHVRVFEMDIDDEWEIDESSDDEEEAGGKPVKIKEEVLSESETEAHQDAAALDPDVV
FT                   IKVEKLDPELDS"
FT   CDS             join(26542673..26542801,26544087..26544192,
FT                   26548029..26548161,26550124..26550198,26550313..26550339,
FT                   26550432..26550476,26551229..26551313,26551895..26551999,
FT                   26553732..26553815,26555040..26555126,26556399..26556463,
FT                   26557002..26557044,26557163..26557239,26558866..26558966,
FT                   26559051..26559102,26564045..26564100,26564305..26564351,
FT                   26565269..26565325,26565632..26565688,26567595..26567688,
FT                   26569725..26569822,26570431..26570492,26570573..26570611,
FT                   26570704..26570805,26572077..26572151,26572969..26573142,
FT                   26574384..26574507,26574885..26575109)
FT                   /codon_start=1
FT                   /gene="Anapc4"
FT                   /locus_tag="mCG_18789"
FT                   /product="anaphase promoting complex subunit 4, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG18789.1 transcript_id=mCT179711.0
FT                   protein_id=mCP102633.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q3TM92"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017169"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR024789"
FT                   /db_xref="InterPro:IPR024790"
FT                   /db_xref="InterPro:IPR024977"
FT                   /db_xref="MGI:MGI:1098673"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TM92"
FT                   /protein_id="EDL37667.1"
FT                   /translation="MLRFPTCFPSFRVVGEKQLPQEIIFLAWSPKRDLIALANTTGEVL
FT                   LHRLASFHRVWSFPPNESTGKEVTCLAWRPDGKLLAFALADTKKIILCDVEKPESLHSF
FT                   SVEAPVSCMHWTEVTVESSVLTSFYNAEDESNLLLPKLPTLPKNYNSTSKIFSEENSDE
FT                   IIKLLGDVRLNILVLGGSSGFIELYAYGMFKIARVTGIAGTCIALCLSSDLKSLSVVTE
FT                   VSSGGESEVSYFQLETNLLYSFLPEVTRMARKFTHISALLQYINLSLTCMCEAWEEILM
FT                   QMDSRLTKFVQEKPTTTSVQDEFMHLLLWGKASAELQTLLMNQLTVKGLKKLGQSIESS
FT                   YSSIQKLVISHLQSGSESLLYHLSELKGMASWKQKYEPLGLDAAGIEDAITAVGSFILK
FT                   ANELLQVIDSSMKNFKAFFRWLYVAMLRMTEDHVLPELNKMTQKDITFVAEFLTEHFNE
FT                   APDLYNRKGKYFNVERVGQYLKDEDDDLVSPPNTEGNQWYDFLQNSTHLKESPLLFPYY
FT                   PRKSLHFVKRRMENVIDQCLQKPADVIGRSMNQAICIPLYKDARSMDCARRLLKFPFLW
FT                   NNKTSNLHYLLFTILEDSVYKMCILRRHTDISQSVSNGLIGIKFGSFTSASADKVRRSS
FT                   YSCLDAQFYDDETVTVILKDSMGREGRDRILVQLSLSLVYNSEDSDEYEFTGSYSTRLD
FT                   EQGSIIPTRTMHFEKHWRLLESMRAQYVAGNGLRKVSCVLSSNLRHVRVFEMDIDDEWE
FT                   IDESSDDEEEAGGKPVKIKEEVLSESETEAHQDAAALDPDVVIKVEKLDPELDS"
FT   gene            complement(26627019..26628305)
FT                   /pseudo
FT                   /locus_tag="mCG_1046073"
FT                   /note="gene_id=mCG1046073.1"
FT   mRNA            complement(26627019..26628305)
FT                   /pseudo
FT                   /locus_tag="mCG_1046073"
FT                   /note="gene_id=mCG1046073.1 transcript_id=mCT163777.1
FT                   created on 16-OCT-2002"
FT   gene            complement(26683602..>26705071)
FT                   /locus_tag="mCG_1046304"
FT                   /note="gene_id=mCG1046304.0"
FT   mRNA            complement(join(26683602..26683852,26701276..26701424,
FT                   26704714..>26705071))
FT                   /locus_tag="mCG_1046304"
FT                   /product="mCG1046304, transcript variant mCT164008"
FT                   /note="gene_id=mCG1046304.0 transcript_id=mCT164008.0
FT                   created on 18-FEB-2003"
FT   mRNA            complement(join(26683642..26683852,26701276..26701424,
FT                   26702889..>26702967))
FT                   /locus_tag="mCG_1046304"
FT                   /product="mCG1046304, transcript variant mCT180215"
FT                   /note="gene_id=mCG1046304.0 transcript_id=mCT180215.0
FT                   created on 18-FEB-2003"
FT   CDS             complement(join(26683774..26683852,26701276..>26701376))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1046304"
FT                   /product="mCG1046304, isoform CRA_a"
FT                   /note="gene_id=mCG1046304.0 transcript_id=mCT180215.0
FT                   protein_id=mCP103137.0 isoform=CRA_a"
FT                   /protein_id="EDL37668.1"
FT                   /translation="LAEPLGRPQQIPKLSAKAPQIPISSGPFKCWDCSKKNKTRGRGER
FT                   KKSKWGTEKLLKGW"
FT   CDS             complement(26704717..>26705004)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1046304"
FT                   /product="mCG1046304, isoform CRA_b"
FT                   /note="gene_id=mCG1046304.0 transcript_id=mCT164008.0
FT                   protein_id=mCP64997.0 isoform=CRA_b"
FT                   /protein_id="EDL37669.1"
FT                   /translation="GSSLKRLRSSPHNRLMGTTAARFSPGPKAFWEVGGVRNSNWVDKN
FT                   VQARDQGGVNAIMSGTREFCSYSASRGPWQQRSQHNCVLGTCFGSFQVGR"
FT   gene            complement(26759599..26761100)
FT                   /locus_tag="mCG_148286"
FT                   /note="gene_id=mCG148286.0"
FT   mRNA            complement(join(26759599..26760150,26760793..26761100))
FT                   /locus_tag="mCG_148286"
FT                   /product="mCG148286"
FT                   /note="gene_id=mCG148286.0 transcript_id=mCT188549.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(26760799..26760996)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148286"
FT                   /product="mCG148286"
FT                   /note="gene_id=mCG148286.0 transcript_id=mCT188549.0
FT                   protein_id=mCP109200.0"
FT                   /protein_id="EDL37670.1"
FT                   /translation="MLTTSCGPLPSASFSQSLCAVPSPGLERLDTEQQIVNSGTRFFFF
FT                   ATKPGLFQVPLPGDLSGLGS"
FT   gene            26761268..26783557
FT                   /gene="Slc34a2"
FT                   /locus_tag="mCG_16302"
FT                   /note="gene_id=mCG16302.1"
FT   mRNA            join(26761268..26761308,26770072..26770186,
FT                   26770280..26770417,26771058..26771186,26772679..26772822,
FT                   26773284..26773395,26775742..26775937,26776692..26776787,
FT                   26777390..26777510,26779463..26779630,26780025..26780141,
FT                   26780240..26780364,26780891..26782326,26782471..26783557)
FT                   /gene="Slc34a2"
FT                   /locus_tag="mCG_16302"
FT                   /product="solute carrier family 34 (sodium phosphate),
FT                   member 2"
FT                   /note="gene_id=mCG16302.1 transcript_id=mCT17187.1 created
FT                   on 20-SEP-2002"
FT   CDS             join(26770075..26770186,26770280..26770417,
FT                   26771058..26771186,26772679..26772822,26773284..26773395,
FT                   26775742..26775937,26776692..26776787,26777390..26777510,
FT                   26779463..26779630,26780025..26780141,26780240..26780364,
FT                   26780891..26781526)
FT                   /codon_start=1
FT                   /gene="Slc34a2"
FT                   /locus_tag="mCG_16302"
FT                   /product="solute carrier family 34 (sodium phosphate),
FT                   member 2"
FT                   /note="gene_id=mCG16302.1 transcript_id=mCT17187.1
FT                   protein_id=mCP3550.1"
FT                   /protein_id="EDL37671.1"
FT                   /translation="MAPWPELENAQPNPGKFIEGASGPQSSIPAKDKEASKTNDNGTPV
FT                   AKTELLPSYSALVLIEEHPEGTDPWDLPELQDTGIKWSERDTKGKTLCIFQGVGKFILL
FT                   LGFLYLFVCSLDVLSSAFQLVGGKVAGQFFSNNSIMSNPVAGLVIGVLVTVMVQSSSTS
FT                   SSIIVSMVASSLLTVRAAIPIIMGANIGTSITNTIVALMQAGDRNEFRRAFAGATVHDF
FT                   FNWLSVFVLLPLEAATHYLEILTNLVLETFKFQNGEDAPDILKVITDPFTKLIIQLDKK
FT                   VIQQIAMGDSAAQNKSLIKIWCKSITNVTEMNVTVPSTDNCTSPSYCWTDGIQTWTIQN
FT                   VTQKENIAKCQHIFVNFSLPDLAVGIILLTVSLVVLCGCLIMIVKLLGSVLRGQVATVI
FT                   KKTLNTDFPFPFAWLTGYLAILVGAGMTFIVQSSSVFTSAMTPLIGIGVISIERAYPLT
FT                   LGSNIGTTTTAILAALASPGNTLRSSLQIALCHFFFNISGILLWYPIPFTRLPIRLAKG
FT                   LGNISAKYRWFAVFYLIFFFFVTPLTVFGLSLAGWPVLVGVGVPIILLLLLVLCLRMLQ
FT                   FRCPRILPLKLRDWNFLPLWMHSLKPWDNVISLATTCFQRRCCCCCRVCCRVCCMVCGC
FT                   KCCRCSKCCRDQGEEEEEKEQDIPVKASGAFDNAAMSKECQDEGKGQVEVLSMKALSNT
FT                   TVF"
FT   gene            complement(26818913..>26925409)
FT                   /gene="2310045A20Rik"
FT                   /locus_tag="mCG_16306"
FT                   /note="gene_id=mCG16306.3"
FT   mRNA            complement(join(26818913..26820004,26828152..26828258,
FT                   26828874..26829001,26833577..26833686,26834995..26835079,
FT                   26835214..26835304,26843637..26843720,26847664..26847791,
FT                   26849677..26849853,26855933..26856073,26857322..26857441,
FT                   26866074..26866253,26867456..26867667,26882257..26882397,
FT                   26884474..26884606,26886637..26886769,26893625..26893683,
FT                   26896669..26896784,26897866..26897987,26899870..26899996,
FT                   26912001..26912571,26925220..26925300))
FT                   /gene="2310045A20Rik"
FT                   /locus_tag="mCG_16306"
FT                   /product="RIKEN cDNA 2310045A20, transcript variant
FT                   mCT17191"
FT                   /note="gene_id=mCG16306.3 transcript_id=mCT17191.2 created
FT                   on 26-SEP-2002"
FT   mRNA            complement(join(26818987..26820004,26827997..26828069,
FT                   26828156..26828258,26828874..26829001,26833577..26833686,
FT                   26834995..26835079,26835214..26835304,26843637..26843720,
FT                   26847664..26847791,26849677..26849853,26851699..26851761,
FT                   26855933..26856073,26857322..26857441,26866074..26866253,
FT                   26867456..26867667,26882257..26882397,26884474..26884606,
FT                   26886637..26886769,26893625..26893683,26896669..26896784,
FT                   26897866..26897987,26899870..26899996,26912001..26912571,
FT                   26925220..>26925409))
FT                   /gene="2310045A20Rik"
FT                   /locus_tag="mCG_16306"
FT                   /product="RIKEN cDNA 2310045A20, transcript variant
FT                   mCT193604"
FT                   /note="gene_id=mCG16306.3 transcript_id=mCT193604.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(26819865..26820004,26827997..26828069,
FT                   26828156..26828258,26828874..26829001,26833577..26833686,
FT                   26834995..26835079,26835214..26835304,26843637..26843720,
FT                   26847664..26847791,26849677..26849853,26851699..26851761,
FT                   26855933..26856073,26857322..26857441,26866074..26866253,
FT                   26867456..26867667,26882257..26882397,26884474..26884606,
FT                   26886637..26886769,26893625..26893683,26896669..26896784,
FT                   26897866..26897987,26899870..26899996,26912001..26912571,
FT                   26925220..>26925408))
FT                   /codon_start=1
FT                   /gene="2310045A20Rik"
FT                   /locus_tag="mCG_16306"
FT                   /product="RIKEN cDNA 2310045A20, isoform CRA_b"
FT                   /note="gene_id=mCG16306.3 transcript_id=mCT193604.0
FT                   protein_id=mCP114579.0 isoform=CRA_b"
FT                   /protein_id="EDL37673.1"
FT                   /translation="GGLAMQWRGAGLWWPRRRQQQQQQQPPPPAFGPPAAAMVPPSRGV
FT                   SPGLGGRPTSALLFLCYLNFVPSLGRQTSLTTSVLPRTEQSTTYADFIYFTAFEGSVRN
FT                   VSEVSVEYLCSQPCVVHLEAVVSSEFRSSIPVYKKRWRNEKHLHTSRTQTVHVKFPSIM
FT                   VYRDDYLIRHPISVSTVILRAWITHWHSGGGLNVRGEENLLHAVAKNYTLLQTVPPFER
FT                   PFKDHQVCLEWNMDYLWSLWANRIPQCPLESDAVALLSFPYASSGENTGIVKKLQNFQN
FT                   RELEATRSQRVDYPMVTISLWLYLLHYCEASLCGILYFVDSNEMYGTPSVFLTEDGSLH
FT                   IQMHLVKGEDLAVKTKFTIPLKEWCRLDISFNGGQIVVTASIGWDLKSYHNQTISFHED
FT                   FYYNDTAGYFIIGGSRYVAGIEGFFGPVKYYRLRSLHPAQVLNPFLEKELAEQIKLYYE
FT                   RCTEVQDIISSYAATVQVGGERRETCDFHNSYLDLKRKYGRAEVCRGLPWEKELRDRHP
FT                   SLFQSLLQMDLLTVPWNQNDSVLEIGARIFEKAVKRLSGVDGLHQISSAIPFLMDSSCC
FT                   GYHKASYYLTVFYETGLNGPRDQLQGMLYSLVGGQGSERLSSMNLGYKHYQGVDSYPLD
FT                   WELSYAYYSNIATKTPLDQHTLQGDQAYVETIRLKDDEILKVQTKEDGDVFMWLKHEAT
FT                   RGNAAAQQRLAQMLFWGQQGVAKNPEAAIEWYAKGALETEDPALIYDYAIVLFKGQGVK
FT                   KNRRLALELMKKAASKGLHQAVNGLGWYYHKFRKNYAKAAKYWLKAEEMGNPDASYNLG
FT                   VLYLDGIFPGVPGRNLTLAGEYFHKAAQGGHIEGTLWCSLYYITGNLETFPRDPEKAVV
FT                   WAKHVAEKNGYLGHVIRKGLNAYLEGLWHEALLYYVLAAETGIEVSQTNLAHICEERPD
FT                   LAGRYLGVNCVWRYYNFSVFQIDAPSFAYLKMGDLYYYGHQNQSQDLELSVQMYAQAAL
FT                   DGDSQGFFNLAALIEEGAVIPHHILEFLEIDPSLHSSNTSILQELYERCWSLSNEESLS
FT                   PCSLAWLYLHLRLLWGAVLHSALIYFLGTFLLSVVIAWMVLYLQYISASGSSPAPAWVS
FT                   ADPTSSTPSPAVPPAADASDHDPPMMANGPEPRG"
FT   CDS             complement(join(26819865..26820004,26828152..26828258,
FT                   26828874..26829001,26833577..26833686,26834995..26835079,
FT                   26835214..26835304,26843637..26843720,26847664..26847791,
FT                   26849677..26849853,26855933..26856073,26857322..26857441,
FT                   26866074..26866253,26867456..26867667,26882257..26882397,
FT                   26884474..26884606,26886637..26886769,26893625..26893683,
FT                   26896669..26896784,26897866..26897987,26899870..26899996,
FT                   26912001..26912571,26925220..26925297))
FT                   /codon_start=1
FT                   /gene="2310045A20Rik"
FT                   /locus_tag="mCG_16306"
FT                   /product="RIKEN cDNA 2310045A20, isoform CRA_a"
FT                   /note="gene_id=mCG16306.3 transcript_id=mCT17191.2
FT                   protein_id=mCP3549.2 isoform=CRA_a"
FT                   /protein_id="EDL37672.1"
FT                   /translation="MVPPSRGVSPGLGGRPTSALLFLCYLNFVPSLGRQTSLTTSVLPR
FT                   TEQSTTYADFIYFTAFEGSVRNVSEVSVEYLCSQPCVVHLEAVVSSEFRSSIPVYKKRW
FT                   RNEKHLHTSRTQTVHVKFPSIMVYRDDYLIRHPISVSTVILRAWITHWHSGGGLNVRGE
FT                   ENLLHAVAKNYTLLQTVPPFERPFKDHQVCLEWNMDYLWSLWANRIPQCPLESDAVALL
FT                   SFPYASSGENTGIVKKLQNFQNRELEATRSQRVDYPMVTISLWLYLLHYCEASLCGILY
FT                   FVDSNEMYGTPSVFLTEDGSLHIQMHLVKGEDLAVKTKFTIPLKEWCRLDISFNGGQIV
FT                   VTASIGWDLKSYHNQTISFHEDFYYNDTAGYFIIGGSRYVAGIEGFFGPVKYYRLRSLH
FT                   PAQVLNPFLEKELAEQIKLYYERCTEVQDIISSYAATVQVGGERRETCDFHNSYLDLKR
FT                   KYGRAEVCRGLPWEKELRDRHPSLFQSLLQMDLLTVPWNQNDSVLEIGARIFEKAVKRL
FT                   SGVDGLHQISSAIPFLMDSSCCGYHKASYYLTVFYETGLNGPRDQLQGMLYSLVGGQGS
FT                   ERLSSMNLGYKHYQGVDSYPLDWELSYAYYSNIATKTPLDQHTLQGDQAYVETIRLKDD
FT                   EILKVQTKEDGDVFMWLKHEATRGNAAAQQRLAQMLFWGQQGVAKNPEAAIEWYAKGAL
FT                   ETEDPALIYDYAIVLFKGLHQAVNGLGWYYHKFRKNYAKAAKYWLKAEEMGNPDASYNL
FT                   GVLYLDGIFPGVPGRNLTLAGEYFHKAAQGGHIEGTLWCSLYYITGNLETFPRDPEKAV
FT                   VWAKHVAEKNGYLGHVIRKGLNAYLEGLWHEALLYYVLAAETGIEVSQTNLAHICEERP
FT                   DLAGRYLGVNCVWRYYNFSVFQIDAPSFAYLKMGDLYYYGHQNQSQDLELSVQMYAQAA
FT                   LDGDSQGFFNLAALIEEGAVIPHHILEFLEIDPSLHSSNTSILQELYERCWSLSNEESL
FT                   SPCSLAWLYLHLRLLWGAVLHSALVTSGSSPAPAWVSADPTSSTPSPAVPPAADASDHD
FT                   PPMMANGPEPRG"
FT   gene            <26979177..26990537
FT                   /locus_tag="mCG_16301"
FT                   /note="gene_id=mCG16301.2"
FT   mRNA            join(<26979177..26979368,26989143..26989197,
FT                   26989895..26989927)
FT                   /locus_tag="mCG_16301"
FT                   /product="mCG16301, transcript variant mCT180251"
FT                   /note="gene_id=mCG16301.2 transcript_id=mCT180251.0 created
FT                   on 13-FEB-2003"
FT   CDS             join(<26979179..26979368,26989143..26989197,
FT                   26989895..26989913)
FT                   /codon_start=1
FT                   /locus_tag="mCG_16301"
FT                   /product="mCG16301, isoform CRA_e"
FT                   /note="gene_id=mCG16301.2 transcript_id=mCT180251.0
FT                   protein_id=mCP103174.0 isoform=CRA_e"
FT                   /protein_id="EDL37678.1"
FT                   /translation="TLRPGIEFPNVRGPSPALLPPFSPWQRPGTCAPRSYSEASSPWSA
FT                   PPSIPSTSGPLCGWRNTVKGAGCKSSWYCPGRCATARVESVV"
FT   mRNA            join(<26979189..26979364,26980029..26980082,
FT                   26989143..26989197,26989895..26990537)
FT                   /locus_tag="mCG_16301"
FT                   /product="mCG16301, transcript variant mCT173704"
FT                   /note="gene_id=mCG16301.2 transcript_id=mCT173704.0 created
FT                   on 13-FEB-2003"
FT   CDS             join(<26979191..26979364,26980029..26980082,
FT                   26989143..26989197,26989895..26989932)
FT                   /codon_start=1
FT                   /locus_tag="mCG_16301"
FT                   /product="mCG16301, isoform CRA_d"
FT                   /note="gene_id=mCG16301.2 transcript_id=mCT173704.0
FT                   protein_id=mCP96622.0 isoform=CRA_d"
FT                   /protein_id="EDL37677.1"
FT                   /translation="GIEFPNVRGPSPALLPPFSPWQRPGTCAPRSYSEASSPWSAPPSI
FT                   PSTSGPLCGWRNTILLVSFIFKLAAHMTMASKEQAVNRAGIVQEDVQPPGLKVWSDPFG
FT                   RK"
FT   mRNA            join(<26979222..26979593,26989141..26989197,
FT                   26989895..26989921)
FT                   /locus_tag="mCG_16301"
FT                   /product="mCG16301, transcript variant mCT180252"
FT                   /note="gene_id=mCG16301.2 transcript_id=mCT180252.0 created
FT                   on 13-FEB-2003"
FT   mRNA            join(<26979234..26979364,26980029..26980337,
FT                   26989141..26989197,26989895..26990259)
FT                   /locus_tag="mCG_16301"
FT                   /product="mCG16301, transcript variant mCT173703"
FT                   /note="gene_id=mCG16301.2 transcript_id=mCT173703.0 created
FT                   on 13-FEB-2003"
FT   CDS             join(<26979236..26979364,26980029..26980175)
FT                   /codon_start=1
FT                   /locus_tag="mCG_16301"
FT                   /product="mCG16301, isoform CRA_b"
FT                   /note="gene_id=mCG16301.2 transcript_id=mCT173703.0
FT                   protein_id=mCP96623.0 isoform=CRA_b"
FT                   /protein_id="EDL37675.1"
FT                   /translation="PPFSPWQRPGTCAPRSYSEASSPWSAPPSIPSTSGPLCGWRNTIL
FT                   LVSFIFKLAAHMTMASVRGVIFLLNHSGPIILKATLLPGDLYLSKD"
FT   mRNA            join(<26979257..26979364,26989141..26989197,
FT                   26989895..26990537)
FT                   /locus_tag="mCG_16301"
FT                   /product="mCG16301, transcript variant mCT17186"
FT                   /note="gene_id=mCG16301.2 transcript_id=mCT17186.2 created
FT                   on 13-FEB-2003"
FT   CDS             join(<26979259..26979364,26989141..26989197,
FT                   26989895..26989932)
FT                   /codon_start=1
FT                   /locus_tag="mCG_16301"
FT                   /product="mCG16301, isoform CRA_a"
FT                   /note="gene_id=mCG16301.2 transcript_id=mCT17186.2
FT                   protein_id=mCP3554.2 isoform=CRA_a"
FT                   /protein_id="EDL37674.1"
FT                   /translation="ARNLRTALIFGGFISMVGAAFYPIYFRPLMRLEEYQKEQAVNRAG
FT                   IVQEDVQPPGLKVWSDPFGRK"
FT   CDS             join(<26979423..26979593,26989141..26989158)
FT                   /codon_start=1
FT                   /locus_tag="mCG_16301"
FT                   /product="mCG16301, isoform CRA_c"
FT                   /note="gene_id=mCG16301.2 transcript_id=mCT180252.0
FT                   protein_id=mCP103173.0 isoform=CRA_c"
FT                   /protein_id="EDL37676.1"
FT                   /translation="APTLSVQGVLRKDVDLGVRLPGFQARPVQPGDHGQGAPPLTFNVE
FT                   ALHIFCRISNKTRRSRL"
FT   gene            27304571..27371147
FT                   /gene="Rbpsuh"
FT                   /locus_tag="mCG_16305"
FT                   /note="gene_id=mCG16305.2"
FT   mRNA            join(27304571..27304712,27341479..27341517,
FT                   27350060..27350155,27356063..27356228,27359935..27360109,
FT                   27363385..27363522,27363677..27363789,27365541..27365681,
FT                   27367505..27367660,27367979..27368082,27368202..27370923)
FT                   /gene="Rbpsuh"
FT                   /locus_tag="mCG_16305"
FT                   /product="recombining binding protein suppressor of
FT                   hairless (Drosophila), transcript variant mCT179717"
FT                   /note="gene_id=mCG16305.2 transcript_id=mCT179717.0 created
FT                   on 17-JUN-2003"
FT   CDS             join(27304576..27304712,27341479..27341517,
FT                   27350060..27350155,27356063..27356228,27359935..27360109,
FT                   27363385..27363522,27363677..27363789,27365541..27365681,
FT                   27367505..27367660,27367979..27368082,27368202..27368517)
FT                   /codon_start=1
FT                   /gene="Rbpsuh"
FT                   /locus_tag="mCG_16305"
FT                   /product="recombining binding protein suppressor of
FT                   hairless (Drosophila), isoform CRA_a"
FT                   /note="gene_id=mCG16305.2 transcript_id=mCT179717.0
FT                   protein_id=mCP102639.0 isoform=CRA_a"
FT                   /protein_id="EDL37679.1"
FT                   /translation="MPSGFPQSPRTSPRARPKTRITGALPMDYSEGLSAEERPAHAPSA
FT                   GKFGERPPPKRLTREAMRNYLKERGDQTVLILHAKVAQKSYGNEKRFFCPPPCVYLMGS
FT                   GWKKKKEQMERDGCSEQESQPCAFIGIGNSDQEMQQLNLEGKNYCTAKTLYISDSDKRK
FT                   HFMLSVKMFYGNSDDIGVFLSKRIKVISKPSKKKQSLKNADLCIASGTKVALFNRLRSQ
FT                   TVSTRYLHVEGGNFHASSQQWGAFYIHLLDDDESEGEEFTVRDGYIHYGQTVKLVCSVT
FT                   GMALPRLIIRKVDKQTALLDADDPVSQLHKCAFYLKDTERMYLCLSQERIIQFQATPCP
FT                   KEQNKEMINDGASWTIISTDKAEYTFYEGMGPVLAPVTPVPVVESLQLNGGGDVAMLEL
FT                   TGQNFTPNLRVWFGDVEAETMYRCGESMLCVVPDISAFREGWRWVRQPVQVPVTLVRND
FT                   GVIYSTSLTFTYTPEPGPRPHCSAAGAILRANSSQVPSNESNTNSEGNYTNASTNSTSV
FT                   TSSTATVVS"
FT   mRNA            join(27304594..27304712,27314798..27314847,
FT                   27314930..27315059,27341479..27341517,27350060..27350155,
FT                   27356063..27356228,27359935..27360109,27363385..27363522,
FT                   27363677..27363789,27365541..27365681,27367505..27367660,
FT                   27367979..27368082,27368202..27371147)
FT                   /gene="Rbpsuh"
FT                   /locus_tag="mCG_16305"
FT                   /product="recombining binding protein suppressor of
FT                   hairless (Drosophila), transcript variant mCT180228"
FT                   /note="gene_id=mCG16305.2 transcript_id=mCT180228.1 created
FT                   on 17-JUN-2003"
FT   CDS             join(27314980..27315059,27341479..27341517,
FT                   27350060..27350155,27356063..27356228,27359935..27360109,
FT                   27363385..27363522,27363677..27363789,27365541..27365681,
FT                   27367505..27367660,27367979..27368082,27368202..27368517)
FT                   /codon_start=1
FT                   /gene="Rbpsuh"
FT                   /locus_tag="mCG_16305"
FT                   /product="recombining binding protein suppressor of
FT                   hairless (Drosophila), isoform CRA_b"
FT                   /note="gene_id=mCG16305.2 transcript_id=mCT180228.1
FT                   protein_id=mCP103150.1 isoform=CRA_b"
FT                   /protein_id="EDL37680.1"
FT                   /translation="MWLLGFELLTFRRAVGCSYPLSHLTSPKFGERPPPKRLTREAMRN
FT                   YLKERGDQTVLILHAKVAQKSYGNEKRFFCPPPCVYLMGSGWKKKKEQMERDGCSEQES
FT                   QPCAFIGIGNSDQEMQQLNLEGKNYCTAKTLYISDSDKRKHFMLSVKMFYGNSDDIGVF
FT                   LSKRIKVISKPSKKKQSLKNADLCIASGTKVALFNRLRSQTVSTRYLHVEGGNFHASSQ
FT                   QWGAFYIHLLDDDESEGEEFTVRDGYIHYGQTVKLVCSVTGMALPRLIIRKVDKQTALL
FT                   DADDPVSQLHKCAFYLKDTERMYLCLSQERIIQFQATPCPKEQNKEMINDGASWTIIST
FT                   DKAEYTFYEGMGPVLAPVTPVPVVESLQLNGGGDVAMLELTGQNFTPNLRVWFGDVEAE
FT                   TMYRCGESMLCVVPDISAFREGWRWVRQPVQVPVTLVRNDGVIYSTSLTFTYTPEPGPR
FT                   PHCSAAGAILRANSSQVPSNESNTNSEGNYTNASTNSTSVTSSTATVVS"
FT   gene            complement(27413006..27422547)
FT                   /gene="Cckar"
FT                   /locus_tag="mCG_16304"
FT                   /note="gene_id=mCG16304.2"
FT   mRNA            complement(join(27413006..27414796,27415707..27415834,
FT                   27417344..27417605,27420739..27420990,27421730..27422547))
FT                   /gene="Cckar"
FT                   /locus_tag="mCG_16304"
FT                   /product="cholecystokinin A receptor"
FT                   /note="gene_id=mCG16304.2 transcript_id=mCT17189.2 created
FT                   on 03-APR-2003"
FT   CDS             complement(join(27414240..27414796,27415707..27415834,
FT                   27417344..27417605,27420739..27420990,27421730..27421841))
FT                   /codon_start=1
FT                   /gene="Cckar"
FT                   /locus_tag="mCG_16304"
FT                   /product="cholecystokinin A receptor"
FT                   /note="gene_id=mCG16304.2 transcript_id=mCT17189.2
FT                   protein_id=mCP3553.2"
FT                   /protein_id="EDL37681.1"
FT                   /translation="MDVVDSLLMNGSNITPPCELGLENETLFCLDQPQPSKEWQSAVQI
FT                   LLYSFIFLLSVLGNTLVITVLIRNKRMRTVTNIFLLSLAVSDLMLCLFCMPFNLIPNLL
FT                   KDFIFGSAVCKTTTYFMGTSVSVSTFNLVAISLERYGAICRPLQSRVWQTKSHALKVIA
FT                   ATWCLSFTIMTPYPIYSNLVPFTKNNNQTANMCRFLLPSDAMQQSWQTFLLLILFLIPG
FT                   VVMVVAYGLISLELYQGIKFDASQKKSAKEKRLSSGGGGGGGSSSSRYEDSDGCYLQKS
FT                   RPPRKLELQQLSTSSSGGRINRIRSSGSAANLIAKKRVIRMLIVIVVLFFLCWMPIFSA
FT                   NAWRAYDTVSAEKHLSGTPISFILLLSYTSSCVNPIIYCFMNKRFRLGFMATFPCCPNP
FT                   GPTGVRGEVGEEEDGRTIRASLSRYSYSHMSTSAPPH"
FT   gene            complement(27481045..27481429)
FT                   /pseudo
FT                   /locus_tag="mCG_1046148"
FT                   /note="gene_id=mCG1046148.1"
FT   mRNA            complement(27481045..27481429)
FT                   /pseudo
FT                   /locus_tag="mCG_1046148"
FT                   /note="gene_id=mCG1046148.1 transcript_id=mCT163852.1
FT                   created on 11-OCT-2002"
FT   gene            <27523952..27618579
FT                   /gene="Tbc1d19"
FT                   /locus_tag="mCG_16303"
FT                   /note="gene_id=mCG16303.1"
FT   mRNA            join(<27523952..27524248,27543744..27543816,
FT                   27544849..27544894,27547367..27547442,27549569..27549643,
FT                   27550993..27551056,27552321..27552367,27552524..27552634,
FT                   27560835..27560907,27562797..27562835,27564473..27564585,
FT                   27571483..27571557,27574779..27574841,27586888..27586972,
FT                   27589521..27589565,27598296..27598328,27601988..27602097,
FT                   27603936..27604027,27611607..27611722,27616193..27616263,
FT                   27617948..27618579)
FT                   /gene="Tbc1d19"
FT                   /locus_tag="mCG_16303"
FT                   /product="TBC1 domain family, member 19, transcript variant
FT                   mCT17188"
FT                   /note="gene_id=mCG16303.1 transcript_id=mCT17188.2 created
FT                   on 26-SEP-2002"
FT   CDS             join(27523952..27524248,27543744..27543816,
FT                   27544849..27544894,27547367..27547442,27549569..27549643,
FT                   27550993..27551056,27552321..27552367,27552524..27552634,
FT                   27560835..27560907,27562797..27562835,27564473..27564585,
FT                   27571483..27571557,27574779..27574841,27586888..27586972,
FT                   27589521..27589565,27598296..27598328,27601988..27602097,
FT                   27603936..27604027,27611607..27611722,27616193..27616263,
FT                   27617948..27618022)
FT