Dbfetch

ID   CH466524; SV 1; linear; genomic DNA; CON; MUS; 61163717 BP.
XX
AC   CH466524;
XX
PR   Project:PRJNA11785;
XX
DT   04-AUG-2005 (Rel. 84, Created)
DT   10-JUN-2007 (Rel. 92, Last updated, Version 7)
XX
DE   Mus musculus 232000009833416 genomic scaffold, whole genome shotgun
DE   sequence.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-61163717
RX   DOI; 10.1126/science.1069193.
RX   PUBMED; 12040188.
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Miklos G.L., Wides R.,
RA   Halpern A., Li P.W., Sutton G.G., Nadeau J., Salzberg S.L., Holt R.A.,
RA   Kodira C.D., Lu F., Chen L., Deng Z., Evangelista C.C., Gan W.,
RA   Heiman T.J., Li J., Li Z., Merkulov G.V., Milshina N.V., Naik A.K., Qi R.,
RA   Shue B.C., Wang A., Wang J., Wang X., Yan X., Ye J., Yooseph S., Zhao Q.,
RA   Zheng L., Zhu S.C., Biddick K., Bolanos R., Delcher A.L., Dew I.M.,
RA   Fasulo D., Flanigan M.J., Huson D.H., Kravitz S.A., Miller J.R.,
RA   Mobarry C.M., Reinert K., Remington K.A., Zhang Q., Zheng X.H.,
RA   Nusskern D.R., Lai Z., Lei Y., Zhong W., Yao A., Guan P., Ji R.R., Gu Z.,
RA   Wang Z.Y., Zhong F., Xiao C., Chiang C.C., Yandell M., Wortman J.R.,
RA   Amanatides P.G., Hladun S.L., Pratts E.C., Johnson J.E., Dodson K.L.,
RA   Woodford K.J., Evans C.A., Gropman B., Rusch D.B., Venter E., Wang M.,
RA   Smith T.J., Houck J.T., Tompkins D.E., Haynes C., Jacob D., Chin S.H.,
RA   Allen D.R., Dahlke C.E., Sanders R., Li K., Liu X., Levitsky A.A.,
RA   Majoros W.H., Chen Q., Xia A.C., Lopez J.R., Donnelly M.T., Newman M.H.,
RA   Glodek A., Kraft C.L., Nodell M., Ali F., An H.J., Baldwin-Pitts D.,
RA   Beeson K.Y., Cai S., Carnes M., Carver A., Caulk P.M., Center A.,
RA   Chen Y.H., Cheng M.L., Coyne M.D., Crowder M., Danaher S., Davenport L.B.,
RA   Desilets R., Dietz S.M., Doup L., Dullaghan P., Ferriera S., Fosler C.R.,
RA   Gire H.C., Gluecksmann A., Gocayne J.D., Gray J., Hart B., Haynes J.,
RA   Hoover J., Howland T., Ibegwam C., Jalali M., Johns D., Kline L., Ma D.S.,
RA   MacCawley S., Magoon A., Mann F., May D., McIntosh T.C., Mehta S., Moy L.,
RA   Moy M.C., Murphy B.J., Murphy S.D., Nelson K.A., Nuri Z., Parker K.A.,
RA   Prudhomme A.C., Puri V.N., Qureshi H., Raley J.C., Reardon M.S.,
RA   Regier M.A., Rogers Y.H., Romblad D.L., Schutz J., Scott J.L., Scott R.,
RA   Sitter C.D., Smallwood M., Sprague A.C., Stewart E., Strong R.V., Suh E.,
RA   Sylvester K., Thomas R., Tint N.N., Tsonis C., Wang G., Wang G.,
RA   Williams M.S., Williams S.M., Windsor S.M., Wolfe K., Wu M.M., Zaveri J.,
RA   Chaturvedi K., Gabrielian A.E., Ke Z., Sun J., Subramanian G., Venter J.C.,
RA   Pfannkoch C.M., Barnstead M., Stephenson L.D.;
RT   "A comparison of whole-genome shotgun-derived mouse chromosome 16 and the
RT   human genome";
RL   Science, e1252229 296(5573):1661-1671(2002).
XX
RN   [2]
RP   1-61163717
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (05-JUL-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
DR   MD5; 261a943bcabf22138051af11b4399b9a.
DR   ENA; AAHY01000000; SET.
DR   ENA; AAHY00000000; SET.
DR   ENA-CON; CM000213.
DR   BioSample; SAMN03004379.
DR   Ensembl-Gn; ENSMUSG00000000560; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000001260; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000001566; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000004642; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000005103; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000005107; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000005220; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000006641; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000013622; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000013629; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000014932; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000015806; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000023452; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025746; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025747; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029086; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029088; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029093; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029097; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029103; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029104; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029108; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029127; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029128; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029130; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029131; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029138; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029145; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029146; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029162; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029167; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029169; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029176; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029177; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029178; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029191; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029192; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029196; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029199; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029201; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029203; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029204; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029205; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029211; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029212; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029213; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029219; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029228; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029236; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029246; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029247; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029248; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029253; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029255; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029260; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029272; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000033036; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000035811; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000035836; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000036435; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000036553; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000036596; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000036693; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000037355; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000037373; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000037685; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038552; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038676; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039095; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039106; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039156; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039191; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039358; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039474; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000044827; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000045302; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000046572; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000047215; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000048450; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000049691; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000051246; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000051498; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000051674; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000052783; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000053856; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000054252; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000054520; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000054630; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000054892; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000054920; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000057425; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000059434; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000060636; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000061184; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000061535; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000061906; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000062960; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000064037; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000067285; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000067367; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000070704; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000075703; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000089992; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000097271; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000107283; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000001112; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000005234; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000005238; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000005352; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000012734; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000013693; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000013766; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000013773; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000026845; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000026846; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030980; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030986; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031020; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031061; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031072; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031073; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031097; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031103; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031106; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031108; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031119; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031121; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031122; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031127; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031146; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031160; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031161; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031170; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031181; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031183; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031186; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031201; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000036177; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000036227; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000037370; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000038676; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000039744; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000041266; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000041364; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000041646; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000043475; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000043964; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000053876; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000057258; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000057551; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000057885; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000059349; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000060820; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000061895; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000062315; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000063116; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000066544; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000067150; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000067638; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000067790; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000068110; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000070203; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000072311; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000072818; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000074113; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000074840; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000075858; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000076949; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000077693; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000078804; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000080036; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000080431; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000087181; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000087332; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000087441; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000087820; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000087864; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000094649; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000094783; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000101191; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000101354; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113372; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113516; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114603; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114668; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115075; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115076; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115078; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115079; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000117525; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000117536; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000117661; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000117880; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000120094; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000120912; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000121872; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000122026; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000122204; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000124036; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000126267; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000130417; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000132404; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000132734; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000133316; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000134521; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000134846; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000135930; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000140076; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000142407; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000143436; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000145858; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000146401; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000151104; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000154975; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000160383; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000165512; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000165536; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000166409; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000166769; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000166924; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000167460; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000168707; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000169212; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000169534; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000172435; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000179555; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000179943; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000181102; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000196462; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000197284; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000197315; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000197946; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000199321; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000199617; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000199705; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000200730; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000201166; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000201182; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000201184; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000201275; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000201511; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000201533; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000201571; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000201621; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000201912; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000202138; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000202205; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000202241; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000202520; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000202543; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000202556; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000202567; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000202816; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000202913; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000204965; mus_musculus.
XX
CC   This is the July 2001 combined whole genome shotgun assembly of Mus
CC   musculus. It contains 27 million Celera reads on four Mus musculus
CC   strains (129X1/SvJ, 129S1/SvImJ, DBA/2J and A/J), 13 million reads
CC   on C57BL/6J from the NCBI Trace Archive, 0.4 million BAC end
CC   sequences from TIGR, and unfinished and finished BACs pulled from
CC   NCBI (Nature 2002. 420:520-562). The assembly process relied on
CC   Celera's paired reads and BAC end reads for long range order and
CC   orientation. Its scaffolds were mapped to chromosomes using STS
CC   maps. For more detailed information about whole genome sequencing
CC   and Celera's assembly process, please refer to Venter, J.C. et al.
CC   Science 2001. 291:1304-1351.
CC   This version of genes, transcripts, and proteins was
CC   computationally created in November 2001 from the whole-genome
CC   mapping of transcript and protein sequences on the Celera mouse
CC   genome assembly by Celera Chromosome Team and Content Systems.  The
CC   data sets used by this annotation process were collected in 2001
CC   and include RefSeq (NM_ from mouse and human) sequences, GenBank
CC   mRNA and dbEST sequences, mammalian SwissProt sequences,  and NRAA
CC   sequences (all mouse unless noted otherwise).  The initial gene set
CC   was manually curated between 2002 and 2003. Subsequently, automated
CC   annotation updates were performed.  The CDS of each transcript was
CC   manually or computationally defined by either the longest
CC   ATG-to-Stop or the longest open reading frame. All CDSs
CC   corresponding to the longest open reading frames with no starting
CC   ATG were flagged as partial.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..61163717
FT                   /organism="Mus musculus"
FT                   /chromosome="5"
FT                   /strain="mixed"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   gene            <1289..3427
FT                   /locus_tag="mCG_113006"
FT                   /note="gene_id=mCG113006.0"
FT   mRNA            join(<1289..1434,2070..2253,2994..3427)
FT                   /locus_tag="mCG_113006"
FT                   /product="mCG113006"
FT                   /note="gene_id=mCG113006.0 transcript_id=mCT114083.0
FT                   created on 01-OCT-2002"
FT   CDS             join(<1289..1434,2070..2253,2994..3170)
FT                   /codon_start=1
FT                   /locus_tag="mCG_113006"
FT                   /product="mCG113006"
FT                   /note="gene_id=mCG113006.0 transcript_id=mCT114083.0
FT                   protein_id=mCP64658.0"
FT                   /protein_id="EDL37212.1"
FT                   /translation="RPYHRQTRHYKELKLKEKEIMTYLHDLEMKNMEARENNQELKKEK
FT                   NFYRNLHTRILLGENLIKKKLAILQQESKEIHADWAIIQQRLVELNLSGKDEQEKTSNL
FT                   EAQENQVSEAARKLGLATAEEDSILQNELPCQEAPAEHHPQHPPSSSDESSSDESSYST
FT                   CPSWE"
FT   assembly_gap    3447..3466
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4519..7891
FT                   /estimated_length=3373
FT                   /gap_type="unknown"
FT   assembly_gap    109174..109193
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    115070..115089
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    116519..116538
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    120728..120747
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    138794..141632
FT                   /estimated_length=2839
FT                   /gap_type="unknown"
FT   gene            145920..151577
FT                   /locus_tag="mCG_113008"
FT                   /note="gene_id=mCG113008.0"
FT   mRNA            join(145920..146135,147123..147282,148553..148684,
FT                   149320..149503,150247..151577)
FT                   /locus_tag="mCG_113008"
FT                   /product="mCG113008, transcript variant mCT114085"
FT                   /note="gene_id=mCG113008.0 transcript_id=mCT114085.0
FT                   created on 01-OCT-2002"
FT   CDS             join(145997..146135,147123..147282,148553..148684,
FT                   149320..149503,150247..150423)
FT                   /codon_start=1
FT                   /locus_tag="mCG_113008"
FT                   /product="mCG113008, isoform CRA_a"
FT                   /note="gene_id=mCG113008.0 transcript_id=mCT114085.0
FT                   protein_id=mCP64674.1 isoform=CRA_a"
FT                   /protein_id="EDL37213.1"
FT                   /translation="MALFARLCRLFQRANVDGRETREGRKDAGLPSERNEGRRRGTWRM
FT                   WMAHRQTTSPVPVTSKKQFEKEEKELIKKIQLTTEETNELRDRLIYVTEGSMNKRQTRH
FT                   YKELKLKEKEIMTFLNDLEMENMEARENNQELKKEKNFYRNLHSRILLEENLIKKKLAI
FT                   LQQESKEIQADWAIIHQLLVELNLSGKDEQEKTSNLETQEHQVSEAARELGLATAEEDS
FT                   ILQKELPCQEAPAEHHPQHPPSSSDESSSDESSYSTCPEWE"
FT   mRNA            join(<148553..148684,150247..151577)
FT                   /locus_tag="mCG_113008"
FT                   /product="mCG113008, transcript variant mCT174525"
FT                   /note="gene_id=mCG113008.0 transcript_id=mCT174525.0
FT                   created on 01-OCT-2002"
FT   CDS             join(<148554..148684,150247..150448)
FT                   /codon_start=1
FT                   /locus_tag="mCG_113008"
FT                   /product="mCG113008, isoform CRA_b"
FT                   /note="gene_id=mCG113008.0 transcript_id=mCT174525.0
FT                   protein_id=mCP97444.0 isoform=CRA_b"
FT                   /protein_id="EDL37214.1"
FT                   /translation="QTRHYKELKLKEKEIMTFLNDLEMENMEARENNQELKKEKNFYRS
FT                   QKLQESWDWPQLKKTASCRRSCHARRPLLSTIPSTHHLPRMNLPQMNLLIAHVLSGNRP
FT                   YRGSHG"
FT   assembly_gap    166355..166554
FT                   /estimated_length=200
FT                   /gap_type="unknown"
FT   assembly_gap    186777..186796
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    193335..193421
FT                   /estimated_length=87
FT                   /gap_type="unknown"
FT   assembly_gap    195679..195880
FT                   /estimated_length=202
FT                   /gap_type="unknown"
FT   assembly_gap    206680..206744
FT                   /estimated_length=65
FT                   /gap_type="unknown"
FT   assembly_gap    220502..221922
FT                   /estimated_length=1421
FT                   /gap_type="unknown"
FT   gene            241921..243715
FT                   /pseudo
FT                   /locus_tag="mCG_12038"
FT                   /note="gene_id=mCG12038.1"
FT   mRNA            241921..243715
FT                   /pseudo
FT                   /locus_tag="mCG_12038"
FT                   /note="gene_id=mCG12038.1 transcript_id=mCT12420.1 created
FT                   on 01-OCT-2002"
FT   assembly_gap    253941..253960
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    267227..267246
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    272304..273895
FT                   /estimated_length=1592
FT                   /gap_type="unknown"
FT   assembly_gap    317327..319871
FT                   /estimated_length=2545
FT                   /gap_type="unknown"
FT   gene            complement(339298..>372358)
FT                   /locus_tag="mCG_1046109"
FT                   /note="gene_id=mCG1046109.2"
FT   mRNA            complement(join(339298..339592,358762..359132,
FT                   362333..362468,369628..369702,372285..>372358))
FT                   /locus_tag="mCG_1046109"
FT                   /product="mCG1046109, transcript variant mCT180213"
FT                   /note="gene_id=mCG1046109.2 transcript_id=mCT180213.0
FT                   created on 18-FEB-2003"
FT   mRNA            complement(join(339300..339592,358762..358910,
FT                   369424..369702,372285..>372324))
FT                   /locus_tag="mCG_1046109"
FT                   /product="mCG1046109, transcript variant mCT174531"
FT                   /note="gene_id=mCG1046109.2 transcript_id=mCT174531.0
FT                   created on 18-FEB-2003"
FT   CDS             complement(join(339472..339592,358762..358910,
FT                   369424..>369528))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1046109"
FT                   /product="mCG1046109, isoform CRA_a"
FT                   /note="gene_id=mCG1046109.2 transcript_id=mCT174531.0
FT                   protein_id=mCP97450.0 isoform=CRA_a"
FT                   /protein_id="EDL37215.1"
FT                   /translation="EVTVMIMGIPSSEGSRDHCSGLGFKTRRVSRDSFKDEPSKSPKDT
FT                   RMYPETKSPTQNVQTQRFWHQELLELLFMEVQEVPPNNISDLGNHILLLLAVPFSLSSS
FT                   LCRNHPRDCMPRTGESLQVI"
FT   CDS             complement(join(339472..339592,358762..>358916))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1046109"
FT                   /product="mCG1046109, isoform CRA_b"
FT                   /note="gene_id=mCG1046109.2 transcript_id=mCT180213.0
FT                   protein_id=mCP103135.0 isoform=CRA_b"
FT                   /protein_id="EDL37216.1"
FT                   /translation="SQDEPSKSPKDTRMYPETKSPTQNVQTQRFWHQELLELLFMEVQE
FT                   VPPNNISDLGNHILLLLAVPFSLSSSLCRNHPRDCMPRTGESLQVI"
FT   assembly_gap    345766..345916
FT                   /estimated_length=151
FT                   /gap_type="unknown"
FT   assembly_gap    349289..349308
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            complement(join(353970..354370,358762..359132,
FT                   372285..>372334))
FT                   /locus_tag="mCG_1046109"
FT                   /product="mCG1046109, transcript variant mCT163813"
FT                   /note="gene_id=mCG1046109.2 transcript_id=mCT163813.0
FT                   created on 18-FEB-2003"
FT   CDS             complement(354084..>354341)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1046109"
FT                   /product="mCG1046109, isoform CRA_c"
FT                   /note="gene_id=mCG1046109.2 transcript_id=mCT163813.0
FT                   protein_id=mCP65111.0 isoform=CRA_c"
FT                   /protein_id="EDL37217.1"
FT                   /translation="ESRQYFKRKRLKSTHDPNPPITATSSSPLHIELNSVTVTVVCCFE
FT                   RHTSPCPVLAHPPHSQPPQATLLSVPCPLPAMAVSPSSHG"
FT   assembly_gap    381835..382973
FT                   /estimated_length=1139
FT                   /gap_type="unknown"
FT   assembly_gap    429277..429296
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    446886..446905
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    448029..448048
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    487683..487848
FT                   /estimated_length=166
FT                   /gap_type="unknown"
FT   assembly_gap    556435..556770
FT                   /estimated_length=336
FT                   /gap_type="unknown"
FT   assembly_gap    608973..608992
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    610434..610453
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    623424..623460
FT                   /estimated_length=37
FT                   /gap_type="unknown"
FT   assembly_gap    631235..631254
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    634479..634538
FT                   /estimated_length=60
FT                   /gap_type="unknown"
FT   assembly_gap    667871..667890
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(708921..709340)
FT                   /pseudo
FT                   /locus_tag="mCG_61063"
FT                   /note="gene_id=mCG61063.2"
FT   mRNA            complement(708921..709340)
FT                   /pseudo
FT                   /locus_tag="mCG_61063"
FT                   /note="gene_id=mCG61063.2 transcript_id=mCT61246.2 created
FT                   on 14-OCT-2002"
FT   assembly_gap    723145..723164
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    727866..727980
FT                   /estimated_length=115
FT                   /gap_type="unknown"
FT   assembly_gap    762530..762549
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    876236..876255
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(886973..888600)
FT                   /pseudo
FT                   /locus_tag="mCG_1046046"
FT                   /note="gene_id=mCG1046046.1"
FT   mRNA            complement(join(886973..887343,888265..888600))
FT                   /pseudo
FT                   /locus_tag="mCG_1046046"
FT                   /note="gene_id=mCG1046046.1 transcript_id=mCT163750.1
FT                   created on 14-OCT-2002"
FT   assembly_gap    895385..895404
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    929044..929444
FT                   /estimated_length=401
FT                   /gap_type="unknown"
FT   gene            930717..930945
FT                   /pseudo
FT                   /locus_tag="mCG_141313"
FT                   /note="gene_id=mCG141313.0"
FT   mRNA            930717..930945
FT                   /pseudo
FT                   /locus_tag="mCG_141313"
FT                   /note="gene_id=mCG141313.0 transcript_id=mCT174532.0
FT                   created on 14-OCT-2002"
FT   assembly_gap    933368..933387
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    984163..984182
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    993131..993198
FT                   /estimated_length=68
FT                   /gap_type="unknown"
FT   assembly_gap    1012239..1012258
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1015657..1015676
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1071961..1071999
FT                   /estimated_length=39
FT                   /gap_type="unknown"
FT   assembly_gap    1104882..1104992
FT                   /estimated_length=111
FT                   /gap_type="unknown"
FT   assembly_gap    1106778..1110492
FT                   /estimated_length=3715
FT                   /gap_type="unknown"
FT   assembly_gap    1120206..1120225
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <1141429..1604623
FT                   /gene="Dpp6"
FT                   /locus_tag="mCG_113122"
FT                   /note="gene_id=mCG113122.2"
FT   mRNA            join(<1141429..1141706,1256417..1256531,1272598..1272696,
FT                   1324213..1324307,1346059..1346133,1414871..1414923,
FT                   1434988..1435069,1476210..1476330,1508829..1508983,
FT                   1511959..1512056,1529842..1529965,1531365..1531403,
FT                   1539258..1539365,1541101..1541192,1542386..1542433,
FT                   1544061..1544179,1574495..1574542,1587067..1587165,
FT                   1590225..1590294,1592024..1592218,1596114..1596168,
FT                   1598713..1598824,1600341..1600399,1601040..1601112,
FT                   1601209..1601282,1603276..1604152)
FT                   /gene="Dpp6"
FT                   /locus_tag="mCG_113122"
FT                   /product="dipeptidylpeptidase 6, transcript variant
FT                   mCT193625"
FT                   /note="gene_id=mCG113122.2 transcript_id=mCT193625.0
FT                   created on 09-MAR-2004"
FT   mRNA            join(<1141430..1141706,1256417..1256531,1272598..1272696,
FT                   1324213..1324307,1346059..1346133,1414871..1414923,
FT                   1434988..1435069,1476210..1476330,1508829..1508983,
FT                   1511959..1512056,1529842..1529965,1539258..1539365,
FT                   1541101..1541192,1542386..1542433,1544061..1544179,
FT                   1574495..1574542,1587067..1587165,1590225..1590294,
FT                   1592024..1592218,1596114..1596168,1598713..1598824,
FT                   1600341..1600399,1601040..1601112,1601209..1601282,
FT                   1603276..1604623)
FT                   /gene="Dpp6"
FT                   /locus_tag="mCG_113122"
FT                   /product="dipeptidylpeptidase 6, transcript variant
FT                   mCT114200"
FT                   /note="gene_id=mCG113122.2 transcript_id=mCT114200.1
FT                   created on 01-OCT-2002"
FT   CDS             join(<1141533..1141706,1256417..1256531,1272598..1272696,
FT                   1324213..1324307,1346059..1346133,1414871..1414923,
FT                   1434988..1435069,1476210..1476330,1508829..1508983,
FT                   1511959..1512056,1529842..1529965,1531365..1531403,
FT                   1539258..1539365,1541101..1541192,1542386..1542433,
FT                   1544061..1544179,1574495..1574542,1587067..1587165,
FT                   1590225..1590294,1592024..1592218,1596114..1596168,
FT                   1598713..1598824,1600341..1600399,1601040..1601112,
FT                   1601209..1601282,1603276..1603422)
FT                   /codon_start=1
FT                   /gene="Dpp6"
FT                   /locus_tag="mCG_113122"
FT                   /product="dipeptidylpeptidase 6, isoform CRA_a"
FT                   /note="gene_id=mCG113122.2 transcript_id=mCT193625.0
FT                   protein_id=mCP114557.0 isoform=CRA_a"
FT                   /protein_id="EDL37218.1"
FT                   /translation="FWKYGLESLSSSPYHSDPGASKVSVKPLLSLGWRVPGQTMTTAKE
FT                   PSASGKSVQQQDQELVGSNPPQRNWKGIAIALLVILVICSLIVTSVILLTPAEDTSLSQ
FT                   KKKVTVEDLFSEDFKIHDPEAKWISNKEFIYRERKGSVILRNVETNNSTVLIEGKKIES
FT                   LRAIRYEISPDKEYVLFSYNVEPVYQHSHTGYYVLSKIPHGDPQSLDPPEVSNAKLQYA
FT                   GWGPKGQQLIFIFENNIYYCAHVGKQAIRVVSTGKEGVIYNGLSDWLYEEEILKSHIAH
FT                   WWSPDGTRLAYATINDSRVPLMELPTYTGSVYPTVKPYHYPKAGSENPSISLHVIGLNG
FT                   PTHDLEMMPPDDPRMREYYITMVKWATSTKVAVTWLNRAQNVSILTLCDATTGVCTKKH
FT                   EDESEAWLHRQNEEPVFSKDGRKFFFVRAIPQGGRGKFYHITVSSSQPNSSNDNIQSIT
FT                   SGDWDVTKILSYDEKRNKIYFLSTEDLPRRRHLYSANTVDDFNRQCLSCDLVENCTYVS
FT                   ASFSHNMDFFLLKCEGPGVPTVTVHNTTDKRRMFDLEANEEVQKAINDRQMPKIEYRKI
FT                   EVEDYSLPMQILKPATFTDTAHYPLLLVVDGTPGSQSVTERFEVTWETVLVSSHGAVVV
FT                   KCDGRGSGFQGTKLLQEVRRRLGFLEEKDQMEAVRTMLKEQYIDKTRVAVFGKDYGGYL
FT                   STYILPAKGENQGQTFTCGSALSPITDFKLYASAFSERYLGLHGLDNRAYEMTKLAHRV
FT                   SALEDQQFLIIHATADEKIHFQHTAELITQLIKGKANYSLQIYPDESHYFHSVALKQHL
FT                   SRSIIGFFVECFRVQDKLPTATAKEEEEED"
FT   assembly_gap    1176045..1182338
FT                   /estimated_length=6294
FT                   /gap_type="unknown"
FT   assembly_gap    1185456..1185475
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1216510..1216906
FT                   /estimated_length=397
FT                   /gap_type="unknown"
FT   assembly_gap    1238223..1238242
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(<1256417..1256531,1272598..1272696,1324213..1324307,
FT                   1346059..1346133,1414871..1414923,1434988..1435069,
FT                   1476210..1476330,1508829..1508983,1511959..1512056,
FT                   1529842..1529965,1539258..1539365,1541101..1541192,
FT                   1542386..1542433,1544061..1544179,1574495..1574542,
FT                   1587067..1587165,1590225..1590294,1592024..1592218,
FT                   1596114..1596168,1598713..1598824,1600341..1600399,
FT                   1601040..1601112,1601209..1601282,1603276..1603422)
FT                   /codon_start=1
FT                   /gene="Dpp6"
FT                   /locus_tag="mCG_113122"
FT                   /product="dipeptidylpeptidase 6, isoform CRA_b"
FT                   /note="gene_id=mCG113122.2 transcript_id=mCT114200.1
FT                   protein_id=mCP65324.1 isoform=CRA_b"
FT                   /protein_id="EDL37219.1"
FT                   /translation="ELVGSNPPQRNWKGIAIALLVILVICSLIVTSVILLTPAEDTSLS
FT                   QKKKVTVEDLFSEDFKIHDPEAKWISNKEFIYRERKGSVILRNVETNNSTVLIEGKKIE
FT                   SLRAIRYEISPDKEYVLFSYNVEPVYQHSHTGYYVLSKIPHGDPQSLDPPEVSNAKLQY
FT                   AGWGPKGQQLIFIFENNIYYCAHVGKQAIRVVSTGKEGVIYNGLSDWLYEEEILKSHIA
FT                   HWWSPDGTRLAYATINDSRVPLMELPTYTGSVYPTVKPYHYPKAGSENPSISLHVIGLN
FT                   GPTHDLEMMPPDDPRMREYYITMVKWATSTKVAVTWLNRAQNVSILTLCDATTGVCTKN
FT                   EEPVFSKDGRKFFFVRAIPQGGRGKFYHITVSSSQPNSSNDNIQSITSGDWDVTKILSY
FT                   DEKRNKIYFLSTEDLPRRRHLYSANTVDDFNRQCLSCDLVENCTYVSASFSHNMDFFLL
FT                   KCEGPGVPTVTVHNTTDKRRMFDLEANEEVQKAINDRQMPKIEYRKIEVEDYSLPMQIL
FT                   KPATFTDTAHYPLLLVVDGTPGSQSVTERFEVTWETVLVSSHGAVVVKCDGRGSGFQGT
FT                   KLLQEVRRRLGFLEEKDQMEAVRTMLKEQYIDKTRVAVFGKDYGGYLSTYILPAKGENQ
FT                   GQTFTCGSALSPITDFKLYASAFSERYLGLHGLDNRAYEMTKLAHRVSALEDQQFLIIH
FT                   ATADEKIHFQHTAELITQLIKGKANYSLQIYPDESHYFHSVALKQHLSRSIIGFFVECF
FT                   RVQDKLPTATAKEEEEED"
FT   mRNA            join(<1256498..1256531,1272598..1272696,1324213..1324307,
FT                   1346059..1346133,1434988..>1435072)
FT                   /gene="Dpp6"
FT                   /locus_tag="mCG_113122"
FT                   /product="dipeptidylpeptidase 6, transcript variant
FT                   mCT173992"
FT                   /note="gene_id=mCG113122.2 transcript_id=mCT173992.0
FT                   created on 01-OCT-2002"
FT   CDS             join(<1256498..1256531,1272598..1272696,1324213..1324307,
FT                   1346059..1346133,1434988..>1435072)
FT                   /codon_start=1
FT                   /gene="Dpp6"
FT                   /locus_tag="mCG_113122"
FT                   /product="dipeptidylpeptidase 6, isoform CRA_c"
FT                   /note="gene_id=mCG113122.2 transcript_id=mCT173992.0
FT                   protein_id=mCP96911.0 isoform=CRA_c"
FT                   /protein_id="EDL37220.1"
FT                   /translation="LIVTSVILLTPAEDTSLSQKKKVTVEDLFSEDFKIHDPEAKWISN
FT                   KEFIYRERKGSVILRNVETNNSTVLIEGKKIESLRAIRYEISPDKEYVLFSYNVEPGPS
FT                   ESGPTRSQQRKASVCRVGPKRPAAG"
FT   assembly_gap    1274222..1274557
FT                   /estimated_length=336
FT                   /gap_type="unknown"
FT   assembly_gap    1300356..1300376
FT                   /estimated_length=21
FT                   /gap_type="unknown"
FT   assembly_gap    1301091..1301190
FT                   /estimated_length=100
FT                   /gap_type="unknown"
FT   assembly_gap    1341227..1341246
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1342720..1342739
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1344352..1344371
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1346488..1346507
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1348639..1348658
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1372633..1378590)
FT                   /locus_tag="mCG_56332"
FT                   /note="gene_id=mCG56332.2"
FT   mRNA            complement(join(1372633..1373960,1374705..1374888,
FT                   1375524..1375667,1376902..1377061,1378057..1378590))
FT                   /locus_tag="mCG_56332"
FT                   /product="mCG56332"
FT                   /note="gene_id=mCG56332.2 transcript_id=mCT56515.2 created
FT                   on 01-OCT-2002"
FT   CDS             complement(join(1373784..1373960,1374705..1374888,
FT                   1375524..1375667,1376902..1377061,1378057..1378153))
FT                   /codon_start=1
FT                   /locus_tag="mCG_56332"
FT                   /product="mCG56332"
FT                   /note="gene_id=mCG56332.2 transcript_id=mCT56515.2
FT                   protein_id=mCP24528.2"
FT                   /protein_id="EDL37221.1"
FT                   /translation="MWMGERPERGGRMLAFPSESNEGRRRWNWRMWMAHRQTSSPVPVI
FT                   SKKQFEKEEKELIKKIQLTTEETNELRDRLIYVTEGSMNKRPYHRQNRHYKELKLKEKE
FT                   IMTYLHDLEMKNMEARENKQELKKEINFYRNLHTRILLEENLIKKKLAILQQESKEVLA
FT                   NWAIIHQCLVELNLSGKDKQEKTSNLKTQEHQVSETARELGLATAEEDSILQNELPRQE
FT                   APAEHHPQHPPSSSDESSSDESSYSTCPEWE"
FT   assembly_gap    1407209..1407402
FT                   /estimated_length=194
FT                   /gap_type="unknown"
FT   assembly_gap    1419518..1420144
FT                   /estimated_length=627
FT                   /gap_type="unknown"
FT   assembly_gap    1439754..1439773
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1440611..1440630
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1442240..1442575
FT                   /estimated_length=336
FT                   /gap_type="unknown"
FT   assembly_gap    1457679..1457734
FT                   /estimated_length=56
FT                   /gap_type="unknown"
FT   assembly_gap    1461023..1461109
FT                   /estimated_length=87
FT                   /gap_type="unknown"
FT   assembly_gap    1498763..1498872
FT                   /estimated_length=110
FT                   /gap_type="unknown"
FT   assembly_gap    1524226..1524678
FT                   /estimated_length=453
FT                   /gap_type="unknown"
FT   assembly_gap    1576153..1576172
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1576960..1577053
FT                   /estimated_length=94
FT                   /gap_type="unknown"
FT   assembly_gap    1593350..1593369
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1605091..1605110
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1609979..1609998
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1620546..1671369)
FT                   /gene="Paxip1"
FT                   /locus_tag="mCG_7319"
FT                   /note="gene_id=mCG7319.1"
FT   mRNA            complement(join(1620546..1620999,1622611..1622673,
FT                   1622755..1622830,1622919..1623053,1627845..1627945,
FT                   1629985..1630153,1631517..1631619,1633258..1633328,
FT                   1635726..1635769,1637238..1637422,1638177..1638298,
FT                   1638780..1638917,1640384..1640479,1643945..1644039,
FT                   1644398..1645097,1651823..1652443,1655385..1655498,
FT                   1661241..1661304,1663549..1663592,1668462..1668596,
FT                   1671018..1671369))
FT                   /gene="Paxip1"
FT                   /locus_tag="mCG_7319"
FT                   /product="PAX interacting (with transcription-activation
FT                   domain) protein 1, transcript variant mCT6358"
FT                   /note="gene_id=mCG7319.1 transcript_id=mCT6358.1 created on
FT                   24-DEC-2002"
FT   CDS             complement(join(1620986..1620999,1622611..1622673,
FT                   1622755..1622830,1622919..1623053,1627845..1627945,
FT                   1629985..1630153,1631517..1631619,1633258..1633328,
FT                   1635726..1635769,1637238..1637422,1638177..1638298,
FT                   1638780..1638917,1640384..1640479,1643945..1644039,
FT                   1644398..1645097,1651823..1652443,1655385..1655498,
FT                   1661241..1661304,1663549..1663592,1668462..1668596,
FT                   1671018..1671098))
FT                   /codon_start=1
FT                   /gene="Paxip1"
FT                   /locus_tag="mCG_7319"
FT                   /product="PAX interacting (with transcription-activation
FT                   domain) protein 1, isoform CRA_a"
FT                   /note="gene_id=mCG7319.1 transcript_id=mCT6358.1
FT                   protein_id=mCP1606.2 isoform=CRA_a"
FT                   /protein_id="EDL37222.1"
FT                   /translation="MSEPAPEVPEELFREVKYYAVGDIDPQVIQLLKAGKAKEVSYNAL
FT                   ASHIISEDGDNPEVGEAREVFDLPVVKPSWVTLSVQCGALLPVNGFSPESCQIFFGLTA
FT                   CLSQVSSEDRSALWALVTFHGGSCQLNLNKKCTHLIVPEPKGEKYERAVKRTSIKIVTP
FT                   DWVLDCVSEKRRKDEAFYHPRLIIYEEEEEEEEEGDNEEQDSQNEGSTEKSSVASSAVA
FT                   SPAEQPCSPKPRAEVSKGELMFDDSSDSSPEKQERSLNWAPAEAPPLNTAQRRLPQGKG
FT                   PGLINLCANVPPVPGDILPPDMRGNLMAPGQNLQNSERSEILGTWSPAVRTLRNITNNA
FT                   DIQQINRPSNVAHILQSLSAPTKSLEQQVARGQQGHPNASAVLFGQAKGAPETHVLQQH
FT                   HPPQQPQQQHPALHLQPQIMQLQQQQQQQQQQQQQPQPYPQPPSHQFPQQVHQHQFSQQ
FT                   QLQFPQQPLHPQQQLHRPQQQLQPFQQQHALQQQLHQLQQQQLQHHQLAQLQQQQQQQH
FT                   NLLQQQQQQQQLQRLQQQQQMQNQAAHLSQASQALQHQVLPQQPLQLSLQPPPQQQQQQ
FT                   QLFGHDPAVEIPEESFLLGCVFAIADYPEQMSDKQLLATWKRIIQAHGGTVDPTFTSRC
FT                   THLLCASQVSSMYTQALRERKRCVTAHWLNTVLKKKKLMPPHRALHFPVAFPPGGKPCS
FT                   QHIISVTGFVDNDRDDLKLMAYLAGAKYTGYLCRSNTVLICKEPSGLKYEKAKEWRIPC
FT                   VNAQWLGDILLGNFEALRQVQYSRYTAFNMPDPFVPTPHLVLGLLDAWRTPVKVTAELL
FT                   MGVRLPPKLKPNEVANIQPSSKRARIEDLPPPTKKLTPELTPLVLFTGFEPVQVQQYIK
FT                   KLYILGGEVAECTKKCTHLIASKVTRTVKFLTAISVVKHIVTPDWLEECFKRQTFIDEQ
FT                   NYILRDAEAEVLFSFSLEESLKRAHVSPLFKTKYFYITPGICPSLATMKAIVECAGGKV
FT                   LAKQPSFRKLMEHKQNKSLSEIILISCENDLHLCREYFARGIDVHNAEFVLTGVLTQTL
FT                   DYESYKFN"
FT   assembly_gap    1623857..1623876
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1629940..1629959
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1631251..1631270
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1649740..1649759
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            complement(join(1652310..1652443,1655385..1655498,
FT                   1660085..1660145,1663549..1663592,1668462..1668596,
FT                   1671018..1671369))
FT                   /gene="Paxip1"
FT                   /locus_tag="mCG_7319"
FT                   /product="PAX interacting (with transcription-activation
FT                   domain) protein 1, transcript variant mCT173439"
FT                   /note="gene_id=mCG7319.1 transcript_id=mCT173439.0 created
FT                   on 24-DEC-2002"
FT   CDS             complement(join(1660112..1660145,1663549..1663592,
FT                   1668462..1668596,1671018..1671098))
FT                   /codon_start=1
FT                   /gene="Paxip1"
FT                   /locus_tag="mCG_7319"
FT                   /product="PAX interacting (with transcription-activation
FT                   domain) protein 1, isoform CRA_b"
FT                   /note="gene_id=mCG7319.1 transcript_id=mCT173439.0
FT                   protein_id=mCP96358.0 isoform=CRA_b"
FT                   /protein_id="EDL37223.1"
FT                   /translation="MSEPAPEVPEELFREVKYYAVGDIDPQVIQLLKAGKAKEVSYNAL
FT                   ASHIISEDGDNPEVGEAREVFDLPVVKPSWVTLSVQCGALLPLNLYHMMLPI"
FT   assembly_gap    1675185..1675264
FT                   /estimated_length=80
FT                   /gap_type="unknown"
FT   assembly_gap    1681443..1687209
FT                   /estimated_length=5767
FT                   /gap_type="unknown"
FT   gene            1696849..1697771
FT                   /pseudo
FT                   /locus_tag="mCG_51587"
FT                   /note="gene_id=mCG51587.2"
FT   mRNA            1696849..1697771
FT                   /pseudo
FT                   /locus_tag="mCG_51587"
FT                   /note="gene_id=mCG51587.2 transcript_id=mCT51770.2 created
FT                   on 14-OCT-2002"
FT   assembly_gap    1698580..1698926
FT                   /estimated_length=347
FT                   /gap_type="unknown"
FT   gene            1701025..1701942
FT                   /pseudo
FT                   /locus_tag="mCG_1046048"
FT                   /note="gene_id=mCG1046048.1"
FT   mRNA            1701025..1701942
FT                   /pseudo
FT                   /locus_tag="mCG_1046048"
FT                   /note="gene_id=mCG1046048.1 transcript_id=mCT163752.1
FT                   created on 14-OCT-2002"
FT   gene            1721866..1731464
FT                   /gene="Htr5a"
FT                   /locus_tag="mCG_7318"
FT                   /note="gene_id=mCG7318.1"
FT   mRNA            join(1721866..1723108,1731029..1731464)
FT                   /gene="Htr5a"
FT                   /locus_tag="mCG_7318"
FT                   /product="5-hydroxytryptamine (serotonin) receptor 5A"
FT                   /note="gene_id=mCG7318.1 transcript_id=mCT6360.0 created on
FT                   23-SEP-2002"
FT   CDS             join(1722368..1723108,1731029..1731361)
FT                   /codon_start=1
FT                   /gene="Htr5a"
FT                   /locus_tag="mCG_7318"
FT                   /product="5-hydroxytryptamine (serotonin) receptor 5A"
FT                   /note="gene_id=mCG7318.1 transcript_id=mCT6360.0
FT                   protein_id=mCP1605.1"
FT                   /db_xref="GOA:P30966"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR001397"
FT                   /db_xref="InterPro:IPR002231"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:96283"
FT                   /db_xref="UniProtKB/Swiss-Prot:P30966"
FT                   /protein_id="EDL37224.1"
FT                   /translation="MDLPVNLTSFSLSTPSSLEPNRSLDTEVLRPSRPFLSAFRVLVLT
FT                   LLGFLAAATFTWNLLVLATILKVRTFHRVPHNLVASMAISDVLVAVLVMPLSLVHELSG
FT                   RRWQLGRRLCQLWIACDVLCCTASIWNVTAIALDRYWSITRHLEYTLRTRKRVSNVMIL
FT                   LTWALSTVISLAPLLFGWGETYSEPSEECQVSREPSYTVFSTVGAFYLPLCVVLFVYWK
FT                   IYRAAKFRMGSRKTNSVSPVPEAVEVKNATQHPQMVFTVRHATVTFQTEGDTWREQKEQ
FT                   RAALMVGILIGVFVLCWFPFFVTELISPLCSWDVPAIWKSIFLWLGYSNSFFNPLIYTA
FT                   FNRSYSSAFKVFFSKQQ"
FT   assembly_gap    1726565..1726584
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1738590..1738858
FT                   /estimated_length=269
FT                   /gap_type="unknown"
FT   assembly_gap    1741277..1742242
FT                   /estimated_length=966
FT                   /gap_type="unknown"
FT   assembly_gap    1743885..1743904
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1745525..1745544
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1746214..1747149)
FT                   /pseudo
FT                   /locus_tag="mCG_113121"
FT                   /note="gene_id=mCG113121.0"
FT   mRNA            complement(1746214..1747149)
FT                   /pseudo
FT                   /locus_tag="mCG_113121"
FT                   /note="gene_id=mCG113121.0 transcript_id=mCT114199.0
FT                   created on 01-OCT-2002"
FT   gene            1747149..1747857
FT                   /pseudo
FT                   /locus_tag="mCG_1046020"
FT                   /note="gene_id=mCG1046020.1"
FT   mRNA            1747149..1747857
FT                   /pseudo
FT                   /locus_tag="mCG_1046020"
FT                   /note="gene_id=mCG1046020.1 transcript_id=mCT163724.1
FT                   created on 18-OCT-2002"
FT   assembly_gap    1748667..1748686
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1749237..1749256
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1750581..1750600
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1751644..1751663
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1752977..1755815
FT                   /estimated_length=2839
FT                   /gap_type="unknown"
FT   assembly_gap    1759691..1759710
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1767515..1767534
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1769687..1769706
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1771896..1771915
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1772977..1772996
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1774188..1775488
FT                   /estimated_length=1301
FT                   /gap_type="unknown"
FT   assembly_gap    1779932..1780161
FT                   /estimated_length=230
FT                   /gap_type="unknown"
FT   assembly_gap    1781329..1781348
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1782505..1782524
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1783814..1783833
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1795283..1795572
FT                   /estimated_length=290
FT                   /gap_type="unknown"
FT   assembly_gap    1798770..1799291
FT                   /estimated_length=522
FT                   /gap_type="unknown"
FT   assembly_gap    1800575..1800594
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1802160..1802179
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1806574..1807612
FT                   /estimated_length=1039
FT                   /gap_type="unknown"
FT   assembly_gap    1826385..1826404
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            1858105..1860529
FT                   /pseudo
FT                   /locus_tag="mCG_1046049"
FT                   /note="gene_id=mCG1046049.1"
FT   mRNA            1858105..1860529
FT                   /pseudo
FT                   /locus_tag="mCG_1046049"
FT                   /note="gene_id=mCG1046049.1 transcript_id=mCT163753.1
FT                   created on 14-OCT-2002"
FT   assembly_gap    1871059..1871078
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1877739..1877758
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1881235..1882909)
FT                   /pseudo
FT                   /locus_tag="mCG_49883"
FT                   /note="gene_id=mCG49883.2"
FT   mRNA            complement(1881235..1882909)
FT                   /pseudo
FT                   /locus_tag="mCG_49883"
FT                   /note="gene_id=mCG49883.2 transcript_id=mCT50066.2 created
FT                   on 01-OCT-2002"
FT   assembly_gap    1911765..1912575
FT                   /estimated_length=811
FT                   /gap_type="unknown"
FT   assembly_gap    1931157..1931176
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1935362..1936870)
FT                   /locus_tag="mCG_148309"
FT                   /note="gene_id=mCG148309.0"
FT   mRNA            complement(join(1935362..1936526,1936673..1936870))
FT                   /locus_tag="mCG_148309"
FT                   /product="mCG148309"
FT                   /note="gene_id=mCG148309.0 transcript_id=mCT188572.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(1936185..1936307)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148309"
FT                   /product="mCG148309"
FT                   /note="gene_id=mCG148309.0 transcript_id=mCT188572.0
FT                   protein_id=mCP109223.0"
FT                   /protein_id="EDL37225.1"
FT                   /translation="MVCKDPPPSKKRTFQKWGLGLWASVGYPAIEPMPSPTPEL"
FT   assembly_gap    1939761..1939780
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            1952782..1960081
FT                   /gene="Insig1"
FT                   /locus_tag="mCG_7565"
FT                   /note="gene_id=mCG7565.2"
FT   mRNA            join(1952782..1953214,1954966..1955090,1955901..1956067,
FT                   1956481..1956580,1958210..1960081)
FT                   /gene="Insig1"
FT                   /locus_tag="mCG_7565"
FT                   /product="insulin induced gene 1"
FT                   /note="gene_id=mCG7565.2 transcript_id=mCT6465.2 created on
FT                   24-SEP-2002"
FT   CDS             join(1952857..1953214,1954966..1955090,1955901..1956067,
FT                   1956481..1956580,1958210..1958239)
FT                   /codon_start=1
FT                   /gene="Insig1"
FT                   /locus_tag="mCG_7565"
FT                   /product="insulin induced gene 1"
FT                   /note="gene_id=mCG7565.2 transcript_id=mCT6465.2
FT                   protein_id=mCP3948.1"
FT                   /protein_id="EDL37226.1"
FT                   /translation="MPRLHDHVWNYPSAGAARPYSLPRGMIAAAACPQGPGVPEPEHAP
FT                   RGQRAGTTGCSARPGSWHHDLVQRSLVLFSFGVVLALVLNLLQIQRNVTLFPDEVIATI
FT                   FSSAWWVPPCCGTAAAVVGLLYPCIDSHLGEPHKFKREWASVMRCIAVFVGINHASAKL
FT                   DFANNVQLSLTLAALSLGLWWTFDRSRSGLGLGITIAFLATLITQFLVYNGVYQYTSPD
FT                   FLYIRSWLPCIFFSGGVTVGNIGRQLAMGVPEKPHSD"
FT   assembly_gap    1965752..1965771
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1971765..1971784
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1996154..1996173
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1999468..1999963
FT                   /estimated_length=496
FT                   /gap_type="unknown"
FT   assembly_gap    2042432..2042451
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            2045852..2051511
FT                   /gene="En2"
FT                   /locus_tag="mCG_7563"
FT                   /note="gene_id=mCG7563.1"
FT   mRNA            join(2045852..2046556,2049461..2051511)
FT                   /gene="En2"
FT                   /locus_tag="mCG_7563"
FT                   /product="engrailed 2"
FT                   /note="gene_id=mCG7563.1 transcript_id=mCT6463.1 created on
FT                   16-SEP-2002"
FT   CDS             join(2045899..2046556,2049461..2049777)
FT                   /codon_start=1
FT                   /gene="En2"
FT                   /locus_tag="mCG_7563"
FT                   /product="engrailed 2"
FT                   /note="gene_id=mCG7563.1 transcript_id=mCT6463.1
FT                   protein_id=mCP3913.1"
FT                   /db_xref="GOA:Q3TZM2"
FT                   /db_xref="InterPro:IPR000747"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017970"
FT                   /db_xref="InterPro:IPR019549"
FT                   /db_xref="InterPro:IPR019737"
FT                   /db_xref="InterPro:IPR020479"
FT                   /db_xref="MGI:MGI:95390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TZM2"
FT                   /protein_id="EDL37227.1"
FT                   /translation="MEEKDSKPSETAAEAQRQPEPSSGGGSGGGSSPSDSDTGRRRALM
FT                   LPEVLQAPGNHQHPHRITNFFIDNILRPEFGRRKDAGTCCAGAGGARGGEGGAGTTEGG
FT                   GGGAGGAEQLLGARESRPNPACAPSAGGTLSAAAGDPAVDGEGGSKTLSLHGGAKKPGD
FT                   PGGSLDGVLKARGLGGGDLSVSSDSDSSQASATLGAQPMLWPAWVYCTRYSDRPSSGPR
FT                   SRKPKKKNPNKEDKRPRTAFTAEQLQRLKAEFQTNRYLTEQRRQSLAQELSLNESQIKI
FT                   WFQNKRAKIKKATGNKNTLAVHLMAQGLYNHSTTAKEGKSDSE"
FT   assembly_gap    2057408..2057492
FT                   /estimated_length=85
FT                   /gap_type="unknown"
FT   assembly_gap    2072563..2072582
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(2080178..2125269)
FT                   /gene="9630008K15Rik"
FT                   /locus_tag="mCG_56335"
FT                   /note="gene_id=mCG56335.2"
FT   mRNA            complement(join(2080178..2082779,2086630..2086726,
FT                   2088440..2088643,2125156..2125269))
FT                   /gene="9630008K15Rik"
FT                   /locus_tag="mCG_56335"
FT                   /product="RIKEN cDNA 9630008K15"
FT                   /note="gene_id=mCG56335.2 transcript_id=mCT56518.2 created
FT                   on 14-OCT-2002"
FT   CDS             complement(join(2082742..2082779,2086630..2086726,
FT                   2088440..2088643,2125156..2125254))
FT                   /codon_start=1
FT                   /gene="9630008K15Rik"
FT                   /locus_tag="mCG_56335"
FT                   /product="RIKEN cDNA 9630008K15"
FT                   /note="gene_id=mCG56335.2 transcript_id=mCT56518.2
FT                   protein_id=mCP26978.2"
FT                   /protein_id="EDL37228.1"
FT                   /translation="MDEVEYDITKARQKKTKVGSYRIRPDGTQERKKVPLAQSEAFLID
FT                   LLDKVCMRMNDYQLEDDPVTKQKYFRRYAPRKGDKIYKEYKKFFFYSDAFRPLKFACEA
FT                   IIEKYEDEIFELIAQEANHLADMLCNEKSDLCGTPTNSPEP"
FT   assembly_gap    2086968..2086987
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2096432..2096451
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2098847..2098866
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2106942..2106961
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2125328..2125483
FT                   /estimated_length=156
FT                   /gap_type="unknown"
FT   assembly_gap    2136605..2136652
FT                   /estimated_length=48
FT                   /gap_type="unknown"
FT   gene            2197203..2295653
FT                   /locus_tag="mCG_141193"
FT                   /note="gene_id=mCG141193.0"
FT   mRNA            join(2197203..2197420,2211136..2211214,2215848..2215896,
FT                   2217000..2217076,2219022..2219334,2222421..2222540,
FT                   2232452..2232623,2238243..2238451,2242001..2242147,
FT                   2270127..2270207,2271274..2271423,2274392..2275042,
FT                   2288628..2288834,2290944..2291132,2293661..2293749,
FT                   2293942..2295653)
FT                   /locus_tag="mCG_141193"
FT                   /product="mCG141193, transcript variant mCT173724"
FT                   /note="gene_id=mCG141193.0 transcript_id=mCT173724.0
FT                   created on 24-SEP-2002"
FT   CDS             join(2197378..2197420,2211136..2211214,2215848..2215896,
FT                   2217000..2217076,2219022..2219334,2222421..2222540,
FT                   2232452..2232623,2238243..2238451,2242001..2242147,
FT                   2270127..2270207,2271274..2271423,2274392..2275042,
FT                   2288628..2288834,2290944..2291132,2293661..2293749,
FT                   2293942..2293990)
FT                   /codon_start=1
FT                   /locus_tag="mCG_141193"
FT                   /product="mCG141193, isoform CRA_a"
FT                   /note="gene_id=mCG141193.0 transcript_id=mCT173724.0
FT                   protein_id=mCP96644.0 isoform=CRA_a"
FT                   /protein_id="EDL37229.1"
FT                   /translation="MAAALGAGGGAGAGDDDFDQFDKPGAERSWRRRAADEDWDSELED
FT                   DLLGEDLLSGKKNQSDLSDEELNDDLLQSDNEEEENFSSQGVTISLNTTSGIVTSFELS
FT                   DNTNDQSGEQESEYEQGDDELAYHKPEEQELYTQEYPEEGQYEGHDAELTEDQIEYGDE
FT                   PEEEQLYSDEVLDIEINEPLDEFTDEEYLQAYGGQQGLQVREDCEAEDDLDEITDSQVA
FT                   SETHEGGMETLELQKDIKEESDEEDDDDEESGRLRFKTERKEGTIIRLSDVTRERRNIP
FT                   ETLELSAEAKAALLEFEERERQHKQGRYGSRRGGRRGGSLMCRGMGDQRRDNSERGRMK
FT                   EHRPALLPTQPSVVGVHMPPQIETPRMMLTPPPVTPQQPKNIHINPHFKGTVVTPVQGT
FT                   CSFLFRPHVQTAQPQPSSSRMQCTPHQGLRHNAASQNISKRPMQQMQPTAPRNSNLREL
FT                   PIAPSHVLEMSGNRCSSTPVAQFPDEDEETRLYRLKIEEQKRLREEILKQKELRRQQQA
FT                   GARKKELLERLAQQQQQQHQPQQQQPQQIYGSQTSMEQEELAATPSPTNGNPLLPFPGA
FT                   QCRQNVKTRLLVKNQDITTASVQPKAVNFVPPGANVQHQGQHLRPLKHLRQLPHKVLQV
FT                   KPMDMEETPHSPQAARVTSLQGRPQDTKPGVKRTVMHRANSGGGGDGPHVSSKVRVIKL
FT                   SGGGGESDGFSHTEGQPQRLPQPPDMRQQPTRKVTLTKGVPQQPQHLPVGPHMYPAIPP
FT                   GIKSIQGIHPAKKAIMHGRGRGVAGPMGRGRLMPNKQNLRVVECKPQPCVVSVEGLSSS
FT                   TTDVQLKSLLMSVGPIQSLQMLPQQRKAIAKFKEPAHALAFQQKFHRHMIDLSHINVAL
FT                   IVE"
FT   mRNA            join(<2219096..2219334,2232452..2232623,2238243..2238451,
FT                   2241842..>2241991)
FT                   /locus_tag="mCG_141193"
FT                   /product="mCG141193, transcript variant mCT173725"
FT                   /note="gene_id=mCG141193.0 transcript_id=mCT173725.0
FT                   created on 24-SEP-2002"
FT   CDS             join(<2219098..2219334,2232452..2232623,2238243..2238451,
FT                   2241842..>2241991)
FT                   /codon_start=1
FT                   /locus_tag="mCG_141193"
FT                   /product="mCG141193, isoform CRA_b"
FT                   /note="gene_id=mCG141193.0 transcript_id=mCT173725.0
FT                   protein_id=mCP96643.0 isoform=CRA_b"
FT                   /protein_id="EDL37230.1"
FT                   /translation="DQSGEQESEYEQGDDELAYHKPEEQELYTQEYPEEGQYEGHDAEL
FT                   TEDQIEYGDEPEEEQLYSDEVLDIEINEPLDEFTGGMETLELQKDIKEESDEEDDDDEE
FT                   SGRLRFKTERKEGTIIRLSDVTRERRNIPETLELSAEAKAALLEFEERERQHKQGRYGS
FT                   RRGGRRGGSLMCRGMGDQRRDNSERGRMKEHRPALLPTQPSVVAHSPRLIPPPQPQPPP
FT                   PPPPPPPQQQPIRSLFQQQQLQPLLPLQHPHHPS"
FT   assembly_gap    2224306..2224366
FT                   /estimated_length=61
FT                   /gap_type="unknown"
FT   assembly_gap    2240434..2240453
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2260821..2260840
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2265153..2265172
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2318046..2318065
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2319202..2319221
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(2330206..2339606)
FT                   /gene="Shh"
FT                   /locus_tag="mCG_7564"
FT                   /note="gene_id=mCG7564.2"
FT   mRNA            complement(join(2330206..2330957,2333676..2333937,
FT                   2338815..2339606))
FT                   /gene="Shh"
FT                   /locus_tag="mCG_7564"
FT                   /product="sonic hedgehog"
FT                   /note="gene_id=mCG7564.2 transcript_id=mCT6464.2 created on
FT                   01-OCT-2002"
FT   CDS             complement(join(2330209..2330957,2333676..2333937,
FT                   2338815..2339117))
FT                   /codon_start=1
FT                   /gene="Shh"
FT                   /locus_tag="mCG_7564"
FT                   /product="sonic hedgehog"
FT                   /note="gene_id=mCG7564.2 transcript_id=mCT6464.2
FT                   protein_id=mCP3918.2"
FT                   /protein_id="EDL37231.1"
FT                   /translation="MLLLLARCFLVILASSLLVCPGLACGPGRGFGKRRHPKKLTPLAY
FT                   KQFIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCK
FT                   DKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLA
FT                   RLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGGCFPGSATVHLEQGGTKLVKDLRPG
FT                   DRVLAADDQGRLLYSDFLTFLDRDEGAKKVFYVIETLEPRERLLLTAAHLLFVAPHNDS
FT                   GPTPGPSALFASRVRPGQRVYVVAERGGDRRLLPAAVHSVTLREEEAGAYAPLTAHGTI
FT                   LINRVLASCYAVIEEHSWAHRAFAPFRLAHALLAALAPARTDGGGGGSIPAAQSATEAR
FT                   GAEPTAGIHWYSQLLYHIGTWLLDSETMHPLGMAVKSS"
FT   gene            <2339338..2573756
FT                   /locus_tag="mCG_146320"
FT                   /note="gene_id=mCG146320.0"
FT   mRNA            join(<2339338..2339702,2434849..2434985,2523374..2523654,
FT                   2526926..2528514,2565481..2565568,2565669..2565740,
FT                   2573363..2573756)
FT                   /locus_tag="mCG_146320"
FT                   /product="mCG146320"
FT                   /note="gene_id=mCG146320.0 transcript_id=mCT186423.0
FT                   created on 14-JUL-2003"
FT   assembly_gap    2352005..2352024
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2356645..2364476
FT                   /estimated_length=7832
FT                   /gap_type="unknown"
FT   assembly_gap    2379408..2379685
FT                   /estimated_length=278
FT                   /gap_type="unknown"
FT   assembly_gap    2380824..2383740
FT                   /estimated_length=2917
FT                   /gap_type="unknown"
FT   assembly_gap    2403064..2403259
FT                   /estimated_length=196
FT                   /gap_type="unknown"
FT   gene            2409604..2410877
FT                   /pseudo
FT                   /locus_tag="mCG_119764"
FT                   /note="gene_id=mCG119764.1"
FT   mRNA            2409604..2410877
FT                   /pseudo
FT                   /locus_tag="mCG_119764"
FT                   /note="gene_id=mCG119764.1 transcript_id=mCT120941.1
FT                   created on 01-OCT-2002"
FT   assembly_gap    2411858..2414029
FT                   /estimated_length=2172
FT                   /gap_type="unknown"
FT   assembly_gap    2423748..2423820
FT                   /estimated_length=73
FT                   /gap_type="unknown"
FT   assembly_gap    2425736..2426474
FT                   /estimated_length=739
FT                   /gap_type="unknown"
FT   assembly_gap    2441997..2442383
FT                   /estimated_length=387
FT                   /gap_type="unknown"
FT   CDS             <2527105..2527428
FT                   /codon_start=1
FT                   /locus_tag="mCG_146320"
FT                   /product="mCG146320"
FT                   /note="gene_id=mCG146320.0 transcript_id=mCT186423.0
FT                   protein_id=mCP107488.0"
FT                   /protein_id="EDL37232.1"
FT                   /translation="TLPRYLERGTLSEVAPCLNLGSLHPTWSPLPHRALLFCSSYRILF
FT                   LSSSSAGFCPQKDQSIRVAPLGAGSTPVSLWVSKDEHTAYHIFSMEEMAEPEKIRLRCH
FT                   HPM"
FT   assembly_gap    2528937..2529097
FT                   /estimated_length=161
FT                   /gap_type="unknown"
FT   assembly_gap    2584030..2584049
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2584928..2585071
FT                   /estimated_length=144
FT                   /gap_type="unknown"
FT   assembly_gap    2598545..2598616
FT                   /estimated_length=72
FT                   /gap_type="unknown"
FT   assembly_gap    2628282..2629379
FT                   /estimated_length=1098
FT                   /gap_type="unknown"
FT   assembly_gap    2635543..2635562
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2671735..2671907
FT                   /estimated_length=173
FT                   /gap_type="unknown"
FT   assembly_gap    2686012..2686599
FT                   /estimated_length=588
FT                   /gap_type="unknown"
FT   assembly_gap    2695695..2695714
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2730959..2733258
FT                   /estimated_length=2300
FT                   /gap_type="unknown"
FT   assembly_gap    2781549..2782308
FT                   /estimated_length=760
FT                   /gap_type="unknown"
FT   assembly_gap    2858356..2858375
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2861136..2861877
FT                   /estimated_length=742
FT                   /gap_type="unknown"
FT   assembly_gap    2869314..2869586
FT                   /estimated_length=273
FT                   /gap_type="unknown"
FT   assembly_gap    2878495..2878582
FT                   /estimated_length=88
FT                   /gap_type="unknown"
FT   assembly_gap    2909515..2914783
FT                   /estimated_length=5269
FT                   /gap_type="unknown"
FT   assembly_gap    2920375..2920702
FT                   /estimated_length=328
FT                   /gap_type="unknown"
FT   assembly_gap    2921825..2922112
FT                   /estimated_length=288
FT                   /gap_type="unknown"
FT   assembly_gap    3017709..3017728
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3030571..3030590
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            3043778..3073203
FT                   /gene="Rnf32"
FT                   /locus_tag="mCG_7344"
FT                   /note="gene_id=mCG7344.2"
FT   mRNA            join(3043778..3043897,3044365..3044430,3045711..3045805,
FT                   3046359..3046623,3053454..3053486,3054481..3054589,
FT                   3071802..3071969,3072728..3073166)
FT                   /gene="Rnf32"
FT                   /locus_tag="mCG_7344"
FT                   /product="ring finger protein 32, transcript variant
FT                   mCT173438"
FT                   /note="gene_id=mCG7344.2 transcript_id=mCT173438.0 created
FT                   on 18-FEB-2003"
FT   mRNA            join(3043782..3043897,3044365..3044430,3045711..3045805,
FT                   3046359..3046623,3050840..3050982,3053454..3053486,
FT                   3053959..3054083,3054481..3054589,3071802..3071969,
FT                   3072728..3073203)
FT                   /gene="Rnf32"
FT                   /locus_tag="mCG_7344"
FT                   /product="ring finger protein 32, transcript variant
FT                   mCT6327"
FT                   /note="gene_id=mCG7344.2 transcript_id=mCT6327.2 created on
FT                   18-FEB-2003"
FT   mRNA            join(3043822..3043869,3044365..3044430,3045711..3045805,
FT                   3046359..3046623,3050840..3050982,3053454..3053486,
FT                   3053959..3054083,3054481..3054589,3071802..3071969,
FT                   3072728..3073124)
FT                   /gene="Rnf32"
FT                   /locus_tag="mCG_7344"
FT                   /product="ring finger protein 32, transcript variant
FT                   mCT180246"
FT                   /note="gene_id=mCG7344.2 transcript_id=mCT180246.0 created
FT                   on 18-FEB-2003"
FT   CDS             join(3045791..3045805,3046359..3046623,3050840..3050982,
FT                   3053454..3053486,3053959..3054083,3054481..3054589,
FT                   3071802..3071969,3072728..3072976)
FT                   /codon_start=1
FT                   /gene="Rnf32"
FT                   /locus_tag="mCG_7344"
FT                   /product="ring finger protein 32, isoform CRA_b"
FT                   /note="gene_id=mCG7344.2 transcript_id=mCT180246.0
FT                   protein_id=mCP103168.0 isoform=CRA_b"
FT                   /protein_id="EDL37234.1"
FT                   /translation="MLRNKDRSSNKGNLAVTAVALQDHLLHDLQLGHLSVADPCKIKAR
FT                   KKEKKSKSLKRDATAIIDTGLRKSTEGPNMEDPEKEYVLDPTPPPLTLAQKLGLLPPPP
FT                   LPLSSDEWERVKQRSLLQGDSIQPCPICKEEFELHPQVLLSCSHVFHRACLQAFEKFTN
FT                   KKTCPLCRKNQYQTRVIHDGARLFRVKCATRIQAYWRGYIVRKWYRNLRKIIPPSDAKL
FT                   RRKFFEEKFTEISHRILCSYNTNIDELFSEIDVCLAVNRSILQQLDERCGQIITKEDWE
FT                   KIQAQAAHHEIYECSICLTPLSFHGDGRQAAIGTSSQRPRETVLLSCAHLFHNACLLAL
FT                   EEFSLGDNAPFHVCPLCRSCYQKKIVEC"
FT   CDS             join(3045791..3045805,3046359..3046623,3050840..3050982,
FT                   3053454..3053486,3053959..3054083,3054481..3054589,
FT                   3071802..3071969,3072728..3072976)
FT                   /codon_start=1
FT                   /gene="Rnf32"
FT                   /locus_tag="mCG_7344"
FT                   /product="ring finger protein 32, isoform CRA_b"
FT                   /note="gene_id=mCG7344.2 transcript_id=mCT6327.2
FT                   protein_id=mCP3961.1 isoform=CRA_b"
FT                   /protein_id="EDL37235.1"
FT                   /translation="MLRNKDRSSNKGNLAVTAVALQDHLLHDLQLGHLSVADPCKIKAR
FT                   KKEKKSKSLKRDATAIIDTGLRKSTEGPNMEDPEKEYVLDPTPPPLTLAQKLGLLPPPP
FT                   LPLSSDEWERVKQRSLLQGDSIQPCPICKEEFELHPQVLLSCSHVFHRACLQAFEKFTN
FT                   KKTCPLCRKNQYQTRVIHDGARLFRVKCATRIQAYWRGYIVRKWYRNLRKIIPPSDAKL
FT                   RRKFFEEKFTEISHRILCSYNTNIDELFSEIDVCLAVNRSILQQLDERCGQIITKEDWE
FT                   KIQAQAAHHEIYECSICLTPLSFHGDGRQAAIGTSSQRPRETVLLSCAHLFHNACLLAL
FT                   EEFSLGDNAPFHVCPLCRSCYQKKIVEC"
FT   CDS             join(3045791..3045805,3046359..3046623,3053454..3053485)
FT                   /codon_start=1
FT                   /gene="Rnf32"
FT                   /locus_tag="mCG_7344"
FT                   /product="ring finger protein 32, isoform CRA_a"
FT                   /note="gene_id=mCG7344.2 transcript_id=mCT173438.0
FT                   protein_id=mCP96357.0 isoform=CRA_a"
FT                   /db_xref="MGI:MGI:1861747"
FT                   /db_xref="UniProtKB/TrEMBL:E0CZC4"
FT                   /protein_id="EDL37233.1"
FT                   /translation="MLRNKDRSSNKGNLAVTAVALQDHLLHDLQLGHLSVADPCKIKAR
FT                   KKEKKSKSLKRDATAIIDTGLRKSTEGPNMEDPEKEYVLDPTPPPLTLGAAFLLTCIP"
FT   gene            3065339..3066966
FT                   /pseudo
FT                   /locus_tag="mCG_7346"
FT                   /note="gene_id=mCG7346.2"
FT   mRNA            3065339..3066966
FT                   /pseudo
FT                   /locus_tag="mCG_7346"
FT                   /note="gene_id=mCG7346.2 transcript_id=mCT6337.2 created on
FT                   01-OCT-2002"
FT   gene            complement(3077489..3077877)
FT                   /gene="1110048D14Rik"
FT                   /locus_tag="mCG_148289"
FT                   /note="gene_id=mCG148289.0"
FT   mRNA            complement(3077489..3077877)
FT                   /gene="1110048D14Rik"
FT                   /locus_tag="mCG_148289"
FT                   /product="RIKEN cDNA 1110048D14"
FT                   /note="gene_id=mCG148289.0 transcript_id=mCT188552.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(3077543..3077734)
FT                   /codon_start=1
FT                   /gene="1110048D14Rik"
FT                   /locus_tag="mCG_148289"
FT                   /product="RIKEN cDNA 1110048D14"
FT                   /note="gene_id=mCG148289.0 transcript_id=mCT188552.0
FT                   protein_id=mCP109203.0"
FT                   /db_xref="GOA:Q8BMZ2"
FT                   /db_xref="MGI:MGI:1861746"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BMZ2"
FT                   /protein_id="EDL37236.1"
FT                   /translation="MYLLMVGTIFNVYRQKYYRVFKYVNICSTAFKLKTDMIFFICQDT
FT                   LVNFCYILFSSFLLVLFL"
FT   gene            complement(3079015..>3225458)
FT                   /gene="Lmbr1"
FT                   /locus_tag="mCG_7345"
FT                   /note="gene_id=mCG7345.2"
FT   mRNA            complement(join(3079015..3080833,3082663..3082824,
FT                   3100429..3100495,3101928..3102018,3102232..3102305,
FT                   3105744..3105821,3106365..3106441,3111081..3111161,
FT                   3135119..3135191,3139001..3139065,3139880..3139948,
FT                   3140551..3140677,3171384..3171487,3194333..3194472,
FT                   3208176..3208215,3211011..3211083,3225344..>3225457))
FT                   /gene="Lmbr1"
FT                   /locus_tag="mCG_7345"
FT                   /product="limb region 1, transcript variant mCT6325"
FT                   /note="gene_id=mCG7345.2 transcript_id=mCT6325.2 created on
FT                   01-OCT-2002"
FT   mRNA            complement(join(3079804..3080833,3082663..3082824,
FT                   3100429..3100495,3101928..3102018,3102232..3102305,
FT                   3105744..3105821,3106365..3106441,3111081..3111161,
FT                   3135119..3135191,3139001..3139065,3139880..3139948,
FT                   3140551..3140677,3171384..3171487,3194333..3194472,
FT                   3208176..3208215,3211011..3211083,3212049..3212943,
FT                   3225265..>3225440))
FT                   /gene="Lmbr1"
FT                   /locus_tag="mCG_7345"
FT                   /product="limb region 1, transcript variant mCT193633"
FT                   /note="gene_id=mCG7345.2 transcript_id=mCT193633.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(3080066..3080833,3082663..3082824,
FT                   3100429..3100495,3101928..3102018,3102232..3102305,
FT                   3105744..3105821,3106365..3106441,3111081..3111161,
FT                   3135119..3135191,3139001..3139065,3139880..3139948,
FT                   3140551..3140677,3171384..3171406,3194333..3194472,
FT                   3208176..3208215,3211011..3211083,3225265..>3225368))
FT                   /gene="Lmbr1"
FT                   /locus_tag="mCG_7345"
FT                   /product="limb region 1, transcript variant mCT193634"
FT                   /note="gene_id=mCG7345.2 transcript_id=mCT193634.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(3080748..3080833,3082663..3082824,
FT                   3100429..3100495,3101928..3102018,3102232..3102305,
FT                   3105744..3105821,3106365..3106441,3111081..3111161,
FT                   3135119..3135191,3139001..3139065,3139880..3139948,
FT                   3140551..3140677,3171384..3171406,3194333..3194472,
FT                   3208176..3208215,3211011..3211083,3225265..>3225366))
FT                   /codon_start=1
FT                   /gene="Lmbr1"
FT                   /locus_tag="mCG_7345"
FT                   /product="limb region 1, isoform CRA_c"
FT                   /note="gene_id=mCG7345.2 transcript_id=mCT193634.0
FT                   protein_id=mCP114606.0 isoform=CRA_c"
FT                   /protein_id="EDL37239.1"
FT                   /translation="RRGRPCGGYERRMEGQDEVSAREQHFHSQVRESTICFLLFAILYI
FT                   VSYFIIIRYKRKSDEQEDEDAVVNRISLFLSTFTLAVSAGAVLLLPFSIISNEILLAFP
FT                   HNYYIQWLNGSLIHEGFAGLKKGIRARILETLVMLLLLALLILGMVWVASALIDSDAAS
FT                   MESLYDLWEFYLPYLYSCISLMGCLLLLLCTPVGLSRMFTVMGQLLVKPAILEDLDEQI
FT                   YMITLEEEALQRRLHGLSSSVEYNVMELEQELENVKILKTKLERRKKASAWERNLVYPA
FT                   VMVLLLIETSISVLLVACNILCLLVDETAMPKGTRGPGIGSASLSTFGFVGAALEIILI
FT                   FYLMVSSVVGFYSLRFFGNFTPKKDDTTMTKIIGNCVSILVLSSALPVMSRTLGITRFD
FT                   LLGDFGRFNWLGNFYIVLSYNLLFAIMTTLCLIRKFTSAVREELFKALGLHKLHLSDTS
FT                   RDSETTKPSANGHQKAL"
FT   CDS             complement(join(3080748..3080833,3082663..3082824,
FT                   3100429..3100495,3101928..3102018,3102232..3102305,
FT                   3105744..3105821,3106365..3106441,3111081..3111161,
FT                   3135119..3135191,3139001..3139065,3139880..3139948,
FT                   3140551..3140677,3171384..3171487,3194333..3194472,
FT                   3208176..3208215,3211011..>3211083))
FT                   /codon_start=1
FT                   /gene="Lmbr1"
FT                   /locus_tag="mCG_7345"
FT                   /product="limb region 1, isoform CRA_b"
FT                   /note="gene_id=mCG7345.2 transcript_id=mCT193633.0
FT                   protein_id=mCP114605.0 isoform=CRA_b"
FT                   /protein_id="EDL37238.1"
FT                   /translation="ICFLLFAILYIVSYFIIIRYKRKSDEQEDEDAVVNRISLFLSTFT
FT                   LAVSAGAVLLLPFSIISNEILLAFPHNYYIQWLNGSLIHGLWNLASLFSNLCLFVLMPF
FT                   AFFFLESEGFAGLKKGIRARILETLVMLLLLALLILGMVWVASALIDSDAASMESLYDL
FT                   WEFYLPYLYSCISLMGCLLLLLCTPVGLSRMFTVMGQLLVKPAILEDLDEQIYMITLEE
FT                   EALQRRLHGLSSSVEYNVMELEQELENVKILKTKLERRKKASAWERNLVYPAVMVLLLI
FT                   ETSISVLLVACNILCLLVDETAMPKGTRGPGIGSASLSTFGFVGAALEIILIFYLMVSS
FT                   VVGFYSLRFFGNFTPKKDDTTMTKIIGNCVSILVLSSALPVMSRTLGITRFDLLGDFGR
FT                   FNWLGNFYIVLSYNLLFAIMTTLCLIRKFTSAVREELFKALGLHKLHLSDTSRDSETTK
FT                   PSANGHQKAL"
FT   CDS             complement(join(3080748..3080833,3082663..3082824,
FT                   3100429..3100495,3101928..3102018,3102232..3102305,
FT                   3105744..3105821,3106365..3106441,3111081..3111161,
FT                   3135119..3135191,3139001..3139065,3139880..3139948,
FT                   3140551..3140677,3171384..3171487,3194333..3194472,
FT                   3208176..3208215,3211011..>3211083))
FT                   /codon_start=1
FT                   /gene="Lmbr1"
FT                   /locus_tag="mCG_7345"
FT                   /product="limb region 1, isoform CRA_b"
FT                   /note="gene_id=mCG7345.2 transcript_id=mCT6325.2
FT                   protein_id=mCP4000.2 isoform=CRA_b"
FT                   /protein_id="EDL37240.1"
FT                   /translation="ICFLLFAILYIVSYFIIIRYKRKSDEQEDEDAVVNRISLFLSTFT
FT                   LAVSAGAVLLLPFSIISNEILLAFPHNYYIQWLNGSLIHGLWNLASLFSNLCLFVLMPF
FT                   AFFFLESEGFAGLKKGIRARILETLVMLLLLALLILGMVWVASALIDSDAASMESLYDL
FT                   WEFYLPYLYSCISLMGCLLLLLCTPVGLSRMFTVMGQLLVKPAILEDLDEQIYMITLEE
FT                   EALQRRLHGLSSSVEYNVMELEQELENVKILKTKLERRKKASAWERNLVYPAVMVLLLI
FT                   ETSISVLLVACNILCLLVDETAMPKGTRGPGIGSASLSTFGFVGAALEIILIFYLMVSS
FT                   VVGFYSLRFFGNFTPKKDDTTMTKIIGNCVSILVLSSALPVMSRTLGITRFDLLGDFGR
FT                   FNWLGNFYIVLSYNLLFAIMTTLCLIRKFTSAVREELFKALGLHKLHLSDTSRDSETTK
FT                   PSANGHQKAL"
FT   assembly_gap    3114297..3114316
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            complement(join(3135115..3135191,3139001..3139065,
FT                   3139880..3139948,3140551..3140708,3194333..3194472,
FT                   3208176..3208215,3211011..3211083,3225265..>3225458))
FT                   /gene="Lmbr1"
FT                   /locus_tag="mCG_7345"
FT                   /product="limb region 1, transcript variant mCT174006"
FT                   /note="gene_id=mCG7345.2 transcript_id=mCT174006.0 created
FT                   on 01-OCT-2002"
FT   CDS             complement(join(3140620..3140708,3194333..3194472,
FT                   3208176..3208215,3211011..3211083,3225265..>3225438))
FT                   /codon_start=1
FT                   /gene="Lmbr1"
FT                   /locus_tag="mCG_7345"
FT                   /product="limb region 1, isoform CRA_a"
FT                   /note="gene_id=mCG7345.2 transcript_id=mCT174006.0
FT                   protein_id=mCP96925.0 isoform=CRA_a"
FT                   /protein_id="EDL37237.1"
FT                   /translation="VAFLSGHERLYSPAARGQWCGGARRRGRPCGGYERRMEGQDEVSA
FT                   REQHFHSQVRESTICFLLFAILYIVSYFIIIRYKRKSDEQEDEDAVVNRISLFLSTFTL
FT                   AVSAGAVLLLPFSIISNEILLAFPHNYYIQWLNGSLIHVLKCCCCCVLRESEPAFWKLW
FT                   LCCCFLRC"
FT   assembly_gap    3154276..3154320
FT                   /estimated_length=45
FT                   /gap_type="unknown"
FT   assembly_gap    3187025..3187044
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3199069..3199564
FT                   /estimated_length=496
FT                   /gap_type="unknown"
FT   gene            <3225836..3237627
FT                   /locus_tag="mCG_1046201"
FT                   /note="gene_id=mCG1046201.0"
FT   mRNA            join(<3225836..3227349,3235904..3237627)
FT                   /locus_tag="mCG_1046201"
FT                   /product="mCG1046201"
FT                   /note="gene_id=mCG1046201.0 transcript_id=mCT163905.0
FT                   created on 30-SEP-2002"
FT   CDS             <3236287..3236571
FT                   /codon_start=1
FT                   /locus_tag="mCG_1046201"
FT                   /product="mCG1046201"
FT                   /note="gene_id=mCG1046201.0 transcript_id=mCT163905.0
FT                   protein_id=mCP65044.0"
FT                   /protein_id="EDL37241.1"
FT                   /translation="WKDLCLLCVHMLWRSNTPCHSQPSSPVPICKLTLLGVCYKPCVQA
FT                   VPEPCPSHTDFKMKMPDATELALHASQKTSLPNGLQIMYKCRQRADIRD"
FT   gene            complement(3267414..3271388)
FT                   /locus_tag="mCG_66329"
FT                   /note="gene_id=mCG66329.2"
FT   mRNA            complement(join(3267414..3267558,3268727..3268984,
FT                   3269650..3269761,3271112..3271388))
FT                   /locus_tag="mCG_66329"
FT                   /product="mCG66329"
FT                   /note="gene_id=mCG66329.2 transcript_id=mCT66512.2 created
FT                   on 14-OCT-2002"
FT   CDS             complement(join(3267417..3267558,3268727..3268984,
FT                   3269650..3269761,3271112..3271385))
FT                   /codon_start=1
FT                   /locus_tag="mCG_66329"
FT                   /product="mCG66329"
FT                   /note="gene_id=mCG66329.2 transcript_id=mCT66512.2
FT                   protein_id=mCP26985.1"
FT                   /protein_id="EDL37242.1"
FT                   /translation="MGFYPPRARPYHWPNPFHEKVQLEHQRVMSDIQWLELENTQYSEN
FT                   FQDLKKEIGFHLSQSPPEVEWPFLPFFVSGLKILQLWLYSFCVLAIITLEIHTPSQPPT
FT                   SCTVIVHFSVYAQAYLVALLEAVVQVSYIRRRLLEKLCLAWLSTKLWGSSVSGCSGMKA
FT                   CACLCPTKSSKEQDLERPEEMLQYIQKQKELAIQEKDLEEKLQHQIAVLLMRFEKLRHE
FT                   LEVATTQEERVLQNELLPQEPPAEPHPQQPLNSVDESSS"
FT   gene            3281856..3300598
FT                   /locus_tag="mCG_122632"
FT                   /note="gene_id=mCG122632.1"
FT   mRNA            join(3281856..3282777,3283064..3283191,3284731..3284926,
FT                   3286960..3287283,3288464..3288574,3289627..3289794,
FT                   3290483..3290604,3293371..3293503,3296714..3296823,
FT                   3298159..3300598)
FT                   /locus_tag="mCG_122632"
FT                   /product="mCG122632"
FT                   /note="gene_id=mCG122632.1 transcript_id=mCT123854.1
FT                   created on 01-OCT-2002"
FT   CDS             join(3281881..3282777,3283064..3283191,3284731..3284926,
FT                   3286960..3287283,3288464..3288574,3289627..3289794,
FT                   3290483..3290604,3293371..3293503,3296714..3296823,
FT                   3298159..3298333)
FT                   /codon_start=1
FT                   /locus_tag="mCG_122632"
FT                   /product="mCG122632"
FT                   /note="gene_id=mCG122632.1 transcript_id=mCT123854.1
FT                   protein_id=mCP64743.1"
FT                   /protein_id="EDL37243.1"
FT                   /translation="MAHALLKRSGVRRGLGGREGPLKRLRLAVEDFVRTTSESEACESR
FT                   SAVARSRPGGRKSRKELRKEKRHLRKARRLQRTVGSGSGDQGGNVGLNDGPETRRPPTE
FT                   VRPTPAKATATPAKASAPSTNTKASAAQPKAKAKGAPGKPGPATATARKRALLAANEEE
FT                   DREIRKLERCLGLHKRKKKGDGSSVPLSFARDGLDYILGALECGSGGGLYESSEEEEEE
FT                   KLETGQTVLESDLESNSKESEEDPDWQVLQEDQEDVNSKRRGEAESGTRGNKGTKKVRF
FT                   AEVVEKSRSSSEDDIEQQESHSVESGEKYIPPRLRNEEVIDVHKKEELDRLKKHVKGLI
FT                   NRLSEPNMASISGQLEELYMAHSRKDMNDTLTTALMDACVTASAMPSRLMMEHVFLVSI
FT                   LHHTVGIEVGACFLEAVVKKFDAIYRDGGEGKELDNLFTMIAHLYNFHVVQSILIFDIL
FT                   KKLVGTFTEKDIELILLMLKNVGFALRKDDALSLKELITEAQTQASGAGNKFQDQNRVR
FT                   FMLETMLALKNNDLRKIPGYNPEPVEKLKKLQRTLVRNAGSGSETRLRISWDGILNAEQ
FT                   TGRWWIVGSAWSGTPMIDNSHHIQLQKPLAGMASSKMLELARKQRMNTDVRRIIFCTLM
FT                   TSEDFLDAFEKLLKLGLKDQQEREIVHILMDCCLQEKTYNPFYAFLASKFCDYERRFQV
FT                   VEFSELDKPRVHFLRRVLTALLMETEDDDLAVIFSRVSDNPKLGMLREGLKLFIGHFLL
FT                   KHTQAHQSAEEASLLREKAGLASKSLQGKAILRM"
FT   gene            complement(3320391..3325600)
FT                   /gene="Hlxb9"
FT                   /locus_tag="mCG_7342"
FT                   /note="gene_id=mCG7342.1"
FT   mRNA            complement(join(3320391..3321361,3321886..3322046,
FT                   3324715..3325600))
FT                   /gene="Hlxb9"
FT                   /locus_tag="mCG_7342"
FT                   /product="homeobox gene HB9"
FT                   /note="gene_id=mCG7342.1 transcript_id=mCT6326.1 created on
FT                   16-SEP-2002"
FT   CDS             complement(join(3320999..3321361,3321886..3322046,
FT                   3324715..3325405))
FT                   /codon_start=1
FT                   /gene="Hlxb9"
FT                   /locus_tag="mCG_7342"
FT                   /product="homeobox gene HB9"
FT                   /note="gene_id=mCG7342.1 transcript_id=mCT6326.1
FT                   protein_id=mCP3942.1"
FT                   /db_xref="GOA:A2RSX2"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017970"
FT                   /db_xref="InterPro:IPR020479"
FT                   /db_xref="MGI:MGI:109160"
FT                   /db_xref="UniProtKB/TrEMBL:A2RSX2"
FT                   /protein_id="EDL37244.1"
FT                   /translation="MEKSKNFRIDALLAVDPPRAASTQSAPLALVTSLATTVSGPGRGG
FT                   SGGGGTSSGASRSCSPASSEATAAPGDRLRAESPSPPRLLAAHCALLPKPGFLGAGGGG
FT                   GAAGGPGTPHHHAHPGAAAAAAAAAAAAAAGGLALGLHPGGAQGGAGLPAQAALYGHPV
FT                   YSYSAAAAAAALAGQHPALSYSYPQVQGAHPAHPADPIKLGASTFQLDQWLRASTAGMI
FT                   LPKMPDFSSQAQSNLLGKCRRPRTAFTSQQLLELEHQFKLNKYLSRPKRFEVATSLMLT
FT                   ETQVKIWFQNRRMKWKRSKKAKEQAAQEAEKQKGGGGGTGKGGSEEKTEEELMGPPVSG
FT                   DKASGRRLRDLRDSDPDEDEDDEEEDNFPYSNGAGAHAASSDCSSEDDSPPPRLGGPGH
FT                   QPLPQ"
FT   gene            3385023..3385789
FT                   /locus_tag="mCG_11640"
FT                   /note="gene_id=mCG11640.1"
FT   mRNA            3385023..3385789
FT                   /locus_tag="mCG_11640"
FT                   /product="mCG11640"
FT                   /note="gene_id=mCG11640.1 transcript_id=mCT12255.1 created
FT                   on 24-SEP-2002"
FT   CDS             3385237..3385590
FT                   /codon_start=1
FT                   /locus_tag="mCG_11640"
FT                   /product="mCG11640"
FT                   /note="gene_id=mCG11640.1 transcript_id=mCT12255.1
FT                   protein_id=mCP3889.1"
FT                   /protein_id="EDL37245.1"
FT                   /translation="MVTLMTRKDIPPWVKVPEDLKDPEVFQVQSLVLKSLFGPQGSRMS
FT                   HIEQVSQAMFELKNLESPEELIEVFLYGSQNNKVLAKWILQSMAERYRLRQQKGVLKLE
FT                   ESMKTLELGQCIE"
FT   gene            <3416323..3523154
FT                   /gene="Ube3c"
FT                   /locus_tag="mCG_11645"
FT                   /note="gene_id=mCG11645.3"
FT   mRNA            join(<3416323..3416662,3434357..3434410,3436970..3437044,
FT                   3437892..3438038,3444151..3444266,3445941..3446098,
FT                   3447723..3447876,3448214..3448434,3449278..3449429,
FT                   3453979..3454166,3461986..3462072,3466306..3466463,
FT                   3466633..3466865,3478270..3478374,3479828..3479915,
FT                   3482709..3482806,3484716..3484848,3493488..3493735,
FT                   3505287..3505499,3510540..3510728,3510853..3510919,
FT                   3514991..3515121,3521476..3523154)
FT                   /gene="Ube3c"
FT                   /locus_tag="mCG_11645"
FT                   /product="ubiquitin protein ligase E3C, transcript variant
FT                   mCT193576"
FT                   /note="gene_id=mCG11645.3 transcript_id=mCT193576.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(3416327..3416662,3434357..3434410,3436970..3437044,
FT                   3437892..3438038,3444151..3444266,3445941..3446098,
FT                   3447723..3447876,3448214..3448434,3449278..3449429,
FT                   3453979..3454166,3461986..3462072,3466306..3466463,
FT                   3466639..3466865,3478270..3478374,3479828..3479915,
FT                   3482709..3482806,3484716..3484848,3493488..3493735,
FT                   3505287..3505499,3510540..3510728,3510853..3510919,
FT                   3514991..3515121,3521476..3523154)
FT                   /gene="Ube3c"
FT                   /locus_tag="mCG_11645"
FT                   /product="ubiquitin protein ligase E3C, transcript variant
FT                   mCT12260"
FT                   /note="gene_id=mCG11645.3 transcript_id=mCT12260.2 created
FT                   on 01-OCT-2002"
FT   CDS             join(<3416588..3416662,3434357..3434410,3436970..3437044,
FT                   3437892..3438038,3444151..3444266,3445941..3446098,
FT                   3447723..3447876,3448214..3448434,3449278..3449429,
FT                   3453979..3454166,3461986..3462072,3466306..3466463,
FT                   3466633..3466865,3478270..3478374,3479828..3479915,
FT                   3482709..3482806,3484716..3484848,3493488..3493735,
FT                   3505287..3505499,3510540..3510728,3510853..3510919,
FT                   3514991..3515121,3521476..3521646)
FT                   /codon_start=1
FT                   /gene="Ube3c"
FT                   /locus_tag="mCG_11645"
FT                   /product="ubiquitin protein ligase E3C, isoform CRA_a"
FT                   /note="gene_id=mCG11645.3 transcript_id=mCT193576.0
FT                   protein_id=mCP114513.0 isoform=CRA_a"
FT                   /protein_id="EDL37246.1"
FT                   /translation="AAKMFSFEGDFKTRPKVSLGGASRKEEKASLLHRTQEERRKREEE
FT                   RRRLKNAVIIQSFIRGYRDRKQQYFIQRSAFDQCTDSAQPGGTFCLADGPNLTLLVRQL
FT                   LFFYKQSEDSKRLIWLYQNLIKHSSLFVKQLDGSERLTCLFQIKRLMSLCCRLLQNCSD
FT                   DSLNVALPMRMLEVFTSENTYLPVLQDSSYVVSVIEQILHYMVHSGYYRSLYLLINSKL
FT                   PSSIEYSDLSRVPIAKILLENVLKPLHFTYSSCPEASRHQVFSAFTEEFLGAPFTDQIF
FT                   HFVIPAFADAQTVFPYEPFLNALLLLESQSSKRCSGVPWLFYFVLTVGENYLGALSEDG
FT                   LLVYLRVLQTFLSQLPASPTGTGCPDSTSDSEDDNEETDQPNSPEDGRVSAPYITEECL
FT                   RKLDTKQQTNTLLNLVWRDSASEEVFTRMASICHTLMVQHRMMVPKVRLLYSLAFNARF
FT                   LRHLWFLISSMTTQMITGSMVPLLQLISRGSPMSFEDSSRIIPLFYLFSSLFSHSLISI
FT                   HDNEFFGDPIEVVGQRQSSMMPFTLEELILLSRCLRDACLGIIKLAYPETKPEVREEYV
FT                   TAFQSIGVTTNSEMQQCIQMEQKRWVQLFKVITNLVKMLKSRDTRRNFCPPNHWLSEQE
FT                   DIKADKVTQLYVPASRHVWRFRRMGRIGPLQSTLEVGLESLPLSVSEERQLAILTELPF
FT                   VVPFEERVKIFQRLIYADKQEVQGDGPFLDGINVTIRRNYIYEDAYDKLSPENEPDLKK
FT                   RIRVHLLNAHGLDEAGIDGGGIFREFLNELLKSGFNPNQGFFKTTNEGLLYPNPAAQML
FT                   VGDSFARHYYFLGRMLGKALYENMLVELPFAGFFLSKLLGTSADVDIHHLASLDPEVYR
FT                   NLLFLKSYEEDVEELGLNFTVVNNDLGEAQVVELKFGGKDIPVTGANRIAYIHLVADYR
FT                   LNKQIRPHCLAFRQGLANVVSLEWLRMFDQQEIQVLISGAQVPVSLEDLKSFTNYSGGY
FT                   SADHPVIKIFWRVVEGFTDEEKRKLLKFVTSCSRPPLLGFKELYPAFCIHNGGSDLERL
FT                   PTASTCMNLLKLPEFYDEALLRSKLLYAIECAAGFELS"
FT   CDS             join(3416597..3416662,3434357..3434410,3436970..3437044,
FT                   3437892..3438038,3444151..3444266,3445941..3446098,
FT                   3447723..3447876,3448214..3448434,3449278..3449429,
FT                   3453979..3454166,3461986..3462072,3466306..3466463,
FT                   3466639..3466865,3478270..3478374,3479828..3479915,
FT                   3482709..3482806,3484716..3484848,3493488..3493735,
FT                   3505287..3505499,3510540..3510728,3510853..3510919,
FT                   3514991..3515121,3521476..3521646)
FT                   /codon_start=1
FT                   /gene="Ube3c"
FT                   /locus_tag="mCG_11645"
FT                   /product="ubiquitin protein ligase E3C, isoform CRA_b"
FT                   /note="gene_id=mCG11645.3 transcript_id=mCT12260.2
FT                   protein_id=mCP3892.2 isoform=CRA_b"
FT                   /protein_id="EDL37247.1"
FT                   /translation="MFSFEGDFKTRPKVSLGGASRKEEKASLLHRTQEERRKREEERRR
FT                   LKNAVIIQSFIRGYRDRKQQYFIQRSAFDQCTDSAQPGGTFCLADGPNLTLLVRQLLFF
FT                   YKQSEDSKRLIWLYQNLIKHSSLFVKQLDGSERLTCLFQIKRLMSLCCRLLQNCSDDSL
FT                   NVALPMRMLEVFTSENTYLPVLQDSSYVVSVIEQILHYMVHSGYYRSLYLLINSKLPSS
FT                   IEYSDLSRVPIAKILLENVLKPLHFTYSSCPEASRHQVFSAFTEEFLGAPFTDQIFHFV
FT                   IPAFADAQTVFPYEPFLNALLLLESQSSKRCSGVPWLFYFVLTVGENYLGALSEDGLLV
FT                   YLRVLQTFLSQLPASPTGTGCPDSTSDSEDDNEETDQPNSPEDGRVSAPYITEECLRKL
FT                   DTKQQTNTLLNLVWRDSASEEVFTRMASICHTLMVQHRMMVPKVRLLYSLAFNARFLRH
FT                   LWFLISSMTTQMITGSMVPLLQLISRGSPMSFEDSSRIIPLFYLFSSLFSHSLISIHDN
FT                   EFFGDPIEGQRQSSMMPFTLEELILLSRCLRDACLGIIKLAYPETKPEVREEYVTAFQS
FT                   IGVTTNSEMQQCIQMEQKRWVQLFKVITNLVKMLKSRDTRRNFCPPNHWLSEQEDIKAD
FT                   KVTQLYVPASRHVWRFRRMGRIGPLQSTLEVGLESLPLSVSEERQLAILTELPFVVPFE
FT                   ERVKIFQRLIYADKQEVQGDGPFLDGINVTIRRNYIYEDAYDKLSPENEPDLKKRIRVH
FT                   LLNAHGLDEAGIDGGGIFREFLNELLKSGFNPNQGFFKTTNEGLLYPNPAAQMLVGDSF
FT                   ARHYYFLGRMLGKALYENMLVELPFAGFFLSKLLGTSADVDIHHLASLDPEVYRNLLFL
FT                   KSYEEDVEELGLNFTVVNNDLGEAQVVELKFGGKDIPVTGANRIAYIHLVADYRLNKQI
FT                   RPHCLAFRQGLANVVSLEWLRMFDQQEIQVLISGAQVPVSLEDLKSFTNYSGGYSADHP
FT                   VIKIFWRVVEGFTDEEKRKLLKFVTSCSRPPLLGFKELYPAFCIHNGGSDLERLPTAST
FT                   CMNLLKLPEFYDEALLRSKLLYAIECAAGFELS"
FT   assembly_gap    3524880..3524899
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(3567069..3567600)
FT                   /pseudo
FT                   /locus_tag="mCG_49601"
FT                   /note="gene_id=mCG49601.1"
FT   mRNA            complement(3567069..3567600)
FT                   /pseudo
FT                   /locus_tag="mCG_49601"
FT                   /note="gene_id=mCG49601.1 transcript_id=mCT49784.1 created
FT                   on 18-OCT-2002"
FT   gene            complement(3583157..3614818)
FT                   /locus_tag="mCG_148304"
FT                   /note="gene_id=mCG148304.1"
FT   mRNA            complement(join(3583157..3583841,3614326..3614818))
FT                   /locus_tag="mCG_148304"
FT                   /product="mCG148304"
FT                   /note="gene_id=mCG148304.1 transcript_id=mCT188567.1
FT                   created on 19-MAR-2004"
FT   gene            3583766..3634245
FT                   /locus_tag="mCG_11633"
FT                   /note="gene_id=mCG11633.2"
FT   mRNA            join(3583766..3583905,3596135..3596225,3598728..3598837,
FT                   3600187..3600249,3601332..3601442,3612186..3612317,
FT                   3613293..3613434,3614112..3614182,3628917..3629237,
FT                   3632818..3634245)
FT                   /locus_tag="mCG_11633"
FT                   /product="mCG11633, transcript variant mCT173394"
FT                   /note="gene_id=mCG11633.2 transcript_id=mCT173394.1 created
FT                   on 19-MAR-2004"
FT   mRNA            join(3583766..3583905,3596135..3596225,3598728..3598837,
FT                   3600187..3600249,3601332..3601442,3612186..3612317,
FT                   3613293..3613434,3614112..3614182,3628917..3629474)
FT                   /locus_tag="mCG_11633"
FT                   /product="mCG11633, transcript variant mCT180106"
FT                   /note="gene_id=mCG11633.2 transcript_id=mCT180106.1 created
FT                   on 19-MAR-2004"
FT   mRNA            join(3583766..3583905,3596135..3596225,3598728..3598837,
FT                   3600187..3600249,3601332..3601442,3612186..3612317,
FT                   3613293..3613434,3614112..3614875)
FT                   /locus_tag="mCG_11633"
FT                   /product="mCG11633, transcript variant mCT12247"
FT                   /note="gene_id=mCG11633.2 transcript_id=mCT12247.3 created
FT                   on 19-MAR-2004"
FT   mRNA            join(3583766..3583905,3596135..3596225,3598728..3598837,
FT                   3600187..3600249,3601332..3601442,3604024..3604128,
FT                   3605338..3605758)
FT                   /locus_tag="mCG_11633"
FT                   /product="mCG11633, transcript variant mCT12248"
FT                   /note="gene_id=mCG11633.2 transcript_id=mCT12248.2 created
FT                   on 19-MAR-2004"
FT   CDS             join(3596161..3596225,3598728..3598837,3600187..3600249,
FT                   3601332..3601442,3612186..3612317,3613293..3613434,
FT                   3614112..3614182,3628917..3629237,3632818..3632900)
FT                   /codon_start=1
FT                   /locus_tag="mCG_11633"
FT                   /product="mCG11633, isoform CRA_f"
FT                   /note="gene_id=mCG11633.2 transcript_id=mCT173394.1
FT                   protein_id=mCP96313.1 isoform=CRA_f"
FT                   /protein_id="EDL37254.1"
FT                   /translation="MVDYYEVLGVQRHASPEDIKKAYRKQALKWHPDKNPENKEEAERK
FT                   FKQVAEAYEVLSDAKKRDIYDKYGKEGLNGGGGGGGIHFDSPFEFGFTFRNPDDVFREF
FT                   FGGRDPFSFDFFEDPFDDFFGNRRGPRGNRSRGAGSFFSTFSGFPSFGSGFPAFDTGFT
FT                   PFGSLGHGGLTSFSSTSFGGSGMGNFKSISTSTKIVNGKKITTKRIVENGQERVEVEED
FT                   GQLKSLTINGVADENALAEECQRRGQPTPALAPGPAPAPVRVPSQARPLAPTPAPTPAP
FT                   TPAPAPAQTPAPSVSTRPQKPPRPAPTAKLGSKSNWEDDEQDRQRVPGNWDAPMTSAGL
FT                   KEGGKRKKQKQKEDLKKKKSTKGNH"
FT   CDS             join(3596161..3596225,3598728..3598837,3600187..3600249,
FT                   3601332..3601442,3612186..3612317,3613293..3613434,
FT                   3614112..3614182,3628917..3629341)
FT                   /codon_start=1
FT                   /locus_tag="mCG_11633"
FT                   /product="mCG11633, isoform CRA_b"
FT                   /note="gene_id=mCG11633.2 transcript_id=mCT180106.1
FT                   protein_id=mCP103030.1 isoform=CRA_b"
FT                   /protein_id="EDL37250.1"
FT                   /translation="MVDYYEVLGVQRHASPEDIKKAYRKQALKWHPDKNPENKEEAERK
FT                   FKQVAEAYEVLSDAKKRDIYDKYGKEGLNGGGGGGGIHFDSPFEFGFTFRNPDDVFREF
FT                   FGGRDPFSFDFFEDPFDDFFGNRRGPRGNRSRGAGSFFSTFSGFPSFGSGFPAFDTGFT
FT                   PFGSLGHGGLTSFSSTSFGGSGMGNFKSISTSTKIVNGKKITTKRIVENGQERVEVEED
FT                   GQLKSLTINGVADENALAEECQRRGQPTPALAPGPAPAPVRVPSQARPLAPTPAPTPAP
FT                   TPAPAPAQTPAPSVSTRPQKPPRPAPTAKLGSKSNWEDDEQDRQRVPGNWDAPMTSAGV
FT                   QKGDGVEHPQSVLPPGPGQQTQESGLCCCILT"
FT   CDS             join(3596161..3596225,3598728..3598837,3600187..3600249,
FT                   3601332..3601442,3612186..3612317,3613293..3613434,
FT                   3614112..3614217)
FT                   /codon_start=1
FT                   /locus_tag="mCG_11633"
FT                   /product="mCG11633, isoform CRA_a"
FT                   /note="gene_id=mCG11633.2 transcript_id=mCT12247.3
FT                   protein_id=mCP4025.3 isoform=CRA_a"
FT                   /protein_id="EDL37249.1"
FT                   /translation="MVDYYEVLGVQRHASPEDIKKAYRKQALKWHPDKNPENKEEAERK
FT                   FKQVAEAYEVLSDAKKRDIYDKYGKEGLNGGGGGGGIHFDSPFEFGFTFRNPDDVFREF
FT                   FGGRDPFSFDFFEDPFDDFFGNRRGPRGNRSRGAGSFFSTFSGFPSFGSGFPAFDTGFT
FT                   PFGSLGHGGLTSFSSTSFGGSGMGNFKSISTSTKIVNGKKITTKRIVENGQERVEVEED
FT                   GQLKSLTINGKEHLLRLDNK"
FT   CDS             join(3596161..3596225,3598728..3598837,3600187..3600249,
FT                   3601332..3601442,3604024..3604128,3605338..3605669)
FT                   /codon_start=1
FT                   /locus_tag="mCG_11633"
FT                   /product="mCG11633, isoform CRA_e"
FT                   /note="gene_id=mCG11633.2 transcript_id=mCT12248.2
FT                   protein_id=mCP3977.2 isoform=CRA_e"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="MGI:MGI:1344381"
FT                   /db_xref="UniProtKB/TrEMBL:G3X8S5"
FT                   /protein_id="EDL37253.1"
FT                   /translation="MVDYYEVLGVQRHASPEDIKKAYRKQALKWHPDKNPENKEEAERK
FT                   FKQVAEAYEVLSDAKKRDIYDKYGKEGLNGGGGGGGIHFDSPFEFGFTFRNPDDVFREF
FT                   FGGRDPFSFDFFGLLGDFHFQAVRIFAQEKKLLHGYYVYEVTVQPTGGFEEVASEDLEP
FT                   SEELDQPCFEESVEDALSDEHSEVLDVISSEELDLSEDESSEGCSWGQGGLLSEDLDLV
FT                   SSEEEASLGDAEELSEEYEELLSEEEHSGPDPEALLVQQ"
FT   mRNA            join(3598512..3598837,3600187..3600249,3601332..3601442,
FT                   3612186..3612317,3613293..3613434,3614112..3614182,
FT                   3628917..3629237,3632818..3634245)
FT                   /locus_tag="mCG_11633"
FT                   /product="mCG11633, transcript variant mCT180107"
FT                   /note="gene_id=mCG11633.2 transcript_id=mCT180107.1 created
FT                   on 19-MAR-2004"
FT   mRNA            join(<3602222..3602381,3604024..3604128,3605338..3605758)
FT                   /locus_tag="mCG_11633"
FT                   /product="mCG11633, transcript variant mCT180108"
FT                   /note="gene_id=mCG11633.2 transcript_id=mCT180108.1 created
FT                   on 19-MAR-2004"
FT   CDS             join(<3602357..3602381,3604024..3604128,3605338..3605669)
FT                   /codon_start=1
FT                   /locus_tag="mCG_11633"
FT                   /product="mCG11633, isoform CRA_d"
FT                   /note="gene_id=mCG11633.2 transcript_id=mCT180108.1
FT                   protein_id=mCP103029.1 isoform=CRA_d"
FT                   /protein_id="EDL37252.1"
FT                   /translation="RGTSHPGSGLLGDFHFQAVRIFAQEKKLLHGYYVYEVTVQPTGGF
FT                   EEVASEDLEPSEELDQPCFEESVEDALSDEHSEVLDVISSEELDLSEDESSEGCSWGQG
FT                   GLLSEDLDLVSSEEEASLGDAEELSEEYEELLSEEEHSGPDPEALLVQQ"
FT   CDS             join(3613367..3613434,3614112..3614182,3628917..3629237,
FT                   3632818..3632900)
FT                   /codon_start=1
FT                   /locus_tag="mCG_11633"
FT                   /product="mCG11633, isoform CRA_c"
FT                   /note="gene_id=mCG11633.2 transcript_id=mCT180107.1
FT                   protein_id=mCP103028.1 isoform=CRA_c"
FT                   /protein_id="EDL37251.1"
FT                   /translation="MGNFKSISTSTKIVNGKKITTKRIVENGQERVEVEEDGQLKSLTI
FT                   NGVADENALAEECQRRGQPTPALAPGPAPAPVRVPSQARPLAPTPAPTPAPTPAPAPAQ
FT                   TPAPSVSTRPQKPPRPAPTAKLGSKSNWEDDEQDRQRVPGNWDAPMTSAGLKEGGKRKK
FT                   QKQKEDLKKKKSTKGNH"
FT   CDS             complement(3614520..3614612)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148304"
FT                   /product="mCG148304"
FT                   /note="gene_id=mCG148304.1 transcript_id=mCT188567.1
FT                   protein_id=mCP109218.1"
FT                   /protein_id="EDL37248.1"
FT                   /translation="MLSPQQADTTHSQFTTMGSRSMLVLQTVSS"
FT   gene            3635670..3637172
FT                   /locus_tag="mCG_148308"
FT                   /note="gene_id=mCG148308.0"
FT   mRNA            join(3635670..3636860,3637104..3637172)
FT                   /locus_tag="mCG_148308"
FT                   /product="mCG148308"
FT                   /note="gene_id=mCG148308.0 transcript_id=mCT188571.0
FT                   created on 13-JAN-2004"
FT   CDS             3635718..3635858
FT                   /codon_start=1
FT                   /locus_tag="mCG_148308"
FT                   /product="mCG148308"
FT                   /note="gene_id=mCG148308.0 transcript_id=mCT188571.0
FT                   protein_id=mCP109222.0"
FT                   /protein_id="EDL37255.1"
FT                   /translation="MSKGDSWSIKKLLPDMSLSTDLPSVVPPYLRAMMKIVGLKRLSNM
FT                   W"
FT   assembly_gap    3639372..3639635
FT                   /estimated_length=264
FT                   /gap_type="unknown"
FT   gene            complement(3641913..3642967)
FT                   /pseudo
FT                   /locus_tag="mCG_11639"
FT                   /note="gene_id=mCG11639.1"
FT   mRNA            complement(3641913..3642967)
FT                   /pseudo
FT                   /locus_tag="mCG_11639"
FT                   /note="gene_id=mCG11639.1 transcript_id=mCT12254.1 created
FT                   on 01-OCT-2002"
FT   assembly_gap    3649180..3649393
FT                   /estimated_length=214
FT                   /gap_type="unknown"
FT   assembly_gap    3653122..3653141
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(3654525..3656232)
FT                   /pseudo
FT                   /locus_tag="mCG_51660"
FT                   /note="gene_id=mCG51660.2"
FT   mRNA            complement(3654525..3656232)
FT                   /pseudo
FT                   /locus_tag="mCG_51660"
FT                   /note="gene_id=mCG51660.2 transcript_id=mCT51843.2 created
FT                   on 18-OCT-2002"
FT   gene            complement(3679048..3681469)
FT                   /pseudo
FT                   /locus_tag="mCG_52324"
FT                   /note="gene_id=mCG52324.2"
FT   mRNA            complement(3679048..3681469)
FT                   /pseudo
FT                   /locus_tag="mCG_52324"
FT                   /note="gene_id=mCG52324.2 transcript_id=mCT52507.2 created
FT                   on 14-OCT-2002"
FT   assembly_gap    3683866..3683933
FT                   /estimated_length=68
FT                   /gap_type="unknown"
FT   assembly_gap    3687105..3687124
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3721599..3721618
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3729419..3729438
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3734175..3734500
FT                   /estimated_length=326
FT                   /gap_type="unknown"
FT   assembly_gap    3751047..3751066
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3783728..3783911
FT                   /estimated_length=184
FT                   /gap_type="unknown"
FT   assembly_gap    3789512..3789755
FT                   /estimated_length=244
FT                   /gap_type="unknown"
FT   assembly_gap    3792727..3792746
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3835653..3836027
FT                   /estimated_length=375
FT                   /gap_type="unknown"
FT   gene            complement(3844545..>3857202)
FT                   /locus_tag="mCG_1046205"
FT                   /note="gene_id=mCG1046205.0"
FT   mRNA            complement(join(3844545..3844778,3852879..3852968,
FT                   3857171..>3857202))
FT                   /locus_tag="mCG_1046205"
FT                   /product="mCG1046205"
FT                   /note="gene_id=mCG1046205.0 transcript_id=mCT163909.0
FT                   created on 14-OCT-2002"
FT   CDS             complement(3844558..>3844761)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1046205"
FT                   /product="mCG1046205"
FT                   /note="gene_id=mCG1046205.0 transcript_id=mCT163909.0
FT                   protein_id=mCP65090.0"
FT                   /protein_id="EDL37256.1"
FT                   /translation="SLTPSFGEPWLTSEEGLLLSSVPSTHIRHHSRLPVTTASEGLTPF
FT                   SGLSVRLHSHSCAHIYTHIHII"
FT   gene            <3861546..3868382
FT                   /gene="Il6"
FT                   /locus_tag="mCG_11634"
FT                   /note="gene_id=mCG11634.2"
FT   mRNA            join(<3861546..3861614,3861780..3861964,3863223..3863336,
FT                   3866404..3868382)
FT                   /gene="Il6"
FT                   /locus_tag="mCG_11634"
FT                   /product="interleukin 6, transcript variant mCT193535"
FT                   /note="gene_id=mCG11634.2 transcript_id=mCT193535.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(3861565..3861614,3861780..3861964,3863223..3863336,
FT                   3866404..3866553,3867782..3868369)
FT                   /gene="Il6"
FT                   /locus_tag="mCG_11634"
FT                   /product="interleukin 6, transcript variant mCT12249"
FT                   /note="gene_id=mCG11634.2 transcript_id=mCT12249.1 created
FT                   on 16-SEP-2002"
FT   CDS             join(<3861578..3861614,3861780..3861964,3863223..3863336,
FT                   3866404..3866712)
FT                   /codon_start=1
FT                   /gene="Il6"
FT                   /locus_tag="mCG_11634"
FT                   /product="interleukin 6, isoform CRA_a"
FT                   /note="gene_id=mCG11634.2 transcript_id=mCT193535.0
FT                   protein_id=mCP114512.0 isoform=CRA_a"
FT                   /protein_id="EDL37257.1"
FT                   /translation="SIPETAMKFLSARDFHPVAFLGLMLVTTTAFPTSQVRRGDFTEDT
FT                   TPNRPVYTTSQVGGLITHVLWEIVEMRKELCNGNSDCMNNDDALAENNLKLPEIQRNDG
FT                   CYQTGYNQEICLLKISSGLLEYHSYLEYMKNNLKDNKKDKARVLQRDTETLIHIFNQEV
FT                   SASPSLMQCGKEDTRHLRVAALFPDSCSEGRESEQQFLIIRPCFVLLWGFV"
FT   CDS             join(3861596..3861614,3861780..3861964,3863223..3863336,
FT                   3866404..3866553,3867782..3867949)
FT                   /codon_start=1
FT                   /gene="Il6"
FT                   /locus_tag="mCG_11634"
FT                   /product="interleukin 6, isoform CRA_b"
FT                   /note="gene_id=mCG11634.2 transcript_id=mCT12249.1
FT                   protein_id=mCP3999.2 isoform=CRA_b"
FT                   /db_xref="GOA:A2RTD1"
FT                   /db_xref="InterPro:IPR003574"
FT                   /db_xref="InterPro:IPR009079"
FT                   /db_xref="InterPro:IPR012351"
FT                   /db_xref="InterPro:IPR030473"
FT                   /db_xref="InterPro:IPR030474"
FT                   /db_xref="MGI:MGI:96559"
FT                   /db_xref="UniProtKB/TrEMBL:A2RTD1"
FT                   /protein_id="EDL37258.1"
FT                   /translation="MKFLSARDFHPVAFLGLMLVTTTAFPTSQVRRGDFTEDTTPNRPV
FT                   YTTSQVGGLITHVLWEIVEMRKELCNGNSDCMNNDDALAENNLKLPEIQRNDGCYQTGY
FT                   NQEICLLKISSGLLEYHSYLEYMKNNLKDNKKDKARVLQRDTETLIHIFNQEVKDLHKI
FT                   VLPTPISNALLTDKLESQKEWLRTKTIQFILKSLEEFLKVTLRSTRQT"
FT   assembly_gap    3869937..3869956
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            3887921..3889075
FT                   /pseudo
FT                   /locus_tag="mCG_1046024"
FT                   /note="gene_id=mCG1046024.1"
FT   mRNA            3887921..3889075
FT                   /pseudo
FT                   /locus_tag="mCG_1046024"
FT                   /note="gene_id=mCG1046024.1 transcript_id=mCT163728.1
FT                   created on 18-OCT-2002"
FT   assembly_gap    3890217..3890236
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3900278..3900297
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3901128..3904255
FT                   /estimated_length=3128
FT                   /gap_type="unknown"
FT   gene            complement(3904549..3922351)
FT                   /gene="Tyms"
FT                   /locus_tag="mCG_11630"
FT                   /note="gene_id=mCG11630.1"
FT   mRNA            complement(join(3904549..3904685,3909675..3909862,
FT                   3910697..3910768,3911965..3912140,3912814..3912915,
FT                   3917168..3917342,3920345..3920418,3922072..3922351))
FT                   /gene="Tyms"
FT                   /locus_tag="mCG_11630"
FT                   /product="thymidylate synthase, transcript variant
FT                   mCT12244"
FT                   /note="gene_id=mCG11630.1 transcript_id=mCT12244.2 created
FT                   on 24-SEP-2002"
FT   assembly_gap    3906254..3906273
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            complement(join(3907556..3909862,3910697..3910768,
FT                   3911965..3912140,3912814..3912915,3917168..3917342,
FT                   3920345..3920418,3922072..>3922293))
FT                   /gene="Tyms"
FT                   /locus_tag="mCG_11630"
FT                   /product="thymidylate synthase, transcript variant
FT                   mCT193533"
FT                   /note="gene_id=mCG11630.1 transcript_id=mCT193533.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(3909725..3909862,3910697..3910768,
FT                   3911965..3912140,3912814..3912915,3917168..3917342,
FT                   3920345..3920418,3922072..>3922291))
FT                   /codon_start=1
FT                   /gene="Tyms"
FT                   /locus_tag="mCG_11630"
FT                   /product="thymidylate synthase, isoform CRA_a"
FT                   /note="gene_id=mCG11630.1 transcript_id=mCT193533.0
FT                   protein_id=mCP114511.0 isoform=CRA_a"
FT                   /protein_id="EDL37259.1"
FT                   /translation="SLTTLLPDCSVMLVVGSELQSDAQQLSAEAPRHGELQYLRQVEHI
FT                   LRCGFKKEDRTGTGTLSVFGMQARYSLRDEFPLLTTKRVFWKGVLEELLWFIKGSTNAK
FT                   ELSSKGVRIWDANGSRDFLDSLGFSARQEGDLGPVYGFQWRHFGAEYKDMDSDYSGQGV
FT                   DQLQKVIDTIKTNPDDRRIIMCAWNPKDLPLMALPPCHALCQFYVVNGELSCQLYQRSG
FT                   DMGLGVPFNIASYALLTYMIAHITGLQPGDFVHTLGDAHIYLNHIEPLKIQLQREPRPF
FT                   PKLKILRKVETIDDFKVEDFQIEGYNPHPTIKMEMAV"
FT   CDS             complement(join(3909725..3909862,3910697..3910768,
FT                   3911965..3912140,3912814..3912915,3917168..3917342,
FT                   3920345..3920418,3922072..3922258))
FT                   /codon_start=1
FT                   /gene="Tyms"
FT                   /locus_tag="mCG_11630"
FT                   /product="thymidylate synthase, isoform CRA_b"
FT                   /note="gene_id=mCG11630.1 transcript_id=mCT12244.2
FT                   protein_id=mCP3932.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q544L2"
FT                   /db_xref="InterPro:IPR000398"
FT                   /db_xref="InterPro:IPR020940"
FT                   /db_xref="InterPro:IPR023451"
FT                   /db_xref="MGI:MGI:98878"
FT                   /db_xref="UniProtKB/TrEMBL:Q544L2"
FT                   /protein_id="EDL37260.1"
FT                   /translation="MLVVGSELQSDAQQLSAEAPRHGELQYLRQVEHILRCGFKKEDRT
FT                   GTGTLSVFGMQARYSLRDEFPLLTTKRVFWKGVLEELLWFIKGSTNAKELSSKGVRIWD
FT                   ANGSRDFLDSLGFSARQEGDLGPVYGFQWRHFGAEYKDMDSDYSGQGVDQLQKVIDTIK
FT                   TNPDDRRIIMCAWNPKDLPLMALPPCHALCQFYVVNGELSCQLYQRSGDMGLGVPFNIA
FT                   SYALLTYMIAHITGLQPGDFVHTLGDAHIYLNHIEPLKIQLQREPRPFPKLKILRKVET
FT                   IDDFKVEDFQIEGYNPHPTIKMEMAV"
FT   assembly_gap    3914426..3914607
FT                   /estimated_length=182
FT                   /gap_type="unknown"
FT   gene            complement(3944738..3946393)
FT                   /pseudo
FT                   /locus_tag="mCG_11638"
FT                   /note="gene_id=mCG11638.2"
FT   mRNA            complement(3944738..3946393)
FT                   /pseudo
FT                   /locus_tag="mCG_11638"
FT                   /note="gene_id=mCG11638.2 transcript_id=mCT12253.2 created
FT                   on 01-OCT-2002"
FT   assembly_gap    3953516..3953794
FT                   /estimated_length=279
FT                   /gap_type="unknown"
FT   gene            3954035..3967818
FT                   /locus_tag="mCG_11643"
FT                   /note="gene_id=mCG11643.2"
FT   mRNA            join(3954035..3954225,3957074..3957214,3962120..3962250,
FT                   3962762..3963445,3963641..3963823,3964723..3964892,
FT                   3965097..3966103,3966653..3967818)
FT                   /locus_tag="mCG_11643"
FT                   /product="mCG11643"
FT                   /note="gene_id=mCG11643.2 transcript_id=mCT12258.2 created
FT                   on 02-OCT-2002"
FT   CDS             join(3954114..3954225,3957074..3957214,3962120..3962250,
FT                   3962762..3963445,3963641..3963823,3964723..3964892,
FT                   3965097..3966103,3966653..3966933)
FT                   /codon_start=1
FT                   /locus_tag="mCG_11643"
FT                   /product="mCG11643"
FT                   /note="gene_id=mCG11643.2 transcript_id=mCT12258.2
FT                   protein_id=mCP4028.2"
FT                   /protein_id="EDL37261.1"
FT                   /translation="MEKLAAGLAGLRWSMGAFPLDLIVSRCRLPTLACLGPGEYAEGVS
FT                   ERDILLIHSCRQWTTVTAHTLEEGHYVIGPKIDIPLQYPGKFKLLEQARDVREPVRYFS
FT                   SVEEVASVFPDRIFVMEAITFSVKVVSGEFSEDSEVYNFTLHAGDELTLMGQAEILCAK
FT                   TTKERSRFTTLLRKLGRAGALAGIGGPGSMGATGGGGGAARPVKSKMPCLICMNHRTNE
FT                   SLSLPFQCQGRFSTRSPLELQMQEGEHTVRAIIERVRLPVNVLVPSRPPRNPYDLHPVR
FT                   EGHCYKLVSIISKTVVLGLALRREGPAPLHFLLLTDTPRFTLPQGLLAGDPRVERLVRD
FT                   SASYCRERFDPDEYSTPAGGCAEIPYEELWVHQAPESRADARARPLAGPDLISFGIVGP
FT                   PRHEPEAPPPPVPPKSEAVKEECRLLHAPPVPPRGGGSCSKLTGSPPVLPHFPKLQPVH
FT                   SPSSSLSYYSSGLQDGAGSRSGSGSPSPDAYSLYCYPCTWGDCKASESSSRPPPGPLPS
FT                   TTTQPSQASRGLSEPLSGRTPSLLGADTPVVKNYHSCPPLFKSSRPQKSFAPFGALNPF
FT                   SGPAHPSGAPAASSSGSISTSGVLATSSPTHSPGPGPGPQGQGYSAAPSSSLSSSEWQE
FT                   PALEPLDPFELGQASPPELELVRCQEPRAAGAPGSGPCLSPLGQPKAFEPEGLVLRQVP
FT                   ASLSPAALQGPEAGGTLLFLTQGCLEGPPGSPREGATGAGVRDASSWQPPADLSALSLE
FT                   EVSRSLRFIGLSEDVVSFFARERIDGSIFVQLSEDILADDFHLTKLQVKKIMQFIKVDQ
FT                   LQAYVQHQSPCSDIITDSLLFSTEEPDVSQTPPAYQSPAISFGSNGLLVASLVCHWYRT
FT                   ASGSERLLAPELSHLFTWFRADLCTLQTQVW"
FT   assembly_gap    3962068..3962087
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(3968261..4003950)
FT                   /gene="Hadha"
FT                   /locus_tag="mCG_11632"
FT                   /note="gene_id=mCG11632.2"
FT   mRNA            complement(join(3968261..3968796,3968881..3969026,
FT                   3969524..3969638,3970174..3970369,3970986..3971054,
FT                   3971457..3971597,3972444..3972530,3975401..3975572,
FT                   3977636..3977770,3978657..3978766,3981079..3981135,
FT                   3982897..3983015,3983818..3983940,3989790..3989892,
FT                   3991560..3991679,3993000..3993138,3994076..3994209,
FT                   3996183..3996253,3996817..3996858,4003719..4003950))
FT                   /gene="Hadha"
FT                   /locus_tag="mCG_11632"
FT                   /product="hydroxyacyl-Coenzyme A
FT                   dehydrogenase/3-ketoacyl-Coenzyme A thiolase/enoyl-Coenzyme
FT                   A hydratase (trifunctional protein), alpha subunit,
FT                   transcript variant mCT12246"
FT                   /note="gene_id=mCG11632.2 transcript_id=mCT12246.2 created
FT                   on 02-OCT-2002"
FT   mRNA            complement(join(3968261..3968796,3968881..3969026,
FT                   3972492..3972530,3975401..3975420,3982948..3983015,
FT                   3983818..3983940,3989790..3989885,3991556..>3991591))
FT                   /gene="Hadha"
FT                   /locus_tag="mCG_11632"
FT                   /product="hydroxyacyl-Coenzyme A
FT                   dehydrogenase/3-ketoacyl-Coenzyme A thiolase/enoyl-Coenzyme
FT                   A hydratase (trifunctional protein), alpha subunit,
FT                   transcript variant mCT173994"
FT                   /note="gene_id=mCG11632.2 transcript_id=mCT173994.0 created
FT                   on 02-OCT-2002"
FT   CDS             complement(join(3968651..3968796,3968881..3969026,
FT                   3969524..3969638,3970174..3970369,3970986..3971054,
FT                   3971457..3971597,3972444..3972530,3975401..3975572,
FT                   3977636..3977770,3978657..3978766,3981079..3981135,
FT                   3982897..3983015,3983818..3983940,3989790..3989892,
FT                   3991560..3991679,3993000..3993138,3994076..3994209,
FT                   3996183..3996253,3996817..3996858,4003719..4003785))
FT                   /codon_start=1
FT                   /gene="Hadha"
FT                   /locus_tag="mCG_11632"
FT                   /product="hydroxyacyl-Coenzyme A
FT                   dehydrogenase/3-ketoacyl-Coenzyme A thiolase/enoyl-Coenzyme
FT                   A hydratase (trifunctional protein), alpha subunit, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG11632.2 transcript_id=mCT12246.2
FT                   protein_id=mCP3959.2 isoform=CRA_a"
FT                   /protein_id="EDL37262.1"
FT                   /translation="MVASRAIGSLSRFSAFRILRSRGCICRSFTTSSALLTRTHINYGV
FT                   KGDVAVIRINSPNSKVNTLNKEVQSEFIEVMNEIWANDQIRSAVLISSKPGCFVAGADI
FT                   NMLSSCTTPQEATRISQEGQRMFEKLEKSPKPVVAAISGSCLGGGLELAIACQYRIATK
FT                   DRKTVLGVPEVLLGILPGAGGTQRLPKMVGVPAAFDMMLTGRNIRADRAKKMGLVDQLV
FT                   EPLGPGIKSPEERTIEYLEEVAVNFAKGLADRKVSAKQSKGLVEKLTTYAMTVPFVRQQ
FT                   VYKTVEEKVKKQTKGLYPAPLKIIDAVKAGLEQGSDAGYLAESQKFGELALTKESKALM
FT                   GLYNGQVLCKKNKFGAPQKNVQQLAILGAGLMGAGIAQVSVDKGLKTLLKDTTVTGLGR
FT                   GQQQVFKGLNDKVKKKALTSFERDSIFSNLIGQLDYKGFEKADMVIEAVFEDLGVKHKV
FT                   LKEVESVTPEHCIFASNTSALPINQIAAVSKRPEKVIGMHYFSPVDKMQLLEIITTDKT
FT                   SKDTTASAVAVGLRQGKVIIVVKDGPGFYTTRCLAPMMSEVMRILQEGVDPKKLDALTT
FT                   GFGFPVGAATLADEVGVDVAQHVAEDLGKAFGERFGGGSVELLKQMVSKGFLGRKSGKG
FT                   FYIYQEGSKNKSLNSEMDNILANLRLPAKPEVSSDEDVQYRVITRFVNEAVLCLQEGIL
FT                   ATPAEGDIGAVFGLGFPPCLGGPFRFVDLYGAQKVVDRLRKYESAYGTQFTPCQLLLDH
FT                   ANNSSKKFYQ"
FT   CDS             complement(join(3975415..3975420,3982948..3983015,
FT                   3983818..3983940,3989790..3989885,3991556..>3991589))
FT                   /codon_start=1
FT                   /gene="Hadha"
FT                   /locus_tag="mCG_11632"
FT                   /product="hydroxyacyl-Coenzyme A
FT                   dehydrogenase/3-ketoacyl-Coenzyme A thiolase/enoyl-Coenzyme
FT                   A hydratase (trifunctional protein), alpha subunit, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG11632.2 transcript_id=mCT173994.0
FT                   protein_id=mCP96913.0 isoform=CRA_b"
FT                   /protein_id="EDL37263.1"
FT                   /translation="AGGTQRLPKMVMPAAFDMMLTGRNIRADRAKKMGLVDQLVEPLGP
FT                   GIKSPEERTIEYLEEVAVNFAKGLADRKVSAKQSKGLVEKLTTYAMTVPFVRQQVYKTV
FT                   EEKC"
FT   assembly_gap    3988509..3988528
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            4004060..4033426
FT                   /locus_tag="mCG_11629"
FT                   /note="gene_id=mCG11629.2"
FT   mRNA            join(4004060..4004223,4012506..4012580,4012863..4012907,
FT                   4015502..4015601,4017361..4017405,4018333..4018432,
FT                   4021463..4021550,4022647..4022834,4023628..4023808,
FT                   4025725..4025846,4027477..4027556,4027634..4027681,
FT                   4028389..4028476,4029152..4029226,4029758..4029922,
FT                   4032890..4033426)
FT                   /locus_tag="mCG_11629"
FT                   /product="mCG11629, transcript variant mCT12243"
FT                   /note="gene_id=mCG11629.2 transcript_id=mCT12243.2 created
FT                   on 13-FEB-2003"
FT   mRNA            join(<4004125..4004219,4012506..4012580,4012863..4012907,
FT                   4015502..4015601,4017361..4017405,4018333..4018432,
FT                   4021463..4021550,4022647..4022834,4023628..4023808,
FT                   4025725..4025846,4027477..4027556,4027634..4027681,
FT                   4028389..4028476,4029152..4029226,4029758..4029922,
FT                   4032890..4033327)
FT                   /locus_tag="mCG_11629"
FT                   /product="mCG11629, transcript variant mCT193632"
FT                   /note="gene_id=mCG11629.2 transcript_id=mCT193632.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(4004126..4004176,4012506..4012580,4012863..4012907,
FT                   4015502..4015601,4017361..4017405,4018333..4018432,
FT                   4021463..4021550,4022647..4022834,4023628..4023808,
FT                   4025725..4025846,4027477..4027556,4027634..4027681,
FT                   4028389..4028476,4029152..4029226,4029758..4029922,
FT                   4032890..4033421)
FT                   /locus_tag="mCG_11629"
FT                   /product="mCG11629, transcript variant mCT180104"
FT                   /note="gene_id=mCG11629.2 transcript_id=mCT180104.0 created
FT                   on 13-FEB-2003"
FT   CDS             join(<4004126..4004219,4012506..4012580,4012863..4012907,
FT                   4015502..4015601,4017361..4017405,4018333..4018432,
FT                   4021463..4021550,4022647..4022834,4023628..4023808,
FT                   4025725..4025846,4027477..4027556,4027634..4027681,
FT                   4028389..4028476,4029152..4029226,4029758..4029922,
FT                   4032890..4032925)
FT                   /codon_start=1
FT                   /locus_tag="mCG_11629"
FT                   /product="mCG11629, isoform CRA_d"
FT                   /note="gene_id=mCG11629.2 transcript_id=mCT193632.0
FT                   protein_id=mCP114558.0 isoform=CRA_d"
FT                   /protein_id="EDL37268.1"
FT                   /translation="VSLDLTLLAAAVFADSKVRQRASRFSSDFPTDFRMTTILTSTFRN
FT                   LSTTSKWALRSSIRPLSCSSQLHSAPAVQTKSKKTLAKPNMKNIVVVEGVRIPFLLSGT
FT                   SYKDLMPHDLARAALSGLLHRTNIPKDVVDYIIFGTVIQEVKTSNVAREAALGAGFSDK
FT                   TPAHTVTMACISSNQAMTTAVGLIASGQCDVVVAGGVELMSDVPIRHSRNMRKMMLDLN
FT                   KAKTLGQRLSLLSKFRLNFLSPELPAVAEFSTNETMGHSADRLAAAFAVSRMEQDEYAL
FT                   RSHSLAKKAQDEGHLSDIVPFKVPGKDTVTKDNGIRPSSLEQMAKLKPAFIKPYGTVTA
FT                   ANSSFLTDGASAMLIMSEDRALAMGYKPKAYLRDFIYVSQDPKDQLLLGPTYATPKVLE
FT                   KAGLTMNDIDAFEFHEAFSGQILANFKAMDSDWFAQNYMGRKTKVGSPPLEKFNIWGGS
FT                   LSLGHPFGATGCRLVMAAANRLRKDGGQYALVAACAAGGQGHAMIVEAYPK"
FT   mRNA            join(4004156..4004219,4012506..4012580,4012863..4012907,
FT                   4015502..4015601,4017361..4017405,4018333..4018366,
FT                   4029875..4029922,4032890..4033011)
FT                   /locus_tag="mCG_11629"
FT                   /product="mCG11629, transcript variant mCT180105"
FT                   /note="gene_id=mCG11629.2 transcript_id=mCT180105.0 created
FT                   on 13-FEB-2003"
FT   mRNA            join(<4012503..4012580,4012863..4012907,4015502..4015601,
FT                   4022690..4022834,4023626..>4023694)
FT                   /locus_tag="mCG_11629"
FT                   /product="mCG11629, transcript variant mCT173680"
FT                   /note="gene_id=mCG11629.2 transcript_id=mCT173680.0 created
FT                   on 13-FEB-2003"
FT   CDS             join(<4012505..4012580,4012863..4012907,4015502..4015601,
FT                   4022690..4022834,4023626..>4023694)
FT                   /codon_start=1
FT                   /locus_tag="mCG_11629"
FT                   /product="mCG11629, isoform CRA_e"
FT                   /note="gene_id=mCG11629.2 transcript_id=mCT173680.0
FT                   protein_id=mCP96599.0 isoform=CRA_e"
FT                   /protein_id="EDL37269.1"
FT                   /translation="DFRMTTILTSTFRNLSTTSKWALRSSIRPLSCSSQLHSAPAVQTK
FT                   SKKTLAKPNMKNIVVVEGVRIPFLLSGTSGGVELMSDVPIRHSRNMRKMMLDLNKAKTL
FT                   GQRLSLLSKFRLNFLSPESSLQWLSSPLMRPWATLQTDWLL"
FT   CDS             join(4012514..4012580,4012863..4012907,4015502..4015601,
FT                   4017361..4017405,4018333..4018432,4021463..4021550,
FT                   4022647..4022834,4023628..4023808,4025725..4025846,
FT                   4027477..4027556,4027634..4027681,4028389..4028476,
FT                   4029152..4029226,4029758..4029922,4032890..4032925)
FT                   /codon_start=1
FT                   /locus_tag="mCG_11629"
FT                   /product="mCG11629, isoform CRA_a"
FT                   /note="gene_id=mCG11629.2 transcript_id=mCT12243.2
FT                   protein_id=mCP3938.2 isoform=CRA_a"
FT                   /protein_id="EDL37264.1"
FT                   /translation="MTTILTSTFRNLSTTSKWALRSSIRPLSCSSQLHSAPAVQTKSKK
FT                   TLAKPNMKNIVVVEGVRIPFLLSGTSYKDLMPHDLARAALSGLLHRTNIPKDVVDYIIF
FT                   GTVIQEVKTSNVAREAALGAGFSDKTPAHTVTMACISSNQAMTTAVGLIASGQCDVVVA
FT                   GGVELMSDVPIRHSRNMRKMMLDLNKAKTLGQRLSLLSKFRLNFLSPELPAVAEFSTNE
FT                   TMGHSADRLAAAFAVSRMEQDEYALRSHSLAKKAQDEGHLSDIVPFKVPGKDTVTKDNG
FT                   IRPSSLEQMAKLKPAFIKPYGTVTAANSSFLTDGASAMLIMSEDRALAMGYKPKAYLRD
FT                   FIYVSQDPKDQLLLGPTYATPKVLEKAGLTMNDIDAFEFHEAFSGQILANFKAMDSDWF
FT                   AQNYMGRKTKVGSPPLEKFNIWGGSLSLGHPFGATGCRLVMAAANRLRKDGGQYALVAA
FT                   CAAGGQGHAMIVEAYPK"
FT   CDS             join(4012514..4012580,4012863..4012907,4015502..4015601,
FT                   4017361..4017405,4018333..4018432,4021463..4021550,
FT                   4022647..4022834,4023628..4023808,4025725..4025846,
FT                   4027477..4027556,4027634..4027681,4028389..4028476,
FT                   4029152..4029226,4029758..4029922,4032890..4032925)
FT                   /codon_start=1
FT                   /locus_tag="mCG_11629"
FT                   /product="mCG11629, isoform CRA_a"
FT                   /note="gene_id=mCG11629.2 transcript_id=mCT180104.0
FT                   protein_id=mCP103026.0 isoform=CRA_a"
FT                   /protein_id="EDL37266.1"
FT                   /translation="MTTILTSTFRNLSTTSKWALRSSIRPLSCSSQLHSAPAVQTKSKK
FT                   TLAKPNMKNIVVVEGVRIPFLLSGTSYKDLMPHDLARAALSGLLHRTNIPKDVVDYIIF
FT                   GTVIQEVKTSNVAREAALGAGFSDKTPAHTVTMACISSNQAMTTAVGLIASGQCDVVVA
FT                   GGVELMSDVPIRHSRNMRKMMLDLNKAKTLGQRLSLLSKFRLNFLSPELPAVAEFSTNE
FT                   TMGHSADRLAAAFAVSRMEQDEYALRSHSLAKKAQDEGHLSDIVPFKVPGKDTVTKDNG
FT                   IRPSSLEQMAKLKPAFIKPYGTVTAANSSFLTDGASAMLIMSEDRALAMGYKPKAYLRD
FT                   FIYVSQDPKDQLLLGPTYATPKVLEKAGLTMNDIDAFEFHEAFSGQILANFKAMDSDWF
FT                   AQNYMGRKTKVGSPPLEKFNIWGGSLSLGHPFGATGCRLVMAAANRLRKDGGQYALVAA
FT                   CAAGGQGHAMIVEAYPK"
FT   CDS             join(4012514..4012580,4012863..4012907,4015502..4015601,
FT                   4017361..4017405,4018333..4018366,4029875..4029922,
FT                   4032890..4032925)
FT                   /codon_start=1
FT                   /locus_tag="mCG_11629"
FT                   /product="mCG11629, isoform CRA_c"
FT                   /note="gene_id=mCG11629.2 transcript_id=mCT180105.0
FT                   protein_id=mCP103027.0 isoform=CRA_c"
FT                   /protein_id="EDL37267.1"
FT                   /translation="MTTILTSTFRNLSTTSKWALRSSIRPLSCSSQLHSAPAVQTKSKK
FT                   TLAKPNMKNIVVVEGVRIPFLLSGTSYKDLMPHDLARAALSGLLHRTNIPKDDGGQYAL
FT                   VAACAAGGQGHAMIVEAYPK"
FT   mRNA            join(<4025741..4025846,4027477..4027556,4027634..4027681,
FT                   4028389..4028476,4029152..4029192,4032890..4033426)
FT                   /locus_tag="mCG_11629"
FT                   /product="mCG11629, transcript variant mCT173679"
FT                   /note="gene_id=mCG11629.2 transcript_id=mCT173679.0 created
FT                   on 13-FEB-2003"
FT   CDS             join(<4025742..4025846,4027477..4027556,4027634..4027681,
FT                   4028389..4028476,4029152..4029192,4032890..4032902)
FT                   /codon_start=1
FT                   /locus_tag="mCG_11629"
FT                   /product="mCG11629, isoform CRA_b"
FT                   /note="gene_id=mCG11629.2 transcript_id=mCT173679.0
FT                   protein_id=mCP96598.0 isoform=CRA_b"
FT                   /protein_id="EDL37265.1"
FT                   /translation="KDNGIRPSSLEQMAKLKPAFIKPYGTVTAANSSFLTDGASAMLIM
FT                   SEDRALAMGYKPKAYLRDFIYVSQDPKDQLLLGPTYATPKVLEKAGLTMNDIDAFEFHE
FT                   AFSGQILANFKAMDSDWVML"
FT   gene            complement(4042272..4053484)
FT                   /gene="Gpr113"
FT                   /locus_tag="mCG_52323"
FT                   /note="gene_id=mCG52323.3"
FT   mRNA            complement(join(4042272..4042398,4043884..4043939,
FT                   4044338..4044400,4045080..4046456,4047204..4047383,
FT                   4047858..4048054,4048239..4048382,4049281..4049487,
FT                   4051080..4051298,4051798..4051974,4052328..4052468,
FT                   4053236..4053484))
FT                   /gene="Gpr113"
FT                   /locus_tag="mCG_52323"
FT                   /product="G protein-coupled receptor 113"
FT                   /note="gene_id=mCG52323.3 transcript_id=mCT52506.3 created
FT                   on 18-APR-2003"
FT   CDS             complement(join(4042374..4042398,4043884..4043939,
FT                   4044338..4044400,4045080..4046456,4047204..4047383,
FT                   4047858..4048054,4048239..4048382,4049281..4049487,
FT                   4051080..4051298,4051798..4051852))
FT                   /codon_start=1
FT                   /gene="Gpr113"
FT                   /locus_tag="mCG_52323"
FT                   /product="G protein-coupled receptor 113"
FT                   /note="gene_id=mCG52323.3 transcript_id=mCT52506.3
FT                   protein_id=mCP26973.3"
FT                   /protein_id="EDL37270.1"
FT                   /translation="MCRSFHGPVTGYCQLLPPVPANLILDSQLQMHGNTLNLILLKKEE
FT                   ATNLRWFLRHSKNHTPISLWPGTNVLQTSSEGQSGLRVARMSRHWAGEYESIFEAQGFR
FT                   WRLRQLVKVPLQEEEVVRLPDALSISCTASTGFQLSCCIPLTTDYTATWSPGEDSQASL
FT                   QKMSDSQCFVLAVPHCPATNTTYTCTLQSQNLPPLVAPVSITIIQDGDTTCPEDFSVVS
FT                   WNVTKAGFVAQAPCPVNKKGVVKRLCGTDGIWRPVQNTCTEAKILTLCLKAKLLLEGQG
FT                   KPYEEVPWILSELQEQVGVASTPSDLWEMLHTVTLLAKVVAETSTELTGSALKDLLTTT
FT                   DKILDANISALWTLAQAQEPSMGSDFLKAVETLVHSLRPQQHPFSFSSANVLLQSQLLR
FT                   HSSPPGYQMSFSTWPLLQARIPWHSLAPLVHSGTNVSITSLVLQKLDYRLPSNYTQGLW
FT                   NTPYTTPGLILVVSITADGQAFTQAEVIMDYEDMNGTLHCVFWDHRVFQGQGGWSDEGC
FT                   EVHAANASITQCICQHLTAFSILMSQHTVPENPTLDLLSQVGTGASVLALLVCLAIYGL
FT                   VWRVVVRNKVAFFRHTTLFNMVICLLVADTCFLGSPFLPSGYHSLICLVTAFLCHFFYL
FT                   ATFFWMLAQALVLAHQLLFVFHQLSKHVVLSLMVMLGYLCPLGFAGVTLGLYLPQRKYL
FT                   WEGKCFLNGGGVMLYSFSEPVLAIVGVNGLVLVIAVLKLLRPSLSEGPTVEKRQALVGV
FT                   LKALLILTPIFGLTWGLGVATLFDGSIVSHYAFSILNSLQVLEALRKRLRGSRSSNSAI
FT                   SMVTNETYTSEHSKERSEPASYEERMTD"
FT   assembly_gap    4052711..4052787
FT                   /estimated_length=77
FT                   /gap_type="unknown"
FT   assembly_gap    4056082..4056101
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4057632..4057941
FT                   /estimated_length=310
FT                   /gap_type="unknown"
FT   gene            complement(4070467..4070829)
FT                   /pseudo
FT                   /locus_tag="mCG_11636"
FT                   /note="gene_id=mCG11636.1"
FT   mRNA            complement(4070467..4070829)
FT                   /pseudo
FT                   /locus_tag="mCG_11636"
FT                   /note="gene_id=mCG11636.1 transcript_id=mCT12251.1 created
FT                   on 02-OCT-2002"
FT   assembly_gap    4076758..4077005
FT                   /estimated_length=248
FT                   /gap_type="unknown"
FT   gene            4082303..4122765
FT                   /gene="D5Wsu178e"
FT                   /locus_tag="mCG_11644"
FT                   /note="gene_id=mCG11644.2"
FT   mRNA            join(4082303..4082468,4097116..4097184,4102363..4102437,
FT                   4105731..4105993,4107365..4107408)
FT                   /gene="D5Wsu178e"
FT                   /locus_tag="mCG_11644"
FT                   /product="DNA segment, Chr 5, Wayne State University 178,
FT                   expressed, transcript variant mCT173681"
FT                   /note="gene_id=mCG11644.2 transcript_id=mCT173681.0 created
FT                   on 18-FEB-2003"
FT   mRNA            join(4082318..4082468,4097116..4097184,4098065..4098173,
FT                   4102363..4102437,4105731..4105993,4107365..4107473,
FT                   4113406..4113454,4114610..4114790,4115673..4115858,
FT                   4117236..4122765)
FT                   /gene="D5Wsu178e"
FT                   /locus_tag="mCG_11644"
FT                   /product="DNA segment, Chr 5, Wayne State University 178,
FT                   expressed, transcript variant mCT12259"
FT                   /note="gene_id=mCG11644.2 transcript_id=mCT12259.2 created
FT                   on 18-FEB-2003"
FT   mRNA            join(4082324..4082468,4097116..4097184,4098065..4098173,
FT                   4105731..4105993,4107365..4107414,4113406..4113454,
FT                   4114610..4114790,4115673..4115858,4117236..4119308)
FT                   /gene="D5Wsu178e"
FT                   /locus_tag="mCG_11644"
FT                   /product="DNA segment, Chr 5, Wayne State University 178,
FT                   expressed, transcript variant mCT180247"
FT                   /note="gene_id=mCG11644.2 transcript_id=mCT180247.0 created
FT                   on 18-FEB-2003"
FT   CDS             join(4082412..4082468,4097116..4097184,4098065..4098173,
FT                   4102363..4102437,4105731..4105993,4107365..4107473,
FT                   4113406..4113454,4114610..4114790,4115673..4115858,
FT                   4117236..4117301)
FT                   /codon_start=1
FT                   /gene="D5Wsu178e"
FT                   /locus_tag="mCG_11644"
FT                   /product="DNA segment, Chr 5, Wayne State University 178,
FT                   expressed, isoform CRA_a"
FT                   /note="gene_id=mCG11644.2 transcript_id=mCT12259.2
FT                   protein_id=mCP3893.2 isoform=CRA_a"
FT                   /protein_id="EDL37271.1"
FT                   /translation="MAGYEYVSPEQLSGFDKYKYSALDTNPLSLYIMHPFWNTIVKVFP
FT                   TWLAPNLITFSGFMLLVFNFLLLTYFDPDFYASAPGHKHVPDWVWIVVGILNFAAYTLD
FT                   GVDGKQARRTNSSTPLGELFDHGLDSWSCVYFVVTVYSIFGRGPTGVSVFVLYLLLWVV
FT                   LFSFILSHWEKYNTGVLFLPWGYDISQVTISFVYIVTAVVGVEAWYEPFLFNFLYRDLF
FT                   TAMIIGCALCVTLPMSLLNFFRSYKSNTLKHKSVYEAMVPFFSPCLLFTLCTVWILWSP
FT                   SDILEIHPRIFYFMVGTAFANITCQLIVCQMSSTRCPTLNWLLLPLLLVVAAVIVGAAT
FT                   SRLESALLYTLTAAFTLAHIHYGVQVVKQLSRHFQIYPFSLRKPNSD"
FT   CDS             join(4082412..4082468,4097116..4097184,4098065..4098173,
FT                   4105731..4105993,4107365..4107414,4113406..4113454)
FT                   /codon_start=1
FT                   /gene="D5Wsu178e"
FT                   /locus_tag="mCG_11644"
FT                   /product="DNA segment, Chr 5, Wayne State University 178,
FT                   expressed, isoform CRA_c"
FT                   /note="gene_id=mCG11644.2 transcript_id=mCT180247.0
FT                   protein_id=mCP103169.0 isoform=CRA_c"
FT                   /db_xref="GOA:Q8CET7"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR014472"
FT                   /db_xref="MGI:MGI:107898"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CET7"
FT                   /protein_id="EDL37273.1"
FT                   /translation="MAGYEYVSPEQLSGFDKYKYSALDTNPLSLYIMHPFWNTIVKVFP
FT                   TWLAPNLITFSGFMLLVFNFLLLTYFDPDFYASDGVDGKQARRTNSSTPLGELFDHGLD
FT                   SWSCVYFVVTVYSIFGRGPTGVSVFVLYLLLWVVLFSFILSHWEKYNTGVLFLPWGYDI
FT                   SQVTISFVYIVTAVVGVEAWVCIMCDSSNEFIKLF"
FT   CDS             join(4082412..4082468,4097116..4097184,4102363..4102437)
FT                   /codon_start=1
FT                   /gene="D5Wsu178e"
FT                   /locus_tag="mCG_11644"
FT                   /product="DNA segment, Chr 5, Wayne State University 178,
FT                   expressed, isoform CRA_b"
FT                   /note="gene_id=mCG11644.2 transcript_id=mCT173681.0
FT                   protein_id=mCP96600.0 isoform=CRA_b"
FT                   /db_xref="InterPro:IPR014472"
FT                   /db_xref="MGI:MGI:107898"
FT                   /db_xref="UniProtKB/TrEMBL:D6RE20"
FT                   /protein_id="EDL37272.1"
FT                   /translation="MAGYEYVSPEQLSGFDKYKYSALDTNPLSLYIMHPFWNTIVKPLV
FT                   ISMCLTGFGLSWASSTLLPTL"
FT   assembly_gap    4112042..4112061
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4131169..4131343
FT                   /estimated_length=175
FT                   /gap_type="unknown"
FT   gene            4131784..4174051
FT                   /locus_tag="mCG_11631"
FT                   /note="gene_id=mCG11631.1"
FT   mRNA            join(4131784..4131997,4149581..4149724,4152511..4152637,
FT                   4154186..4154323,4155793..4155879,4157531..4157653,
FT                   4162328..4162467,4162801..4162935,4163713..4163846,
FT                   4165812..4165924,4166917..4167006,4167350..4167436,
FT                   4170343..4170624,4171266..4171438,4171728..4171830,
FT                   4173838..4174051)
FT                   /locus_tag="mCG_11631"
FT                   /product="mCG11631"
FT                   /note="gene_id=mCG11631.1 transcript_id=mCT12245.1 created
FT                   on 02-OCT-2002"
FT   CDS             join(4131843..4131997,4149581..4149724,4152511..4152637,
FT                   4154186..4154323,4155793..4155879,4157531..4157653,
FT                   4162328..4162467,4162801..4162935,4163713..4163846,
FT                   4165812..4165924,4166917..4167006,4167350..4167436,
FT                   4170343..4170624,4171266..4171438,4171728..4171830,
FT                   4173838..4173894)
FT                   /codon_start=1
FT                   /locus_tag="mCG_11631"
FT                   /product="mCG11631"
FT                   /note="gene_id=mCG11631.1 transcript_id=mCT12245.1
FT                   protein_id=mCP3962.2"
FT                   /protein_id="EDL37274.1"
FT                   /translation="MNPSGTIGVLEQNGEEHLATPILGPSVHSDNPQERIQARRLRIAA
FT                   RQEARRRFTACRLSVFQKLTKLLLCGTELVTNIQVAADVREIHRRVEEEETKRQRLEKL
FT                   ENEVKTSQDKFDEITAKWEEGRRKRIPQELWEMLNSQQELKIKDDQYVKDLKKQSEDIT
FT                   LILERMEEQVKNVMKNFRQELIHIEKAFESERQELLSSNKKKWERALQAHNAKELEYLT
FT                   NRMKKVEDYEKQLNKQRVWDCEEYNTIKIKLEQDVQILEQQLQQMKATYQLNQEKLEYN
FT                   FQVLKKRDEESTVIKSQQKRKLNRLHDVVNNLRTKYTKQIRQFQDDNQSLTSDYKRLVT
FT                   QFKDLQKALRIIHSQHLGLPWNMPDLWFLNNVGPISLQQQKSVTQILEELLLQTEDEAT
FT                   EAAMSEDEDYMDLPNQISAKTTTKVLMLLCDESGFLIESKLLSLLHPLEKSECYLLRLD
FT                   AIFSALAIEDEDDLYKLVNFFLRYRAHRLSSAQASSSIHSNVERTSLMSALERLSLMSQ
FT                   TDKGSMVSKSDQEPTEQEDEQEGDNASLSSRELEEQEDLSSPRFIHPNDVLKILEAFVT
FT                   GLKKPKYAGVETGTTLTSRDAQPVLKLKKETRDNSKDTEYWESLAAVIPFFKQNLWDAL
FT                   YKALEKYYLVLTERAKLLMENESLEQQNAEMQSLLQQYLQAKVNTELQIPPTQGFRMPS
FT                   K"
FT   assembly_gap    4140170..4146608
FT                   /estimated_length=6439
FT                   /gap_type="unknown"
FT   assembly_gap    4148444..4148677
FT                   /estimated_length=234
FT                   /gap_type="unknown"
FT   assembly_gap    4151877..4151973
FT                   /estimated_length=97
FT                   /gap_type="unknown"
FT   assembly_gap    4153354..4153460
FT                   /estimated_length=107
FT                   /gap_type="unknown"
FT   assembly_gap    4161387..4162048
FT                   /estimated_length=662
FT                   /gap_type="unknown"
FT   assembly_gap    4163357..4163705
FT                   /estimated_length=349
FT                   /gap_type="unknown"
FT   gene            complement(4174414..4271383)
FT                   /gene="Otof"
FT                   /locus_tag="mCG_11635"
FT                   /note="gene_id=mCG11635.1"
FT   mRNA            complement(join(4174414..4175108,4177623..4177825,
FT                   4178247..4178347,4178448..4178626,4179077..4179318,
FT                   4179440..4179538,4181171..4181259,4181555..4181697,
FT                   4182422..4182582,4183179..4183349,4183452..4183579,
FT                   4183855..4183992,4184191..4184325,4184422..4184558,
FT                   4186573..4186639,4187024..4187155,4187445..4187474,
FT                   4188069..4188199,4188490..4188652,4188778..4188939,
FT                   4189434..4189553,4189705..4189866,4190311..4190445,
FT                   4190769..4190893,4190997..4191186,4191487..4191639,
FT                   4191901..4192017,4192137..4192227,4192329..4192429,
FT                   4192867..4192987,4193079..4193259,4193720..4193828,
FT                   4194240..4194463,4196200..4196406,4196602..4196768,
FT                   4197735..4197894,4202086..4202170,4202607..4202669,
FT                   4207162..4207293,4214518..4214572,4215086..4215212,
FT                   4216534..4216607,4228696..4228874,4230271..4230370,
FT                   4236866..4236954,4250668..4250726,4271201..4271383))
FT                   /gene="Otof"
FT                   /locus_tag="mCG_11635"
FT                   /product="otoferlin, transcript variant mCT12250"
FT                   /note="gene_id=mCG11635.1 transcript_id=mCT12250.1 created
FT                   on 16-SEP-2002"
FT   mRNA            complement(join(4174414..4175108,4178247..4178347,
FT                   4178448..4178626,4179077..4179318,4179440..4179538,
FT                   4181171..4181259,4181555..4181697,4182422..4182582,
FT                   4183179..4183349,4183452..4183579,4183855..4183992,
FT                   4184191..4184325,4184422..4184558,4186573..4186639,
FT                   4187024..4187155,4187445..4187474,4188069..4188139,
FT                   4188490..4188652,4188778..4188939,4189434..4189553,
FT                   4189705..4189866,4190311..4190445,4190769..4190893,
FT                   4190997..4191186,4191487..4191639,4191901..4192017,
FT                   4192137..4192227,4192329..4192429,4192867..4192987,
FT                   4193079..4193259,4193720..4193828,4194240..4194463,
FT                   4196200..4196406,4196602..4196768,4197735..4197894,
FT                   4202086..4202170,4202607..4202669,4207162..4207293,
FT                   4214518..4214572,4215086..4215212,4216534..4216607,
FT                   4223842..4223886,4228696..4228874,4230271..4230370,
FT                   4236866..4236954,4250668..4250726,4271201..4271383))
FT                   /gene="Otof"
FT                   /locus_tag="mCG_11635"
FT                   /product="otoferlin, transcript variant mCT173395"
FT                   /note="gene_id=mCG11635.1 transcript_id=mCT173395.0 created
FT                   on 16-SEP-2002"
FT   CDS             complement(join(4174607..4175108,4178247..4178347,
FT                   4178448..4178626,4179077..4179318,4179440..4179538,
FT                   4181171..4181259,4181555..4181697,4182422..4182582,
FT                   4183179..4183349,4183452..4183579,4183855..4183992,
FT                   4184191..4184325,4184422..4184558,4186573..4186639,
FT                   4187024..4187155,4187445..4187474,4188069..4188139,
FT                   4188490..4188652,4188778..4188939,4189434..4189553,
FT                   4189705..4189866,4190311..4190445,4190769..4190893,
FT                   4190997..4191186,4191487..4191639,4191901..4192017,
FT                   4192137..4192227,4192329..4192429,4192867..4192987,
FT                   4193079..4193259,4193720..4193828,4194240..4194463,
FT                   4196200..4196406,4196602..4196768,4197735..4197894,
FT                   4202086..4202170,4202607..4202669,4207162..4207293,
FT                   4214518..4214572,4215086..4215212,4216534..4216607,
FT                   4223842..4223886,4228696..4228874,4230271..4230370,
FT                   4236866..4236954,4250668..4250726,4271201..4271279))
FT                   /codon_start=1
FT                   /gene="Otof"
FT                   /locus_tag="mCG_11635"
FT                   /product="otoferlin, isoform CRA_a"
FT                   /note="gene_id=mCG11635.1 transcript_id=mCT173395.0
FT                   protein_id=mCP96314.0 isoform=CRA_a"
FT                   /protein_id="EDL37275.1"
FT                   /translation="MALIVHLKTVSELRGKGDRIAKVTFRGQSFYSRVLENCEGVADFD
FT                   ETFRWPVASSIDRNEVLEIQIFNYSKVFSNKLIGTFCMVLQKVVEENRVEVTDTLMDDS
FT                   NAIIKTSLSMEVRYQATDGTVGPWDDGDFLGDESLQEEKDSQETDGLLPGSRPSTRISG
FT                   EKSFRSKGREKTKGGRDGEHKAGRSVFSAMKLGKTRSHKEEPQRQDEPAVLEMEDLDHL
FT                   AIQLGDGLDPDSVSLASVTALTSNVSNKRSKPDIKMEPSAGRPMDYQVSITVIEARQLV
FT                   GLNMDPVVCVEVGDDKKYTSMKESTNCPYYNEYFVFDFHVSPDVMFDKIIKISVIHSKN
FT                   LLRSGTLVGSFKMDVGTVYSQPEHQFHHKWAILSDPDDISAGLKGYVKCDVAVVGKGDN
FT                   IKTPHKANETDEDDIEGNLLLPEGVPPERQWARFYVKIYRAEGLPRMNTSLMANVKKAF
FT                   IGENKPLVDPYVQVWLFSHQGKTSVQKSSYEPLWNEQVVFTDLFPPLCKRMKVQIRDSD
FT                   KVNDVAIGTHFIDLRKISNDGDKGFLPTLGPAWVNMYGSTRNYTLLDEHQDLNEGLGEG
FT                   VSFRARLMLGLAVEILDTSNPELTSSTEVQVEQATPVSESCTGRMEEFFLFGAFLEASM
FT                   IDRKNGDKPITFEVTIGNYGNEVDGMSRPLRPRPRKEPGDEEEVDLIQNSSDDEGDEAG
FT                   DLASVSSTPPMRPQITDRNYFHLPYLERKPCIYIKSWWPDQRRRLYNANIMDHIADKLE
FT                   EGLNDVQEMIKTEKSYPERRLRGVLEELSCGCHRFLSLSDKDQGRSSRTRLDRERLKSC
FT                   MRELESMGQQAKSLRAQVKRHTVRDKLRSCQNFLQKLRFLADEPQHSIPDVFIWMMSNN
FT                   KRIAYARVPSKDLLFSIVEEELGKDCAKVKTLFLKLPGKRGFGSAGWTVQAKLELYLWL
FT                   GLSKQRKDFLCGLPCGFEEVKAAQGLGLHSFPPISLVYTKKQAFQLRAHMYQARSLFAA
FT                   DSSGLSDPFARVFFINQSQCTEVLNETLCPTWDQMLVFDNLELYGEAHELRDDPPIIVI
FT                   EIYDQDSMGKADFMGRTFAKPLVKMADEAYCPPRFPPQLEYYQIYRGSATAGDLLAAFE
FT                   LLQIGPSGKADLPPINGPVDMDRGPIMPVPVGIRPVLSKYRVEVLFWGLRDLKRVNLAQ
FT                   VDRPRVDIECAGKGVQSSLIHNYKKNPNFNTLVKWFEVDLPENELLHPPLNIRVVDCRA
FT                   FGRYTLVGSHAVSSLRRFIYRPPDRSAPNWNTTGEVVVSMEPEEPVKKLETMVKLDATS
FT                   DAVVKVDVAEDEKERKKKKKKGPSEEPEEEEPDESMLDWWSKYFASIDTMKEQLRQHET
FT                   SGTDLEEKEEMESAEGLKGPMKSKEKSRAAKEEKKKKNQSPGPGQGSEAPEKKKAKIDE
FT                   LKVYPKELESEFDSFEDWLHTFNLLRGKTGDDEDGSTEEERIVGRFKGSLCVYKVPLPE
FT                   DVSREAGYDPTYGMFQGIPSNDPINVLVRIYVVRATDLHPADINGKADPYIAIKLGKTD
FT                   IRDKENYISKQLNPVFGKSFDIEASFPMESMLTVAVYDWDLVGTDDLIGETKIDLENRF
FT                   YSKHRATCGIAQTYSIHGYNIWRDPMKPSQILTRLCKEGKVDGPHFGPHGRVRVANRVF
FT                   TGPSEIEDENGQRKPTDEHVALSALRHWEDIPRVGCRLVPEHVETRPLLNPDKPGIEQG
FT                   RLELWVDMFPMDMPAPGTPLDISPRKPKKYELRVIVWNTDEVVLEDDDFFTGEKSSDIF
FT                   VRGWLKGQQEDKQDTDVHYHSLTGEGNFNWRYLFPFDYLAAEEKIVMSKKESMFSWDET
FT                   EYKIPARLTLQIWDADHFSADDFLGAIELDLNRFPRGAKTAKQCTMEMATGEVDVPLVS
FT                   IFKQKRVKGWWPLLARNENDEFELTGKVEAELHLLTAEEAEKNPVGLARNEPDPLEKPN
FT                   PPTPASLEQDTCLLDFIPTPHPNCCLPDLVPGLPGVWGTVGLQNQIPSCLKYQVPLPNP
FT                   KSGSGPTLPVLSKSCLKAPVKLTKKRGAMPKALMSRNTWKAPGMPAEARRHTSLQSIQA
FT                   ERRAAASCFCACSPLGSASFSQSQSLHSLALGFPSLPGVPLPWPVCVS"
FT   assembly_gap    4175109..4176062
FT                   /estimated_length=954
FT                   /gap_type="unknown"
FT   CDS             complement(join(4177645..4177825,4178247..4178347,
FT                   4178448..4178626,4179077..4179318,4179440..4179538,
FT                   4181171..4181259,4181555..4181697,4182422..4182582,
FT                   4183179..4183349,4183452..4183579,4183855..4183992,
FT                   4184191..4184325,4184422..4184558,4186573..4186639,
FT                   4187024..4187155,4187445..4187474,4188069..4188199,
FT                   4188490..4188652,4188778..4188939,4189434..4189553,
FT                   4189705..4189866,4190311..4190445,4190769..4190893,
FT                   4190997..4191186,4191487..4191639,4191901..4192017,
FT                   4192137..4192227,4192329..4192429,4192867..4192987,
FT                   4193079..4193259,4193720..4193828,4194240..4194463,
FT                   4196200..4196406,4196602..4196768,4197735..4197894,
FT                   4202086..4202170,4202607..4202669,4207162..4207293,
FT                   4214518..4214572,4215086..4215212,4216534..4216607,
FT                   4228696..4228874,4230271..4230370,4236866..4236954,
FT                   4250668..4250726,4271201..4271279))
FT                   /codon_start=1
FT                   /gene="Otof"
FT                   /locus_tag="mCG_11635"
FT                   /product="otoferlin, isoform CRA_b"
FT                   /note="gene_id=mCG11635.1 transcript_id=mCT12250.1
FT                   protein_id=mCP3992.2 isoform=CRA_b"
FT                   /protein_id="EDL37276.1"
FT                   /translation="MALIVHLKTVSELRGKGDRIAKVTFRGQSFYSRVLENCEGVADFD
FT                   ETFRWPVASSIDRNEVLEIQIFNYSKVFSNKLIGTFCMVLQKVVEENRVEVTDTLMDDS
FT                   NAIIKTSLSMEVRYQATDGTVGPWDDGDFLGDESLQEEKDSQETDGLLPGSRPSTRISG
FT                   EKSFRRAGRSVFSAMKLGKTRSHKEEPQRQDEPAVLEMEDLDHLAIQLGDGLDPDSVSL
FT                   ASVTALTSNVSNKRSKPDIKMEPSAGRPMDYQVSITVIEARQLVGLNMDPVVCVEVGDD
FT                   KKYTSMKESTNCPYYNEYFVFDFHVSPDVMFDKIIKISVIHSKNLLRSGTLVGSFKMDV
FT                   GTVYSQPEHQFHHKWAILSDPDDISAGLKGYVKCDVAVVGKGDNIKTPHKANETDEDDI
FT                   EGNLLLPEGVPPERQWARFYVKIYRAEGLPRMNTSLMANVKKAFIGENKPLVDPYVQVW
FT                   LFSHQGKTSVQKSSYEPLWNEQVVFTDLFPPLCKRMKVQIRDSDKVNDVAIGTHFIDLR
FT                   KISNDGDKGFLPTLGPAWVNMYGSTRNYTLLDEHQDLNEGLGEGVSFRARLMLGLAVEI
FT                   LDTSNPELTSSTEVQVEQATPVSESCTGRMEEFFLFGAFLEASMIDRKNGDKPITFEVT
FT                   IGNYGNEVDGMSRPLRPRPRKEPGDEEEVDLIQNSSDDEGDEAGDLASVSSTPPMRPQI
FT                   TDRNYFHLPYLERKPCIYIKSWWPDQRRRLYNANIMDHIADKLEEGLNDVQEMIKTEKS
FT                   YPERRLRGVLEELSCGCHRFLSLSDKDQGRSSRTRLDRERLKSCMRELESMGQQAKSLR
FT                   AQVKRHTVRDKLRSCQNFLQKLRFLADEPQHSIPDVFIWMMSNNKRIAYARVPSKDLLF
FT                   SIVEEELGKDCAKVKTLFLKLPGKRGFGSAGWTVQAKLELYLWLGLSKQRKDFLCGLPC
FT                   GFEEVKAAQGLGLHSFPPISLVYTKKQAFQLRAHMYQARSLFAADSSGLSDPFARVFFI
FT                   NQSQCTEVLNETLCPTWDQMLVFDNLELYGEAHELRDDPPIIVIEIYDQDSMGKADFMG
FT                   RTFAKPLVKMADEAYCPPRFPPQLEYYQIYRGSATAGDLLAAFELLQIGPSGKADLPPI
FT                   NGPVDMDRGPIMPVPVGIRPVLSKYRVEVLFWGLRDLKRVNLAQVDRPRVDIECAGKGV
FT                   QSSLIHNYKKNPNFNTLVKWFEVDLPENELLHPPLNIRVVDCRAFGRYTLVGSHAVSSL
FT                   RRFIYRPPDRSAPNWNTTVRLLRGCHRLRNGGPSSRPTGEVVVSMEPEEPVKKLETMVK
FT                   LDATSDAVVKVDVAEDEKERKKKKKKGPSEEPEEEEPDESMLDWWSKYFASIDTMKEQL
FT                   RQHETSGTDLEEKEEMESAEGLKGPMKSKEKSRAAKEEKKKKNQSPGPGQGSEAPEKKK
FT                   AKIDELKVYPKELESEFDSFEDWLHTFNLLRGKTGDDEDGSTEEERIVGRFKGSLCVYK
FT                   VPLPEDVSREAGYDPTYGMFQGIPSNDPINVLVRIYVVRATDLHPADINGKADPYIAIK
FT                   LGKTDIRDKENYISKQLNPVFGKSFDIEASFPMESMLTVAVYDWDLVGTDDLIGETKID
FT                   LENRFYSKHRATCGIAQTYSIHGYNIWRDPMKPSQILTRLCKEGKVDGPHFGPHGRVRV
FT                   ANRVFTGPSEIEDENGQRKPTDEHVALSALRHWEDIPRVGCRLVPEHVETRPLLNPDKP
FT                   GIEQGRLELWVDMFPMDMPAPGTPLDISPRKPKKYELRVIVWNTDEVVLEDDDFFTGEK
FT                   SSDIFVRGWLKGQQEDKQDTDVHYHSLTGEGNFNWRYLFPFDYLAAEEKIVMSKKESMF
FT                   SWDETEYKIPARLTLQIWDADHFSADDFLGAIELDLNRFPRGAKTAKQCTMEMATGEVD
FT                   VPLVSIFKQKRVKGWWPLLARNENDEFELTGKVEAELHLLTAEEAEKNPVGLARNEPDP
FT                   LEKPNRPDTSFIWFLNPLKSARYFLWHTYRWLLLKFLLLFLLLLLFALFLYSLPGYLAK
FT                   KILGA"
FT   assembly_gap    4180662..4180863
FT                   /estimated_length=202
FT                   /gap_type="unknown"
FT   assembly_gap    4185418..4185782
FT                   /estimated_length=365
FT                   /gap_type="unknown"
FT   assembly_gap    4187493..4187579
FT                   /estimated_length=87
FT                   /gap_type="unknown"
FT   assembly_gap    4196467..4196601
FT                   /estimated_length=135
FT                   /gap_type="unknown"
FT   assembly_gap    4210570..4210589
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4211816..4211835
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4226553..4226678
FT                   /estimated_length=126
FT                   /gap_type="unknown"
FT   assembly_gap    4231774..4231874
FT                   /estimated_length=101
FT                   /gap_type="unknown"
FT   assembly_gap    4256180..4256199
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            4275525..4293569
FT                   /gene="1700001C02Rik"
FT                   /locus_tag="mCG_11646"
FT                   /note="gene_id=mCG11646.1"
FT   mRNA            join(4275525..4275666,4289867..4290137,4291558..4291670,
FT                   4293350..4293569)
FT                   /gene="1700001C02Rik"
FT                   /locus_tag="mCG_11646"
FT                   /product="RIKEN cDNA 1700001C02"
FT                   /note="gene_id=mCG11646.1 transcript_id=mCT12261.1 created
FT                   on 24-SEP-2002"
FT   CDS             join(4275593..4275666,4289867..4290137,4291558..4291670,
FT                   4293350..4293494)
FT                   /codon_start=1
FT                   /gene="1700001C02Rik"
FT                   /locus_tag="mCG_11646"
FT                   /product="RIKEN cDNA 1700001C02"
FT                   /note="gene_id=mCG11646.1 transcript_id=mCT12261.1
FT                   protein_id=mCP3911.1"
FT                   /protein_id="EDL37277.1"
FT                   /translation="MAFRSAGTLMTEFNAAFVPPALMPGYKGHVPGVASSFGSSYGNTT
FT                   FKYFQDLRNTGLEKSYALLSGGCFPTIFSPNSPLVLTDNSQNWDRWLHQPTYSRSNQDN
FT                   GRTTELTNFYKTVQQQRKYYQDKTGILSRVPYFVLPVKEPDRYPLPTDLPPLSEKSKWN
FT                   LLRLSPDYKRTYQTFPSGKRVSSQERQRRDLYFEFRA"
FT   gene            complement(4295066..>4355652)
FT                   /locus_tag="mCG_11642"
FT                   /note="gene_id=mCG11642.1"
FT   mRNA            complement(join(4295066..4295250,4296928..4297016,
FT                   4297967..4298076,4307487..4307628,4344022..4344118,
FT                   4354482..4354516,4355542..>4355652))
FT                   /locus_tag="mCG_11642"
FT                   /product="mCG11642"
FT                   /note="gene_id=mCG11642.1 transcript_id=mCT12257.2 created
FT                   on 25-SEP-2002"
FT   CDS             complement(join(4295220..4295250,4296928..4297016,
FT                   4297967..4298076,4307487..4307628,4344022..4344118,
FT                   4354482..4354516,4355542..>4355643))
FT                   /codon_start=1
FT                   /locus_tag="mCG_11642"
FT                   /product="mCG11642"
FT                   /note="gene_id=mCG11642.1 transcript_id=mCT12257.2
FT                   protein_id=mCP3891.1"
FT                   /protein_id="EDL37278.1"
FT                   /translation="ALGAEVLLLAGGGWFSMGQCLRYQMQWEDLEEYQALTFLTRNEIL
FT                   CIHDTFLKLCPSGKHYKEATLTMDQVSSLPALRVNPFRDRICRVFSHDNVFSFEDVLGM
FT                   ASVFSEQACPSLKIEYAFRIYDFNENGFIDEEDLEEIVLRLLKSDDASEDLLMDVMHHV
FT                   LSESDLDNDSMLSFSEFEHAMAKSPDFMNSFRIHFWGC"
FT   assembly_gap    4305258..4305458
FT                   /estimated_length=201
FT                   /gap_type="unknown"
FT   gene            4338957..4353646
FT                   /locus_tag="mCG_148294"
FT                   /note="gene_id=mCG148294.0"
FT   mRNA            join(4338957..4339186,4350746..4353646)
FT                   /locus_tag="mCG_148294"
FT                   /product="mCG148294"
FT                   /note="gene_id=mCG148294.0 transcript_id=mCT188557.0
FT                   created on 13-JAN-2004"
FT   assembly_gap    4340513..4341817
FT                   /estimated_length=1305
FT                   /gap_type="unknown"
FT   assembly_gap    4348749..4348768
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             4351273..4351515
FT                   /codon_start=1
FT                   /locus_tag="mCG_148294"
FT                   /product="mCG148294"
FT                   /note="gene_id=mCG148294.0 transcript_id=mCT188557.0
FT                   protein_id=mCP109208.0"
FT                   /protein_id="EDL37279.1"
FT                   /translation="MSSLGMVSNTPYLTYSTSPWSQRSLLAGATQSEVWLLVLRNGAIS
FT                   QGGSERASREACETGLISCTAFPSHIWTTEVAPFP"
FT   gene            complement(4387101..>4398132)
FT                   /locus_tag="mCG_146317"
FT                   /note="gene_id=mCG146317.0"
FT   mRNA            complement(join(4387101..4388198,4389266..4389368,
FT                   4392499..4392575,4398027..>4398132))
FT                   /locus_tag="mCG_146317"
FT                   /product="mCG146317"
FT                   /note="gene_id=mCG146317.0 transcript_id=mCT186420.0
FT                   created on 14-JUL-2003"
FT   CDS             complement(4387460..>4387888)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146317"
FT                   /product="mCG146317"
FT                   /note="gene_id=mCG146317.0 transcript_id=mCT186420.0
FT                   protein_id=mCP107483.0"
FT                   /protein_id="EDL37280.1"
FT                   /translation="TEGTGQVQESASAFPMAGQMLSFRWKTGPRCEQGLVTIAHTGAQG
FT                   QNHQGTALDPLKVEMRKGGRAILAQSSGTQPRQGLRRSPCLCGAKGYCWGFELVPEEER
FT                   LSRGPQRPEGDGTILPIWTRVATGRGPRWGWDIQAMST"
FT   assembly_gap    4389851..4389870
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4397520..4397539
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            4397742..4433229
FT                   /gene="Kcnk3"
FT                   /locus_tag="mCG_23503"
FT                   /note="gene_id=mCG23503.2"
FT   mRNA            join(4397742..4398255,4431636..4433229)
FT                   /gene="Kcnk3"
FT                   /locus_tag="mCG_23503"
FT                   /product="potassium channel, subfamily K, member 3"
FT                   /note="gene_id=mCG23503.2 transcript_id=mCT23412.2 created
FT                   on 02-OCT-2002"
FT   CDS             join(4397973..4398255,4431636..4432582)
FT                   /codon_start=1
FT                   /gene="Kcnk3"
FT                   /locus_tag="mCG_23503"
FT                   /product="potassium channel, subfamily K, member 3"
FT                   /note="gene_id=mCG23503.2 transcript_id=mCT23412.2
FT                   protein_id=mCP3968.2"
FT                   /protein_id="EDL37281.1"
FT                   /translation="MKRQNVRTLALIVCTFTYLLVGAAVFDALESEPEMIERQRLELRQ
FT                   LELRARYNLSEGGYEELERVVLRLKPHKAGVQWRFAGSFYFAITVITTIGYGHAAPSTD
FT                   GGKVFCMFYALLGIPLTLVMFQSLGERINTFVRYLLHRAKRGLGMRHAEVSMANMVLIG
FT                   FVSCISTLCIGAAAFSYYERWTFFQAYYYCFITLTTIGFGDYVALQKDQALQTQPQYVA
FT                   FSFVYILTGLTVIGAFLNLVVLRFMTMNAEDEKRDAEHRALLTHNGQAVGLGGLSCLSG
FT                   SLGDGVRPRDPVTCAAAAGGVGVGVGGSGFRNVYAEVLHFQSMCSCLWYKSREKLQYSI
FT                   PMIIPRDLSTSDTCVEHSHSSPGGGGRYSDTPSHPCLCSGTQRSAISSVSTGLHSLAAF
FT                   RGLMKRRSSV"
FT   assembly_gap    4410619..4410723
FT                   /estimated_length=105
FT                   /gap_type="unknown"
FT   assembly_gap    4426268..4426287
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4441769..4441788
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4452939..4453034
FT                   /estimated_length=96
FT                   /gap_type="unknown"
FT   gene            4457734..4469521
FT                   /gene="4930471M23Rik"
FT                   /locus_tag="mCG_23502"
FT                   /note="gene_id=mCG23502.1"
FT   mRNA            join(4457734..4457890,4464540..4464612,4465287..4465458,
FT                   4465680..4465892,4466539..4466649,4467169..4469521)
FT                   /gene="4930471M23Rik"
FT                   /locus_tag="mCG_23502"
FT                   /product="RIKEN cDNA 4930471M23"
FT                   /note="gene_id=mCG23502.1 transcript_id=mCT23411.1 created
FT                   on 25-SEP-2002"
FT   CDS             join(4457814..4457890,4464540..4464612,4465287..4465458,
FT                   4465680..4465892,4466539..4466649,4467169..4467641)
FT                   /codon_start=1
FT                   /gene="4930471M23Rik"
FT                   /locus_tag="mCG_23502"
FT                   /product="RIKEN cDNA 4930471M23"
FT                   /note="gene_id=mCG23502.1 transcript_id=mCT23411.1
FT                   protein_id=mCP3965.1"
FT                   /protein_id="EDL37282.1"
FT                   /translation="MAWTKYQLFLAGLMLVTGSINTLSAKWADNFVAEGCGGSQEHSFK
FT                   HPFVQAVGMFLGEFSCLAAFYLLKCQGRRQSASSVEPQQPFNTLLFLPPALCDMTGTSI
FT                   MYVALNMTSASSFQMLRGAVIIFTGLFSVAFLDRRLAPSQWLGILITIAGLVVVGLADL
FT                   LSKHDSQHKLSEVITGDLLIIMAQIIIAIQMVLEEKFVYKHNIHPLQAVGIEGFFGFVI
FT                   LSLLLVPMFYIPTASFSGNPRGVLEDALDAFCQVGRQPLIALALLGNISSIAFFNFSGI
FT                   SVTKELSATTRMVLDTLRTIVIWAFTLALGWEIFYPLQILGFLILLMGTALYNGLHRPL
FT                   LAFLSRRWRLPTQEGEQERLLGDSRTPINEAS"
FT   assembly_gap    4470281..4470300
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4474195..4474389
FT                   /estimated_length=195
FT                   /gap_type="unknown"
FT   gene            4476940..4484871
FT                   /gene="Cenpa"
FT                   /locus_tag="mCG_23505"
FT                   /note="gene_id=mCG23505.2"
FT   mRNA            join(4476940..4477158,4482509..4482615,4483027..4483104,
FT                   4483338..4483488,4484083..4484871)
FT                   /gene="Cenpa"
FT                   /locus_tag="mCG_23505"
FT                   /product="centromere protein A, transcript variant
FT                   mCT23414"
FT                   /note="gene_id=mCG23505.2 transcript_id=mCT23414.2 created
FT                   on 18-FEB-2003"
FT   mRNA            join(4476940..4477158,4479044..4479097,4479737..4479873,
FT                   4482509..4482615,4483027..4483104,4483338..4483488,
FT                   4484083..4484304)
FT                   /gene="Cenpa"
FT                   /locus_tag="mCG_23505"
FT                   /product="centromere protein A, transcript variant
FT                   mCT173428"
FT                   /note="gene_id=mCG23505.2 transcript_id=mCT173428.0 created
FT                   on 18-FEB-2003"
FT   mRNA            join(4476940..4477158,4479737..4479873,4482509..4482615,
FT                   4483027..4483104,4483338..4483488,4484083..4484258)
FT                   /gene="Cenpa"
FT                   /locus_tag="mCG_23505"
FT                   /product="centromere protein A, transcript variant
FT                   mCT173430"
FT                   /note="gene_id=mCG23505.2 transcript_id=mCT173430.0 created
FT                   on 18-FEB-2003"
FT   mRNA            join(4476940..4477158,4482509..4482615,4483027..4483104,
FT                   4484083..>4484153)
FT                   /gene="Cenpa"
FT                   /locus_tag="mCG_23505"
FT                   /product="centromere protein A, transcript variant
FT                   mCT173429"
FT                   /note="gene_id=mCG23505.2 transcript_id=mCT173429.0 created
FT                   on 18-FEB-2003"
FT   mRNA            join(<4477019..4477158,4479044..4479097,4479783..4479873,
FT                   4482509..4482615,4483027..4483104,4483338..4483488,
FT                   4484083..4484453)
FT                   /gene="Cenpa"
FT                   /locus_tag="mCG_23505"
FT                   /product="centromere protein A, transcript variant
FT                   mCT193542"
FT                   /note="gene_id=mCG23505.2 transcript_id=mCT193542.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(4477043..4477158,4482509..4482615,4483027..4483104,
FT                   4483312..4483488,4484083..4484425)
FT                   /gene="Cenpa"
FT                   /locus_tag="mCG_23505"
FT                   /product="centromere protein A, transcript variant
FT                   mCT180245"
FT                   /note="gene_id=mCG23505.2 transcript_id=mCT180245.0 created
FT                   on 18-FEB-2003"
FT   CDS             join(4477074..4477158,4482509..4482615,4483027..4483104,
FT                   4484083..>4484153)
FT                   /codon_start=1
FT                   /gene="Cenpa"
FT                   /locus_tag="mCG_23505"
FT                   /product="centromere protein A, isoform CRA_b"
FT                   /note="gene_id=mCG23505.2 transcript_id=mCT173429.0
FT                   protein_id=mCP96348.0 isoform=CRA_b"
FT                   /protein_id="EDL37284.1"
FT                   /translation="MGPRRKPQTPRRRPSSPAPGPSRQSSSVGSQTLRRRQKFMWLKEI
FT                   KTLQKSTDLLFRKKPFSMVVREICEKFSRGVDFWWQAQALLALQETLPGSFWSCSLTVV
FT                   SEELAGFCC"
FT   CDS             join(4477074..4477158,4482509..4482615,4483027..4483104,
FT                   4483338..4483472)
FT                   /codon_start=1
FT                   /gene="Cenpa"
FT                   /locus_tag="mCG_23505"
FT                   /product="centromere protein A, isoform CRA_e"
FT                   /note="gene_id=mCG23505.2 transcript_id=mCT23414.2
FT                   protein_id=mCP3954.2 isoform=CRA_e"
FT                   /protein_id="EDL37287.1"
FT                   /translation="MGPRRKPQTPRRRPSSPAPGPSRQSSSVGSQTLRRRQKFMWLKEI
FT                   KTLQKSTDLLFRKKPFSMVVREICEKFSRGVDFWWQAQALLALQEAAEAFLIHLFEDAY
FT                   LLSLHAGRVTLFPKDIQLTRRIRGFEGGLP"
FT   CDS             join(4477074..4477158,4482509..4482615,4483027..4483104,
FT                   4483312..4483434)
FT                   /codon_start=1
FT                   /gene="Cenpa"
FT                   /locus_tag="mCG_23505"
FT                   /product="centromere protein A, isoform CRA_f"
FT                   /note="gene_id=mCG23505.2 transcript_id=mCT180245.0
FT                   protein_id=mCP103167.0 isoform=CRA_f"
FT                   /db_xref="GOA:A0A0G2JEV2"
FT                   /db_xref="InterPro:IPR000164"
FT                   /db_xref="InterPro:IPR007125"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="MGI:MGI:88375"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0G2JEV2"
FT                   /protein_id="EDL37288.1"
FT                   /translation="MGPRRKPQTPRRRPSSPAPGPSRQSSSVGSQTLRRRQKFMWLKEI
FT                   KTLQKSTDLLFRKKPFSMVVREICEKFSRGVDFWWQAQALLALQEPRQCSLLPRQQKLS
FT                   SSTSLRTPTSSPYMLVGSRFSPKTFS"
FT   CDS             join(4477074..4477158,4479737..4479780)
FT                   /codon_start=1
FT                   /gene="Cenpa"
FT                   /locus_tag="mCG_23505"
FT                   /product="centromere protein A, isoform CRA_c"
FT                   /note="gene_id=mCG23505.2 transcript_id=mCT173430.0
FT                   protein_id=mCP96349.0 isoform=CRA_c"
FT                   /db_xref="MGI:MGI:88375"
FT                   /db_xref="UniProtKB/TrEMBL:D6RCV6"
FT                   /protein_id="EDL37285.1"
FT                   /translation="MGPRRKPQTPRRRPSSPAPGPSRQSSSVEGQVHCSPPPPIWI"
FT   CDS             join(4477074..4477158,4479044..4479078)
FT                   /codon_start=1
FT                   /gene="Cenpa"
FT                   /locus_tag="mCG_23505"
FT                   /product="centromere protein A, isoform CRA_a"
FT                   /note="gene_id=mCG23505.2 transcript_id=mCT173428.0
FT                   protein_id=mCP96347.0 isoform=CRA_a"
FT                   /db_xref="MGI:MGI:88375"
FT                   /db_xref="UniProtKB/TrEMBL:D6RJ71"
FT                   /protein_id="EDL37283.1"
FT                   /translation="MGPRRKPQTPRRRPSSPAPGPSRQSSSVGVGTVGEGLWA"
FT   CDS             join(<4479095..4479097,4479783..4479873,4482509..4482615,
FT                   4483027..4483104,4483338..4483472)
FT                   /codon_start=1
FT                   /gene="Cenpa"
FT                   /locus_tag="mCG_23505"
FT                   /product="centromere protein A, isoform CRA_d"
FT                   /note="gene_id=mCG23505.2 transcript_id=mCT193542.0
FT                   protein_id=mCP114546.0 isoform=CRA_d"
FT                   /protein_id="EDL37286.1"
FT                   /translation="CIGEQAVSSIPPRILPPDSCLELLPWLLLMDGSQTLRRRQKFMWL
FT                   KEIKTLQKSTDLLFRKKPFSMVVREICEKFSRGVDFWWQAQALLALQEAAEAFLIHLFE
FT                   DAYLLSLHAGRVTLFPKDIQLTRRIRGFEGGLP"
FT   gene            4497634..4498061
FT                   /pseudo
FT                   /locus_tag="mCG_1046209"
FT                   /note="gene_id=mCG1046209.1"
FT   mRNA            4497634..4498061
FT                   /pseudo
FT                   /locus_tag="mCG_1046209"
FT                   /note="gene_id=mCG1046209.1 transcript_id=mCT163913.1
FT                   created on 14-OCT-2002"
FT   assembly_gap    4504610..4504712
FT                   /estimated_length=103
FT                   /gap_type="unknown"
FT   gene            4521739..4609845
FT                   /gene="Dpysl5"
FT                   /locus_tag="mCG_23504"
FT                   /note="gene_id=mCG23504.2"
FT   mRNA            join(4521739..4522177,4555531..4555795,4587663..4587821,
FT                   4588318..4588501,4589211..4589279,4591822..4591866,
FT                   4593538..4593613,4594654..4594810,4599042..4599183,
FT                   4601975..4602117,4602603..4602810,4604410..4604578,
FT                   4606713..4609445)
FT                   /gene="Dpysl5"
FT                   /locus_tag="mCG_23504"
FT                   /product="dihydropyrimidinase-like 5, transcript variant
FT                   mCT23413"
FT                   /note="gene_id=mCG23504.2 transcript_id=mCT23413.1 created
FT                   on 07-FEB-2003"
FT   mRNA            join(4521739..4522177,4555531..4555795,4587663..4587821,
FT                   4588318..4588497,4589211..4589279,4591822..4591866,
FT                   4593538..4593613,4594654..4594810,4599042..4599183,
FT                   4601975..4602117,4602603..4602810,4604410..4604578,
FT                   4606713..4609445)
FT                   /gene="Dpysl5"
FT                   /locus_tag="mCG_23504"
FT                   /product="dihydropyrimidinase-like 5, transcript variant
FT                   mCT179720"
FT                   /note="gene_id=mCG23504.2 transcript_id=mCT179720.0 created
FT                   on 07-FEB-2003"
FT   mRNA            join(4522027..4522177,4555531..4555795,4587663..4587821,
FT                   4589211..4589324,4593538..4593613,4594654..4594810,
FT                   4599042..4599187,4602496..4602810,4606713..4608804)
FT                   /gene="Dpysl5"
FT                   /locus_tag="mCG_23504"
FT                   /product="dihydropyrimidinase-like 5, transcript variant
FT                   mCT173427"
FT                   /note="gene_id=mCG23504.2 transcript_id=mCT173427.0 created
FT                   on 07-FEB-2003"
FT   mRNA            join(4522027..4522177,4555531..4555795,4587663..4587821,
FT                   4589119..4589324,4593538..4593613,4594654..4594810,
FT                   4602561..4602810,4604410..4604578,4606713..4608803)
FT                   /gene="Dpysl5"
FT                   /locus_tag="mCG_23504"
FT                   /product="dihydropyrimidinase-like 5, transcript variant
FT                   mCT173426"
FT                   /note="gene_id=mCG23504.2 transcript_id=mCT173426.0 created
FT                   on 07-FEB-2003"
FT   mRNA            join(<4522070..4522344,4555531..4555795,4587663..4587821,
FT                   4588318..4588497,4589211..4589279,4591822..4591866,
FT                   4593538..4593613,4594654..4594810,4599042..4599183,
FT                   4601975..4602117,4602603..4602810,4604410..4604578,
FT                   4606713..4609845)
FT                   /gene="Dpysl5"
FT                   /locus_tag="mCG_23504"
FT                   /product="dihydropyrimidinase-like 5, transcript variant
FT                   mCT193539"
FT                   /note="gene_id=mCG23504.2 transcript_id=mCT193539.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<4522292..4522344,4555531..4555795,4587663..4587821,
FT                   4588318..4588497,4589211..4589279,4591822..4591866,
FT                   4593538..4593613,4594654..4594810,4599042..4599183,
FT                   4601975..4602117,4602603..4602810,4604410..4604578,
FT                   4606713..4606798)
FT                   /codon_start=1
FT                   /gene="Dpysl5"
FT                   /locus_tag="mCG_23504"
FT                   /product="dihydropyrimidinase-like 5, isoform CRA_c"
FT                   /note="gene_id=mCG23504.2 transcript_id=mCT193539.0
FT                   protein_id=mCP114545.0 isoform=CRA_c"
FT                   /protein_id="EDL37291.1"
FT                   /translation="APPADERDVEDSGRSGLRNMLANSASVRILIKGGKVVNDDCTHEA
FT                   DVYIESGIIQQVGRELMIPGGAKVIDATGKLVIPGGIDTSTHFHQTFMNATCVDDFYHG
FT                   TKAALVGGTTMIIGHVLPDKETSLVEAYEKCRALADPKVCCDYALHVGITWWAPKVKAE
FT                   METLVREKGVNSFQMFMTYKDLYMLRDSELYQVFHACRDIGAIPRVHAENGELVAEGAK
FT                   EALDLGITGPEGIEISHPEELEAEATHRVITIANRTHCPIYLVNVSSISAGDVIAAAKM
FT                   QGKVVLAETTNAHATLTGLHYYHQDWSHAAAYVTVPPLRLDTNTSTYLMSLLANDTLNI
FT                   VASDHRPFTTKQKAMGKEDFTKIPHGVSGVQDRMSVVWERGVVGGKMDENRFVAVTSSN
FT                   AAKILNLYPRKGRIIPGADADVVVWDPEATKTISASTQVQGGDFNLYENMRCHGVPLVT
FT                   ISRGRVVYENGVFMCAEGTGKFCPLRSFPDIVYKKLVQREKTLKVRGVDRTPYLGDVAI
FT                   VVHPGKKEMGTPLADTPTRPVTRHGGMRDLHESSFSLSGSQIDDHVPKRASARILAPPG
FT                   GRSSGIW"
FT   assembly_gap    4542383..4542425
FT                   /estimated_length=43
FT                   /gap_type="unknown"
FT   assembly_gap    4546275..4546416
FT                   /estimated_length=142
FT                   /gap_type="unknown"
FT   CDS             join(4555535..4555795,4587663..4587821,4588318..4588497,
FT                   4589211..4589279,4591822..4591866,4593538..4593613,
FT                   4594654..4594810,4599042..4599183,4601975..4602117,
FT                   4602603..4602810,4604410..4604578,4606713..4606798)
FT                   /codon_start=1
FT                   /gene="Dpysl5"
FT                   /locus_tag="mCG_23504"
FT                   /product="dihydropyrimidinase-like 5, isoform CRA_b"
FT                   /note="gene_id=mCG23504.2 transcript_id=mCT179720.0
FT                   protein_id=mCP102642.0 isoform=CRA_b"
FT                   /protein_id="EDL37290.1"
FT                   /translation="MLANSASVRILIKGGKVVNDDCTHEADVYIESGIIQQVGRELMIP
FT                   GGAKVIDATGKLVIPGGIDTSTHFHQTFMNATCVDDFYHGTKAALVGGTTMIIGHVLPD
FT                   KETSLVEAYEKCRALADPKVCCDYALHVGITWWAPKVKAEMETLVREKGVNSFQMFMTY
FT                   KDLYMLRDSELYQVFHACRDIGAIPRVHAENGELVAEGAKEALDLGITGPEGIEISHPE
FT                   ELEAEATHRVITIANRTHCPIYLVNVSSISAGDVIAAAKMQGKVVLAETTNAHATLTGL
FT                   HYYHQDWSHAAAYVTVPPLRLDTNTSTYLMSLLANDTLNIVASDHRPFTTKQKAMGKED
FT                   FTKIPHGVSGVQDRMSVVWERGVVGGKMDENRFVAVTSSNAAKILNLYPRKGRIIPGAD
FT                   ADVVVWDPEATKTISASTQVQGGDFNLYENMRCHGVPLVTISRGRVVYENGVFMCAEGT
FT                   GKFCPLRSFPDIVYKKLVQREKTLKVRGVDRTPYLGDVAIVVHPGKKEMGTPLADTPTR
FT                   PVTRHGGMRDLHESSFSLSGSQIDDHVPKRASARILAPPGGRSSGIW"
FT   CDS             join(4555535..4555795,4587663..4587821,4589211..4589324,
FT                   4593538..4593613,4594654..4594810,4599042..4599187,
FT                   4602496..4602560)
FT                   /codon_start=1
FT                   /gene="Dpysl5"
FT                   /locus_tag="mCG_23504"
FT                   /product="dihydropyrimidinase-like 5, isoform CRA_a"
FT                   /note="gene_id=mCG23504.2 transcript_id=mCT173427.0
FT                   protein_id=mCP96345.0 isoform=CRA_a"
FT                   /protein_id="EDL37289.1"
FT                   /translation="MLANSASVRILIKGGKVVNDDCTHEADVYIESGIIQQVGRELMIP
FT                   GGAKVIDATGKLVIPGGIDTSTHFHQTFMNATCVDDFYHGTKAALVGGTTMIIGHVLPD
FT                   KETSLVEAYEKCRALADPKVCCDYALHVGITWWAPKGAKEALDLGITGPEGIEISHPEE
FT                   VGETSCVHGQLLYSQTHCPIYLVNVSSISAGDVIAAAKMQGKVVLAETTNAHATLTGLH
FT                   YYHQDWSHAAAYVTVPPLRLDTNTSTYLMSLLANDTLNIVASDHRPFTTKQKAMGKEDF
FT                   TKIPHGVSGVQDRMSVVWERGVVVLGTIPSCWVASLCHDVLCCL"
FT   CDS             join(4555535..4555795,4587663..4587821,4588318..4588501,
FT                   4589211..4589218)
FT                   /codon_start=1
FT                   /gene="Dpysl5"
FT                   /locus_tag="mCG_23504"
FT                   /product="dihydropyrimidinase-like 5, isoform CRA_d"
FT                   /note="gene_id=mCG23504.2 transcript_id=mCT23413.1
FT                   protein_id=mCP3985.2 isoform=CRA_d"
FT                   /protein_id="EDL37292.1"
FT                   /translation="MLANSASVRILIKGGKVVNDDCTHEADVYIESGIIQQVGRELMIP
FT                   GGAKVIDATGKLVIPGGIDTSTHFHQTFMNATCVDDFYHGTKAALVGGTTMIIGHVLPD
FT                   KETSLVEAYEKCRALADPKVCCDYALHVGITWWAPKVKAEMETLVREKGVNSFQMFMTY
FT                   KDLYMLRDSELYQVFHACRDIGAIPRVHAENGELVAEARC"
FT   CDS             join(4555535..4555795,4587663..4587821,4589119..4589130)
FT                   /codon_start=1
FT                   /gene="Dpysl5"
FT                   /locus_tag="mCG_23504"
FT                   /product="dihydropyrimidinase-like 5, isoform CRA_e"
FT                   /note="gene_id=mCG23504.2 transcript_id=mCT173426.0
FT                   protein_id=mCP96346.0 isoform=CRA_e"
FT                   /protein_id="EDL37293.1"
FT                   /translation="MLANSASVRILIKGGKVVNDDCTHEADVYIESGIIQQVGRELMIP
FT                   GGAKVIDATGKLVIPGGIDTSTHFHQTFMNATCVDDFYHGTKAALVGGTTMIIGHVLPD
FT                   KETSLVEAYEKCRALADPKVCCDYALHVGITWWAPKKEA"
FT   assembly_gap    4586754..4586908
FT                   /estimated_length=155
FT                   /gap_type="unknown"
FT   assembly_gap    4599744..4600001
FT                   /estimated_length=258
FT                   /gap_type="unknown"
FT   assembly_gap    4603400..4603419
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <4625231..4676788
FT                   /gene="Mapre3"
FT                   /locus_tag="mCG_145577"
FT                   /note="gene_id=mCG145577.1"
FT   mRNA            join(<4625231..4625375,4672490..4672617,4673181..4674088,
FT                   4675257..4675411,4675498..4675650,4675811..4676740)
FT                   /gene="Mapre3"
FT                   /locus_tag="mCG_145577"
FT                   /product="microtubule-associated protein, RP/EB family,
FT                   member 3, transcript variant mCT185001"
FT                   /note="gene_id=mCG145577.1 transcript_id=mCT185001.0
FT                   created on 05-JUN-2003"
FT   mRNA            join(<4625233..4625375,4672490..4672617,4673181..4673326,
FT                   4673887..4674088,4675257..4675411,4675498..4675650,
FT                   4675811..4676788)
FT                   /gene="Mapre3"
FT                   /locus_tag="mCG_145577"
FT                   /product="microtubule-associated protein, RP/EB family,
FT                   member 3, transcript variant mCT193635"
FT                   /note="gene_id=mCG145577.1 transcript_id=mCT193635.0
FT                   created on 09-MAR-2004"
FT   CDS             join(<4625272..4625375,4672490..4672617,4673181..4673326,
FT                   4673887..4674088,4675257..4675411,4675498..4675650,
FT                   4675811..4675879)
FT                   /codon_start=1
FT                   /gene="Mapre3"
FT                   /locus_tag="mCG_145577"
FT                   /product="microtubule-associated protein, RP/EB family,
FT                   member 3, isoform CRA_b"
FT                   /note="gene_id=mCG145577.1 transcript_id=mCT193635.0
FT                   protein_id=mCP114614.0 isoform=CRA_b"
FT                   /protein_id="EDL37295.1"
FT                   /translation="DPPPRSRRPEPQPLPQRPRLPSPPLPSQPEPPPALWGMAVNVYST
FT                   SVTSENLSRHDMLAWVNDSLHLNYTKIEQLCSGAAYCQFMDMLFPGCVHLRKVKFQAKL
FT                   EHEYIHNFKVLQAAFKKMGVDKIIPVEKLVKGKFQDNFEFIQWFKKFFDANYDGKDYNP
FT                   LLARQGQDVAPPPNPGDQIFNKSKKLIGTAVPQRTSPTGPKNMQTSGRLSNVAPPCILR
FT                   KNPPSARNGGHEADAQILELNQQLLDLKLTVDGLEKERDFYFSKLRDIELICQEHESEN
FT                   SPVISGIIGILYATEEGFAPPEDDEIEEHQQEDQDEY"
FT   assembly_gap    4642018..4642037
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4646668..4647197
FT                   /estimated_length=530
FT                   /gap_type="unknown"
FT   CDS             join(<4673797..4674088,4675257..4675411,4675498..4675650,
FT                   4675811..4675879)
FT                   /codon_start=1
FT                   /gene="Mapre3"
FT                   /locus_tag="mCG_145577"
FT                   /product="microtubule-associated protein, RP/EB family,
FT                   member 3, isoform CRA_a"
FT                   /note="gene_id=mCG145577.1 transcript_id=mCT185001.0
FT                   protein_id=mCP105608.0 isoform=CRA_a"
FT                   /protein_id="EDL37294.1"
FT                   /translation="GPGADFAVLTAEGSPTQQVGKMVCLCGLFQIIPVEKLVKGKFQDN
FT                   FEFIQWFKKFFDANYDGKDYNPLLARQGQDVAPPPNPGDQIFNKSKKLIGTAVPQRTSP
FT                   TGPKNMQTSGRLSNVAPPCILRKNPPSARNGGHEADAQILELNQQLLDLKLTVDGLEKE
FT                   RDFYFSKLRDIELICQEHESENSPVISGIIGILYATEEGFAPPEDDEIEEHQQEDQDEY
FT                   "
FT   gene            4680017..4689047
FT                   /gene="1110039B18Rik"
FT                   /locus_tag="mCG_23493"
FT                   /note="gene_id=mCG23493.2"
FT   mRNA            join(4680017..4680501,4681272..4681471,4682103..4682253,
FT                   4682404..4682538,4682755..4682837,4683184..4683289,
FT                   4683370..4683451,4683726..4683827,4684178..4684319,
FT                   4684639..4684730,4684996..4685044,4685220..4685333,
FT                   4685534..4685651,4686473..4686569,4686730..4686898,
FT                   4687046..4687191,4687347..4688144)
FT                   /gene="1110039B18Rik"
FT                   /locus_tag="mCG_23493"
FT                   /product="RIKEN cDNA 1110039B18, transcript variant
FT                   mCT23403"
FT                   /note="gene_id=mCG23493.2 transcript_id=mCT23403.1 created
FT                   on 25-SEP-2002"
FT   mRNA            join(<4680313..4680501,4681272..4681471,4682103..4682253,
FT                   4682404..4682538,4682755..4682837,4683184..4683289,
FT                   4683370..4683827,4684178..4684319,4684639..4684730,
FT                   4684996..4685044,4685220..4685333,4685534..4685651,
FT                   4686473..4686569,4686730..4686898,4687046..4687191,
FT                   4687347..4689047)
FT                   /gene="1110039B18Rik"
FT                   /locus_tag="mCG_23493"
FT                   /product="RIKEN cDNA 1110039B18, transcript variant
FT                   mCT193620"
FT                   /note="gene_id=mCG23493.2 transcript_id=mCT193620.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(<4680322..4680420,4683749..4683827,4684178..4684319,
FT                   4684639..4684730,4684996..4685044,4685220..4685333,
FT                   4685534..4685651,4686473..4686569,4686730..4686898,
FT                   4687046..4687191,4687347..4688145)
FT                   /gene="1110039B18Rik"
FT                   /locus_tag="mCG_23493"
FT                   /product="RIKEN cDNA 1110039B18, transcript variant
FT                   mCT193621"
FT                   /note="gene_id=mCG23493.2 transcript_id=mCT193621.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<4680324..4680420,4683749..4683827,4684178..4684319,
FT                   4684639..4684730,4684996..4685044,4685220..4685333,
FT                   4685534..4685651,4686473..4686569,4686730..4686898,
FT                   4687046..4687191,4687347..4687473)
FT                   /codon_start=1
FT                   /gene="1110039B18Rik"
FT                   /locus_tag="mCG_23493"
FT                   /product="RIKEN cDNA 1110039B18, isoform CRA_b"
FT                   /note="gene_id=mCG23493.2 transcript_id=mCT193621.0
FT                   protein_id=mCP114591.0 isoform=CRA_b"
FT                   /protein_id="EDL37297.1"
FT                   /translation="KPGGGGAEVMAARSAGSGGWEVVKRGRRPGASSFGMIGPKDFFPL
FT                   LDFAYMPNNSLSPSLQEQLCQLFPRLKVLAFGAKPESSLHTYFPSFLSRATPSCPAAMK
FT                   KELLASLTQCLTVDPLSTSVWRQLYPKHLSQSSLLLEHLLKSWEHIPKKARKSLQETIQ
FT                   SLKVTNQELLKKGSGGSEHVLTCDTACKGLLQRARGPRPPWARLFLLLLVFAVGFLCHD
FT                   LRSNSSLQASLTGRLLRSSGLLPVGQQVCARLSSYSLQSYNWLQETLPACGSHLLAVVQ
FT                   PSLQLAWTHIYAIFSFLSAHCASYLACFSDSLAGFFQRVQLPEALQQLFHALKELLLLF
FT                   CHSVLLPTWHLLLAALAQVQEHCHEACRGDVTWDCIKTQLSRAAQWTWLCLQDVTVAFL
FT                   DWALTMISQQ"
FT   CDS             join(4680351..4680501,4681272..4681471,4682103..4682253,
FT                   4682404..4682538,4682755..4682837,4683184..4683289,
FT                   4683370..4683451,4683726..4683827,4684178..4684319,
FT                   4684639..4684730,4684996..4685044,4685220..4685333,
FT                   4685534..4685651,4686473..4686569,4686730..4686898,
FT                   4687046..4687191,4687347..4687473)
FT                   /codon_start=1
FT                   /gene="1110039B18Rik"
FT                   /locus_tag="mCG_23493"
FT                   /product="RIKEN cDNA 1110039B18, isoform CRA_c"
FT                   /note="gene_id=mCG23493.2 transcript_id=mCT23403.1
FT                   protein_id=mCP4002.1 isoform=CRA_c"
FT                   /protein_id="EDL37298.1"
FT                   /translation="MAARSAGSGGWEVVKRGRRPGASSGGRGGGGGSDRRALGEANGVL
FT                   KYDLSSPIQTTSTLYERGFEKIMKRQNKEQVPPPAAESKKPINKKQPKKVTAVPSQNQK
FT                   QGPFRRLEDALKALDVAALQKELDKSQSVFTGNPSVWLKDLASYLNYKLQTPRMEPTLS
FT                   QYPHDYPYSLVSRELRGIIRGLLTKAAGSVELFFDHCLFTMLQELDKTPGESLHGYRIC
FT                   IQAVLQDKPKIVTSNLDKFLELLRSHQSRPAKCLTIMWALGQAGFTNLTEGLKVWLGIM
FT                   LPVLGIKALSPFAIAYLDRLLLMHPNLTKGFGMIGPKDFFPLLDFAYMPNNSLSPSLQE
FT                   QLCQLFPRLKVLAFGAKPESSLHTYFPSFLSRATPSCPAAMKKELLASLTQCLTVDPLS
FT                   TSVWRQLYPKHLSQSSLLLEHLLKSWEHIPKKARKSLQETIQSLKVTNQELLKKGSGGS
FT                   EHVLTCDTACKGLLQRARGPRPPWARLFLLLLVFAVGFLCHDLRSNSSLQASLTGRLLR
FT                   SSGLLPVGQQVCARLSSYSLQSYNWLQETLPACGSHLLAVVQPSLQLAWTHIYAIFSFL
FT                   SAHCASYLACFSDSLAGFFQRVQLPEALQQLFHALKELLLLFCHSVLLPTWHLLLAALA
FT                   QVQEHCHEACRGDVTWDCIKTQLSRAAQWTWLCLQDVTVAFLDWALTMISQQ"
FT   CDS             join(<4683670..4683827,4684178..4684319,4684639..4684730,
FT                   4684996..4685044,4685220..4685333,4685534..4685651,
FT                   4686473..4686569,4686730..4686898,4687046..4687191,
FT                   4687347..4687473)
FT                   /codon_start=1
FT                   /gene="1110039B18Rik"
FT                   /locus_tag="mCG_23493"
FT                   /product="RIKEN cDNA 1110039B18, isoform CRA_a"
FT                   /note="gene_id=mCG23493.2 transcript_id=mCT193620.0
FT                   protein_id=mCP114590.0 isoform=CRA_a"
FT                   /protein_id="EDL37296.1"
FT                   /translation="VHGWNTIVVSNKPAPSLSRMHPNLTKGFGMIGPKDFFPLLDFAYM
FT                   PNNSLSPSLQEQLCQLFPRLKVLAFGAKPESSLHTYFPSFLSRATPSCPAAMKKELLAS
FT                   LTQCLTVDPLSTSVWRQLYPKHLSQSSLLLEHLLKSWEHIPKKARKSLQETIQSLKVTN
FT                   QELLKKGSGGSEHVLTCDTACKGLLQRARGPRPPWARLFLLLLVFAVGFLCHDLRSNSS
FT                   LQASLTGRLLRSSGLLPVGQQVCARLSSYSLQSYNWLQETLPACGSHLLAVVQPSLQLA
FT                   WTHIYAIFSFLSAHCASYLACFSDSLAGFFQRVQLPEALQQLFHALKELLLLFCHSVLL
FT                   PTWHLLLAALAQVQEHCHEACRGDVTWDCIKTQLSRAAQWTWLCLQDVTVAFLDWALTM
FT                   ISQQ"
FT   assembly_gap    4692862..4692881
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            4699815..4717899
FT                   /gene="9430057O19Rik"
FT                   /locus_tag="mCG_23501"
FT                   /note="gene_id=mCG23501.3"
FT   mRNA            join(4699815..4699994,4701045..4701305,4701524..4701695,
FT                   4701985..4702148,4702738..4702915,4703363..4703541,
FT                   4703930..4704386,4704826..4704995,4705300..4705435,
FT                   4705922..4706124,4706691..4706905,4713987..4714142,
FT                   4715637..4715749,4716043..4716089,4716570..4716695,
FT                   4717050..4717898)
FT                   /gene="9430057O19Rik"
FT                   /locus_tag="mCG_23501"
FT                   /product="RIKEN cDNA 9430057O19, transcript variant
FT                   mCT23408"
FT                   /note="gene_id=mCG23501.3 transcript_id=mCT23408.2 created
FT                   on 25-SEP-2002"
FT   mRNA            join(<4699879..4700006,4701045..4701305,4701524..4701695,
FT                   4702083..4702148,4702738..4702915,4703363..4703541,
FT                   4703930..4704386,4704826..4705435,4705922..4706124,
FT                   4706691..4706905,4713987..4714142,4715637..4715749,
FT                   4716043..4716089,4716565..4716695,4717050..4717601)
FT                   /gene="9430057O19Rik"
FT                   /locus_tag="mCG_23501"
FT                   /product="RIKEN cDNA 9430057O19, transcript variant
FT                   mCT193536"
FT                   /note="gene_id=mCG23501.3 transcript_id=mCT193536.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(<4699926..4700006,4701045..4701305,4701524..4701695,
FT                   4701985..4702148,4702738..4702915,4703363..4703541,
FT                   4703930..4704386,4704826..4704995,4705300..4705435,
FT                   4705922..4706124,4706691..4706905,4713987..4714142,
FT                   4715637..4715749,4715952..4716089,4716565..4716695,
FT                   4717050..4717593)
FT                   /gene="9430057O19Rik"
FT                   /locus_tag="mCG_23501"
FT                   /product="RIKEN cDNA 9430057O19, transcript variant
FT                   mCT193537"
FT                   /note="gene_id=mCG23501.3 transcript_id=mCT193537.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<4699972..4700006,4701045..4701305,4701524..4701695,
FT                   4701985..4702148,4702738..4702915,4703363..4703541,
FT                   4703930..4704386,4704826..4704995,4705300..4705435,
FT                   4705922..4706124,4706691..4706905,4713987..4714142,
FT                   4715637..4715749,4715952..4716020)
FT                   /codon_start=1
FT                   /gene="9430057O19Rik"
FT                   /locus_tag="mCG_23501"
FT                   /product="RIKEN cDNA 9430057O19, isoform CRA_b"
FT                   /note="gene_id=mCG23501.3 transcript_id=mCT193537.0
FT                   protein_id=mCP114543.0 isoform=CRA_b"
FT                   /protein_id="EDL37300.1"
FT                   /translation="REREREQRPGESSQGLCGARGCFPSPTMELRCGGLLFSSRFDSGN
FT                   LAHVEKVETVSSDGEGVGGVATAPASGSAASPDYEFNVWTRPDCAETEYENGNRSWFYF
FT                   SVRGGTPGKLIKINIMNMNKQSKLYSQGMAPFVRTLPSRPRWERIRERPTFEMTETQFV
FT                   LSFVHRFVEGRGATTFFAFCYPFSYSDCQDLLSQLDQRFSENYSTHSSPLDSIYYHREL
FT                   LCYSLDGLRVDLLTITSCHGLRDDREPRLEQLFPDLGTPRPFRFTGKRIFFLSSRVHPG
FT                   ETPSSFVFNGFLDFILRPDDPRAQTLRRLFVFKLIPMLNPDGVVRGHYRTDSRGVNLNR
FT                   QYLKPDAVLHPAIYGAKAVLLYHHVHSRLNAKSPTNQQPTLHLPPEAPLSDLEKANNLH
FT                   NEAHLGQSPDGENPATWPETEPAEEKTDPVWLMPQPIPELEEPAPDTIPPKESGVAYYV
FT                   DLHGHASKRGCFMYGNSFSDESTQVENMLYPKLISLNSAHFDFQGCNFSEKNMYARDRR
FT                   DGQSKEGSGRVAIYKASGIIHSYTLECNYNTGRSVNSIPAACHDNGRASPPPPPAFPSR
FT                   YTVELFEQVGRAMAIAALDMAECNPWPRIVLSEHSSLTNLRAWMLRHVRNSRGLTSAGN
FT                   MGASKKRGARTPPKSNNSLPVSCSENALSRVRSFSTGTSTGGSSSSQQNSPQMKNSPSF
FT                   PFHGSRTAGLPGLGSSTQKVSHRVLGPVREPRCSDRRRRQQPLNHRSTTSSLAPSPTLA
FT                   SSGPTSSRNMGSCLLPNSLSLSGSSCSFSSSGDKPEAVMVIGKSLLGAGARIPCIRTRL
FT                   QTPLSLPDAPQPQPTSFGFPTRP"
FT   CDS             join(4701091..4701305,4701524..4701695,4701985..4702148,
FT                   4702738..4702915,4703363..4703541,4703930..4704386,
FT                   4704826..4704995,4705300..4705435,4705922..4706124,
FT                   4706691..4706905,4713987..4714142,4715637..4715749,
FT                   4716043..4716089,4716570..4716695,4717050..4717221)
FT                   /codon_start=1
FT                   /gene="9430057O19Rik"
FT                   /locus_tag="mCG_23501"
FT                   /product="RIKEN cDNA 9430057O19, isoform CRA_d"
FT                   /note="gene_id=mCG23501.3 transcript_id=mCT23408.2
FT                   protein_id=mCP3902.2 isoform=CRA_d"
FT                   /protein_id="EDL37302.1"
FT                   /translation="MELRCGGLLFSSRFDSGNLAHVEKVETVSSDGEGVGGVATAPASG
FT                   SAASPDYEFNVWTRPDCAETEYENGNRSWFYFSVRGGTPGKLIKINIMNMNKQSKLYSQ
FT                   GMAPFVRTLPSRPRWERIRERPTFEMTETQFVLSFVHRFVEGRGATTFFAFCYPFSYSD
FT                   CQDLLSQLDQRFSENYSTHSSPLDSIYYHRELLCYSLDGLRVDLLTITSCHGLRDDREP
FT                   RLEQLFPDLGTPRPFRFTGKRIFFLSSRVHPGETPSSFVFNGFLDFILRPDDPRAQTLR
FT                   RLFVFKLIPMLNPDGVVRGHYRTDSRGVNLNRQYLKPDAVLHPAIYGAKAVLLYHHVHS
FT                   RLNAKSPTNQQPTLHLPPEAPLSDLEKANNLHNEAHLGQSPDGENPATWPETEPAEEKT
FT                   DPVWLMPQPIPELEEPAPDTIPPKESGVAYYVDLHGHASKRGCFMYGNSFSDESTQVEN
FT                   MLYPKLISLNSAHFDFQGCNFSEKNMYARDRRDGQSKEGSGRVAIYKASGIIHSYTLEC
FT                   NYNTGRSVNSIPAACHDNGRASPPPPPAFPSRYTVELFEQVGRAMAIAALDMAECNPWP
FT                   RIVLSEHSSLTNLRAWMLRHVRNSRGLTSAGNMGASKKRGARTPPKSNNSLPVSCSENA
FT                   LSRVRSFSTGTSTGGSSSSQQNSPQMKNSPSFPFHGSRTAGLPGLGSSTQKVSHRVLGP
FT                   VREPRCSDRRRRQQPLNHRSTTSSLAPSPTLASSGPTSSRNMGSCLLPNSLSLSGSSCS
FT                   FSSSGDKPEAVMVIGKSLLGAGARIPCIRTRLQTCQRRVSARRGPGFPRPRLGRSSPPT
FT                   RRGMRGSSPTSPIPQTRESSELEPGPHSATPGLPQAGPPRPRSAPAFSPISCTLSDSPS
FT                   RICYSRGLLNQCEVCFVPKSPPLTISPRV"
FT   CDS             join(<4701595..4701695,4702083..4702148,4702738..4702915,
FT                   4703363..4703541,4703930..4704386,4704826..4705299)
FT                   /codon_start=1
FT                   /gene="9430057O19Rik"
FT                   /locus_tag="mCG_23501"
FT                   /product="RIKEN cDNA 9430057O19, isoform CRA_a"
FT                   /note="gene_id=mCG23501.3 transcript_id=mCT193536.0
FT                   protein_id=mCP114542.0 isoform=CRA_a"
FT                   /protein_id="EDL37299.1"
FT                   /translation="TSKANCIPRAWPPLCAHCLPGHAGNALESGPPLSDCQDLLSQLDQ
FT                   RFSENYSTHSSPLDSIYYHRELLCYSLDGLRVDLLTITSCHGLRDDREPRLEQLFPDLG
FT                   TPRPFRFTGKRIFFLSSRVHPGETPSSFVFNGFLDFILRPDDPRAQTLRRLFVFKLIPM
FT                   LNPDGVVRGHYRTDSRGVNLNRQYLKPDAVLHPAIYGAKAVLLYHHVHSRLNAKSPTNQ
FT                   QPTLHLPPEAPLSDLEKANNLHNEAHLGQSPDGENPATWPETEPAEEKTDPVWLMPQPI
FT                   PELEEPAPDTIPPKESGVAYYVDLHGHASKRGCFMYGNSFSDESTQVENMLYPKLISLN
FT                   SAHFDFQGCNFSEKNMYARDRRDGQSKEGSGRVAIYKASGIIHRLGGNWHSREITSLKE
FT                   KILIPGCLRGLNHANLLKREPQLARLALFWEFFTFGGLPGHMVSCYLGITAFSLGLYLF
FT                   QSDDYLRPSWCPSVFCCKTLTKISVS"
FT   mRNA            join(<4701615..4701695,4701985..4702148,4702738..4702915,
FT                   4703363..4703541,4703930..4704386,4704826..4704995,
FT                   4705300..4705435,4705922..4706124,4706691..4706905,
FT                   4713987..4714142,4715637..4715749,4716043..4716089,
FT                   4716565..4716695,4717050..4717899)
FT                   /gene="9430057O19Rik"
FT                   /locus_tag="mCG_23501"
FT                   /product="RIKEN cDNA 9430057O19, transcript variant
FT                   mCT193538"
FT                   /note="gene_id=mCG23501.3 transcript_id=mCT193538.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<4701615..4701695,4701985..4702148,4702738..4702915,
FT                   4703363..4703541,4703930..4704386,4704826..4704995,
FT                   4705300..4705435,4705922..4706124,4706691..4706905,
FT                   4713987..4714142,4715637..4715749,4716043..4716089,
FT                   4716565..4716613)
FT                   /codon_start=1
FT                   /gene="9430057O19Rik"
FT                   /locus_tag="mCG_23501"
FT                   /product="RIKEN cDNA 9430057O19, isoform CRA_c"
FT                   /note="gene_id=mCG23501.3 transcript_id=mCT193538.0
FT                   protein_id=mCP114544.0 isoform=CRA_c"
FT                   /protein_id="EDL37301.1"
FT                   /translation="SQGMAPFVRTLPSRPRWERIRERPTFEMTETQFVLSFVHRFVEGR
FT                   GATTFFAFCYPFSYSDCQDLLSQLDQRFSENYSTHSSPLDSIYYHRELLCYSLDGLRVD
FT                   LLTITSCHGLRDDREPRLEQLFPDLGTPRPFRFTGKRIFFLSSRVHPGETPSSFVFNGF
FT                   LDFILRPDDPRAQTLRRLFVFKLIPMLNPDGVVRGHYRTDSRGVNLNRQYLKPDAVLHP
FT                   AIYGAKAVLLYHHVHSRLNAKSPTNQQPTLHLPPEAPLSDLEKANNLHNEAHLGQSPDG
FT                   ENPATWPETEPAEEKTDPVWLMPQPIPELEEPAPDTIPPKESGVAYYVDLHGHASKRGC
FT                   FMYGNSFSDESTQVENMLYPKLISLNSAHFDFQGCNFSEKNMYARDRRDGQSKEGSGRV
FT                   AIYKASGIIHSYTLECNYNTGRSVNSIPAACHDNGRASPPPPPAFPSRYTVELFEQVGR
FT                   AMAIAALDMAECNPWPRIVLSEHSSLTNLRAWMLRHVRNSRGLTSAGNMGASKKRGART
FT                   PPKSNNSLPVSCSENALSRVRSFSTGTSTGGSSSSQQNSPQMKNSPSFPFHGSRTAGLP
FT                   GLGSSTQKVSHRVLGPVREPRCSDRRRRQQPLNHRSTTSSLAPSPTLASSGPTSSRNMG
FT                   SCLLPNSLSLSGSSCSFSSSGDKPEAVMVIGKSLLGAGARIPCIRTRLQTCQRRVSARR
FT                   GPGFPRLGPGWAGAHRRLAEG"
FT   assembly_gap    4711125..4711144
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(4716818..4718724)
FT                   /gene="2310016E02Rik"
FT                   /locus_tag="mCG_23494"
FT                   /note="gene_id=mCG23494.1"
FT   mRNA            complement(join(4716818..4717700,4718333..4718470,
FT                   4718599..4718724))
FT                   /gene="2310016E02Rik"
FT                   /locus_tag="mCG_23494"
FT                   /product="RIKEN cDNA 2310016E02, transcript variant
FT                   mCT23404"
FT                   /note="gene_id=mCG23494.1 transcript_id=mCT23404.1 created
FT                   on 25-SEP-2002"
FT   mRNA            complement(join(4716841..4717700,4718333..4718651))
FT                   /gene="2310016E02Rik"
FT                   /locus_tag="mCG_23494"
FT                   /product="RIKEN cDNA 2310016E02, transcript variant
FT                   mCT173721"
FT                   /note="gene_id=mCG23494.1 transcript_id=mCT173721.0 created
FT                   on 25-SEP-2002"
FT   CDS             complement(4718356..4718469)
FT                   /codon_start=1
FT                   /gene="2310016E02Rik"
FT                   /locus_tag="mCG_23494"
FT                   /product="RIKEN cDNA 2310016E02, isoform CRA_a"
FT                   /note="gene_id=mCG23494.1 transcript_id=mCT173721.0
FT                   protein_id=mCP96640.0 isoform=CRA_a"
FT                   /protein_id="EDL37303.1"
FT                   /translation="MITDVQLAIFANMLGVSLFLLVVLYHYVAVNNPKKQE"
FT   CDS             complement(4718356..4718469)
FT                   /codon_start=1
FT                   /gene="2310016E02Rik"
FT                   /locus_tag="mCG_23494"
FT                   /product="RIKEN cDNA 2310016E02, isoform CRA_a"
FT                   /note="gene_id=mCG23494.1 transcript_id=mCT23404.1
FT                   protein_id=mCP3914.2 isoform=CRA_a"
FT                   /protein_id="EDL37304.1"
FT                   /translation="MITDVQLAIFANMLGVSLFLLVVLYHYVAVNNPKKQE"
FT   assembly_gap    4722410..4722429
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4724328..4724406
FT                   /estimated_length=79
FT                   /gap_type="unknown"
FT   gene            4724511..4732363
FT                   /gene="Emilin1"
FT                   /locus_tag="mCG_23500"
FT                   /note="gene_id=mCG23500.1"
FT   mRNA            join(4724511..4725123,4726063..4726188,4726598..4726818,
FT                   4728027..4729952,4730349..4730465,4731024..4731041,
FT                   4731173..4731310,4731708..4732363)
FT                   /gene="Emilin1"
FT                   /locus_tag="mCG_23500"
FT                   /product="elastin microfibril interfacer 1, transcript
FT                   variant mCT23410"
FT                   /note="gene_id=mCG23500.1 transcript_id=mCT23410.1 created
FT                   on 16-SEP-2002"
FT   CDS             join(4724954..4725123,4726063..4726188,4726598..4726818,
FT                   4728027..4729952,4730349..4730465,4731024..4731041,
FT                   4731173..4731310,4731708..4732045)
FT                   /codon_start=1
FT                   /gene="Emilin1"
FT                   /locus_tag="mCG_23500"
FT                   /product="elastin microfibril interfacer 1, isoform CRA_b"
FT                   /note="gene_id=mCG23500.1 transcript_id=mCT23410.1
FT                   protein_id=mCP4009.2 isoform=CRA_b"
FT                   /protein_id="EDL37306.1"
FT                   /translation="MAPRALWSCYLCCLLTIATEAASYPPRGYSLYTGGTGALSPGGPQ
FT                   AQNSPRPASRHRNWCAYVVTRTVSCVLEDGVETIVKPDYQPCGWGQPHCSRSIMYRSFL
FT                   RPRYRVAYKTVTDMEWRCCQGYGGDDCGEGPASVLGPAPSTPLPRPRPVRPNLSGSSAG
FT                   SHLSGLGGEGPVESEKVQQLERQVKSLTKELQGLRGVLQGMNGRLAEDVQRAVDTVFNG
FT                   RQQPADAAARPGVHETLSEIQQQLQLLDNRVSTHDQELGHLNNHHNGGPGGGGRASGPV
FT                   PVPSGPSEELLRQLERQLQESCSVCLTGLDGFRQQQQEDRERLRTLEKLMSSMEERQQQ
FT                   LVGPAMARRPPQECCPPELGRRVSELERRLDVVTGSLTVLSGRRGSELGGAAGQGGHPP
FT                   GYTSLASRLSRLEDRFNSTLGPSEEQEKNWPGGPGRLGHWLPAAPGRLEKLEGLLANVS
FT                   RELGGRMDLLEEQVAGAVRTCGQICSGAPGEQDSRVNEILSALERRVLDSEGRLQLVGS
FT                   GLHEAEAAGEAQQAVLEGLQGLLSRLRERMDAQEETAAEILLRLNLTAAQLSQLEGLLQ
FT                   ARGDEGCGACGGVQEELGRLRDGVERCSCPLLPPRGPGAGPGVGGPSRGPLDGFSVFGG
FT                   SSGSALQALQGELSEVILTFSSLNDSLHELQTTVEGQGADLADLGATKDSIISEINRLQ
FT                   QEATEHVTESEERFRGLEEGQAQAGQCPSLEGRLGRLEGVCERLDTVAGGLQGLREGLS
FT                   RHVAGLWAAVRESNSTSLTQAALLEKLLGGQAGLGRRLGALNNSLLLLEDRLQQLSLKD
FT                   FTGPSGKAGPPGPPGLQGPSGPAGPPGPPGKDGQQGAIGPPGPQGEQGAEGAPAAPVPR
FT                   VAFSAALSLPRSEPGTVPFDRVLLNDGGYYDPETGVFTAPLAGRYLLSAVLTGHRHEKV
FT                   EAVLSRSNLGVARIDSGGYEPEGLENKPVAESQPSPGALGVFSLILPLQVGDTVCIDLV
FT                   MGQLAHSEEPLTIFSGALLYEDTELEQV"
FT   mRNA            join(<4729330..4729952,4731173..4731310,4731708..4732349)
FT                   /gene="Emilin1"
FT                   /locus_tag="mCG_23500"
FT                   /product="elastin microfibril interfacer 1, transcript
FT                   variant mCT173425"
FT                   /note="gene_id=mCG23500.1 transcript_id=mCT173425.0 created
FT                   on 16-SEP-2002"
FT   CDS             join(<4729331..4729952,4731173..4731310,4731708..4732045)
FT                   /codon_start=1
FT                   /gene="Emilin1"
FT                   /locus_tag="mCG_23500"
FT                   /product="elastin microfibril interfacer 1, isoform CRA_a"
FT                   /note="gene_id=mCG23500.1 transcript_id=mCT173425.0
FT                   protein_id=mCP96344.0 isoform=CRA_a"
FT                   /protein_id="EDL37305.1"
FT                   /translation="LPPRGPGAGPGVGGPSRGPLDGFSVFGGSSGSALQALQGELSEVI
FT                   LTFSSLNDSLHELQTTVEGQGADLADLGATKDSIISEINRLQQEATEHVTESEERFRGL
FT                   EEGQAQAGQCPSLEGRLGRLEGVCERLDTVAGGLQGLREGLSRHVAGLWAAVRESNSTS
FT                   LTQAALLEKLLGGQAGLGRRLGALNNSLLLLEDRLQQLSLKDFTGAEGAPAAPVPRVAF
FT                   SAALSLPRSEPGTVPFDRVLLNDGGYYDPETGVFTAPLAGRYLLSAVLTGHRHEKVEAV
FT                   LSRSNLGVARIDSGGYEPEGLENKPVAESQPSPGALGVFSLILPLQVGDTVCIDLVMGQ
FT                   LAHSEEPLTIFSGALLYEDTELEQV"
FT   gene            4732633..4742341
FT                   /gene="Khk"
FT                   /locus_tag="mCG_23498"
FT                   /note="gene_id=mCG23498.2"
FT   mRNA            join(4732633..4733100,4735832..4735948,4737781..4737915,
FT                   4739536..4739608,4740614..>4740761)
FT                   /gene="Khk"
FT                   /locus_tag="mCG_23498"
FT                   /product="ketohexokinase, transcript variant mCT181686"
FT                   /note="gene_id=mCG23498.2 transcript_id=mCT181686.0 created
FT                   on 03-APR-2003"
FT   mRNA            join(4732691..4733100,4735832..4735948,4738115..4738249,
FT                   4739536..4739608,4740614..4740760,4741642..4741730,
FT                   4741810..4741967,4742056..4742341)
FT                   /gene="Khk"
FT                   /locus_tag="mCG_23498"
FT                   /product="ketohexokinase, transcript variant mCT23407"
FT                   /note="gene_id=mCG23498.2 transcript_id=mCT23407.1 created
FT                   on 03-APR-2003"
FT   mRNA            join(4732713..4733100,4735832..4735948,4737781..4737915,
FT                   4738115..4738249,4739536..4739608,4740614..>4740638)
FT                   /gene="Khk"
FT                   /locus_tag="mCG_23498"
FT                   /product="ketohexokinase, transcript variant mCT181685"
FT                   /note="gene_id=mCG23498.2 transcript_id=mCT181685.0 created
FT                   on 03-APR-2003"
FT   mRNA            join(4732724..4733100,4735832..4735948,4738115..4738249,
FT                   4739536..4739608,4740614..4740760,4741642..4741719,
FT                   4741802..>4741899)
FT                   /gene="Khk"
FT                   /locus_tag="mCG_23498"
FT                   /product="ketohexokinase, transcript variant mCT181688"
FT                   /note="gene_id=mCG23498.2 transcript_id=mCT181688.0 created
FT                   on 03-APR-2003"
FT   mRNA            join(4732735..4733100,4735832..4735948,4739536..4739608,
FT                   4740614..4740760,4741642..4741730,4741810..4741967,
FT                   4742056..4742341)
FT                   /gene="Khk"
FT                   /locus_tag="mCG_23498"
FT                   /product="ketohexokinase, transcript variant mCT181687"
FT                   /note="gene_id=mCG23498.2 transcript_id=mCT181687.0 created
FT                   on 03-APR-2003"
FT   CDS             join(4733009..4733100,4735832..4735948,4738115..4738249,
FT                   4739536..4739608,4740614..4740760,4741642..4741730,
FT                   4741810..4741967,4742056..4742141)
FT                   /codon_start=1
FT                   /gene="Khk"
FT                   /locus_tag="mCG_23498"
FT                   /product="ketohexokinase, isoform CRA_d"
FT                   /note="gene_id=mCG23498.2 transcript_id=mCT23407.1
FT                   protein_id=mCP3947.0 isoform=CRA_d"
FT                   /db_xref="GOA:A0A0J9YU79"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="MGI:MGI:1096353"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0J9YU79"
FT                   /protein_id="EDL37310.1"
FT                   /translation="MEEKQILCVGLVVLDIINVVDKYPEEDTDRRCLSQRWQRGGNASN
FT                   SCTVLSLLGARCAFMGSLAPGHVADFLVADFRQRGVDVSQVTWQSQGDTPCSCCIVNNS
FT                   NGSRTIILYDTNLPDVSAKDFEKVDLTRFKWIHIEGRNASEQVKMLQRIEEHNAKQPLP
FT                   QKVRVSVEIEKPREELFQLFSYGEVVFVSKDVAKHLGFQSAVEALRGLYSRVKKGATLV
FT                   CAWAEEGADALGPDGQLLHSDAFPPPRVVDTLGAGDTFNASVIFSLSKGNSMQEALRFG
FT                   CQVAGKKCGLQGFDGIV"
FT   CDS             join(4733009..4733100,4735832..4735948,4739536..4739608,
FT                   4740614..4740760,4741642..4741730,4741810..4741967,
FT                   4742056..4742141)
FT                   /codon_start=1
FT                   /gene="Khk"
FT                   /locus_tag="mCG_23498"
FT                   /product="ketohexokinase, isoform CRA_e"
FT                   /note="gene_id=mCG23498.2 transcript_id=mCT181687.0
FT                   protein_id=mCP104607.0 isoform=CRA_e"
FT                   /db_xref="GOA:A0A0J9YUK6"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="MGI:MGI:1096353"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0J9YUK6"
FT                   /protein_id="EDL37311.1"
FT                   /translation="MEEKQILCVGLVVLDIINVVDKYPEEDTDRRCLSQRWQRGGNASN
FT                   SCTVLSLLGARCAFMGSLAPGHVAENLPDVSAKDFEKVDLTRFKWIHIEGRNASEQVKM
FT                   LQRIEEHNAKQPLPQKVRVSVEIEKPREELFQLFSYGEVVFVSKDVAKHLGFQSAVEAL
FT                   RGLYSRVKKGATLVCAWAEEGADALGPDGQLLHSDAFPPPRVVDTLGAGDTFNASVIFS
FT                   LSKGNSMQEALRFGCQVAGKKCGLQGFDGIV"
FT   CDS             join(4733009..4733100,4735832..4735948,4738115..4738249,
FT                   4739536..4739608,4740614..4740760,4741642..4741719,
FT                   4741802..>4741899)
FT                   /codon_start=1
FT                   /gene="Khk"
FT                   /locus_tag="mCG_23498"
FT                   /product="ketohexokinase, isoform CRA_c"
FT                   /note="gene_id=mCG23498.2 transcript_id=mCT181688.0
FT                   protein_id=mCP104610.0 isoform=CRA_c"
FT                   /protein_id="EDL37309.1"
FT                   /translation="MEEKQILCVGLVVLDIINVVDKYPEEDTDRRCLSQRWQRGGNASN
FT                   SCTVLSLLGARCAFMGSLAPGHVADFLVADFRQRGVDVSQVTWQSQGDTPCSCCIVNNS
FT                   NGSRTIILYDTNLPDVSAKDFEKVDLTRFKWIHIEGRNASEQVKMLQRIEEHNAKQPLP
FT                   QKVRVSVEIEKPREELFQLFSYGEVVFVSKDVAKHLGFQSAVEALRGLYSRSYRATLVC
FT                   AWAEEGADALGPDGQLLHSDAFPPP"
FT   CDS             join(4733009..4733100,4735832..4735948,4737781..4737915,
FT                   4739536..4739608,4740614..>4740761)
FT                   /codon_start=1
FT                   /gene="Khk"
FT                   /locus_tag="mCG_23498"
FT                   /product="ketohexokinase, isoform CRA_b"
FT                   /note="gene_id=mCG23498.2 transcript_id=mCT181686.0
FT                   protein_id=mCP104609.0 isoform=CRA_b"
FT                   /protein_id="EDL37308.1"
FT                   /translation="MEEKQILCVGLVVLDIINVVDKYPEEDTDRRCLSQRWQRGGNASN
FT                   SCTVLSLLGARCAFMGSLAPGHVADFVLDDLRQHSVDLRYVVLQTEGSIPTSTVIINEA
FT                   SGSRTILHAYRNLPDVSAKDFEKVDLTRFKWIHIEGRNASEQVKMLQRIEEHNAKQPLP
FT                   QKVRVSVEIEKPREELFQLFSYGEV"
FT   CDS             join(4733009..4733100,4735832..4735948,4737781..4737915,
FT                   4738115..4738249,4739536..4739608,4740614..>4740638)
FT                   /codon_start=1
FT                   /gene="Khk"
FT                   /locus_tag="mCG_23498"
FT                   /product="ketohexokinase, isoform CRA_a"
FT                   /note="gene_id=mCG23498.2 transcript_id=mCT181685.0
FT                   protein_id=mCP104608.0 isoform=CRA_a"
FT                   /protein_id="EDL37307.1"
FT                   /translation="MEEKQILCVGLVVLDIINVVDKYPEEDTDRRCLSQRWQRGGNASN
FT                   SCTVLSLLGARCAFMGSLAPGHVADFVLDDLRQHSVDLRYVVLQTEGSIPTSTVIINEA
FT                   SGSRTILHAYSFLVADFRQRGVDVSQVTWQSQGDTPCSCCIVNNSNGSRTIILYDTNLP
FT                   DVSAKDFEKVDLTRFKWIHIEGRNASEQV"
FT   gene            complement(4744239..4756578)
FT                   /locus_tag="mCG_23492"
FT                   /note="gene_id=mCG23492.1"
FT   mRNA            complement(join(4744239..4745088,4745260..4745381,
FT                   4745456..4745526,4745620..4745685,4746955..4747057,
FT                   4756387..4756578))
FT                   /locus_tag="mCG_23492"
FT                   /product="mCG23492, transcript variant mCT23402"
FT                   /note="gene_id=mCG23492.1 transcript_id=mCT23402.2 created
FT                   on 18-FEB-2003"
FT   mRNA            complement(join(4744243..4745088,4745260..4745381,
FT                   4745456..4745526,4745620..4745685,4746955..4747057,
FT                   4756450..4756500))
FT                   /locus_tag="mCG_23492"
FT                   /product="mCG23492, transcript variant mCT180313"
FT                   /note="gene_id=mCG23492.1 transcript_id=mCT180313.0 created
FT                   on 18-FEB-2003"
FT   CDS             complement(join(4744588..4745088,4745260..4745381,
FT                   4745456..4745526,4745620..4745685,4746955..4747040))
FT                   /codon_start=1
FT                   /locus_tag="mCG_23492"
FT                   /product="mCG23492, isoform CRA_a"
FT                   /note="gene_id=mCG23492.1 transcript_id=mCT180313.0
FT                   protein_id=mCP103235.0 isoform=CRA_a"
FT                   /protein_id="EDL37312.1"
FT                   /translation="MFQWLMQALMLPLLLLPLGRAAPKDGVARLDPEVQQQLTPNPFQP
FT                   GPEQLRHLQNYLKGLEKMEEDPEHMDREQVLLSLFALHDYDQNGQLDGLELLSMLTAAL
FT                   APGAAHFPINPVILVVDSVLETQDLDGDGLMTPAELINFPEVPKHTESLPPALQEPQPA
FT                   GSQPLLANSPLQSETQQSLGTKEEIRGQVEAKRASLEPEQEAGHQTEGKVDTLSPEEEA
FT                   RGQAESEGDVPGPREGAEEQVEIKDNEGEAKELLVETLESLNTPNEAEAHSIQLENDEI
FT                   "
FT   CDS             complement(join(4744588..4745088,4745260..4745381,
FT                   4745456..4745526,4745620..4745685,4746955..4747040))
FT                   /codon_start=1
FT                   /locus_tag="mCG_23492"
FT                   /product="mCG23492, isoform CRA_a"
FT                   /note="gene_id=mCG23492.1 transcript_id=mCT23402.2
FT                   protein_id=mCP3982.2 isoform=CRA_a"
FT                   /protein_id="EDL37313.1"
FT                   /translation="MFQWLMQALMLPLLLLPLGRAAPKDGVARLDPEVQQQLTPNPFQP
FT                   GPEQLRHLQNYLKGLEKMEEDPEHMDREQVLLSLFALHDYDQNGQLDGLELLSMLTAAL
FT                   APGAAHFPINPVILVVDSVLETQDLDGDGLMTPAELINFPEVPKHTESLPPALQEPQPA
FT                   GSQPLLANSPLQSETQQSLGTKEEIRGQVEAKRASLEPEQEAGHQTEGKVDTLSPEEEA
FT                   RGQAESEGDVPGPREGAEEQVEIKDNEGEAKELLVETLESLNTPNEAEAHSIQLENDEI
FT                   "
FT   gene            4761164..4766187
FT                   /gene="Abhd1"
FT                   /locus_tag="mCG_23497"
FT                   /note="gene_id=mCG23497.1"
FT   mRNA            join(4761164..4761340,4763981..4764141,4764441..4764623,
FT                   4764765..4764810,4764977..4765089,4765189..4765363,
FT                   4765503..4765551,4765632..4765797,4765914..4766187)
FT                   /gene="Abhd1"
FT                   /locus_tag="mCG_23497"
FT                   /product="abhydrolase domain containing 1, transcript
FT                   variant mCT23406"
FT                   /note="gene_id=mCG23497.1 transcript_id=mCT23406.1 created
FT                   on 16-SEP-2002"
FT   mRNA            join(4761184..4761340,4764441..4764623,4764765..4764810,
FT                   4764977..4765089,4765189..4765363,4765503..4765551,
FT                   4765632..4765798)
FT                   /gene="Abhd1"
FT                   /locus_tag="mCG_23497"
FT                   /product="abhydrolase domain containing 1, transcript
FT                   variant mCT173424"
FT                   /note="gene_id=mCG23497.1 transcript_id=mCT173424.0 created
FT                   on 16-SEP-2002"
FT   CDS             join(4761203..4761340,4763981..4764141,4764441..4764623,
FT                   4764765..4764810,4764977..4765089,4765189..4765279)
FT                   /codon_start=1
FT                   /gene="Abhd1"
FT                   /locus_tag="mCG_23497"
FT                   /product="abhydrolase domain containing 1, isoform CRA_b"
FT                   /note="gene_id=mCG23497.1 transcript_id=mCT23406.1
FT                   protein_id=mCP3923.2 isoform=CRA_b"
FT                   /protein_id="EDL37315.1"
FT                   /translation="MEYPYTTKMLSSSLSPQNGTWSDTISLLLALGVALYLGYYWACVP
FT                   QRPRLVAGPQFLAFLEQHCPVTVETFYPTLWCFEGRLQTIFRVLLQSQPVVPYRSEVLQ
FT                   TPDGGQFLLDWAEQPNSTHYPDPTTQPIVLLLPGISGSSQEPYILHLVNQALKDGYRAV
FT                   VFNNRGCRGEELLTHRAYCASNTEDLETVVKHIKRRYSQAPLLAVGISFGGILVLNYLA
FT                   QTGKAGGLVAGLTIVCMLGFL"
FT   CDS             join(4761203..4761340,4764441..4764443)
FT                   /codon_start=1
FT                   /gene="Abhd1"
FT                   /locus_tag="mCG_23497"
FT                   /product="abhydrolase domain containing 1, isoform CRA_a"
FT                   /note="gene_id=mCG23497.1 transcript_id=mCT173424.0
FT                   protein_id=mCP96343.0 isoform=CRA_a"
FT                   /protein_id="EDL37314.1"
FT                   /translation="MEYPYTTKMLSSSLSPQNGTWSDTISLLLALGVALYLGYYWACVP
FT                   Q"
FT   gene            complement(4766141..4770973)
FT                   /gene="Preb"
FT                   /locus_tag="mCG_23495"
FT                   /note="gene_id=mCG23495.2"
FT   mRNA            complement(join(4766141..4766835,4767360..4767432,
FT                   4768580..4768753,4768925..4769049,4769163..4769243,
FT                   4769408..4769628,4769915..4770104,4770663..4770973))
FT                   /gene="Preb"
FT                   /locus_tag="mCG_23495"
FT                   /product="prolactin regulatory element binding, transcript
FT                   variant mCT180314"
FT                   /note="gene_id=mCG23495.2 transcript_id=mCT180314.0 created
FT                   on 18-FEB-2003"
FT   mRNA            complement(join(4766148..4766835,4767028..4767187,
FT                   4767360..4767432,4768580..4768753,4768925..4769049,
FT                   4769163..4769243,4769408..4769628,4769915..4770104,
FT                   4770663..4770932))
FT                   /gene="Preb"
FT                   /locus_tag="mCG_23495"
FT                   /product="prolactin regulatory element binding, transcript
FT                   variant mCT23405"
FT                   /note="gene_id=mCG23495.2 transcript_id=mCT23405.1 created
FT                   on 18-FEB-2003"
FT   CDS             complement(join(4766741..4766835,4767028..4767187,
FT                   4767360..4767432,4768580..4768753,4768925..4769049,
FT                   4769163..4769243,4769408..4769628,4769915..4770104,
FT                   4770663..4770797))
FT                   /codon_start=1
FT                   /gene="Preb"
FT                   /locus_tag="mCG_23495"
FT                   /product="prolactin regulatory element binding, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG23495.2 transcript_id=mCT23405.1
FT                   protein_id=mCP3904.1 isoform=CRA_c"
FT                   /db_xref="GOA:Q3UAP1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="MGI:MGI:1355326"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UAP1"
FT                   /protein_id="EDL37318.1"
FT                   /translation="MGRRRGVELYRAPFPLYALRIDPKTGLLIAAGGGGAAKTGIKNGV
FT                   HFLQLELINGCLSASLLHSHDTETRATMNLALAGDILAAGQDAQCQLLRFQVHQQKGSK
FT                   AEKSGSKEQGPRQRKGAPPAEKKSGAQVHPEGVELKVKNLEAVQTDFSNEPLQKVVCFN
FT                   HDNTLLATGGTDGHVRVWKVPSLEKVLEFKAHEGEIGDLTLGPDGKLVTVGWDFKASVW
FT                   QKDQLVTQLQWQENGPASSNTPYRYQACRFGQVPDQLGGLRLFTVQIPHKRLRQPPPCY
FT                   LTAWDSSTFLPLRTRSCGHEVISCLSVSDSGTFLGLGTVTGSVAIYIAFSLQRLYYVKE
FT                   AHGIVVTDVTFLPEKGCGPKLLGPHETALFSVAVDSRCQLHLLPSRRSVPVWLLLLLCV
FT                   GLIIVTILLLQTAFPGFL"
FT   mRNA            complement(join(<4766781..4766835,4768580..4768753,
FT                   4768925..4769049,4769163..>4769243))
FT                   /gene="Preb"
FT                   /locus_tag="mCG_23495"
FT                   /product="prolactin regulatory element binding, transcript
FT                   variant mCT173423"
FT                   /note="gene_id=mCG23495.2 transcript_id=mCT173423.0 created
FT                   on 18-FEB-2003"
FT   CDS             complement(join(<4766781..4766835,4768580..4768753,
FT                   4768925..4769049,4769163..>4769243))
FT                   /codon_start=1
FT                   /gene="Preb"
FT                   /locus_tag="mCG_23495"
FT                   /product="prolactin regulatory element binding, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG23495.2 transcript_id=mCT173423.0
FT                   protein_id=mCP96342.0 isoform=CRA_a"
FT                   /protein_id="EDL37316.1"
FT                   /translation="VPSLEKVLEFKAHEGEIGDLTLGPDGKLVTVGWDFKASVWQKDQL
FT                   VTQLQWQENGPASSNTPYRYQACRFGQVPDQLGGLRLFTVQIPHKRLRQPPPCYLTAWD
FT                   SSTFLPLRTRSCGHEVISCLSVRECSCMASAPAVCRPYYCD"
FT   CDS             complement(join(4766782..4766835,4767360..4767432,
FT                   4768580..4768753,4768925..4769049,4769163..4769243,
FT                   4769408..4769628,4769915..4770104,4770663..4770797))
FT                   /codon_start=1
FT                   /gene="Preb"
FT                   /locus_tag="mCG_23495"
FT                   /product="prolactin regulatory element binding, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG23495.2 transcript_id=mCT180314.0
FT                   protein_id=mCP103236.0 isoform=CRA_b"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="MGI:MGI:1355326"
FT                   /db_xref="UniProtKB/TrEMBL:D3Z3S1"
FT                   /protein_id="EDL37317.1"
FT                   /translation="MGRRRGVELYRAPFPLYALRIDPKTGLLIAAGGGGAAKTGIKNGV
FT                   HFLQLELINGCLSASLLHSHDTETRATMNLALAGDILAAGQDAQCQLLRFQVHQQKGSK
FT                   AEKSGSKEQGPRQRKGAPPAEKKSGAQVHPEGVELKVKNLEAVQTDFSNEPLQKVVCFN
FT                   HDNTLLATGGTDGHVRVWKVPSLEKVLEFKAHEGEIGDLTLGPDGKLVTVGWDFKASVW
FT                   QKDQLVTQLQWQENGPASSNTPYRYQACRFGQVPDQLGGLRLFTVQIPHKRLRQPPPCY
FT                   LTAWDSSTFLPLRTRSCGHEVISCLSVSDSGTFLGLGTVTGSVAIYIAFSLQGVFLYGF
FT                   CSCCVSALLL"
FT   assembly_gap    4778305..4778448
FT                   /estimated_length=144
FT                   /gap_type="unknown"
FT   gene            4779350..4787692
FT                   /gene="Tcf23"
FT                   /locus_tag="mCG_63988"
FT                   /note="gene_id=mCG63988.2"
FT   mRNA            join(4779350..4779671,4780749..4780991,4784156..4787692)
FT                   /gene="Tcf23"
FT                   /locus_tag="mCG_63988"
FT                   /product="transcription factor 23"
FT                   /note="gene_id=mCG63988.2 transcript_id=mCT64171.2 created
FT                   on 16-SEP-2002"
FT   CDS             join(4779453..4779671,4780749..4780991,4784156..4784323)
FT                   /codon_start=1
FT                   /gene="Tcf23"
FT                   /locus_tag="mCG_63988"
FT                   /product="transcription factor 23"
FT                   /note="gene_id=mCG63988.2 transcript_id=mCT64171.2
FT                   protein_id=mCP27017.2"
FT                   /protein_id="EDL37319.1"
FT                   /translation="MSQEATEAPAMPGEGHGHNKAKARWLLGTDRKRSRINRTRQDLWE
FT                   DTSWSNHRLSRATSAPRGTRARGTAHGRSEASPENAARERTRVKTLRQAFLALQAALPA
FT                   VPPDTKLSKLDVLVLATSYIAHLTRTLGHELPGPAWPPFVRGLRYLHPLKKWPMRSRLY
FT                   AGGLGCSDLDSTTAITTGQRCKDAELGSQDSVAAESLLTSPAFGNK"
FT   assembly_gap    4796474..4803376
FT                   /estimated_length=6903
FT                   /gap_type="unknown"
FT   assembly_gap    4817808..4817827
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4826523..4826857
FT                   /estimated_length=335
FT                   /gap_type="unknown"
FT   gene            complement(4839283..4852256)
FT                   /locus_tag="mCG_23491"
FT                   /note="gene_id=mCG23491.2"
FT   mRNA            complement(join(4839283..4840204,4840354..4840469,
FT                   4840660..4840763,4840965..4841143,4841265..4841351,
FT                   4842273..4842340,4842635..4842747,4843085..4843173,
FT                   4843693..4843822,4843989..4844129,4844475..4844629,
FT                   4844875..4844942,4845469..4845520,4845910..4845975,
FT                   4846281..4846763,4847844..4847922,4851039..4851201,
FT                   4852082..4852256))
FT                   /locus_tag="mCG_23491"
FT                   /product="mCG23491, transcript variant mCT23400"
FT                   /note="gene_id=mCG23491.2 transcript_id=mCT23400.2 created
FT                   on 02-OCT-2002"
FT   mRNA            complement(join(4839287..4840204,4840354..4840469,
FT                   4840660..4840763,4840965..4841143,4841265..4841351,
FT                   4842273..4842340,4842635..4842747,4843085..4843173,
FT                   4843693..4843822,4843989..4844129,4844475..4844629,
FT                   4844875..4844942,4845469..4845520,4845910..4845975,
FT                   4846281..4846790,4847844..4847922,4850960..4851129,
FT                   4852082..>4852254))
FT                   /locus_tag="mCG_23491"
FT                   /product="mCG23491, transcript variant mCT193617"
FT                   /note="gene_id=mCG23491.2 transcript_id=mCT193617.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(4839287..4840204,4840354..4840469,
FT                   4840660..4840763,4840965..4841143,4841265..4841351,
FT                   4842273..4842340,4842635..4842747,4843085..4843173,
FT                   4843693..4843822,4843989..4844129,4844475..4844629,
FT                   4844875..4844942,4845469..4845520,4845910..4845975,
FT                   4846281..4846790,4847844..4847922,4850960..4851129,
FT                   4851502..>4851580))
FT                   /locus_tag="mCG_23491"
FT                   /product="mCG23491, transcript variant mCT193616"
FT                   /note="gene_id=mCG23491.2 transcript_id=mCT193616.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(4840058..4840204,4840354..4840469,
FT                   4840660..4840763,4840965..4841143,4841265..4841351,
FT                   4842273..4842340,4842635..4842747,4843085..4843173,
FT                   4843693..4843822,4843989..4844129,4844475..4844629,
FT                   4844875..4844942,4845469..4845520,4845910..4845975,
FT                   4846281..>4846763))
FT                   /codon_start=1
FT                   /locus_tag="mCG_23491"
FT                   /product="mCG23491, isoform CRA_a"
FT                   /note="gene_id=mCG23491.2 transcript_id=mCT193616.0
FT                   protein_id=mCP114588.0 isoform=CRA_a"
FT                   /protein_id="EDL37320.1"
FT                   /translation="KRNAVRLNEEPSRDSSEPRSTKSLQSISTVRMSVASTAAPFHTTS
FT                   GSSGAISTFSVVDYVVFGLLLVLSLVIGLYHACRGWGHHTVGELLMADRKMGCLPVALS
FT                   LLATFQSAVAILGAPAEIFRFGTQYWFLGCSYFLGLLIPAHIFIPVFYRLHLTSAYEYL
FT                   ELRFNKAVRICGTVTFIFQMVIYMGVALYAPSLALNAVTGFDLWLSVLALGIVCNIYTA
FT                   LGGLKAVIWTDVFQTLVMFLGQLVVIIVGAARVGGLGHVWNVTSQHGLISGINLDPDPF
FT                   VRHTFWTLAFGGVFMMLSLYGVNQAQVQRYLSSHSERAAVLSCYAVFPCQQVALCMSCL
FT                   IGLVMFAYYNMYSMSPELKQAAPDQLVLYFVMDLLKDMPGLPGLFVACLFSGSLSTISS
FT                   AFNSLATVTMEDLIQPWFPQLTETRAIMLSRGLAFAYGLVCLGMAYISSHLGSVLQAAL
FT                   SIFGMVGGPLLGLFCLGLFFPCANPLGAIVGLLTGLTMAFWIGIGSIVSRMSSAVAPPP
FT                   LNGSSSFLPANVTVAAVTTVMPSTLSKPTGLQHFYSLSYLWYSAHNSTTVIVVGLIVSL
FT                   LTGGMRGRSLNPGTIYPVLPKLLALLPLSCQKRLCWRSHSQDIPVIPNLFPEKMRNGVL
FT                   QDSTDKERMAEDGLVHQPCSPTYVVQETSL"
FT   CDS             complement(join(4840058..4840204,4840354..4840469,
FT                   4840660..4840763,4840965..4841143,4841265..4841351,
FT                   4842273..4842340,4842635..4842747,4843085..4843173,
FT                   4843693..4843822,4843989..4844129,4844475..4844629,
FT                   4844875..4844942,4845469..4845520,4845910..4845975,
FT                   4846281..>4846763))
FT                   /codon_start=1
FT                   /locus_tag="mCG_23491"
FT                   /product="mCG23491, isoform CRA_a"
FT                   /note="gene_id=mCG23491.2 transcript_id=mCT193617.0
FT                   protein_id=mCP114589.0 isoform=CRA_a"
FT                   /protein_id="EDL37321.1"
FT                   /translation="KRNAVRLNEEPSRDSSEPRSTKSLQSISTVRMSVASTAAPFHTTS
FT                   GSSGAISTFSVVDYVVFGLLLVLSLVIGLYHACRGWGHHTVGELLMADRKMGCLPVALS
FT                   LLATFQSAVAILGAPAEIFRFGTQYWFLGCSYFLGLLIPAHIFIPVFYRLHLTSAYEYL
FT                   ELRFNKAVRICGTVTFIFQMVIYMGVALYAPSLALNAVTGFDLWLSVLALGIVCNIYTA
FT                   LGGLKAVIWTDVFQTLVMFLGQLVVIIVGAARVGGLGHVWNVTSQHGLISGINLDPDPF
FT                   VRHTFWTLAFGGVFMMLSLYGVNQAQVQRYLSSHSERAAVLSCYAVFPCQQVALCMSCL
FT                   IGLVMFAYYNMYSMSPELKQAAPDQLVLYFVMDLLKDMPGLPGLFVACLFSGSLSTISS
FT                   AFNSLATVTMEDLIQPWFPQLTETRAIMLSRGLAFAYGLVCLGMAYISSHLGSVLQAAL
FT                   SIFGMVGGPLLGLFCLGLFFPCANPLGAIVGLLTGLTMAFWIGIGSIVSRMSSAVAPPP
FT                   LNGSSSFLPANVTVAAVTTVMPSTLSKPTGLQHFYSLSYLWYSAHNSTTVIVVGLIVSL
FT                   LTGGMRGRSLNPGTIYPVLPKLLALLPLSCQKRLCWRSHSQDIPVIPNLFPEKMRNGVL
FT                   QDSTDKERMAEDGLVHQPCSPTYVVQETSL"
FT   CDS             complement(join(4840058..4840204,4840354..4840469,
FT                   4840660..4840763,4840965..4841143,4841265..4841351,
FT                   4842273..4842340,4842635..4842747,4843085..4843173,
FT                   4843693..4843822,4843989..4844129,4844475..4844629,
FT                   4844875..4844942,4845469..4845520,4845910..4845975,
FT                   4846281..4846670))
FT                   /codon_start=1
FT                   /locus_tag="mCG_23491"
FT                   /product="mCG23491, isoform CRA_b"
FT                   /note="gene_id=mCG23491.2 transcript_id=mCT23400.2
FT                   protein_id=mCP3971.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q5U4D8"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR018212"
FT                   /db_xref="MGI:MGI:2660847"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5U4D8"
FT                   /protein_id="EDL37322.1"
FT                   /translation="MSVASTAAPFHTTSGSSGAISTFSVVDYVVFGLLLVLSLVIGLYH
FT                   ACRGWGHHTVGELLMADRKMGCLPVALSLLATFQSAVAILGAPAEIFRFGTQYWFLGCS
FT                   YFLGLLIPAHIFIPVFYRLHLTSAYEYLELRFNKAVRICGTVTFIFQMVIYMGVALYAP
FT                   SLALNAVTGFDLWLSVLALGIVCNIYTALGGLKAVIWTDVFQTLVMFLGQLVVIIVGAA
FT                   RVGGLGHVWNVTSQHGLISGINLDPDPFVRHTFWTLAFGGVFMMLSLYGVNQAQVQRYL
FT                   SSHSERAAVLSCYAVFPCQQVALCMSCLIGLVMFAYYNMYSMSPELKQAAPDQLVLYFV
FT                   MDLLKDMPGLPGLFVACLFSGSLSTISSAFNSLATVTMEDLIQPWFPQLTETRAIMLSR
FT                   GLAFAYGLVCLGMAYISSHLGSVLQAALSIFGMVGGPLLGLFCLGLFFPCANPLGAIVG
FT                   LLTGLTMAFWIGIGSIVSRMSSAVAPPPLNGSSSFLPANVTVAAVTTVMPSTLSKPTGL
FT                   QHFYSLSYLWYSAHNSTTVIVVGLIVSLLTGGMRGRSLNPGTIYPVLPKLLALLPLSCQ
FT                   KRLCWRSHSQDIPVIPNLFPEKMRNGVLQDSTDKERMAEDGLVHQPCSPTYVVQETSL"
FT   assembly_gap    4841825..4841945
FT                   /estimated_length=121
FT                   /gap_type="unknown"
FT   gene            4851550..4857944
FT                   /gene="0610007C21Rik"
FT                   /locus_tag="mCG_23484"
FT                   /note="gene_id=mCG23484.1"
FT   mRNA            join(4851550..4852086,4852790..4852908,4855525..4855596,
FT                   4856091..4856212,4857283..4857380,4857585..4857944)
FT                   /gene="0610007C21Rik"
FT                   /locus_tag="mCG_23484"
FT                   /product="RIKEN cDNA 0610007C21, transcript variant
FT                   mCT23339"
FT                   /note="gene_id=mCG23484.1 transcript_id=mCT23339.1 created
FT                   on 13-FEB-2003"
FT   mRNA            join(4851565..4852086,4852790..4852908,4855525..4855596,
FT                   4855790..4855861,4856091..4856212,4857283..4857380,
FT                   4857585..4857944)
FT                   /gene="0610007C21Rik"
FT                   /locus_tag="mCG_23484"
FT                   /product="RIKEN cDNA 0610007C21, transcript variant
FT                   mCT173714"
FT                   /note="gene_id=mCG23484.1 transcript_id=mCT173714.0 created
FT                   on 13-FEB-2003"
FT   mRNA            join(4851969..4852086,4852790..4852908,4855525..4855596,
FT                   4855790..4855861,4856091..4856212,4857283..4857380,
FT                   4857637..>4857666)
FT                   /gene="0610007C21Rik"
FT                   /locus_tag="mCG_23484"
FT                   /product="RIKEN cDNA 0610007C21, transcript variant
FT                   mCT180256"
FT                   /note="gene_id=mCG23484.1 transcript_id=mCT180256.0 created
FT                   on 13-FEB-2003"
FT   mRNA            join(4851985..4852086,4852790..4852811,4855525..4855596,
FT                   4855790..4855861,4856091..4856212,4857283..4857380,
FT                   4857585..4857827)
FT                   /gene="0610007C21Rik"
FT                   /locus_tag="mCG_23484"
FT                   /product="RIKEN cDNA 0610007C21, transcript variant
FT                   mCT180257"
FT                   /note="gene_id=mCG23484.1 transcript_id=mCT180257.0 created
FT                   on 13-FEB-2003"
FT   CDS             join(4852003..4852086,4852790..4852908,4855525..4855596,
FT                   4855790..4855861,4856091..4856212,4857283..4857380,
FT                   4857585..4857689)
FT                   /codon_start=1
FT                   /gene="0610007C21Rik"
FT                   /locus_tag="mCG_23484"
FT                   /product="RIKEN cDNA 0610007C21, isoform CRA_a"
FT                   /note="gene_id=mCG23484.1 transcript_id=mCT173714.0
FT                   protein_id=mCP96633.0 isoform=CRA_a"
FT                   /db_xref="GOA:A8C1S6"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR013032"
FT                   /db_xref="MGI:MGI:1918918"
FT                   /db_xref="UniProtKB/TrEMBL:A8C1S6"
FT                   /protein_id="EDL37323.1"
FT                   /translation="MASRESGGSRAAALLLVLGVERALALPEICTLCPGGMHNLSRVAA
FT                   YCEDTSKLMQARCCLNQKGTILGLDLQNCSLKDPGPNFLQAYTAIIIDLQANPLKDDLA
FT                   NTFRGFTQLQTLILPQDVPCPGGSNAWDNVTSFKDKQICQGQRDLCNSTGSPEMCPENG
FT                   SCASDGPGLLQCVCADGFHGYKCMRQGSFSLLMFFGILGSTTLAISILLWGTQRRKAKA
FT                   S"
FT   CDS             join(4852003..4852086,4852790..4852908,4855525..4855596,
FT                   4856091..4856212,4857283..4857380,4857585..4857689)
FT                   /codon_start=1
FT                   /gene="0610007C21Rik"
FT                   /locus_tag="mCG_23484"
FT                   /product="RIKEN cDNA 0610007C21, isoform CRA_d"
FT                   /note="gene_id=mCG23484.1 transcript_id=mCT23339.1
FT                   protein_id=mCP3898.2 isoform=CRA_d"
FT                   /protein_id="EDL37326.1"
FT                   /translation="MASRESGGSRAAALLLVLGVERALALPEICTLCPGGMHNLSRVAA
FT                   YCEDTSKLMQARCCLNQKGTILGLDLQNCSLKDPGPNFLQAYTAIIMILPQDVPCPGGS
FT                   NAWDNVTSFKDKQICQGQRDLCNSTGSPEMCPENGSCASDGPGLLQCVCADGFHGYKCM
FT                   RQGSFSLLMFFGILGSTTLAISILLWGTQRRKAKAS"
FT   CDS             join(4852003..4852086,4852790..4852908,4855525..4855596,
FT                   4855790..4855861,4856091..4856212,4857283..4857380,
FT                   4857637..>4857666)
FT                   /codon_start=1
FT                   /gene="0610007C21Rik"
FT                   /locus_tag="mCG_23484"
FT                   /product="RIKEN cDNA 0610007C21, isoform CRA_b"
FT                   /note="gene_id=mCG23484.1 transcript_id=mCT180256.0
FT                   protein_id=mCP103179.0 isoform=CRA_b"
FT                   /protein_id="EDL37324.1"
FT                   /translation="MASRESGGSRAAALLLVLGVERALALPEICTLCPGGMHNLSRVAA
FT                   YCEDTSKLMQARCCLNQKGTILGLDLQNCSLKDPGPNFLQAYTAIIIDLQANPLKDDLA
FT                   NTFRGFTQLQTLILPQDVPCPGGSNAWDNVTSFKDKQICQGQRDLCNSTGSPEMCPENG
FT                   SCASDGPGLLQCVCADGFHGYKCMRQPSPFYFGEPS"
FT   CDS             join(4852003..4852086,4852790..4852811,4855525..4855529)
FT                   /codon_start=1
FT                   /gene="0610007C21Rik"
FT                   /locus_tag="mCG_23484"
FT                   /product="RIKEN cDNA 0610007C21, isoform CRA_c"
FT                   /note="gene_id=mCG23484.1 transcript_id=mCT180257.0
FT                   protein_id=mCP103178.0 isoform=CRA_c"
FT                   /protein_id="EDL37325.1"
FT                   /translation="MASRESGGSRAAALLLVLGVERALALPEICTLCPGG"
FT   gene            4858040..4883226
FT                   /gene="Cad"
FT                   /locus_tag="mCG_23490"
FT                   /note="gene_id=mCG23490.2"
FT   mRNA            join(4858040..4858358,4858565..4858707,4861395..4861524,
FT                   4862003..4862145,4862307..4862448,4862759..4862930,
FT                   4863105..4863290,4863425..4863537,4863807..4863952,
FT                   4864154..4864285,4864443..4864676,4864783..4865004,
FT                   4865104..4865292,4865527..4865651,4865788..4865918,
FT                   4870129..4870241,4870422..4870666,4870841..4871087,
FT                   4871547..4871645,4871804..4872028,4872115..4872297,
FT                   4872456..4872674,4872960..4873127,4873736..4873918,
FT                   4874009..4874113,4876610..4876849,4877047..4877128,
FT                   4877302..4877468,4877563..4877727,4877887..4878018,
FT                   4878236..4878437,4878743..4878933,4879015..4879155,
FT                   4879339..4879464,4879834..4879930,4880554..4880598,
FT                   4880700..4880869,4880963..4881037,4881420..4881632,
FT                   4881840..4881965,4882098..4882253,4882342..4882443,
FT                   4882636..4882730,4882840..4883226)
FT                   /gene="Cad"
FT                   /locus_tag="mCG_23490"
FT                   /product="carbamoyl-phosphate synthetase 2, aspartate
FT                   transcarbamylase, and dihydroorotase, transcript variant
FT                   mCT173719"
FT                   /note="gene_id=mCG23490.2 transcript_id=mCT173719.0 created
FT                   on 25-SEP-2002"
FT   mRNA            join(4858040..4858358,4858565..4858704,4861395..4861524,
FT                   4862003..4862191,4862329..4862448,4862759..4862930,
FT                   4863105..4863290,4863425..4863537,4863807..4863952,
FT                   4864154..4864285,4864443..4864676,4864783..4865004,
FT                   4865104..4865292,4865527..4865651,4865788..4865918,
FT                   4870129..4870241,4870422..4870666,4870841..4871087,
FT                   4871547..4871645,4871804..4872028,4872115..4872297,
FT                   4872456..4872674,4872960..4873127,4873736..4873918,
FT                   4874009..4874179,4876672..4876864,4877256..4877468,
FT                   4877563..4877727,4877887..4878018,4878236..4878437,
FT                   4878743..4878940,4879040..4879253,4880931..4881115,
FT                   4881349..4881632,4881840..4881965,4882098..4882253,
FT                   4882342..4882443,4882636..4882730,4882840..4883226)
FT                   /gene="Cad"
FT                   /locus_tag="mCG_23490"
FT                   /product="carbamoyl-phosphate synthetase 2, aspartate
FT                   transcarbamylase, and dihydroorotase, transcript variant
FT                   mCT173717"
FT                   /note="gene_id=mCG23490.2 transcript_id=mCT173717.0 created
FT                   on 25-SEP-2002"
FT   mRNA            join(4858040..4858358,4858565..4858704,4861395..4861524,
FT                   4862003..4862177,4862279..4862448,4862759..4862930,
FT                   4863105..4863290,4863425..4863537,4863807..4863952,
FT                   4864154..4864285,4864443..4864676,4864783..4865004,
FT                   4865104..4865292,4865527..4865651,4865788..4865918,
FT                   4870129..4870241,4870422..4870666,4870841..4871087,
FT                   4871547..4871645,4871804..4872028,4872115..4872297,
FT                   4872456..4872674,4872960..4873127,4873736..4873918,
FT                   4874009..4874117,4876685..4876877,4877069..4877128,
FT                   4877302..4877468,4877563..4877727,4877887..4878018,
FT                   4878236..4878437,4878743..4878933,4879015..4879159,
FT                   4880458..4880598,4880700..4880869,4880963..4881037,
FT                   4881420..4881632,4881840..4881965,4882098..4882253,
FT                   4882348..4882443,4882636..4882730,4882840..4883226)
FT                   /gene="Cad"
FT                   /locus_tag="mCG_23490"
FT                   /product="carbamoyl-phosphate synthetase 2, aspartate
FT                   transcarbamylase, and dihydroorotase, transcript variant
FT                   mCT173718"
FT                   /note="gene_id=mCG23490.2 transcript_id=mCT173718.0 created
FT                   on 25-SEP-2002"
FT   mRNA            join(4858040..4858358,4858565..4858704,4861395..4861524,
FT                   4862003..4862145,4862307..4862448,4862759..4862930,
FT                   4863105..4863290,4863425..4863537,4863807..4863952,
FT                   4864154..4864285,4864443..4864676,4864783..4865004,
FT                   4865104..4865292,4865527..4865651,4865788..4865918,
FT                   4870129..4870241,4870422..4870666,4870841..4871087,
FT                   4871547..4871645,4871804..4872028,4872115..4872297,
FT                   4872456..4872674,4872960..4873127,4873736..4873918,
FT                   4874009..4874113,4876610..4876849,4877047..4877128,
FT                   4877302..4877468,4877563..4877727,4877887..4878018,
FT                   4878236..4878437,4878743..4878933,4879015..4879155,
FT                   4879339..4879440,4879834..4879930,4880554..4880598,
FT                   4880700..4880869,4880963..4881037,4881420..4881632,
FT                   4881840..4881965,4882098..4882253,4882342..4882443,
FT                   4882636..4882730,4882840..4883226)
FT                   /gene="Cad"
FT                   /locus_tag="mCG_23490"
FT                   /product="carbamoyl-phosphate synthetase 2, aspartate
FT                   transcarbamylase, and dihydroorotase, transcript variant
FT                   mCT23399"
FT                   /note="gene_id=mCG23490.2 transcript_id=mCT23399.2 created
FT                   on 25-SEP-2002"
FT   mRNA            join(4858040..4858358,4858565..4858704,4862003..4862145,
FT                   4862307..4862448,4862759..4862930,4863105..4863290,
FT                   4863686..4863952,4864154..4864285,4864443..4864676,
FT                   4864783..4865004,4865104..4865292,4865527..4865651,
FT                   4865788..4865918,4870129..4870241,4870422..4870666,
FT                   4870841..4871087,4871547..4871669,4871825..4872028,
FT                   4872115..4872297,4872456..4872674,4872960..4873127,
FT                   4873736..4873918,4874009..4874113,4876610..4876849,
FT                   4877047..4877128,4877302..4877468,4877563..4877727,
FT                   4877887..4878018,4878236..4878437,4878743..4878933,
FT                   4879015..4879155,4879834..4879930,4880673..4880869,
FT                   4880963..4881037,4881420..4881626,4881809..4881965,
FT                   4882098..4882253,4882342..4882443,4882636..4882730,
FT                   4882840..4883226)
FT                   /gene="Cad"
FT                   /locus_tag="mCG_23490"
FT                   /product="carbamoyl-phosphate synthetase 2, aspartate
FT                   transcarbamylase, and dihydroorotase, transcript variant
FT                   mCT173720"
FT                   /note="gene_id=mCG23490.2 transcript_id=mCT173720.0 created
FT                   on 25-SEP-2002"
FT   CDS             join(4858277..4858358,4858565..4858707,4861395..4861524,
FT                   4862003..4862145,4862307..4862448,4862759..4862930,
FT                   4863105..4863290,4863425..4863537,4863807..4863952,
FT                   4864154..4864285,4864443..4864676,4864783..4865004,
FT                   4865104..4865292,4865527..4865651,4865788..4865918,
FT                   4870129..4870241,4870422..4870666,4870841..4871087,
FT                   4871547..4871645,4871804..4872028,4872115..4872297,
FT                   4872456..4872674,4872960..4873127,4873736..4873918,
FT                   4874009..4874113,4876610..4876849,4877047..4877128,
FT                   4877302..4877468,4877563..4877727,4877887..4878018,
FT                   4878236..4878437,4878743..4878933,4879015..4879155,
FT                   4879339..4879464,4879834..4879930,4880554..4880598,
FT                   4880700..4880869,4880963..4881037,4881420..4881632,
FT                   4881840..4881965,4882098..4882253,4882342..4882443,
FT                   4882636..4882730,4882840..4882942)
FT                   /codon_start=1
FT                   /gene="Cad"
FT                   /locus_tag="mCG_23490"
FT                   /product="carbamoyl-phosphate synthetase 2, aspartate
FT                   transcarbamylase, and dihydroorotase, isoform CRA_d"
FT                   /note="gene_id=mCG23490.2 transcript_id=mCT173719.0
FT                   protein_id=mCP96639.0 isoform=CRA_d"
FT                   /protein_id="EDL37330.1"
FT                   /translation="MAALVLEDGSVLQGRPFGAAVSTAGEVVFQTGMVGYPEALTDPSY
FT                   KAQILVLTYPLIGNYGIPSDEEDEFGLSKVWFESSEIHVAGLVVGECCPTPSHWSANCT
FT                   LHEWLQQRGIPGLQGVDTRELTKKLREQGSLLGKLVQKGTEPSALPFVDPNARPLAPEV
FT                   SIKTPRVFNAGGAPRICALDCGLKYNQIRCLCQLGAEVTVVPWDHELDSQKYDGLFLSN
FT                   GPGDPASYPGVVSTLSRVLSEPNPRPVFGICLGHQLLALAIGAKTYKMRYGNRGHNQPC
FT                   LLVGTGRCFLTSQNHGFAVDADSLPAGWAPLFTNANDCSNEGIVHDSLPFFSVQFHPEH
FT                   RAGPSDMELLFDVFLETVREAAAGNIGGQTVRERLAQRLCPPELPIPGSGLPPPRKVLI
FT                   LGSGGLSIGQAGEFDYSGSQAIKALKEENIQTLLINPNIATVQTSQGLADKVYFLPITL
FT                   HYVTQVIRNERPDGVLLTFGGQTALNCGVELTKAGVLARYGVRVLGTPVETIELTEDRR
FT                   AFAARMAEIGEHVAPSEAANSLEQAQAAAERLGYPVLVRAAFALGGLGSGFASTKEELS
FT                   ALVAPAFAHTSQVLIDKSLKGWKEIEYEVVRDAYGNCVTVCNMENLDPLGIHTGESIVV
FT                   APSQTLNDREYQLLRRTAIKVTQHLGIVGECNVQYALNPESEQYYIIEVNARLSRSSAL
FT                   ASKATGYPLAYVAAKLALGIPLPELRNSVTGGTAAFEPSLDYCVVKIPRWDLSKFLRVS
FT                   TKIGSCMKSVGEVMGIGRSFEEAFQKALRMVDENCVGFDHTVKPVSDMELETPTDKRIF
FT                   VVAAALWAGYSVERLYELTRIDCWFLHRMKRIVTHAQLLEQHRGQALPQDLLHQAKCLG
FT                   FSDKQIALAVLSTELAVRKLRQELGICPAVKQIDTVAAEWPAQTNYLYLTYWGNTHDLD
FT                   FRAPHVLVLGSGVYRIGSSVEFDWCAVGCIQQLRKMGYKTIMVNYNPETVSTDYDMCDR
FT                   LYFDEISFEVVMDIYELENPEGVILSMGGQLPNNMAMALHRQQCRVLGTSPEAIDSAEN
FT                   RFKFSRLLDTIGISQPQWRELSDLESARQFCHTVGYPCVVRPSYVLSGAAMNVAYTDGD
FT                   LERFLSSAAAVSKEHPVVISKFIQEAKEIDVDAVACDGIVSAIAISEHVENAGVHSGDA
FT                   TLVTPPQDITPKTLERIKAIVHAVGQELQVTGPFNLQLIAKDDQLKVIECNVRVSRSFP
FT                   FVSKTLGVDLVALATRIIMGEKVEPVGLMTGSGVVGVKVPQFSFSRLAGADVVLGVEMT
FT                   STGEVAGFGESRCEAYLKAMLSTGFKIPEKNILLTIGSYKNKSELLPTVRLLESLGYSL
FT                   YASLGTADFYTEHGVKVTAVDWHFEEAVDGECPPQRSILDQLAENHFELVINLSMRGAG
FT                   GRRLSSFVTKGYRTRRLAADFSVPLIIDIKCTKLFVEALGQIGPAPPLKVHVDCMTSQK
FT                   LVRLPGLIDVHVHLREPGGTHKEDFASGTAAALAGGVTMVCAMPNTRPPIIDAPALALA
FT                   QKLAEAGARCDFTLFLGASSENAGTLGAVAGSAAGLKLYLNETFSELRLDSVAQWMEHF
FT                   ETWPAHLPIVAHAERQSVAAVLMVAQLTQRPVHICHVARKEEILLIKTAKAQGLPVTCE
FT                   VAPHHLFLNREDLERLGPGKGEVRPELGSREDMEALWENMAVIDCFASDHAPHTLEEKC
FT                   GPKPPPGFPGLETMLPLLLTAVSEGRLSLDDLLQRLHHNPRRIFHLPLQEDTYVEVDLE
FT                   HEWTVPSHMPFSKARWTPFEGQKVKGTVRRVVLRGEVAYIDGQVLVPPGYGQDVRKWPQ
FT                   GVVPQPPPSTPATTEITTVTTLPLGWTPERPRRVIPGLPDGRFHLPPRIHRASDPGLPA
FT                   EEPKEKPPRKVVEPELMGTPDGPCYPAPPVPRQASPQNLGSSGLLHPQMSPLLHSLVGQ
FT                   HILSVKQFTKDQMSHLFNVAHTLRMMVQKERSLDILKGKVMASMFYEVSTRTSSSFAAA
FT                   MARLGGAVLSFSEATSSVQKGESLADSVQTMSCYADVIVLRHPQPGAVELAAKHCRRPV
FT                   INAGDGVGEHPTQALLDIFTIREELGTVNGMTITMVGDLKHGRTVHSLACLLTQYRVSL
FT                   RYVAPPSLRMPPSVRDFVASRGTKQEEFESIEEALPDTDVLYMTRIQKERFGSVQEYEA
FT                   CFGQFILTPHIMTRAKKKMVVMHPMPRVNEISVEVDSDPRAAYFRQAENGMYIRMALLA
FT                   TVLGRF"
FT   CDS             join(4858277..4858358,4858565..4858704,4861395..4861524,
FT                   4862003..4862145,4862307..4862448,4862759..4862930,
FT                   4863105..4863290,4863425..4863537,4863807..4863952,
FT                   4864154..4864285,4864443..4864676,4864783..4865004,
FT                   4865104..4865292,4865527..4865651,4865788..4865918,
FT                   4870129..4870241,4870422..4870666,4870841..4871087,
FT                   4871547..4871645,4871804..4872028,4872115..4872297,
FT                   4872456..4872674,4872960..4873127,4873736..4873918,
FT                   4874009..4874113,4876610..4876849,4877047..4877128,
FT                   4877302..4877468,4877563..4877727,4877887..4878018,
FT                   4878236..4878437,4878743..4878933,4879015..4879155,
FT                   4879339..4879440,4879834..4879930,4880554..4880598,
FT                   4880700..4880869,4880963..4881037,4881420..4881632,
FT                   4881840..4881965,4882098..4882253,4882342..4882443,
FT                   4882636..4882730,4882840..4882942)
FT                   /codon_start=1
FT                   /gene="Cad"
FT                   /locus_tag="mCG_23490"
FT                   /product="carbamoyl-phosphate synthetase 2, aspartate
FT                   transcarbamylase, and dihydroorotase, isoform CRA_c"
FT                   /note="gene_id=mCG23490.2 transcript_id=mCT23399.2
FT                   protein_id=mCP4018.2 isoform=CRA_c"
FT                   /db_xref="GOA:B2RQC6"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="MGI:MGI:1916969"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2RQC6"
FT                   /protein_id="EDL37329.1"
FT                   /translation="MAALVLEDGSVLQGRPFGAAVSTAGEVVFQTGMVGYPEALTDPSY
FT                   KAQILVLTYPLIGNYGIPSDEEDEFGLSKWFESSEIHVAGLVVGECCPTPSHWSANCTL
FT                   HEWLQQRGIPGLQGVDTRELTKKLREQGSLLGKLVQKGTEPSALPFVDPNARPLAPEVS
FT                   IKTPRVFNAGGAPRICALDCGLKYNQIRCLCQLGAEVTVVPWDHELDSQKYDGLFLSNG
FT                   PGDPASYPGVVSTLSRVLSEPNPRPVFGICLGHQLLALAIGAKTYKMRYGNRGHNQPCL
FT                   LVGTGRCFLTSQNHGFAVDADSLPAGWAPLFTNANDCSNEGIVHDSLPFFSVQFHPEHR
FT                   AGPSDMELLFDVFLETVREAAAGNIGGQTVRERLAQRLCPPELPIPGSGLPPPRKVLIL
FT                   GSGGLSIGQAGEFDYSGSQAIKALKEENIQTLLINPNIATVQTSQGLADKVYFLPITLH
FT                   YVTQVIRNERPDGVLLTFGGQTALNCGVELTKAGVLARYGVRVLGTPVETIELTEDRRA
FT                   FAARMAEIGEHVAPSEAANSLEQAQAAAERLGYPVLVRAAFALGGLGSGFASTKEELSA
FT                   LVAPAFAHTSQVLIDKSLKGWKEIEYEVVRDAYGNCVTVCNMENLDPLGIHTGESIVVA
FT                   PSQTLNDREYQLLRRTAIKVTQHLGIVGECNVQYALNPESEQYYIIEVNARLSRSSALA
FT                   SKATGYPLAYVAAKLALGIPLPELRNSVTGGTAAFEPSLDYCVVKIPRWDLSKFLRVST
FT                   KIGSCMKSVGEVMGIGRSFEEAFQKALRMVDENCVGFDHTVKPVSDMELETPTDKRIFV
FT                   VAAALWAGYSVERLYELTRIDCWFLHRMKRIVTHAQLLEQHRGQALPQDLLHQAKCLGF
FT                   SDKQIALAVLSTELAVRKLRQELGICPAVKQIDTVAAEWPAQTNYLYLTYWGNTHDLDF
FT                   RAPHVLVLGSGVYRIGSSVEFDWCAVGCIQQLRKMGYKTIMVNYNPETVSTDYDMCDRL
FT                   YFDEISFEVVMDIYELENPEGVILSMGGQLPNNMAMALHRQQCRVLGTSPEAIDSAENR
FT                   FKFSRLLDTIGISQPQWRELSDLESARQFCHTVGYPCVVRPSYVLSGAAMNVAYTDGDL
FT                   ERFLSSAAAVSKEHPVVISKFIQEAKEIDVDAVACDGIVSAIAISEHVENAGVHSGDAT
FT                   LVTPPQDITPKTLERIKAIVHAVGQELQVTGPFNLQLIAKDDQLKVIECNVRVSRSFPF
FT                   VSKTLGVDLVALATRIIMGEKVEPVGLMTGSGVVGVKVPQFSFSRLAGADVVLGVEMTS
FT                   TGEVAGFGESRCEAYLKAMLSTGFKIPEKNILLTIGSYKNKSELLPTVRLLESLGYSLY
FT                   ASLGTADFYTEHGVKVTAVDWHFEEAVDGECPPQRSILDQLAENHFELVINLSMRGAGG
FT                   RRLSSFVTKGYRTRRLAADFSVPLIIDIKCTKLFVEALGQIGPAPPLKVHVDCMTSQKL
FT                   VRLPGLIDVHVHLREPGGTHKEDFASGTAAALAGGVTMVCAMPNTRPPIIDAPALALAQ
FT                   KLAEAGARCDFTLFLGASSENAGTLGAVAGSAAGLKLYLNETFSELRLDSVAQWMEHFE
FT                   TWPAHLPIVAHAERQSVAAVLMVAQLTQRPVHICHVARKEEILLIKTAKAQGLPVTCEV
FT                   APHHLFLNREDLERLGPGKGEVRPELGSREDMEALWENMAVIDCFASDHAPHTLEEKCG
FT                   PKPPPGFPGLETMLPLLLTAVSEGRLSLDDLLQRLHHNPRRIFHLPLQEDTYVEVDLEH
FT                   EWTVPSHMPFSKARWTPFEGQKVKGTVRRVVLRGEVAYIDGQVLVPPGYGQDVRKWPQG
FT                   VVPQPPPSTPATTEITTTPERPRRVIPGLPDGRFHLPPRIHRASDPGLPAEEPKEKPPR
FT                   KVVEPELMGTPDGPCYPAPPVPRQASPQNLGSSGLLHPQMSPLLHSLVGQHILSVKQFT
FT                   KDQMSHLFNVAHTLRMMVQKERSLDILKGKVMASMFYEVSTRTSSSFAAAMARLGGAVL
FT                   SFSEATSSVQKGESLADSVQTMSCYADVIVLRHPQPGAVELAAKHCRRPVINAGDGVGE
FT                   HPTQALLDIFTIREELGTVNGMTITMVGDLKHGRTVHSLACLLTQYRVSLRYVAPPSLR
FT                   MPPSVRDFVASRGTKQEEFESIEEALPDTDVLYMTRIQKERFGSVQEYEACFGQFILTP
FT                   HIMTRAKKKMVVMHPMPRVNEISVEVDSDPRAAYFRQAENGMYIRMALLATVLGRF"
FT   CDS             join(4858277..4858358,4858565..4858704,4861395..4861524,
FT                   4862003..4862191,4862329..4862448,4862759..4862930,
FT                   4863105..4863290,4863425..4863537,4863807..4863952,
FT                   4864154..4864285,4864443..4864676,4864783..4865004,
FT                   4865104..4865292,4865527..4865651,4865788..4865918,
FT                   4870129..4870241,4870422..4870666,4870841..4871087,
FT                   4871547..4871645,4871804..4872028,4872115..4872297,
FT                   4872456..4872674,4872960..4873127,4873736..4873918,
FT                   4874009..4874179,4876672..4876692)
FT                   /codon_start=1
FT                   /gene="Cad"
FT                   /locus_tag="mCG_23490"
FT                   /product="carbamoyl-phosphate synthetase 2, aspartate
FT                   transcarbamylase, and dihydroorotase, isoform CRA_a"
FT                   /note="gene_id=mCG23490.2 transcript_id=mCT173717.0
FT                   protein_id=mCP96636.0 isoform=CRA_a"
FT                   /protein_id="EDL37327.1"
FT                   /translation="MAALVLEDGSVLQGRPFGAAVSTAGEVVFQTGMVGYPEALTDPSY
FT                   KAQILVLTYPLIGNYGIPSDEEDEFGLSKWFESSEIHVAGLVVGECCPTPSHWSANCTL
FT                   HEWLQQRGIPGLQGVDTRELTKKLREQGSLLGKLVQKGTEPSALPFVDPNARPLAPEVS
FT                   IKVQRKRIGHVCRWKTSGGAPRICALDCGLKYNQIRCLCQLGAEVTVVPWDHELDSQKY
FT                   DGLFLSNGPGDPASYPGVVSTLSRVLSEPNPRPVFGICLGHQLLALAIGAKTYKMRYGN
FT                   RGHNQPCLLVGTGRCFLTSQNHGFAVDADSLPAGWAPLFTNANDCSNEGIVHDSLPFFS
FT                   VQFHPEHRAGPSDMELLFDVFLETVREAAAGNIGGQTVRERLAQRLCPPELPIPGSGLP
FT                   PPRKVLILGSGGLSIGQAGEFDYSGSQAIKALKEENIQTLLINPNIATVQTSQGLADKV
FT                   YFLPITLHYVTQVIRNERPDGVLLTFGGQTALNCGVELTKAGVLARYGVRVLGTPVETI
FT                   ELTEDRRAFAARMAEIGEHVAPSEAANSLEQAQAAAERLGYPVLVRAAFALGGLGSGFA
FT                   STKEELSALVAPAFAHTSQVLIDKSLKGWKEIEYEVVRDAYGNCVTVCNMENLDPLGIH
FT                   TGESIVVAPSQTLNDREYQLLRRTAIKVTQHLGIVGECNVQYALNPESEQYYIIEVNAR
FT                   LSRSSALASKATGYPLAYVAAKLALGIPLPELRNSVTGGTAAFEPSLDYCVVKIPRWDL
FT                   SKFLRVSTKIGSCMKSVGEVMGIGRSFEEAFQKALRMVDENCVGFDHTVKPVSDMELET
FT                   PTDKRIFVVAAALWAGYSVERLYELTRIDCWFLHRMKRIVTHAQLLEQHRGQALPQDLL
FT                   HQAKCLGFSDKQIALAVLSTELAVRKLRQELGICPAVKQIDTVAAEWPAQTNYLYLTYW
FT                   GNTHDLDFRAPHVLVLGSGVYRIGSSVEFDWCAVGCIQQLRKMGYKTIMVNYNPETVST
FT                   DYDMCDRLYFDEISFEVVMDIYELENPEGVILSMGGQLPNNMAMALHRQQCRVLGTSPE
FT                   AIDSAENRFKFSRLLDTIGISQPQWRELSDLESARQFCHTVGYPCVVRPSYVLSGAAMN
FT                   VAYTDGDLERFLSSAAAVSKEHPVVISKFIQEAKEIDVDAVACDGIVSAIAISEHVENA
FT                   GVHSGDATLVTPPQDITPKTLERIKAIVHAVGQELQVTGPFNLQLIAKDDQLKVIECNV
FT                   RVSRSFPFVSKTLGVDLVALATRIIMGEKVEPVGLMTGSGVVGVKVPQFSFSRLAGADV
FT                   VLGVEMTSTGEVAGFGESRCEAYLKAMLSTGFKIPEKNILLTIGSYKNKSELLPTVRLL
FT                   ESLGYSLYASLGTADFYTEHGVKVCGHLPLSPRPQRTLSFSLCPRHLGSAG"
FT   CDS             join(4858277..4858358,4858565..4858704,4861395..4861524,
FT                   4862003..4862177,4862279..4862448,4862759..4862930,
FT                   4863105..4863290,4863425..4863537,4863807..4863952,
FT                   4864154..4864285,4864443..4864676,4864783..4865004,
FT                   4865104..4865292,4865527..4865651,4865788..4865918,
FT                   4870129..4870241,4870422..4870666,4870841..4871087,
FT                   4871547..4871645,4871804..4872028,4872115..4872297,
FT                   4872456..4872674,4872960..4873127,4873736..4873918,
FT                   4874009..4874117,4876685..4876692)
FT                   /codon_start=1
FT                   /gene="Cad"
FT                   /locus_tag="mCG_23490"
FT                   /product="carbamoyl-phosphate synthetase 2, aspartate
FT                   transcarbamylase, and dihydroorotase, isoform CRA_b"
FT                   /note="gene_id=mCG23490.2 transcript_id=mCT173718.0
FT                   protein_id=mCP96637.0 isoform=CRA_b"
FT                   /protein_id="EDL37328.1"
FT                   /translation="MAALVLEDGSVLQGRPFGAAVSTAGEVVFQTGMVGYPEALTDPSY
FT                   KAQILVLTYPLIGNYGIPSDEEDEFGLSKWFESSEIHVAGLVVGECCPTPSHWSANCTL
FT                   HEWLQQRGIPGLQGVDTRELTKKLREQGSLLGKLVQKGTEPSALPFVDPNARPLAPEVS
FT                   IKVQRKRIGHVCSCQLSVLSPQTPRVFNAGGAPRICALDCGLKYNQIRCLCQLGAEVTV
FT                   VPWDHELDSQKYDGLFLSNGPGDPASYPGVVSTLSRVLSEPNPRPVFGICLGHQLLALA
FT                   IGAKTYKMRYGNRGHNQPCLLVGTGRCFLTSQNHGFAVDADSLPAGWAPLFTNANDCSN
FT                   EGIVHDSLPFFSVQFHPEHRAGPSDMELLFDVFLETVREAAAGNIGGQTVRERLAQRLC
FT                   PPELPIPGSGLPPPRKVLILGSGGLSIGQAGEFDYSGSQAIKALKEENIQTLLINPNIA
FT                   TVQTSQGLADKVYFLPITLHYVTQVIRNERPDGVLLTFGGQTALNCGVELTKAGVLARY
FT                   GVRVLGTPVETIELTEDRRAFAARMAEIGEHVAPSEAANSLEQAQAAAERLGYPVLVRA
FT                   AFALGGLGSGFASTKEELSALVAPAFAHTSQVLIDKSLKGWKEIEYEVVRDAYGNCVTV
FT                   CNMENLDPLGIHTGESIVVAPSQTLNDREYQLLRRTAIKVTQHLGIVGECNVQYALNPE
FT                   SEQYYIIEVNARLSRSSALASKATGYPLAYVAAKLALGIPLPELRNSVTGGTAAFEPSL
FT                   DYCVVKIPRWDLSKFLRVSTKIGSCMKSVGEVMGIGRSFEEAFQKALRMVDENCVGFDH
FT                   TVKPVSDMELETPTDKRIFVVAAALWAGYSVERLYELTRIDCWFLHRMKRIVTHAQLLE
FT                   QHRGQALPQDLLHQAKCLGFSDKQIALAVLSTELAVRKLRQELGICPAVKQIDTVAAEW
FT                   PAQTNYLYLTYWGNTHDLDFRAPHVLVLGSGVYRIGSSVEFDWCAVGCIQQLRKMGYKT
FT                   IMVNYNPETVSTDYDMCDRLYFDEISFEVVMDIYELENPEGVILSMGGQLPNNMAMALH
FT                   RQQCRVLGTSPEAIDSAENRFKFSRLLDTIGISQPQWRELSDLESARQFCHTVGYPCVV
FT                   RPSYVLSGAAMNVAYTDGDLERFLSSAAAVSKEHPVVISKFIQEAKEIDVDAVACDGIV
FT                   SAIAISEHVENAGVHSGDATLVTPPQDITPKTLERIKAIVHAVGQELQVTGPFNLQLIA
FT                   KDDQLKVIECNVRVSRSFPFVSKTLGVDLVALATRIIMGEKVEPVGLMTGSGVVGVKVP
FT                   QFSFSRLAGADVVLGVEMTSTGEVAGFGESRCEAYLKAMLSTGFKIPEKNILLTIGSYK
FT                   NKSELLPTVRLLESLGYSLYASLGTADFYTEHGVKVSG"
FT   CDS             join(4858277..4858358,4858565..4858704,4862003..4862023)
FT                   /codon_start=1
FT                   /gene="Cad"
FT                   /locus_tag="mCG_23490"
FT                   /product="carbamoyl-phosphate synthetase 2, aspartate
FT                   transcarbamylase, and dihydroorotase, isoform CRA_e"
FT                   /note="gene_id=mCG23490.2 transcript_id=mCT173720.0
FT                   protein_id=mCP96638.0 isoform=CRA_e"
FT                   /protein_id="EDL37331.1"
FT                   /translation="MAALVLEDGSVLQGRPFGAAVSTAGEVVFQTGMVGYPEALTDPSY
FT                   KAQILVLTYPLIGNYGIPSDEEDEFGLSKEWTLGS"
FT   assembly_gap    4875640..4875659
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4884079..4884098
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4886734..4888059
FT                   /estimated_length=1326
FT                   /gap_type="unknown"
FT   assembly_gap    4889887..4889906
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4891986..4892005
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4893665..4893684
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4895510..4895529
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(4895858..>4904207)
FT                   /gene="Slc30a3"
FT                   /locus_tag="mCG_23488"
FT                   /note="gene_id=mCG23488.1"
FT   mRNA            complement(join(4895858..4896670,4897699..4897841,
FT                   4898055..4898160,4898358..4898556,4899067..4899220,
FT                   4899302..4899448,4899804..4899985,4903011..4903246))
FT                   /gene="Slc30a3"
FT                   /locus_tag="mCG_23488"
FT                   /product="solute carrier family 30 (zinc transporter),
FT                   member 3, transcript variant mCT23397"
FT                   /note="gene_id=mCG23488.1 transcript_id=mCT23397.1 created
FT                   on 16-SEP-2002"
FT   mRNA            complement(join(4895858..4896670,4897707..4897841,
FT                   4898055..4898160,4898358..4898556,4899067..4899220,
FT                   4899302..4899448,4899804..4899985,4903011..>4903233))
FT                   /gene="Slc30a3"
FT                   /locus_tag="mCG_23488"
FT                   /product="solute carrier family 30 (zinc transporter),
FT                   member 3, transcript variant mCT193589"
FT                   /note="gene_id=mCG23488.1 transcript_id=mCT193589.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(4896522..4896670,4897707..4897841,
FT                   4898055..4898160,4898358..4898556,4899067..4899220,
FT                   4899302..4899448,4899804..4899985,4903011..>4903231))
FT                   /codon_start=1
FT                   /gene="Slc30a3"
FT                   /locus_tag="mCG_23488"
FT                   /product="solute carrier family 30 (zinc transporter),
FT                   member 3, isoform CRA_b"
FT                   /note="gene_id=mCG23488.1 transcript_id=mCT193589.0
FT                   protein_id=mCP114587.0 isoform=CRA_b"
FT                   /protein_id="EDL37333.1"
FT                   /translation="RSSLHTGGPAGSPSGPWTARIWRKACPASPPLCGLDGLGSGDMEP
FT                   SLATGGSETTRLVSARDRSSAGGGLRLKSLFTEPSEPLPEEPKLEGMAFHHCHKDPVPQ
FT                   SGLSPERVQARRQLYAACAVCFIFMAGEVVGGYLAHSLAIMTDAAHLLADIGSMLASLF
FT                   SLWLSTRPATRTMTFGWHRSETLGALASVVSLWIVTGILLYLAFLRLLHSDYHIEAGAM
FT                   LLTASIAVCANLLMAFVLHQTGAPHSHGSTGAEYAPLEEGHGYPMSLGNTSVRAAFVHV
FT                   LGDLLQSFGVLAASILIYFKPQYKVADPISTFLFSICALGSTAPTLRDVLLVLMEGAPR
FT                   SVEFEPVRDTLLSVPGVRATHDLHLWALTLTYHVASAHLAIDSTADPEAVLAEASSRLY
FT                   SRFGFSSCTLQVEQYQPEMAQCLRCQEPSQA"
FT   CDS             complement(join(4897699..4897841,4898055..4898160,
FT                   4898358..4898556,4899067..4899220,4899302..4899448,
FT                   4899804..4899985,4903011..4903105))
FT                   /codon_start=1
FT                   /gene="Slc30a3"
FT                   /locus_tag="mCG_23488"
FT                   /product="solute carrier family 30 (zinc transporter),
FT                   member 3, isoform CRA_c"
FT                   /note="gene_id=mCG23488.1 transcript_id=mCT23397.1
FT                   protein_id=mCP3967.1 isoform=CRA_c"
FT                   /protein_id="EDL37334.1"
FT                   /translation="MEPSLATGGSETTRLVSARDRSSAGGGLRLKSLFTEPSEPLPEEP
FT                   KLEGMAFHHCHKDPVPQSGLSPERVQARRQLYAACAVCFIFMAGEVVGGYLAHSLAIMT
FT                   DAAHLLADIGSMLASLFSLWLSTRPATRTMTFGWHRSETLGALASVVSLWIVTGILLYL
FT                   AFLRLLHSDYHIEAGAMLLTASIAVCANLLMAFVLHQTGAPHSHGSTGAEYAPLEEGHG
FT                   YPMSLGNTSVRAAFVHVLGDLLQSFGVLAASILIYFKPQYKVADPISTFLFSICALGST
FT                   APTLRDVLLVLMEGAPRSVEFEPVRDTLLSVPGVRATHDLHLWALTLTYHVASAHLAIG
FT                   E"
FT   mRNA            complement(join(<4899070..4899220,4899302..4899448,
FT                   4899804..4899985,4904127..>4904207))
FT                   /gene="Slc30a3"
FT                   /locus_tag="mCG_23488"
FT                   /product="solute carrier family 30 (zinc transporter),
FT                   member 3, transcript variant mCT173422"
FT                   /note="gene_id=mCG23488.1 transcript_id=mCT173422.0 created
FT                   on 16-SEP-2002"
FT   CDS             complement(join(<4899070..4899220,4899302..4899448,
FT                   4899804..4899985,4904127..>4904206))
FT                   /codon_start=1
FT                   /gene="Slc30a3"
FT                   /locus_tag="mCG_23488"
FT                   /product="solute carrier family 30 (zinc transporter),
FT                   member 3, isoform CRA_a"
FT                   /note="gene_id=mCG23488.1 transcript_id=mCT173422.0
FT                   protein_id=mCP96341.0 isoform=CRA_a"
FT                   /protein_id="EDL37332.1"
FT                   /translation="GHRRLVSESFLWAVVFPQTSTALQLSSLFTEPSEPLPEEPKLEGM
FT                   AFHHCHKDPVPQSGLSPERVQARRQLYAACAVCFIFMAGEVVGGYLAHSLAIMTDAAHL
FT                   LADIGSMLASLFSLWLSTRPATRTMTFGWHRSETLGALASVVSLWIVTGILLYLAFLRL
FT                   LHSDYHIEAGAMLLTASIAVCANL"
FT   gene            4904692..4907002
FT                   /locus_tag="mCG_148307"
FT                   /note="gene_id=mCG148307.0"
FT   mRNA            4904692..4907002
FT                   /locus_tag="mCG_148307"
FT                   /product="mCG148307"
FT                   /note="gene_id=mCG148307.0 transcript_id=mCT188570.0
FT                   created on 13-JAN-2004"
FT   CDS             4904716..4905021
FT                   /codon_start=1
FT                   /locus_tag="mCG_148307"
FT                   /product="mCG148307"
FT                   /note="gene_id=mCG148307.0 transcript_id=mCT188570.0
FT                   protein_id=mCP109219.0"
FT                   /db_xref="GOA:Q8C950"
FT                   /db_xref="MGI:MGI:3642216"
FT                   /db_xref="UniProtKB/TrEMBL:Q8C950"
FT                   /protein_id="EDL37335.1"
FT                   /translation="MVLSGEAEQKIQPARPRRRPTPTRAWGHCLPSLCDGVWTNGGALF
FT                   LTSPVVLRASACVSGGQTEESHQARSPCWPTSEPRWKLCPCPAKPASLSCRPPSVF"
FT   assembly_gap    4912275..4912294
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            4918513..4922716
FT                   /gene="Dnajc5g"
FT                   /locus_tag="mCG_23483"
FT                   /note="gene_id=mCG23483.3"
FT   mRNA            join(4918513..4918613,4919079..4919194,4919687..4919900,
FT                   4920370..4920511,4921305..4921371,4921796..4922716)
FT                   /gene="Dnajc5g"
FT                   /locus_tag="mCG_23483"
FT                   /product="DnaJ (Hsp40) homolog, subfamily C, member 5
FT                   gamma"
FT                   /note="gene_id=mCG23483.3 transcript_id=mCT23338.3 created
FT                   on 13-JUN-2003"
FT   CDS             join(4919082..4919194,4919687..4919900,4920370..4920511,
FT                   4921305..4921333)
FT                   /codon_start=1
FT                   /gene="Dnajc5g"
FT                   /locus_tag="mCG_23483"
FT                   /product="DnaJ (Hsp40) homolog, subfamily C, member 5
FT                   gamma"
FT                   /note="gene_id=mCG23483.3 transcript_id=mCT23338.3
FT                   protein_id=mCP4006.2"
FT                   /db_xref="GOA:Q8C632"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="MGI:MGI:3045263"
FT                   /db_xref="UniProtKB/TrEMBL:Q8C632"
FT                   /protein_id="EDL37336.1"
FT                   /translation="MPLTYDATQRLSRTGKSLYAVLELKKGAETADIKKAYRKLALQYH
FT                   PDKNPDNPLAAEIFKEINTAHAILTDPTKKKIYDRHGSLGLYLYDHFGEEGVRFYFIVN
FT                   SCWFKTLVILCCLLTGCCCCCCCCLCCGRLNPSAEEEEENRQMNVSSQPSRSRTQDIEA
FT                   ED"
FT   assembly_gap    4926261..4926280
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            4926926..4947833
FT                   /gene="Trim54"
FT                   /locus_tag="mCG_23487"
FT                   /note="gene_id=mCG23487.1"
FT   mRNA            join(4926926..4927291,4941250..4941422,4942196..4942367,
FT                   4944258..4944353,4946251..4946484,4946961..4946983,
FT                   4947096..4947220,4947329..4947421,4947685..4947833)
FT                   /gene="Trim54"
FT                   /locus_tag="mCG_23487"
FT                   /product="tripartite motif-containing 54"
FT                   /note="gene_id=mCG23487.1 transcript_id=mCT23342.1 created
FT                   on 16-SEP-2002"
FT   CDS             join(4927172..4927291,4941250..4941422,4942196..4942367,
FT                   4944258..4944353,4946251..4946484,4946961..4946983,
FT                   4947096..4947220,4947329..4947421,4947685..4947701)
FT                   /codon_start=1
FT                   /gene="Trim54"
FT                   /locus_tag="mCG_23487"
FT                   /product="tripartite motif-containing 54"
FT                   /note="gene_id=mCG23487.1 transcript_id=mCT23342.1
FT                   protein_id=mCP3955.1"
FT                   /protein_id="EDL37337.1"
FT                   /translation="MDNLEKQLICPICLEMFSKPVVILPCQHNLCRKCANDVFQASNPL
FT                   WQSRGSTTVSSGGRFRCPSCRHEVVLDRHGVYGLQRNLLVENIIDIYKQESSRPLHAKA
FT                   EQHLMCEEHEDEKINIYCLSCEVPTCSLCKVFGAHKDCEVAPLPTIYKRQKSELSDGIA
FT                   MLVAGNDRVQAVITQMEEVCQTIEDNSRRQKQLLNQRFETLCAVLEERKGELLQALARE
FT                   QEEKLQRVRGLIRQYGDHLEGSSKLVESAIQSMEEPQMALYLQQAKELINKVGAMSKVE
FT                   LAGRPEPGYESMEQFSVSVEHVAEMLRTIDFQPGAAGDEEDDDMALDGEEGNAGLEEER
FT                   LDVPEGSGLH"
FT   gene            complement(4945965..>4947552)
FT                   /locus_tag="mCG_146109"
FT                   /note="gene_id=mCG146109.0"
FT   mRNA            complement(join(4945965..4946510,4946935..4947254,
FT                   4947462..>4947552))
FT                   /locus_tag="mCG_146109"
FT                   /product="mCG146109"
FT                   /note="gene_id=mCG146109.0 transcript_id=mCT186212.0
FT                   created on 14-JUL-2003"
FT   CDS             complement(join(4946422..4946510,4946935..4947254,
FT                   4947462..>4947466))
FT                   /codon_start=1
FT                   /locus_tag="mCG_146109"
FT                   /product="mCG146109"
FT                   /note="gene_id=mCG146109.0 transcript_id=mCT186212.0
FT                   protein_id=mCP107474.0"
FT                   /protein_id="EDL37338.1"
FT                   /translation="VCRSKQSLSRLPHPAGSRWFATFRPRAPRSQRIAPCSHSLAPAVL
FT                   PAPPSTLPRPCDGHKGSAEGPRSLKPLPGQKERIHRVPSFPTAQSTHLLISSFACCRGE
FT                   KEGQGPPPSLSANLEVESHLRLLHGLDGGLHQL"
FT   gene            complement(4948197..4949103)
FT                   /gene="Ucn"
FT                   /locus_tag="mCG_23486"
FT                   /note="gene_id=mCG23486.0"
FT   mRNA            complement(join(4948197..4948741,4949005..4949103))
FT                   /gene="Ucn"
FT                   /locus_tag="mCG_23486"
FT                   /product="urocortin"
FT                   /note="gene_id=mCG23486.0 transcript_id=mCT23341.0 created
FT                   on 16-SEP-2002"
FT   CDS             complement(4948360..4948728)
FT                   /codon_start=1
FT                   /gene="Ucn"
FT                   /locus_tag="mCG_23486"
FT                   /product="urocortin"
FT                   /note="gene_id=mCG23486.0 transcript_id=mCT23341.0
FT                   protein_id=mCP3936.1"
FT                   /db_xref="GOA:P81615"
FT                   /db_xref="InterPro:IPR000187"
FT                   /db_xref="InterPro:IPR003620"
FT                   /db_xref="InterPro:IPR018446"
FT                   /db_xref="MGI:MGI:1276123"
FT                   /db_xref="UniProtKB/Swiss-Prot:P81615"
FT                   /protein_id="EDL37339.1"
FT                   /translation="MIQRGRATLLVALLLLAQLRPESSQWSPAAAAATGVQDPNLRWSP
FT                   GVRNQGGGVRALLLLLAERFPRRAGSEPAGERQRRDDPPLSIDLTFHLLRTLLELARTQ
FT                   SQRERAEQNRIIFDSVGK"
FT   gene            complement(4951181..4964536)
FT                   /gene="Mpv17"
FT                   /locus_tag="mCG_126791"
FT                   /note="gene_id=mCG126791.0"
FT   mRNA            complement(join(4951181..4952060,4954910..4954962,
FT                   4955456..4955488,4955705..4955800,4955894..4955986,
FT                   4956183..4956298,4963970..4964044,4964493..4964536))
FT                   /gene="Mpv17"
FT                   /locus_tag="mCG_126791"
FT                   /product="Mpv17 transgene, kidney disease mutant,
FT                   transcript variant mCT128068"
FT                   /note="gene_id=mCG126791.0 transcript_id=mCT128068.0
FT                   created on 18-FEB-2003"
FT   mRNA            complement(join(4951668..4952060,4954910..4954962,
FT                   4955450..4955488,4955705..4955800,4955894..4955986,
FT                   4956183..4956298,4963970..4964044))
FT                   /gene="Mpv17"
FT                   /locus_tag="mCG_126791"
FT                   /product="Mpv17 transgene, kidney disease mutant,
FT                   transcript variant mCT180115"
FT                   /note="gene_id=mCG126791.0 transcript_id=mCT180115.0
FT                   created on 18-FEB-2003"
FT   mRNA            complement(join(4951868..4952060,4954910..4954962,
FT                   4955705..4955800,4955894..4955986,4956183..4956298,
FT                   4963970..4964044,4964493..>4964522))
FT                   /gene="Mpv17"
FT                   /locus_tag="mCG_126791"
FT                   /product="Mpv17 transgene, kidney disease mutant,
FT                   transcript variant mCT193578"
FT                   /note="gene_id=mCG126791.0 transcript_id=mCT193578.0
FT                   created on 09-MAR-2004"
FT   CDS             complement(join(4951991..4952060,4954910..4954962,
FT                   4955705..4955800,4955894..4955986,4956183..4956298,
FT                   4963970..4964044,4964493..>4964520))
FT                   /codon_start=1
FT                   /gene="Mpv17"
FT                   /locus_tag="mCG_126791"
FT                   /product="Mpv17 transgene, kidney disease mutant, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG126791.0 transcript_id=mCT193578.0
FT                   protein_id=mCP114519.0 isoform=CRA_c"
FT                   /protein_id="EDL37342.1"
FT                   /translation="EGSAQSWHSGSMALWRAYQRALAAHPWKVQVLTAGSLMGVGDMIS
FT                   QQLVERRGLQQHQAGRTLTMVSLGCGFVGPVVGGWYKVLDHLIPGTTKVHALKKMLLDQ
FT                   GGFAPCFLGCFLPLVGILNGMSAQDNWAKLKRLWPAVQLANFYLVPLHYRLAVVQCVAI
FT                   VWNSYLSWKAHQF"
FT   CDS             complement(join(4951991..4952060,4954910..4954962,
FT                   4955456..4955488,4955705..4955800,4955894..4955986,
FT                   4956183..4956298,4963970..4964039))
FT                   /codon_start=1
FT                   /gene="Mpv17"
FT                   /locus_tag="mCG_126791"
FT                   /product="Mpv17 transgene, kidney disease mutant, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG126791.0 transcript_id=mCT128068.0
FT                   protein_id=mCP64603.1 isoform=CRA_a"
FT                   /protein_id="EDL37340.1"
FT                   /translation="MALWRAYQRALAAHPWKVQVLTAGSLMGVGDMISQQLVERRGLQQ
FT                   HQAGRTLTMVSLGCGFVGPVVGGWYKVLDHLIPGTTKVHALKKMLLDQGGFAPCFLGCF
FT                   LPLVGILNGMSAQDNWAKLKRDYPDALITNYYLWPAVQLANFYLVPLHYRLAVVQCVAI
FT                   VWNSYLSWKAHQF"
FT   CDS             complement(join(4951991..4952060,4954910..4954962,
FT                   4955450..4955488,4955705..4955800,4955894..4955986,
FT                   4956183..4956298,4963970..4964039))
FT                   /codon_start=1
FT                   /gene="Mpv17"
FT                   /locus_tag="mCG_126791"
FT                   /product="Mpv17 transgene, kidney disease mutant, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG126791.0 transcript_id=mCT180115.0
FT                   protein_id=mCP103037.0 isoform=CRA_b"
FT                   /db_xref="GOA:G3UVW1"
FT                   /db_xref="InterPro:IPR007248"
FT                   /db_xref="MGI:MGI:97138"
FT                   /db_xref="UniProtKB/TrEMBL:G3UVW1"
FT                   /protein_id="EDL37341.1"
FT                   /translation="MALWRAYQRALAAHPWKVQVLTAGSLMGVGDMISQQLVERRGLQQ
FT                   HQAGRTLTMVSLGCGFVGPVVGGWYKVLDHLIPGTTKVHALKKMLLDQGGFAPCFLGCF
FT                   LPLVGILNGMSAQDNWAKLKRDYPDALITNYYVRLWPAVQLANFYLVPLHYRLAVVQCV
FT                   AIVWNSYLSWKAHQF"
FT   assembly_gap    4959581..4959749
FT                   /estimated_length=169
FT                   /gap_type="unknown"
FT   gene            complement(4966306..4990449)
FT                   /gene="Gtf3c2"
FT                   /locus_tag="mCG_126812"
FT                   /note="gene_id=mCG126812.0"
FT   mRNA            complement(join(4966306..4968069,4968445..4968552,
FT                   4968645..4968797,4969363..4969491,4969736..4969823,
FT                   4970046..4970207,4970294..4970438,4976232..4976361,
FT                   4976707..4976732,4978042..4978150,4978335..4978446,
FT                   4978597..4978824,4979397..4979495,4980183..4980260,
FT                   4980527..4980621,4983130..4983409,4984116..4984437,
FT                   4984580..4984843,4990216..4990449))
FT                   /gene="Gtf3c2"
FT                   /locus_tag="mCG_126812"
FT                   /product="general transcription factor IIIC, polypeptide 2,
FT                   beta, transcript variant mCT128087"
FT                   /note="gene_id=mCG126812.0 transcript_id=mCT128087.1
FT                   created on 25-SEP-2002"
FT   CDS             complement(join(4967851..4968069,4968445..4968552,
FT                   4968645..4968797,4969363..4969491,4969736..4969823,
FT                   4970046..4970207,4970294..4970438,4976232..4976361,
FT                   4976707..4976732,4978042..4978150,4978335..4978446,
FT                   4978597..4978824,4979397..4979495,4980183..4980260,
FT                   4980527..4980621,4983130..4983409,4984116..4984437,
FT                   4984580..4984820))
FT                   /codon_start=1
FT                   /gene="Gtf3c2"
FT                   /locus_tag="mCG_126812"
FT                   /product="general transcription factor IIIC, polypeptide 2,
FT                   beta, isoform CRA_a"
FT                   /note="gene_id=mCG126812.0 transcript_id=mCT128087.1
FT                   protein_id=mCP64754.1 isoform=CRA_a"
FT                   /protein_id="EDL37343.1"
FT                   /translation="MDTCGVGYVALGEADPVGSMIVVDSPGQEELSQLDVKASETSGVE
FT                   ASIEMSLPPPLPGFEDSSDRRLPPDQESLTRLEQQDLSSEMSKVSNTRASKPSGRRGGR
FT                   TARGAKRPQQRKPPSTPLVPGLLDQSNPLSTPMPKKRSQKSKGDLLLLKLSKGLDQPES
FT                   PHPKRPPEDFETPSGERPRRRAAQVALLYLQELAEELSTALPAPPLSGPKSPKVSSPTK
FT                   PKKTRQASSQGEEDGSARDEDFVLQVEGEDEEESEAPSENSSDPEPVAPRSTPRGPAAG
FT                   KQKPHCRGMAPNGLPNYIMAPVWKCLHLTKDLREQHHSFWEFAEWIPVAWKWQLLSELE
FT                   AAPYLPQEEKSPLFSVQREGIPEDGTIYRINRFSSITAHPERWDVSFFTGGPLWALDWC
FT                   PVPEGSAASQYVALFSSPDMNETHPLSQLHSGPGLLQLWGLGTLQQESCPGNRAHFVYG
FT                   IACDSGCIWDLKFCPSGAWEHPETLRKAPLLPRLGLLALACSDGKVLLFSLPHPEALLA
FT                   QQPPDAMKPAIYKVQCLATLQVGSVQASDPSECGQCLSLAWMPTRPHHHLAAGYYNGMV
FT                   VFWNLPTNSPLQRIRLSDGSLKLYPFQCFLAHDQAVRTIQWCKANSHFLVSAGSDRKIK
FT                   FWDLRRPYEPINCIKRFLSTELSWLLPYNGVTVAQDNCYASYGLCGIHYIDAGYLGFKA
FT                   YFTAPRKGTVWSLSGSDWLGTVAAGDISGELIAAILPDMASNPINVKKPAERRFPIYKA
FT                   DLIPYQDSPEDQDYSSTSSETPNPPKARTYTETINHHYLLFQDTDLSSFHNLLRREPML
FT                   RMQEGEGHSQLCLDRLQLEAIHKVRFSPNLDSYGWLVSGGQSGLVRIHFVRGLTSPLAH
FT                   RVQLESRANFNAMFQPSFPTEGPGFSPSSHCLLPNP"
FT   assembly_gap    4969835..4970002
FT                   /estimated_length=168
FT                   /gap_type="unknown"
FT   mRNA            complement(join(4970003..4970207,4970294..4970438,
FT                   4976232..4976361,4976707..4976732,4978042..4978150,
FT                   4978335..4978446,4978597..4978824,4979397..4979495,
FT                   4980183..4980260,4980527..4980621,4983130..4983409,
FT                   4984116..4984437,4984580..4984843,4990216..>4990243))
FT                   /gene="Gtf3c2"
FT                   /locus_tag="mCG_126812"
FT                   /product="general transcription factor IIIC, polypeptide 2,
FT                   beta, transcript variant mCT193531"
FT                   /note="gene_id=mCG126812.0 transcript_id=mCT193531.0
FT                   created on 09-MAR-2004"
FT   CDS             complement(join(4970024..4970207,4970294..4970438,
FT                   4976232..4976361,4976707..4976732,4978042..4978150,
FT                   4978335..4978446,4978597..4978824,4979397..4979495,
FT                   4980183..4980260,4980527..4980621,4983130..4983409,
FT                   4984116..4984437,4984580..4984843,4990216..>4990243))
FT                   /codon_start=1
FT                   /gene="Gtf3c2"
FT                   /locus_tag="mCG_126812"
FT                   /product="general transcription factor IIIC, polypeptide 2,
FT                   beta, isoform CRA_b"
FT                   /note="gene_id=mCG126812.0 transcript_id=mCT193531.0
FT                   protein_id=mCP114520.0 isoform=CRA_b"
FT                   /protein_id="EDL37344.1"
FT                   /translation="LDFRKDFGAGQPFWGVLMDTCGVGYVALGEADPVGSMIVVDSPGQ
FT                   EELSQLDVKASETSGVEASIEMSLPPPLPGFEDSSDRRLPPDQESLTRLEQQDLSSEMS
FT                   KVSNTRASKPSGRRGGRTARGAKRPQQRKPPSTPLVPGLLDQSNPLSTPMPKKRSQKSK
FT                   GDLLLLKLSKGLDQPESPHPKRPPEDFETPSGERPRRRAAQVALLYLQELAEELSTALP
FT                   APPLSGPKSPKVSSPTKPKKTRQASSQGEEDGSARDEDFVLQVEGEDEEESEAPSENSS
FT                   DPEPVAPRSTPRGPAAGKQKPHCRGMAPNGLPNYIMAPVWKCLHLTKDLREQHHSFWEF
FT                   AEWIPVAWKWQLLSELEAAPYLPQEEKSPLFSVQREGIPEDGTIYRINRFSSITAHPER
FT                   WDVSFFTGGPLWALDWCPVPEGSAASQYVALFSSPDMNETHPLSQLHSGPGLLQLWGLG
FT                   TLQQESCPGNRAHFVYGIACDSGCIWDLKFCPSGAWEHPETLRKAPLLPRLGLLALACS
FT                   DGKVLLFSLPHPEALLAQQPPDAMKPAIYKVQCLATLQVGSVQASDPSECGQCLSLAWM
FT                   PTRPHHHLAAGYYNGMVVFWNLPTNSPLQRIRLSDGSLKLYPFQCFLAHDQAVRTIQWC
FT                   KANSHFLVSAGSDRKIKFWDLRRPYEPINCIKRFLSTELSWLLPYNGVTVAQDNCYASY
FT                   DKMKI"
FT   assembly_gap    4984877..4984896
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(4997909..5003803)
FT                   /gene="Eif2b4"
FT                   /locus_tag="mCG_141150"
FT                   /note="gene_id=mCG141150.0"
FT   mRNA            complement(join(4997909..4998149,4998263..4998443,
FT                   4999919..5000096,5000231..5000358,5000709..5000811,
FT                   5000932..5001008,5001187..5001301,5001499..5001590,
FT                   5001715..5001797,5001891..5002097,5002503..5002638,
FT                   5002932..5002975,5003343..5003803))
FT                   /gene="Eif2b4"
FT                   /locus_tag="mCG_141150"
FT                   /product="eukaryotic translation initiation factor 2B,
FT                   subunit 4 delta"
FT                   /note="gene_id=mCG141150.0 transcript_id=mCT173398.0
FT                   created on 17-SEP-2002"
FT   CDS             complement(join(4997950..4998149,4998263..4998443,
FT                   4999919..5000096,5000231..5000358,5000709..5000811,
FT                   5000932..5001008,5001187..5001301,5001499..5001590,
FT                   5001715..5001797,5001891..5002097,5002503..5002638,
FT                   5002932..5002975,5003343..5003373))
FT                   /codon_start=1
FT                   /gene="Eif2b4"
FT                   /locus_tag="mCG_141150"
FT                   /product="eukaryotic translation initiation factor 2B,
FT                   subunit 4 delta"
FT                   /note="gene_id=mCG141150.0 transcript_id=mCT173398.0
FT                   protein_id=mCP96317.0"
FT                   /db_xref="GOA:Q61749"
FT                   /db_xref="InterPro:IPR000649"
FT                   /db_xref="MGI:MGI:95300"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q61749"
FT                   /protein_id="EDL37345.1"
FT                   /translation="MAAVAVAVREESRSEMKTELSPRPGAAGRELTQEEKLQLRKEKKQ
FT                   QKKKRKEEKGADQEIGSAVSAAQRQDPIRELPGPGSQLGGTAGEKLPAGRSKAELRAER
FT                   RAKQEAERALKQARKGEQGGVPPQACPSTAGETTSGVKRVPEHTPADDPTLLRRLLRKP
FT                   DRQQVPTRKDYGSKVSLFSHLPQYSRQSSLTQYMSIPSSVIHPAMVRLGLQYSQGLISG
FT                   SNARCIALLHALQQVIQDYTTPPSEELSRDLVNKLKPYISFLTQCRPMSASMCNAIKFL
FT                   TKEVTGMSSSKREEEAKSELREALDRYVQEKIVLAAQAISRFASTKISDGDVILVYGCS
FT                   SLVSRILQEARVEGRRFRVVVVDSRPRLEGRHMLHSLVRAGVPTSYLLIPAASYVLPEV
FT                   SKVLLGAHALLANGSVMSRVGTAQLALVARAHNVPVLVCCETYKFCERVQTDAFVSNEL
FT                   DDPDDLQCKRGDQVALANWQSHPSLRLLNLVYDVTPPELVDLVITELGMIPCSSVPVVL
FT                   RVKSSDQ"
FT   gene            5001958..5009316
FT                   /gene="Snx17"
FT                   /locus_tag="mCG_23482"
FT                   /note="gene_id=mCG23482.1"
FT   mRNA            join(5001958..5002095,5002492..5002633,5002943..5002977,
FT                   5003331..5003815,5004219..5004293,5005146..5005263,
FT                   5005765..5005829,5006094..5006204,5006299..5006389,
FT                   5006525..5006612,5006829..5006898,5007331..5007423,
FT                   5007518..5007721,5007969..5008094,5008211..5008288,
FT                   5008418..5008492,5008584..5008625,5008706..5009316)
FT                   /gene="Snx17"
FT                   /locus_tag="mCG_23482"
FT                   /product="sorting nexin 17, transcript variant mCT23394"
FT                   /note="gene_id=mCG23482.1 transcript_id=mCT23394.2 created
FT                   on 03-FEB-2003"
FT   mRNA            join(5003677..5003815,5004219..5004293,5005146..5005263,
FT                   5005556..5005629,5005765..5005826)
FT                   /gene="Snx17"
FT                   /locus_tag="mCG_23482"
FT                   /product="sorting nexin 17, transcript variant mCT173716"
FT                   /note="gene_id=mCG23482.1 transcript_id=mCT173716.0 created
FT                   on 03-FEB-2003"
FT   mRNA            join(5003746..5003815,5005146..5005263,5005765..5005829,
FT                   5006094..>5006160)
FT                   /gene="Snx17"
FT                   /locus_tag="mCG_23482"
FT                   /product="sorting nexin 17, transcript variant mCT173715"
FT                   /note="gene_id=mCG23482.1 transcript_id=mCT173715.0 created
FT                   on 03-FEB-2003"
FT   CDS             join(5003753..5003815,5004219..5004293,5005146..5005263,
FT                   5005765..5005829,5006094..5006204,5006299..5006389,
FT                   5006525..5006612,5006829..5006898,5007331..5007423,
FT                   5007518..5007721,5007969..5008094,5008211..5008288,
FT                   5008418..5008492,5008584..5008625,5008706..5008819)
FT                   /codon_start=1
FT                   /gene="Snx17"
FT                   /locus_tag="mCG_23482"
FT                   /product="sorting nexin 17, isoform CRA_b"
FT                   /note="gene_id=mCG23482.1 transcript_id=mCT23394.2
FT                   protein_id=mCP4027.2 isoform=CRA_b"
FT                   /protein_id="EDL37347.1"
FT                   /translation="MHFSIPETESRSGDSGGSAYVAYNIHVNGVLHCRVRYSQLLGLHE
FT                   QLRKEYGANVVPAFPPKKLFSLTPAEVEQRREQLEKYMQAVRQDPLLGSSETFNSFLRR
FT                   AQQETQQVPTEEVSLEVLLSNGQKVLVTVLTSDQTEDVLEAVAAKLDLPDDLIGYFSLF
FT                   LVREKEDGAFSFVRKLQEFELPYVSVTSLRSQEYKIVLRKSYWDSAYDDDVMENRVGLN
FT                   LLYAQTVSDIEHGWILVTKEQHRQLKSLQEKVSKKEFLRLAQTLRHYGYLRFDACVADF
FT                   PEKDCPVVVSAGNSELSLQLRLPGQQLREGSFRVTRMRCWRVTSSVPLPSGGTSSPSRG
FT                   RGEVRLELAFEYLMSKDRLQWVTITSPQAIMMSICLQSMVDELMVKKSGGSIRKMLRRR
FT                   VGGTLRRSDSQQAVKSPPLLESPDASRESMVKLSSKLSAVSLRGIGSPSTDASASAVHG
FT                   NFAFEGIGDEDL"
FT   CDS             join(5003753..5003815,5005146..5005263,5005765..5005829,
FT                   5006094..>5006160)
FT                   /codon_start=1
FT                   /gene="Snx17"
FT                   /locus_tag="mCG_23482"
FT                   /product="sorting nexin 17, isoform CRA_a"
FT                   /note="gene_id=mCG23482.1 transcript_id=mCT173715.0
FT                   protein_id=mCP96634.0 isoform=CRA_a"
FT                   /protein_id="EDL37346.1"
FT                   /translation="MHFSIPETESRSGDSGGSAYVLRKEYGANVVPAFPPKKLFSLTPA
FT                   EVEQRREQLEKYMQAVRQDPLLGSSETFNSFLRRAQQETQQVPTEEVSLEVLLSNGQKV
FT                   "
FT   CDS             join(5003753..5003815,5004219..5004293,5005146..5005263,
FT                   5005556..5005563)
FT                   /codon_start=1
FT                   /gene="Snx17"
FT                   /locus_tag="mCG_23482"
FT                   /product="sorting nexin 17, isoform CRA_c"
FT                   /note="gene_id=mCG23482.1 transcript_id=mCT173716.0
FT                   protein_id=mCP96635.0 isoform=CRA_c"
FT                   /db_xref="GOA:H3BKG9"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="InterPro:IPR028666"
FT                   /db_xref="MGI:MGI:2387801"
FT                   /db_xref="UniProtKB/TrEMBL:H3BKG9"
FT                   /protein_id="EDL37348.1"
FT                   /translation="MHFSIPETESRSGDSGGSAYVAYNIHVNGVLHCRVRYSQLLGLHE
FT                   QLRKEYGANVVPAFPPKKLFSLTPAEVEQRREQLEKYMQAVL"
FT   gene            complement(5009328..>5012581)
FT                   /gene="Zfp513"
FT                   /locus_tag="mCG_23477"
FT                   /note="gene_id=mCG23477.1"
FT   mRNA            complement(join(5009328..5010975,5011045..5011170,
FT                   5011931..5012258))
FT                   /gene="Zfp513"
FT                   /locus_tag="mCG_23477"
FT                   /product="zinc finger protein 513, transcript variant
FT                   mCT23389"
FT                   /note="gene_id=mCG23477.1 transcript_id=mCT23389.1 created
FT                   on 02-OCT-2002"
FT   mRNA            complement(join(5009330..5010495,5010583..5011170,
FT                   5011931..5012086,5012335..>5012581))
FT                   /gene="Zfp513"
FT                   /locus_tag="mCG_23477"
FT                   /product="zinc finger protein 513, transcript variant
FT                   mCT193554"
FT                   /note="gene_id=mCG23477.1 transcript_id=mCT193554.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(5009669..5010495,5010583..5011170,
FT                   5011931..5012086,5012335..>5012476))
FT                   /codon_start=1
FT                   /gene="Zfp513"
FT                   /locus_tag="mCG_23477"
FT                   /product="zinc finger protein 513, isoform CRA_b"
FT                   /note="gene_id=mCG23477.1 transcript_id=mCT193554.0
FT                   protein_id=mCP114541.0 isoform=CRA_b"
FT                   /protein_id="EDL37350.1"
FT                   /translation="EQGPTAGPNWEGRGREASGRRRVGLEPVTMPRRKQSHPQPVKCEG
FT                   VKVDTEDSFDEGPGALVLESDLLLGQDLEFEEEEEEDEGDGHNDQLMGFERDSEGDSQG
FT                   ARPGLPYGLSDDESGGGRALSAESEVEEPARGPGEARGERPGPACQLCGGPTGEGPCCG
FT                   AGGPGGGPPLPPRLLYSCRLCAFVSHYSSHLKRHMQTHSGEKPFRCGRCPYASAQLVNL
FT                   TRHTRTHTGEKPYRCPHCPFACSSLGNLRRHQRTHTGPPTPPCPTCGFRCCAPRPTRPP
FT                   SPTEQEGTMPRRSEDALILPDLSLHVPPGGASFLPDCGQLRGEGESLCGTGSEPLPELL
FT                   FPWTCRGCGQELEEGEGSRLGAAMCGRCMRGEAGGVATGGPQGPGDKGFACSLCPFATH
FT                   YPNHLARHMKTHSGEKPFRCARCPYASAHLDNLKRHQRVHTGEKPYKCPLCPYACGNLA
FT                   NLKRHGRIHSGDKPFRCSLCNYSCNQSMNLKRHMLRHTGEKPFRCATCAYTTGHWDNYK
FT                   RHQKVHGHGGAGGPGLSAPEGWAPPHSPPSVLSTRGPAALGATGSRALHSDSP"
FT   mRNA            complement(join(<5009669..5010146,5011045..5011170,
FT                   5011931..>5012135))
FT                   /gene="Zfp513"
FT                   /locus_tag="mCG_23477"
FT                   /product="zinc finger protein 513, transcript variant
FT                   mCT193553"
FT                   /note="gene_id=mCG23477.1 transcript_id=mCT193553.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(5009669..5010146,5011045..>5011076))
FT                   /codon_start=1
FT                   /gene="Zfp513"
FT                   /locus_tag="mCG_23477"
FT                   /product="zinc finger protein 513, isoform CRA_a"
FT                   /note="gene_id=mCG23477.1 transcript_id=mCT193553.0
FT                   protein_id=mCP114540.0 isoform=CRA_a"
FT                   /protein_id="EDL37349.1"
FT                   /translation="GTSQGSRGGQGGEKPFRCARCPYASAHLDNLKRHQRVHTGEKPYK
FT                   CPLCPYACGNLANLKRHGRIHSGDKPFRCSLCNYSCNQSMNLKRHMLRHTGEKPFRCAT
FT                   CAYTTGHWDNYKRHQKVHGHGGAGGPGLSAPEGWAPPHSPPSVLSTRGPAALGATGSRA
FT                   LHSDSP"
FT   CDS             complement(5009669..5010877)
FT                   /codon_start=1
FT                   /gene="Zfp513"
FT                   /locus_tag="mCG_23477"
FT                   /product="zinc finger protein 513, isoform CRA_c"
FT                   /note="gene_id=mCG23477.1 transcript_id=mCT23389.1
FT                   protein_id=mCP3950.1 isoform=CRA_c"
FT                   /protein_id="EDL37351.1"
FT                   /translation="MQTHSGEKPFRCGRCPYASAQLVNLTRHTRTHTGEKPYRCPHCPF
FT                   ACSSLGNLRRHQRTHTGPPTPPCPTCGFRCCAPRPTRPPSPTEQEGTMPRRSEGKKNTR
FT                   HLGTWVGGDRDAWINGPYLIVPTDALILPDLSLHVPPGGASFLPDCGQLRGEGESLCGT
FT                   GSEPLPELLFPWTCRGCGQELEEGEGSRLGAAMCGRCMRGEAGGVATGGPQGPGDKGFA
FT                   CSLCPFATHYPNHLARHMKTHSGEKPFRCARCPYASAHLDNLKRHQRVHTGEKPYKCPL
FT                   CPYACGNLANLKRHGRIHSGDKPFRCSLCNYSCNQSMNLKRHMLRHTGEKPFRCATCAY
FT                   TTGHWDNYKRHQKVHGHGGAGGPGLSAPEGWAPPHSPPSVLSTRGPAALGATGSRALHS
FT                   DSP"
FT   gene            complement(5013018..5031015)
FT                   /gene="Ppm1g"
FT                   /locus_tag="mCG_23473"
FT                   /note="gene_id=mCG23473.2"
FT   mRNA            complement(join(5013018..5013632,5013920..5014022,
FT                   5014378..5014507,5014801..5015035,5015346..5015477,
FT                   5016386..5016801,5017911..5018043,5018361..5018446,
FT                   5018735..5018804,5030677..5031015))
FT                   /gene="Ppm1g"
FT                   /locus_tag="mCG_23473"
FT                   /product="protein phosphatase 1G (formerly 2C),
FT                   magnesium-dependent, gamma isoform, transcript variant
FT                   mCT23385"
FT                   /note="gene_id=mCG23473.2 transcript_id=mCT23385.2 created
FT                   on 18-FEB-2003"
FT   mRNA            complement(join(5013391..5013632,5013920..5014022,
FT                   5014378..5014507,5014801..5014824,5030677..5031002))
FT                   /gene="Ppm1g"
FT                   /locus_tag="mCG_23473"
FT                   /product="protein phosphatase 1G (formerly 2C),
FT                   magnesium-dependent, gamma isoform, transcript variant
FT                   mCT180310"
FT                   /note="gene_id=mCG23473.2 transcript_id=mCT180310.0 created
FT                   on 18-FEB-2003"
FT   CDS             complement(join(5013429..5013632,5013920..5014022,
FT                   5014378..5014507,5014801..5015035,5015346..5015477,
FT                   5016386..5016801,5017911..5018043,5018361..5018446,
FT                   5018735..5018804,5030677..5030796))
FT                   /codon_start=1
FT                   /gene="Ppm1g"
FT                   /locus_tag="mCG_23473"
FT                   /product="protein phosphatase 1G (formerly 2C),
FT                   magnesium-dependent, gamma isoform, isoform CRA_b"
FT                   /note="gene_id=mCG23473.2 transcript_id=mCT23385.2
FT                   protein_id=mCP3925.1 isoform=CRA_b"
FT                   /protein_id="EDL37353.1"
FT                   /translation="MGAYLSQPNTVKCSGDGVGAPRLPLPYGFSAMQGWRVSMEDAHNC
FT                   IPELDNETAMFSVYDGHGGEEVALYCAKYLPDIIKDQKAYKEGKLQKALQDAFLAIDAK
FT                   LTTEEVIKELAQIAGRPTEDEDDKDKVADEDDVDNEEAALLHEEATMTIEELLTRYGQN
FT                   CQKVPPHTKSGIGTGDEPGPQGLNGEAGPEDPSRETPSQENGPTAKGHTGFSSNSEHGT
FT                   EAGQISEPGTATGEAGPSCSSASDKLPRVAKSKFFEDSEDESDEVEEEEDDSEECSEDE
FT                   DGYSSEEAENEEDEDDTEEAEEDDDEEMMVPGMEGKEEPGSDSGTTAVVALIRGKQLIV
FT                   ANAGDSRCVVSEAGKALDMSYDHKPEDEVELARIKNAGGKVTMDGRVNGGLNLSRAIGD
FT                   HFYKRNKNLPPQEQMISALPDIKVLTLTDDHEFMVIACDGIWNVMSSQEVVDFIQSKIS
FT                   QRDENGELRLLSSIVEELLDQCLAPDTSGDGTGCDNMTCIIICFKPRNTVELQAESGKR
FT                   KLEEALSTEGAEDTGNSDKKKAKRD"
FT   CDS             complement(join(5014457..5014507,5014801..5014824,
FT                   5030677..5030796))
FT                   /codon_start=1
FT                   /gene="Ppm1g"
FT                   /locus_tag="mCG_23473"
FT                   /product="protein phosphatase 1G (formerly 2C),
FT                   magnesium-dependent, gamma isoform, isoform CRA_a"
FT                   /note="gene_id=mCG23473.2 transcript_id=mCT180310.0
FT                   protein_id=mCP103232.0 isoform=CRA_a"
FT                   /protein_id="EDL37352.1"
FT                   /translation="MGAYLSQPNTVKCSGDGVGAPRLPLPYGFSAMQGWRVSMEASTSP
FT                   GPLETTSTRETKTCHPRNR"
FT   assembly_gap    5024165..5024304
FT                   /estimated_length=140
FT                   /gap_type="unknown"
FT   gene            5051455..5062015
FT                   /gene="Nrbp"
FT                   /locus_tag="mCG_23472"
FT                   /note="gene_id=mCG23472.1"
FT   mRNA            join(5051455..5051563,5054202..5054430,5054605..5054727,
FT                   5054897..5054998,5055316..5055405,5055814..5055854,
FT                   5056202..5056296,5057793..5057876,5058135..5058193,
FT                   5058349..5058447,5060000..5060132,5060340..5060445,
FT                   5060541..5060591,5060681..5060816,5060995..5061048,
FT                   5061132..5061195,5061343..5061398,5061476..5062015)
FT                   /gene="Nrbp"
FT                   /locus_tag="mCG_23472"
FT                   /product="nuclear receptor binding protein, transcript
FT                   variant mCT23384"
FT                   /note="gene_id=mCG23472.1 transcript_id=mCT23384.2 created
FT                   on 02-OCT-2002"
FT   mRNA            join(5051470..5051564,5054200..5054434,5054603..5054728,
FT                   5054895..5055000,5055315..5055405,5056202..5056258)
FT                   /gene="Nrbp"
FT                   /locus_tag="mCG_23472"
FT                   /product="nuclear receptor binding protein, transcript
FT                   variant mCT174002"
FT                   /note="gene_id=mCG23472.1 transcript_id=mCT174002.0 created
FT                   on 02-OCT-2002"
FT   mRNA            join(<5051485..5051563,5054202..5054430,5054605..5054727,
FT                   5054897..5054998,5055316..5055405,5055814..5055854,
FT                   5056202..5056296,5056773..5056796,5057793..5057876,
FT                   5058135..5058193,5058349..5058447,5060000..5060132,
FT                   5060340..5060445,5060541..5060591,5060681..5060816,
FT                   5060995..5061048,5061132..5061195,5061343..5061398,
FT                   5061476..5062011)
FT                   /gene="Nrbp"
FT                   /locus_tag="mCG_23472"
FT                   /product="nuclear receptor binding protein, transcript
FT                   variant mCT193550"
FT                   /note="gene_id=mCG23472.1 transcript_id=mCT193550.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<5051535..5051563,5054202..5054430,5054605..5054727,
FT                   5054897..5054998,5055316..5055405,5055814..5055854,
FT                   5056202..5056296,5056773..5056796,5057793..5057876,
FT                   5058135..5058193,5058349..5058447,5060000..5060132,
FT                   5060340..5060445,5060541..5060591,5060681..5060816,
FT                   5060995..5061048,5061132..5061195,5061343..5061398,
FT                   5061476..5061580)
FT                   /codon_start=1
FT                   /gene="Nrbp"
FT                   /locus_tag="mCG_23472"
FT                   /product="nuclear receptor binding protein, isoform CRA_b"
FT                   /note="gene_id=mCG23472.1 transcript_id=mCT193550.0
FT                   protein_id=mCP114538.0 isoform=CRA_b"
FT                   /protein_id="EDL37355.1"
FT                   /translation="SAGCGRGVGRLSVHSSMSEGESQTVVSSGSDPKVESSSLAPGLTS
FT                   VSPPVTSTTSAASPEEEEESEDESEILEESPCGRWQKRREEVNQRNVPGIDSAYLAMDT
FT                   EEGVEVVWNEVQFSERKNYKLQEEKVRAVFDNLIQLEHLNIVKFHKYWADVKENKARVI
FT                   FITEYMSSGSLKQFLKKTKKNHKTMNEKAWKRWCTQILSALSYLHSCDPPIIHGNLTCD
FT                   TIFIQHNGLIKIGSVFHRIFANVAPDTINNHVKTCREEQKNLHFFAPEYGEVTNVTTAV
FT                   DIYSFGMCALEMAVLEIQGNGESSYVPQEAISSAIQLLEDSLQREFIQKCLQSEPARRP
FT                   TARELLFHPALFEVPSLKLLAAHCIVGHQHMIPENALEEITKNMDTSAVLAEIPAGPGR
FT                   EPVQTLYSQSPALELDKFLEDVRNGIYPLTAFGLPRPQQPQQEEVTSPVVPPSVKTPTP
FT                   EPAEVETRKVVLMQCNIESVEEGVKHHLTLLLKLEDKLNRHLSCDLMPNESIPDLAAEL
FT                   VQLGFISEADQSRLTSLLEETLNKFNFTRNSTLNTATVTVSS"
FT   assembly_gap    5051647..5051790
FT                   /estimated_length=144
FT                   /gap_type="unknown"
FT   CDS             join(5054221..5054430,5054605..5054727,5054897..5054998,
FT                   5055316..5055405,5055814..5055854,5056202..5056296,
FT                   5057793..5057876,5058135..5058193,5058349..5058447,
FT                   5060000..5060132,5060340..5060445,5060541..5060591,
FT                   5060681..5060816,5060995..5061048,5061132..5061195,
FT                   5061343..5061398,5061476..5061580)
FT                   /codon_start=1
FT                   /gene="Nrbp"
FT                   /locus_tag="mCG_23472"
FT                   /product="nuclear receptor binding protein, isoform CRA_d"
FT                   /note="gene_id=mCG23472.1 transcript_id=mCT23384.2
FT                   protein_id=mCP3921.2 isoform=CRA_d"
FT                   /protein_id="EDL37357.1"
FT                   /translation="MSEGESQTVVSSGSDPKVESSSLAPGLTSVSPPVTSTTSAASPEE
FT                   EEESEDESEILEESPCGRWQKRREEVNQRNVPGIDSAYLAMDTEEGVEVVWNEVQFSER
FT                   KNYKLQEEKVRAVFDNLIQLEHLNIVKFHKYWADVKENKARVIFITEYMSSGSLKQFLK
FT                   KTKKNHKTMNEKAWKRWCTQILSALSYLHSCDPPIIHGNLTCDTIFIQHNGLIKIGSVA
FT                   PDTINNHVKTCREEQKNLHFFAPEYGEVTNVTTAVDIYSFGMCALEMAVLEIQGNGESS
FT                   YVPQEAISSAIQLLEDSLQREFIQKCLQSEPARRPTARELLFHPALFEVPSLKLLAAHC
FT                   IVGHQHMIPENALEEITKNMDTSAVLAEIPAGPGREPVQTLYSQSPALELDKFLEDVRN
FT                   GIYPLTAFGLPRPQQPQQEEVTSPVVPPSVKTPTPEPAEVETRKVVLMQCNIESVEEGV
FT                   KHHLTLLLKLEDKLNRHLSCDLMPNESIPDLAAELVQLGFISEADQSRLTSLLEETLNK
FT                   FNFTRNSTLNTATVTVSS"
FT   CDS             join(5054221..5054434,5054603..5054728,5054895..5055000,
FT                   5055315..5055405,5056202..5056219)
FT                   /codon_start=1
FT                   /gene="Nrbp"
FT                   /locus_tag="mCG_23472"
FT                   /product="nuclear receptor binding protein, isoform CRA_c"
FT                   /note="gene_id=mCG23472.1 transcript_id=mCT174002.0
FT                   protein_id=mCP96921.0 isoform=CRA_c"
FT                   /protein_id="EDL37356.1"
FT                   /translation="MSEGESQTVVSSGSDPKVESSSLAPGLTSVSPPVTSTTSAASPEE
FT                   EEESEDESEILEESPCGRWQKRREEVKVNQRNVPGIDSAYLAMDTEEGVEVVWNEVQFS
FT                   ERKNYKLQEEEKVRAVFDNLIQLEHLNIVKFHKYWADVKENKARVVIFITEYMSSGSLK
FT                   QFLKKTKKNHKTMNEKLPALL"
FT   mRNA            join(<5055833..5055854,5056202..5056296,5057793..5057876,
FT                   5058135..5058157,5060073..5060132,5060340..5060445,
FT                   5060541..5060591,5060681..5060709)
FT                   /gene="Nrbp"
FT                   /locus_tag="mCG_23472"
FT                   /product="nuclear receptor binding protein, transcript
FT                   variant mCT174001"
FT                   /note="gene_id=mCG23472.1 transcript_id=mCT174001.0 created
FT                   on 02-OCT-2002"
FT   CDS             join(<5055835..5055854,5056202..5056296,5057793..5057876,
FT                   5058135..5058157,5060073..5060132,5060340..5060345)
FT                   /codon_start=1
FT                   /gene="Nrbp"
FT                   /locus_tag="mCG_23472"
FT                   /product="nuclear receptor binding protein, isoform CRA_a"
FT                   /note="gene_id=mCG23472.1 transcript_id=mCT174001.0
FT                   protein_id=mCP96920.0 isoform=CRA_a"
FT                   /protein_id="EDL37354.1"
FT                   /translation="QILSALSYLHSCDPPIIHGNLTCDTIFIQHNGLIKIGSVAPDTIN
FT                   NHVKTCREEQKNLHFFAPEYGEVTNVTTAHCLKCPHSSFLLLTVSWGTNT"
FT   gene            <5062151..5063648
FT                   /gene="Krtcap3"
FT                   /locus_tag="mCG_23476"
FT                   /note="gene_id=mCG23476.2"
FT   mRNA            join(<5062151..5062554,5062643..5062702,5062816..5063022,
FT                   5063106..5063240,5063346..5063453,5063545..5063648)
FT                   /gene="Krtcap3"
FT                   /locus_tag="mCG_23476"
FT                   /product="keratinocyte associated protein 3, transcript
FT                   variant mCT193552"
FT                   /note="gene_id=mCG23476.2 transcript_id=mCT193552.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(5062164..5062265,5062370..5062554,5062643..5062702,
FT                   5062816..5063022,5063106..5063240,5063346..5063453,
FT                   5063545..5063648)
FT                   /gene="Krtcap3"
FT                   /locus_tag="mCG_23476"
FT                   /product="keratinocyte associated protein 3, transcript
FT                   variant mCT23388"
FT                   /note="gene_id=mCG23476.2 transcript_id=mCT23388.1 created
FT                   on 13-FEB-2003"
FT   mRNA            join(5062178..5062265,5062370..5062554,5062643..5062702,
FT                   5062816..5063022,5063106..5063240,5063346..5063453,
FT                   5063549..5063648)
FT                   /gene="Krtcap3"
FT                   /locus_tag="mCG_23476"
FT                   /product="keratinocyte associated protein 3, transcript
FT                   variant mCT180311"
FT                   /note="gene_id=mCG23476.2 transcript_id=mCT180311.0 created
FT                   on 13-FEB-2003"
FT   CDS             join(5062211..5062265,5062370..5062554,5062643..5062702,
FT                   5062816..5063022,5063106..5063240,5063346..5063453)
FT                   /codon_start=1
FT                   /gene="Krtcap3"
FT                   /locus_tag="mCG_23476"
FT                   /product="keratinocyte associated protein 3, isoform CRA_a"
FT                   /note="gene_id=mCG23476.2 transcript_id=mCT180311.0
FT                   protein_id=mCP103233.0 isoform=CRA_a"
FT                   /protein_id="EDL37358.1"
FT                   /translation="MGGGSRAATMRCCGVCAFDAARGPRRLMRVGLALILVGHVNLLVG
FT                   AVLHGTVLRHVANPRGAVTPEYTTANVISVGSGLLSVSVGLVALLASRNLLRPRLHWAL
FT                   LTLALVNLLLSAACSMGLLLAVSLTVANGGRRLIADCHPGLMDPSIPLDQGPGHTDCSF
FT                   DPTRIYDTALALWIPSLFMSAAEAALSGYCCVAALTLRGIGPCRKEGLQEQLQELTELE
FT                   LPECKRQENVQLLHGRQDFQALQKTWV"
FT   CDS             join(5062211..5062265,5062370..5062554,5062643..5062702,
FT                   5062816..5063022,5063106..5063240,5063346..5063453)
FT                   /codon_start=1
FT                   /gene="Krtcap3"
FT                   /locus_tag="mCG_23476"
FT                   /product="keratinocyte associated protein 3, isoform CRA_a"
FT                   /note="gene_id=mCG23476.2 transcript_id=mCT23388.1
FT                   protein_id=mCP3928.2 isoform=CRA_a"
FT                   /protein_id="EDL37360.1"
FT                   /translation="MGGGSRAATMRCCGVCAFDAARGPRRLMRVGLALILVGHVNLLVG
FT                   AVLHGTVLRHVANPRGAVTPEYTTANVISVGSGLLSVSVGLVALLASRNLLRPRLHWAL
FT                   LTLALVNLLLSAACSMGLLLAVSLTVANGGRRLIADCHPGLMDPSIPLDQGPGHTDCSF
FT                   DPTRIYDTALALWIPSLFMSAAEAALSGYCCVAALTLRGIGPCRKEGLQEQLQELTELE
FT                   LPECKRQENVQLLHGRQDFQALQKTWV"
FT   CDS             join(<5062270..5062554,5062643..5062702,5062816..5063022,
FT                   5063106..5063240,5063346..5063453)
FT                   /codon_start=1
FT                   /gene="Krtcap3"
FT                   /locus_tag="mCG_23476"
FT                   /product="keratinocyte associated protein 3, isoform CRA_b"
FT                   /note="gene_id=mCG23476.2 transcript_id=mCT193552.0
FT                   protein_id=mCP114539.0 isoform=CRA_b"
FT                   /protein_id="EDL37359.1"
FT                   /translation="VVRLSTAPVVPQADAGPGAPPCTATVRPSPYLADAARGPRRLMRV
FT                   GLALILVGHVNLLVGAVLHGTVLRHVANPRGAVTPEYTTANVISVGSGLLSVSVGLVAL
FT                   LASRNLLRPRLHWALLTLALVNLLLSAACSMGLLLAVSLTVANGGRRLIADCHPGLMDP
FT                   SIPLDQGPGHTDCSFDPTRIYDTALALWIPSLFMSAAEAALSGYCCVAALTLRGIGPCR
FT                   KEGLQEQLQELTELELPECKRQENVQLLHGRQDFQALQKTWV"
FT   gene            complement(5063626..>5101642)
FT                   /gene="Ift172"
FT                   /locus_tag="mCG_23481"
FT                   /note="gene_id=mCG23481.2"
FT   mRNA            complement(join(5063626..5063875,5064004..5064095,
FT                   5064266..5064419,5064670..5064768,5064853..5064912,
FT                   5065104..5065199,5065702..5065821,5066016..5066126,
FT                   5067007..5067123,5067341..5067427,5067781..5067844,
FT                   5067967..5068076,5068264..5068362,5070843..5070972,
FT                   5071072..5071181,5071376..5071556,5071888..5071952,
FT                   5072280..5072409,5073369..5073511,5073815..5073931,
FT                   5074020..5074155,5074227..5074324,5074854..5074943,
FT                   5075765..5075909,5076090..5076210,5076362..5076440,
FT                   5076622..5076870,5077082..5077159,5077681..5077773,
FT                   5078057..5078126,5082077..5082184,5082424..5082560,
FT                   5086296..5086463,5087313..5087425,5090863..5090948,
FT                   5091110..5091213,5091406..5091459,5091788..5091949,
FT                   5093000..5093095,5093477..5093600,5094448..5094662,
FT                   5095696..5095783,5095903..5095982,5096207..5096272,
FT                   5096522..5096561,5097021..5097133,5097338..5097481,
FT                   5101562..5101603))
FT                   /gene="Ift172"
FT                   /locus_tag="mCG_23481"
FT                   /product="intraflagellar transport 172 homolog
FT                   (Chlamydomonas), transcript variant mCT23393"
FT                   /note="gene_id=mCG23481.2 transcript_id=mCT23393.1 created
FT                   on 17-SEP-2002"
FT   mRNA            complement(join(5063731..5063875,5064004..5064095,
FT                   5064266..5064419,5064670..5064768,5064853..5064912,
FT                   5065104..5065199,5065702..5065821,5066016..5066126,
FT                   5067007..5067123,5067341..5067427,5067781..5067844,
FT                   5067967..5068076,5068264..5068362,5070843..5070972,
FT                   5071072..5071181,5071376..5071556,5071888..5071952,
FT                   5072280..5072373,5073369..5073511,5073815..5073931,
FT                   5074020..5074155,5074227..5074324,5074854..5074943,
FT                   5075765..5075909,5076090..5076210,5076362..5076440,
FT                   5076622..5076870,5077082..5077159,5077681..5077773,
FT                   5078042..5078126,5082077..5082184,5082424..5082560,
FT                   5086296..5086463,5087313..5087425,5090863..5090948,
FT                   5091110..5091213,5091406..5091459,5091788..5091949,
FT                   5093000..5093095,5093477..5093600,5094448..5094662,
FT                   5095696..5095783,5095903..5095982,5096207..5096272,
FT                   5096522..5096561,5097021..5097133,5097338..5097481,
FT                   5101562..>5101642))
FT                   /gene="Ift172"
FT                   /locus_tag="mCG_23481"
FT                   /product="intraflagellar transport 172 homolog
FT                   (Chlamydomonas), transcript variant mCT193583"
FT                   /note="gene_id=mCG23481.2 transcript_id=mCT193583.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(5063786..5063875,5064004..5064095,
FT                   5064266..5064419,5064670..5064768,5064853..5064912,
FT                   5065104..5065199,5065702..5065821,5066016..5066126,
FT                   5067007..5067123,5067341..5067427,5067781..5067844,
FT                   5067967..5068076,5068264..5068362,5070843..5070972,
FT                   5071072..5071181,5071376..5071556,5071888..5071952,
FT                   5072280..5072373,5073369..5073511,5073815..5073931,
FT                   5074020..5074155,5074227..5074324,5074854..5074943,
FT                   5075765..5075909,5076090..5076210,5076362..5076440,
FT                   5076622..5076870,5077082..5077159,5077681..5077773,
FT                   5078042..5078126,5082077..5082184,5082424..5082560,
FT                   5086296..5086463,5087313..5087425,5090863..5090948,
FT                   5091110..5091213,5091406..5091459,5091788..5091949,
FT                   5093000..5093095,5093477..5093600,5094448..5094662,
FT                   5095696..5095783,5095903..5095982,5096207..5096272,
FT                   5096522..5096561,5097021..5097133,5097338..5097481,
FT                   5101562..>5101642))
FT                   /codon_start=1
FT                   /gene="Ift172"
FT                   /locus_tag="mCG_23481"
FT                   /product="intraflagellar transport 172 homolog
FT                   (Chlamydomonas), isoform CRA_a"
FT                   /note="gene_id=mCG23481.2 transcript_id=mCT193583.0
FT                   protein_id=mCP114586.0 isoform=CRA_a"
FT                   /protein_id="EDL37361.1"
FT                   /translation="GVVSVSEHPRPVYVMQLKHLRTLLSPQDGAAKVTCMAWSQNNAKF
FT                   AVCTVDRVVLLYDEHGERRDKFSTKPADMKYGRKSYMVKGMAFSPDSTKIAIGQTDNII
FT                   YVYKIGEDWGDKKVICNKFIQTSAVTCLQWPAEYVIVFGLAEGKVRLANTKTNKSSTIY
FT                   GTESYVVALTTNCSGKGILSGHADGTIVRYFFDDEGSGESQGKLVNHPCPPYALAWATN
FT                   SIVAAGCDRRIVAYGKEGHVLQTFDYSRDPQEREFTTAAASPGGQSVVLGSYDRLRVFN
FT                   WSPRRSIWEEAKPKEIANLYTVTALAWKRDGSRLCAGTLCGGVEQFDCCLRRSIYKNKF
FT                   ELTYVGPSQVIVKNLSSGTRVVLKSHYGYEVEEVKILGKERYLVAHTSDTLLLGDLNTN
FT                   RLSEIAWQGSGGNEKYFFENENVCMIFNAGELTLVEYGSNDSLGSVRTEFMNPHLISVR
FT                   INERCQRGMEDNKKLAYLVDIKTIAIVDLIGGYNIGTISHESRVDWLELNETGHKLLFR
FT                   DRKLRLHLYDIESCSKTMILNFCSYVQWVPGSDVLVAQNRNSLCVWYNIEAPERVTMSS
FT                   IRGDVVGLERGGGKTEVMVTEGVTTVAYTLDEGLIEFGTAIDDGNYTRATAFLETLEMT
FT                   PETEAMWKTLSKLALEARQLHTAERCFSALGHVAKARFLHETNEIADQVSREYGGEGTD
FT                   FYQVRARLAMLEKNYKLAEMIFLEQNAVEEAMDMYQELHRWEECIAVAEAKGHPALEKL
FT                   RRDYYQWLMDTQQEERAGELQESQGDGLAAISLYLKAGLPAKAARLVLTREELLANTEL
FT                   VEHITTALIKGELYERAGDLFEKIRNPQRALECYCKGNAFMKAVELARLAFPVEVVRLE
FT                   EAWGDHLVQQKQLDAAINHYIEARCSIKAIEAALGARQWKKAIYILDLQDRNTASKYYP
FT                   RVAQHYASLQEYEIAEELYTKGDRTKDAIDMYTQAGRWEQAHKLAMKCMRPEDVSVLYI
FT                   TQAQEMEKQGKYREAERLYVTVEEPDLAITMFKKHKLYDDMIRLVGKHHPDLLSDTHLH
FT                   LGKELEAEGRLQEAEYHYLEAQEWKATVNMYRSSGLWEEAYRVAKAHGGANAHKHVAYL
FT                   WAKSLGGEAAVRLLNKLGLLEATIDHAADNCSFEFAFELSRLAFKHKAPEIHLKYAMYL
FT                   EDEGKFEEAEAEFIRAGKPKEAVLMFVHNQDWEAAQRVAEAHDPDSVAEVLVGQARGAL
FT                   EEKDFQKAEGLLLRAQRPGLALNYYKEAGLWSDALRICKDYVPGQLEALQEEYEREATK
FT                   KGGRGVEGLVEQARQWEQAGEYSRAVDCYLKVRDSGSSGLMEKCWMKAAELSIKFLPPQ
FT                   RSLEVVRVVGPQLIGIGKHSAAAELYLNLDLVKEAIDAFIEGEEWNKAKRVAKELDPRY
FT                   EDYVDQHYKEFLKNQGKVDSLVGVDVVAALDLYVEQGQWDKCIETATKQNYKILHKYVA
FT                   LYATHLIREGGYAQALALYVQHGAPANPQNFNIYKRIFTDMVSSPGTNNAEAYHSWADL
FT                   RDVLFNLCENLVKSSEANSAAHEEFEMMLLISHYYATRSAAQSIKQLETVAARLSVSLL
FT                   RHTQLLPADKAFYEAGTAAKEVGWENMAFIFLNRFLDLTDAIEEGTLDALDHSDFQDTD
FT                   IPFEVPLPAKQHVPEAQREEVRDWVLTVSMDQRLEQVLPRDERGVYEASLVAASTGVRA
FT                   LPCLITGYPILRNKIEFKRPGKAANKDNWNKFLMAIKTSHSPVCQDVLKFISQWCGGLP
FT                   STSFSFQ"
FT   CDS             complement(join(5063786..5063875,5064004..5064095,
FT                   5064266..5064419,5064670..5064768,5064853..5064912,
FT                   5065104..5065199,5065702..5065821,5066016..5066126,
FT                   5067007..5067123,5067341..5067427,5067781..5067844,
FT                   5067967..5068076,5068264..5068362,5070843..5070972,
FT                   5071072..5071181,5071376..5071556,5071888..5071952,
FT                   5072280..5072409,5073369..5073511,5073815..5073931,
FT                   5074020..5074155,5074227..5074324,5074854..5074943,
FT                   5075765..5075909,5076090..5076210,5076362..5076440,
FT                   5076622..5076870,5077082..5077159,5077681..5077773,
FT                   5078057..5078126,5082077..5082184,5082424..5082560,
FT                   5086296..5086463,5087313..5087425,5090863..5090948,
FT                   5091110..5091213,5091406..5091459,5091788..5091949,
FT                   5093000..5093095,5093477..5093600,5094448..5094662,
FT                   5095696..5095783,5095903..5095982,5096207..5096272,
FT                   5096522..5096561,5097021..5097133,5097338..5097481,
FT                   5101562..5101600))
FT                   /codon_start=1
FT                   /gene="Ift172"
FT                   /locus_tag="mCG_23481"
FT                   /product="intraflagellar transport 172 homolog
FT                   (Chlamydomonas), isoform CRA_b"
FT                   /note="gene_id=mCG23481.2 transcript_id=mCT23393.1
FT                   protein_id=mCP3908.1 isoform=CRA_b"
FT                   /protein_id="EDL37362.1"
FT                   /translation="MQLKHLRTLLSPQDGAAKVTCMAWSQNNAKFAVCTVDRVVLLYDE
FT                   HGERRDKFSTKPADMKYGRKSYMVKGMAFSPDSTKIAIGQTDNIIYVYKIGEDWGDKKV
FT                   ICNKFIQTSAVTCLQWPAEYVIVFGLAEGKVRLANTKTNKSSTIYGTESYVVALTTNCS
FT                   GKGILSGHADGTIVRYFFDDEGSGESQGKLVNHPCPPYALAWATNSIVAAGCDRRIVAY
FT                   GKEGHVLQTFDYSRDPQEREFTTAAASPGGQSVVLGSYDRLRVFNWSPRRSIWEEAKPK
FT                   EIANLYTVTALAWKRDGSRLCAGTLCGGVEQFDCCLRRSIYKNKFELTYVGPSQVIVKN
FT                   LSSGTRVVLKSHYGYEVEEVKILGKERYLVAHTSDTLLLGDLNTNRLSEIAWQGSGGNE
FT                   KYFFENENVCMIFNAGELTLVEYGSNDSLGSVRTEFMNPHLISVRINERCQRGMEDNKK
FT                   LAYLVDIKTIAIVDLIGGYNIGTISHESRVDWLELNETGHKLLFRDRKLRLHLYDIESC
FT                   SKTMILNFCSYVQWVPGSDVLVAQNRNSLCVWYNIEAPERVTMSSIRGDVVGLERGGGK
FT                   TEVMVTEGVTTVAYTLDEGLIEFGTAIDDGNYTRATAFLETLEMTPETEAMWKTLSKLA
FT                   LEARQLHTAERCFSALGHVAKARFLHETNEIADQGGEGTDFYQVRARLAMLEKNYKLAE
FT                   MIFLEQNAVEEAMDMYQELHRWEECIAVAEAKGHPALEKLRRDYYQWLMDTQQEERAGE
FT                   LQESQGDGLAAISLYLKAGLPAKAARLVLTREELLANTELVEHITTALIKGELYERAGD
FT                   LFEKIRNPQRALECYCKGNAFMKAVELARLAFPVEVVRLEEAWGDHLVQQKQLDAAINH
FT                   YIEARCSIKAIEAALGARQWKKAIYILDLQDRNTASKYYPRVAQHYASLQEYEIAEELY
FT                   TKGDRTKDAIDMYTQAGRWEQAHKLAMKCMRPEDVSVLYITQAQEMEKQGKYREAERLY
FT                   VTVEEPDLAITMFKKHKLYDDMIRLVGKHHPDLLSDTHLHLGKELEAEGRLQEAEYHYL
FT                   EAQEWKATVNMYRSSGLWEEAYRVAKAHGGANAHKHVAYLWAKSLGGEAAVRLLNKLGL
FT                   LEATIDHAADNCMKYKLIQIVHFSSFEFAFELSRLAFKHKAPEIHLKYAMYLEDEGKFE
FT                   EAEAEFIRAGKPKEAVLMFVHNQDWEAAQRVAEAHDPDSVAEVLVGQARGALEEKDFQK
FT                   AEGLLLRAQRPGLALNYYKEAGLWSDALRICKDYVPGQLEALQEEYEREATKKGGRGVE
FT                   GLVEQARQWEQAGEYSRAVDCYLKVRDSGSSGLMEKCWMKAAELSIKFLPPQRSLEVVR
FT                   VVGPQLIGIGKHSAAAELYLNLDLVKEAIDAFIEGEEWNKAKRVAKELDPRYEDYVDQH
FT                   YKEFLKNQGKVDSLVGVDVVAALDLYVEQGQWDKCIETATKQNYKILHKYVALYATHLI
FT                   REGGYAQALALYVQHGAPANPQNFNIYKRIFTDMVSSPGTNNAEAYHSWADLRDVLFNL
FT                   CENLVKSSEANSAAHEEFEMMLLISHYYATRSAAQSIKQLETVAARLSVSLLRHTQLLP
FT                   ADKAFYEAGTAAKEVGWENMAFIFLNRFLDLTDAIEEGTLDALDHSDFQDTDIPFEVPL
FT                   PAKQHVPEAQREEVRDWVLTVSMDQRLEQVLPRDERGVYEASLVAASTGVRALPCLITG
FT                   YPILRNKIEFKRPGKAANKDNWNKFLMAIKTSHSPVCQDVLKFISQWCGGLPSTSFSFQ
FT                   "
FT   assembly_gap    5069147..5069270
FT                   /estimated_length=124
FT                   /gap_type="unknown"
FT   assembly_gap    5100693..5100712
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(5102843..5106505)
FT                   /gene="Fndc4"
FT                   /locus_tag="mCG_23479"
FT                   /note="gene_id=mCG23479.2"
FT   mRNA            complement(join(5102843..5104074,5104274..5104401,
FT                   5104692..5104781,5105218..5105422,5105594..5105709,
FT                   5105801..5105945,5106122..5106505))
FT                   /gene="Fndc4"
FT                   /locus_tag="mCG_23479"
FT                   /product="fibronectin type III domain containing 4,
FT                   transcript variant mCT23391"
FT                   /note="gene_id=mCG23479.2 transcript_id=mCT23391.2 created
FT                   on 18-FEB-2003"
FT   mRNA            complement(join(5103474..5103752,5104002..5104074,
FT                   5104274..5104401,5104692..5104781,5105218..5105422,
FT                   5105594..5105709,5105801..5105945,5106122..5106461))
FT                   /gene="Fndc4"
FT                   /locus_tag="mCG_23479"
FT                   /product="fibronectin type III domain containing 4,
FT                   transcript variant mCT180312"
FT                   /note="gene_id=mCG23479.2 transcript_id=mCT180312.0 created
FT                   on 18-FEB-2003"
FT   CDS             complement(join(5104039..5104074,5104274..5104401,
FT                   5104692..5104781,5105218..5105422,5105594..5105709,
FT                   5105801..5105921))
FT                   /codon_start=1
FT                   /gene="Fndc4"
FT                   /locus_tag="mCG_23479"
FT                   /product="fibronectin type III domain containing 4, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG23479.2 transcript_id=mCT23391.2
FT                   protein_id=mCP3905.1 isoform=CRA_a"
FT                   /db_xref="GOA:B9EI95"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="MGI:MGI:1917195"
FT                   /db_xref="UniProtKB/TrEMBL:B9EI95"
FT                   /protein_id="EDL37363.1"
FT                   /translation="MPLAPPANSVETMASLMPLSPYLSPTVLLLVSCDLGFVRADRPPS
FT                   PVNVTVTHLRANSATVSWDVPEGNIVIGYSISQQRQNGPGQRVIREVNTTTRACALWGL
FT                   AEDSDYTVQVRSIGLRGESPPGPRVHFRTLKGSDRLPSNSSSPGDITVEGLDGERPLQT
FT                   GEVVIIVVVLLMWAAVIGLFCRQYDIIKDNDSNNNPKEKGKGPEQSPQGRPVGTTRQKK
FT                   SPSINTIDV"
FT   CDS             complement(join(5104039..5104074,5104274..5104401,
FT                   5104692..5104781,5105218..5105422,5105594..5105709,
FT                   5105801..5105921))
FT                   /codon_start=1
FT                   /gene="Fndc4"
FT                   /locus_tag="mCG_23479"
FT                   /product="fibronectin type III domain containing 4, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG23479.2 transcript_id=mCT180312.0
FT                   protein_id=mCP103234.0 isoform=CRA_a"
FT                   /db_xref="GOA:B9EI95"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="MGI:MGI:1917195"
FT                   /db_xref="UniProtKB/TrEMBL:B9EI95"
FT                   /protein_id="EDL37364.1"
FT                   /translation="MPLAPPANSVETMASLMPLSPYLSPTVLLLVSCDLGFVRADRPPS
FT                   PVNVTVTHLRANSATVSWDVPEGNIVIGYSISQQRQNGPGQRVIREVNTTTRACALWGL
FT                   AEDSDYTVQVRSIGLRGESPPGPRVHFRTLKGSDRLPSNSSSPGDITVEGLDGERPLQT
FT                   GEVVIIVVVLLMWAAVIGLFCRQYDIIKDNDSNNNPKEKGKGPEQSPQGRPVGTTRQKK
FT                   SPSINTIDV"
FT   assembly_gap    5106509..5106528
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            5108101..5137580
FT                   /gene="Gckr"
FT                   /locus_tag="mCG_23480"
FT                   /note="gene_id=mCG23480.2"
FT   mRNA            join(5108101..5108260,5108746..5108901,5109295..5109363,
FT                   5110139..5110207,5110580..5110653,5111160..5111226,
FT                   5111393..5111446,5112557..5112651,5115369..5115474,
FT                   5116888..5117006,5117466..5117564,5117721..5117818,
FT                   5118155..5118231,5118585..5118681,5119236..5119333,
FT                   5119421..5119504,5134850..5134999,5136635..5136769,
FT                   5137205..5137580)
FT                   /gene="Gckr"
FT                   /locus_tag="mCG_23480"
FT                   /product="glucokinase regulatory protein, transcript
FT                   variant mCT23392"
FT                   /note="gene_id=mCG23480.2 transcript_id=mCT23392.2 created
FT                   on 07-FEB-2003"
FT   mRNA            join(5108162..5108260,5108746..5108901,5109295..5109363,
FT                   5110139..5110207,5110580..5110653,5111160..5111226,
FT                   5111393..5111446,5112557..5112651,5115369..5115474,
FT                   5116888..5117006,5117466..5117564,5117721..5117818,
FT                   5118155..5118231,5118585..5118681,5119236..5119333,
FT                   5119421..5119504,5134850..5134891,5136635..5136769,
FT                   5137205..5137578)
FT                   /gene="Gckr"
FT                   /locus_tag="mCG_23480"
FT                   /product="glucokinase regulatory protein, transcript
FT                   variant mCT179730"
FT                   /note="gene_id=mCG23480.2 transcript_id=mCT179730.0 created
FT                   on 07-FEB-2003"
FT   CDS             join(5108201..5108260,5108746..5108901,5109295..5109363,
FT                   5110139..5110207,5110580..5110653,5111160..5111226,
FT                   5111393..5111446,5112557..5112651,5115369..5115474,
FT                   5116888..5117006,5117466..5117564,5117721..5117818,
FT                   5118155..5118231,5118585..5118681,5119236..5119333,
FT                   5119421..5119504,5134850..5134999,5136635..5136769,
FT                   5137205..5137369)
FT                   /codon_start=1
FT                   /gene="Gckr"
FT                   /locus_tag="mCG_23480"
FT                   /product="glucokinase regulatory protein, isoform CRA_b"
FT                   /note="gene_id=mCG23480.2 transcript_id=mCT23392.2
FT                   protein_id=mCP3986.2 isoform=CRA_b"
FT                   /db_xref="GOA:A0A0J9YUI8"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005486"
FT                   /db_xref="MGI:MGI:1096345"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0J9YUI8"
FT                   /protein_id="EDL37366.1"
FT                   /translation="MPSTKRYQHVIETPEPGEWELSGYEAAVPITEKSNPLTRNLDKAD
FT                   AEKIVQLLGQCDAEIFQEEGQIMPTYQRLYSESVLTTMLQVAGKVQEVLKEPDGGLVVL
FT                   SGGGTSGRMAFLMSVSFNQLMKGLGQKPLYTYLIAGGDRSVVASRERTEDSALHGIEEL
FT                   KKVAAGKKRVVVIGISVGLSAPFVAGQMDYCMDNTAVFLPVLVGFNPVSMARNDPIEDW
FT                   RSTFRQVAERMQKMQEKQEAFVLNPAIGPEGLSGSSRMKGGSATKILLETLLLAAHKTV
FT                   DQGVVSSQRCLLEILRTFERAHQVTYSQSSKIATLTKQVGISLEKKGHVHLVGWQTLGI
FT                   IAIMDGVECIHTFGADFRDIRGFLIGDHNDMFNQKDELSNQGPQFTFSQDDFLTSVLPS
FT                   LTEIDTVVFIFTLDDNLAEVQALAERVREKSWNIQALVHSTVGQSLPAPLKKLFPSLIS
FT                   ITWPLLFFDYEGSYVQKFQRELSTKWVLNTVSTGAHVLLGKILQNHMLDLRIANSKLFW
FT                   RALAMLQRFSGQSKARCIESLLQVIHFPQPLSNDVRAAPISCHVQVAHEKEKVIPTALL
FT                   SLLLRCSITEAKERLAAASSVCEVVRSALSGPGQKRSIQAFGDPVVP"
FT   CDS             join(5108201..5108260,5108746..5108901,5109295..5109363,
FT                   5110139..5110207,5110580..5110653,5111160..5111226,
FT                   5111393..5111446,5112557..5112651,5115369..5115474,
FT                   5116888..5117006,5117466..5117564,5117721..5117818,
FT                   5118155..5118231,5118585..5118681,5119236..5119333,
FT                   5119421..5119504,5134850..5134891,5136635..5136769,
FT                   5137205..5137369)
FT                   /codon_start=1
FT                   /gene="Gckr"
FT                   /locus_tag="mCG_23480"
FT                   /product="glucokinase regulatory protein, isoform CRA_a"
FT                   /note="gene_id=mCG23480.2 transcript_id=mCT179730.0
FT                   protein_id=mCP102652.0 isoform=CRA_a"
FT                   /protein_id="EDL37365.1"
FT                   /translation="MPSTKRYQHVIETPEPGEWELSGYEAAVPITEKSNPLTRNLDKAD
FT                   AEKIVQLLGQCDAEIFQEEGQIMPTYQRLYSESVLTTMLQVAGKVQEVLKEPDGGLVVL
FT                   SGGGTSGRMAFLMSVSFNQLMKGLGQKPLYTYLIAGGDRSVVASRERTEDSALHGIEEL
FT                   KKVAAGKKRVVVIGISVGLSAPFVAGQMDYCMDNTAVFLPVLVGFNPVSMARNDPIEDW
FT                   RSTFRQVAERMQKMQEKQEAFVLNPAIGPEGLSGSSRMKGGSATKILLETLLLAAHKTV
FT                   DQGVVSSQRCLLEILRTFERAHQVTYSQSSKIATLTKQVGISLEKKGHVHLVGWQTLGI
FT                   IAIMDGVECIHTFGADFRDIRGFLIGDHNDMFNQKDELSNQGPQFTFSQDDFLTSVLPS
FT                   LTEIDTVVFIFTLDDNLAEVQALAERVREKSWNIQALVHSTVGQSLPAPLKKLFPSLIS
FT                   ITWPLLFFDYEGSYVQKFQRELSTKWVLNTRFSGQSKARCIESLLQVIHFPQPLSNDVR
FT                   AAPISCHVQVAHEKEKVIPTALLSLLLRCSITEAKERLAAASSVCEVVRSALSGPGQKR
FT                   SIQAFGDPVVP"
FT   assembly_gap    5112332..5112355
FT                   /estimated_length=24
FT                   /gap_type="unknown"
FT   assembly_gap    5121820..5122025
FT                   /estimated_length=206
FT                   /gap_type="unknown"
FT   assembly_gap    5142638..5142657
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5187556..5187728
FT                   /estimated_length=173
FT                   /gap_type="unknown"
FT   assembly_gap    5233983..5234008
FT                   /estimated_length=26
FT                   /gap_type="unknown"
FT   assembly_gap    5238477..5238496
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            5262578..5291319
FT                   /gene="Zfp512"
FT                   /locus_tag="mCG_141151"
FT                   /note="gene_id=mCG141151.1"
FT   mRNA            join(5262578..5262724,5263303..5263361,5275506..5275687,
FT                   5276292..5276390,5276646..5276729,5277376..5277500,
FT                   5278208..5278294,5280412..5280510,5281051..5281218,
FT                   5282824..5283015,5283507..5283608,5285685..5285789,
FT                   5286835..5286933,5290024..5291319)
FT                   /gene="Zfp512"
FT                   /locus_tag="mCG_141151"
FT                   /product="zinc finger protein 512"
FT                   /note="gene_id=mCG141151.1 transcript_id=mCT173400.1
FT                   created on 01-APR-2004"
FT   CDS             join(5262695..5262724,5263303..5263361,5275506..5275687,
FT                   5276292..5276390,5276646..5276729,5277376..5277500,
FT                   5278208..5278294,5280412..5280510,5281051..5281218,
FT                   5282824..5283015,5283507..5283608,5285685..5285789,
FT                   5286835..5286933,5290024..5290311)
FT                   /codon_start=1
FT                   /gene="Zfp512"
FT                   /locus_tag="mCG_141151"
FT                   /product="zinc finger protein 512"
FT                   /note="gene_id=mCG141151.1 transcript_id=mCT173400.1
FT                   protein_id=mCP96319.1"
FT                   /protein_id="EDL37367.1"
FT                   /translation="MSSRLGAVTATPGPTSLKQQRSTRIVGAKKAQCSIKDNSFQYTIP
FT                   HEDSLSGSSSASSCEPVSDFTATLRKSTYWMKMRRIKPAATSQVEGEKEKERAKGKRNV
FT                   KQEEDEDYRELPQKKHKLYGRKQRPKAQPHPKPQARRVRKEPPVYAAGSMEEKWYLEIM
FT                   DKGSVSCPTCQAVGRKTIEGLKKHMENCKQEMFTCHHCGKQLHSLAGMKYHVMANHNSL
FT                   PILKAGDEVDEPSERERLRTVLKRMGKLRCMRESCSSTFTSIMGYLYHVRKCGKEASEL
FT                   EKLALKCHHCGKPYRSKAGLAYHMRSEHGPVFFPESEQPDCLKEMSLEAKGGGRVQRRS
FT                   AKIAVYHLQELASAELTKEWPKRKVLQDLVPDDRKLKYTRPGLPTFSQEVLHKWKTDIK
FT                   KYHRIQCPNQGSVWHRLTLASLFQGCEAVYSSVSGLKAHLGSCTLGTFVAGKYKCLLCE
FT                   KEFVSESGVKYHINSVHAEDWFVVNPTTTKSFEKLMKIKQRQQEEEKQRQQHGRRRSLR
FT                   RQQQPCMEPPESQLEPKAGKEQGGNEELVGPDPEPVPAQPQKAEPAKTTHKRGRK"
FT   assembly_gap    5266290..5266525
FT                   /estimated_length=236
FT                   /gap_type="unknown"
FT   assembly_gap    5268138..5268319
FT                   /estimated_length=182
FT                   /gap_type="unknown"
FT   assembly_gap    5269868..5270237
FT                   /estimated_length=370
FT                   /gap_type="unknown"
FT   gene            5295917..5298525
FT                   /gene="4930548H24Rik"
FT                   /locus_tag="mCG_142381"
FT                   /note="gene_id=mCG142381.0"
FT   mRNA            join(5295917..5296354,5297332..5298525)
FT                   /gene="4930548H24Rik"
FT                   /locus_tag="mCG_142381"
FT                   /product="RIKEN cDNA 4930548H24"
FT                   /note="gene_id=mCG142381.0 transcript_id=mCT180060.0
FT                   created on 11-FEB-2003"
FT   CDS             join(5295978..5296354,5297332..5298268)
FT                   /codon_start=1
FT                   /gene="4930548H24Rik"
FT                   /locus_tag="mCG_142381"
FT                   /product="RIKEN cDNA 4930548H24"
FT                   /note="gene_id=mCG142381.0 transcript_id=mCT180060.0
FT                   protein_id=mCP102982.0"
FT                   /db_xref="GOA:Q9D496"
FT                   /db_xref="InterPro:IPR032777"
FT                   /db_xref="MGI:MGI:1914906"
FT                   /db_xref="UniProtKB/TrEMBL:Q9D496"
FT                   /protein_id="EDL37368.1"
FT                   /translation="MGRLDNGETEKESVVAEWDVGGGARPCSSEVREEMDSQMQCDCIS
FT                   QDRSPRSGGKFSRPARTKLVAKTKKLYVNPSCAKSHPVCPKVKTPLENCAPQRQTCGTS
FT                   SLAKILSEPQTHLNACLSSGTRFAQSSKGSPQPSTYLTILNELFKSERLTELEKEVKSK
FT                   TMEALESLSRKIEEARLQQEHLLQDSRLLQRDTLCVDAEKNCFLRVLRKQSEQCKKKHG
FT                   QLWNQYVQDLGEIIRRKQELTLRFAKQTEELQTQLFQGKIKQSQLEQQFQSMEHISSIQ
FT                   KSQEMKIQMLEKELEDVKAETARKDHQAHLQFLQRKTHLMRQIQELRSLQAGDHNTPEV
FT                   RQKAQLFKSTAKKVNSEYCRSVCRENQELQEDLLKLIQEYYKLESIKRKLEMCKERLKE
FT                   EQCYQEALVRGRGQLKAKREKSHTCDPCPPNQGVLRPH"
FT   gene            5304799..5321816
FT                   /gene="Xab1"
FT                   /locus_tag="mCG_141152"
FT                   /note="gene_id=mCG141152.0"
FT   mRNA            join(5304799..5304935,5305570..5305663,5307363..5307402,
FT                   5308392..5308458,5309319..5309356,5310906..5310984,
FT                   5311164..5311258,5313443..5313488,5314099..5314245,
FT                   5315140..5315222,5316380..5316419,5317662..5317752,
FT                   5319487..5319594,5321020..5321816)
FT                   /gene="Xab1"
FT                   /locus_tag="mCG_141152"
FT                   /product="XPA binding protein 1"
FT                   /note="gene_id=mCG141152.0 transcript_id=mCT173399.0
FT                   created on 17-SEP-2002"
FT   CDS             join(5304825..5304935,5305570..5305663,5307363..5307402,
FT                   5308392..5308458,5309319..5309356,5310906..5310984,
FT                   5311164..5311258,5313443..5313488,5314099..5314245,
FT                   5315140..5315222,5316380..5316419,5317662..5317752,
FT                   5319487..5319594,5321020..5321099)
FT                   /codon_start=1
FT                   /gene="Xab1"
FT                   /locus_tag="mCG_141152"
FT                   /product="XPA binding protein 1"
FT                   /note="gene_id=mCG141152.0 transcript_id=mCT173399.0
FT                   protein_id=mCP96318.0"
FT                   /db_xref="GOA:Q4VAB2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004130"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030230"
FT                   /db_xref="MGI:MGI:1921504"
FT                   /db_xref="UniProtKB/TrEMBL:Q4VAB2"
FT                   /protein_id="EDL37369.1"
FT                   /translation="MAAPVAPSEPQASRAPQPPVCLLVLGMAGSGKTTFVQRLTGHLHN
FT                   KGCPPYVINLDPAVHEVPFPANIDIRDTVKYKEVMKQYGLGPNGGIVTSLNLFATRFDQ
FT                   VMKFIEKAQNTFRYVLIDTPGQIEVFTWSASGTIITEALASSFPTVVIYVMDTSRSTNP
FT                   VTFMSNMLYACSILYKTKLPFIVVMNKTDIIDHSFAVEWMQDFEAFQDALNQETTYVSN
FT                   LTRSMSLVLDEFYSSLRVVGVSAVVGTGFDELCTQVTSAAEEYEREYRPEYERLKKSLA
FT                   NAQSNQQKEQLERLRKDMGSVALDPEAGKGNASPVLDPSDLILTRGTLDEEDEEADSDT
FT                   DDIDHRVTEESREEPAFQNFMEESMAHWKRNK"
FT   assembly_gap    5313795..5313974
FT                   /estimated_length=180
FT                   /gap_type="unknown"
FT   gene            complement(5324758..>5336921)
FT                   /gene="Supt7l"
FT                   /locus_tag="mCG_23470"
FT                   /note="gene_id=mCG23470.3"
FT   mRNA            complement(join(5324758..5326114,5328455..5328692,
FT                   5330271..5330595,5332842..5333449,5336803..5336901))
FT                   /gene="Supt7l"
FT                   /locus_tag="mCG_23470"
FT                   /product="suppressor of Ty 7 (S. cerevisiae)-like,
FT                   transcript variant mCT23337"
FT                   /note="gene_id=mCG23470.3 transcript_id=mCT23337.2 created
FT                   on 25-SEP-2002"
FT   CDS             complement(join(5325852..5326114,5328455..5328692,
FT                   5330271..5330595,5332842..5333254))
FT                   /codon_start=1
FT                   /gene="Supt7l"
FT                   /locus_tag="mCG_23470"
FT                   /product="suppressor of Ty 7 (S. cerevisiae)-like, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG23470.3 transcript_id=mCT23337.2
FT                   protein_id=mCP3937.2 isoform=CRA_b"
FT                   /protein_id="EDL37371.1"
FT                   /translation="MLRYWGEIPIPSGQTNRSSFDLLPREFRLVEVHDPPLHQPSANKP
FT                   KPPTMLDIPSEPCSLTIHTIQLIQHNRRLRSLIATAQTQSQQQTEGVKAEESEPLPSCP
FT                   GSPPLPDDLQPLDCKNPNAPFQIRHSDPESDFYRGKGEPVTELSWHSCRQLLYQAVATI
FT                   LAHTGFECANESVLETLTDVAHEYCLKFTKLLRFAVDREALLGQTPFPDVMEQVFHEVG
FT                   IGSVLSLQKFWQHRIKDYHTYMLQISKQLSEEYERIVNPEKATEDTKPVKIKEEPVSDI
FT                   TFPVSEELEADLASGDQSLPIGVLGAQSERFPSNLEVEASPQAPSAEVNASPLWNLAHV
FT                   KMEPQESEEGNVSAHGVLGSDVFEEPMSGMSEAGLPQSPDDSDSSYGSHSTDSLMGSSP
FT                   VFNQRCRKRMRKI"
FT   mRNA            complement(join(5326687..5328692,5330271..5330595,
FT                   5332842..5333449,5336803..>5336921))
FT                   /gene="Supt7l"
FT                   /locus_tag="mCG_23470"
FT                   /product="suppressor of Ty 7 (S. cerevisiae)-like,
FT                   transcript variant mCT193544"
FT                   /note="gene_id=mCG23470.3 transcript_id=mCT193544.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(5328396..5328692,5330271..5330595,
FT                   5332842..>5333284))
FT                   /codon_start=1
FT                   /gene="Supt7l"
FT                   /locus_tag="mCG_23470"
FT                   /product="suppressor of Ty 7 (S. cerevisiae)-like, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG23470.3 transcript_id=mCT193544.0
FT                   protein_id=mCP114536.0 isoform=CRA_a"
FT                   /protein_id="EDL37370.1"
FT                   /translation="AGEPFSACSKMLRYWGEIPIPSGQTNRSSFDLLPREFRLVEVHDP
FT                   PLHQPSANKPKPPTMLDIPSEPCSLTIHTIQLIQHNRRLRSLIATAQTQSQQQTEGVKA
FT                   EESEPLPSCPGSPPLPDDLQPLDCKNPNAPFQIRHSDPESDFYRGKGEPVTELSWHSCR
FT                   QLLYQAVATILAHTGFECANESVLETLTDVAHEYCLKFTKLLRFAVDREALLGQTPFPD
FT                   VMEQVFHEVGIGSVLSLQKFWQHRIKDYHTYMLQISKQLSEEYERIVNPEKATEDTKPV
FT                   KIKEEPVSDITFPVSEELEADLASGDQSLPIGVLGAQSERFPSNLEVEASPQAPSKKES
FT                   CIHFASGSAHLSTS"
FT   gene            5337185..5363995
FT                   /gene="Slc4a1ap"
FT                   /locus_tag="mCG_23471"
FT                   /note="gene_id=mCG23471.2"
FT   mRNA            join(5337185..5337370,5337411..5337753,5338112..5338307,
FT                   5340661..5340783,5342001..5342061,5342472..5342611,
FT                   5344073..5344233,5344886..5344955,5346166..5346352,
FT                   5350415..5350526,5353699..5353942,5358563..5358633,
FT                   5360665..5360734,5363691..5363995)
FT                   /gene="Slc4a1ap"
FT                   /locus_tag="mCG_23471"
FT                   /product="solute carrier family 4 (anion exchanger), member
FT                   1, adaptor protein, transcript variant mCT23336"
FT                   /note="gene_id=mCG23471.2 transcript_id=mCT23336.2 created
FT                   on 29-OCT-2002"
FT   mRNA            join(5337185..5337370,5337411..5337753,5338112..5338307,
FT                   5342001..5342061,5342472..5342611,5344073..5344477)
FT                   /gene="Slc4a1ap"
FT                   /locus_tag="mCG_23471"
FT                   /product="solute carrier family 4 (anion exchanger), member
FT                   1, adaptor protein, transcript variant mCT173713"
FT                   /note="gene_id=mCG23471.2 transcript_id=mCT173713.0 created
FT                   on 29-OCT-2002"
FT   mRNA            join(<5337199..5337753,5338112..5338307,5340661..5340783,
FT                   5342001..5342061,5342472..5342611,5344073..5344233,
FT                   5344886..5344955,5346166..5346352,5350415..5350526,
FT                   5353699..5353942,5358563..5358633,5360665..5360734,
FT                   5363691..5363995)
FT                   /gene="Slc4a1ap"
FT                   /locus_tag="mCG_23471"
FT                   /product="solute carrier family 4 (anion exchanger), member
FT                   1, adaptor protein, transcript variant mCT193549"
FT                   /note="gene_id=mCG23471.2 transcript_id=mCT193549.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<5337349..5337753,5338112..5338307,5340661..5340783,
FT                   5342001..5342061,5342472..5342611,5344073..5344233,
FT                   5344886..5344955,5346166..5346352,5350415..5350526,
FT                   5353699..5353942,5358563..5358633,5360665..5360734,
FT                   5363691..5363740)
FT                   /codon_start=1
FT                   /gene="Slc4a1ap"
FT                   /locus_tag="mCG_23471"
FT                   /product="solute carrier family 4 (anion exchanger), member
FT                   1, adaptor protein, isoform CRA_c"
FT                   /note="gene_id=mCG23471.2 transcript_id=mCT193549.0
FT                   protein_id=mCP114537.0 isoform=CRA_c partial"
FT                   /protein_id="EDL37374.1"
FT                   /translation="RKNVSRRSWXXXXXXXPSWGSPATAPYSLETLKGGTILGTRTLKD
FT                   TSCCFFGRLASCDICLEHPSVSRYHAVLQHRGADPSGDSEGHEQGFYLYDLGSTHGTFL
FT                   NKTRIPPRTYCRVHVGHVMRFGGSTRLFILQGPEEDREAESELTVTQLKELRKQQQILL
FT                   EKKMLGEDSDEEEEANTTEGKSSRSGQDDELGCTWGMGEDAVEDEAEENPIALDFQQDR
FT                   EAFYIKDPKKALQGFFDREGEELEYEFDEQGHSTWLCRVRLPVDDSTGKQLVAEAIHSG
FT                   KKKEAMVQCSLEACRVLDTLGLLRQEAVSRKRKAKNWEDEDFYDSDDDTFLDRTGLVEK
FT                   KRLNRMKKAGKLDEKPETFESLVAKLNDAERELAEISERLKASSKVLSEPSSQDSLDAF
FT                   MSEMKSGSTLDGVSRKKLHLRTFELRKEQQRLKGLIKLVKPAEIPELKKTELQTTNAEN
FT                   KTKKLALPLFGAMKGGSKFKLKTGTVGKLPPKRPELPPALMQMKDEPEVEEEEEEEEEE
FT                   EEKVKEEHEERVEDGGVRLLQEPELELEAAVEHPSAPSEPSCSKETKSHAAPANEYKQD
FT                   RDEPKKKKSPGPGKFPPILSSKYPEDDPDYCIWVPPEGQSGDGRTHLNDKYGY"
FT   assembly_gap    5337377..5337396
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(5337715..5337753,5338112..5338307,5340661..5340783,
FT                   5342001..5342061,5342472..5342611,5344073..5344233,
FT                   5344886..5344955,5346166..5346352,5350415..5350526,
FT                   5353699..5353942,5358563..5358633,5360665..5360734,
FT                   5363691..5363740)
FT                   /codon_start=1
FT                   /gene="Slc4a1ap"
FT                   /locus_tag="mCG_23471"
FT                   /product="solute carrier family 4 (anion exchanger), member
FT                   1, adaptor protein, isoform CRA_e"
FT                   /note="gene_id=mCG23471.2 transcript_id=mCT23336.2
FT                   protein_id=mCP3958.2 isoform=CRA_e"
FT                   /db_xref="GOA:Q5BKS1"
FT                   /db_xref="MGI:MGI:1196608"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BKS1"
FT                   /protein_id="EDL37376.1"
FT                   /translation="MRFGGSTRLFILQGPEEDREAESELTVTQLKELRKQQQILLEKKM
FT                   LGEDSDEEEEANTTEGKSSRSGQDDELGCTWGMGEDAVEDEAEENPIALDFQQDREAFY
FT                   IKDPKKALQGFFDREGEELEYEFDEQGHSTWLCRVRLPVDDSTGKQLVAEAIHSGKKKE
FT                   AMVQCSLEACRVLDTLGLLRQEAVSRKRKAKNWEDEDFYDSDDDTFLDRTGLVEKKRLN
FT                   RMKKAGKLDEKPETFESLVAKLNDAERELAEISERLKASSKVLSEPSSQDSLDAFMSEM
FT                   KSGSTLDGVSRKKLHLRTFELRKEQQRLKGLIKLVKPAEIPELKKTELQTTNAENKTKK
FT                   LALPLFGAMKGGSKFKLKTGTVGKLPPKRPELPPALMQMKDEPEVEEEEEEEEEEEEKV
FT                   KEEHEERVEDGGVRLLQEPELELEAAVEHPSAPSEPSCSKETKSHAAPANEYKQDRDEP
FT                   KKKKSPGPGKFPPILSSKYPEDDPDYCIWVPPEGQSGDGRTHLNDKYGY"
FT   CDS             join(5337715..5337753,5338112..5338307,5342001..5342061,
FT                   5342472..5342611,5344073..5344248)
FT                   /codon_start=1
FT                   /gene="Slc4a1ap"
FT                   /locus_tag="mCG_23471"
FT                   /product="solute carrier family 4 (anion exchanger), member
FT                   1, adaptor protein, isoform CRA_d"
FT                   /note="gene_id=mCG23471.2 transcript_id=mCT173713.0
FT                   protein_id=mCP96631.0 isoform=CRA_d"
FT                   /protein_id="EDL37375.1"
FT                   /translation="MRFGGSTRLFILQGPEEDREAESELTVTQLKELRKQQQILLEKKM
FT                   LGEDSDEEEEANTTEGKSSRSGQDDELGCTWGMGEELEYEFDEQGHSTWLCRVRLPVDD
FT                   STGKQLVAEAIHSGKKKEAMVQCSLEACRVLDTLGLLRQEAVSRKRKAKNWEDEDFYDS
FT                   DDDTFLDRTGLVEKKRLNRMKKAGKLDEKPETFESLASCS"
FT   assembly_gap    5340103..5340190
FT                   /estimated_length=88
FT                   /gap_type="unknown"
FT   mRNA            join(<5353623..5353942,5356209..5356295,5358563..5358633,
FT                   5360665..5360734,5363691..5363994)
FT                   /gene="Slc4a1ap"
FT                   /locus_tag="mCG_23471"
FT                   /product="solute carrier family 4 (anion exchanger), member
FT                   1, adaptor protein, transcript variant mCT173712"
FT                   /note="gene_id=mCG23471.2 transcript_id=mCT173712.0 created
FT                   on 29-OCT-2002"
FT   mRNA            join(<5353623..5353942,5358563..5358633,5360665..5360734,
FT                   5363691..5363983)
FT                   /gene="Slc4a1ap"
FT                   /locus_tag="mCG_23471"
FT                   /product="solute carrier family 4 (anion exchanger), member
FT                   1, adaptor protein, transcript variant mCT175270"
FT                   /note="gene_id=mCG23471.2 transcript_id=mCT175270.0 created
FT                   on 29-OCT-2002"
FT   CDS             join(<5353699..5353942,5356209..5356295,5358563..5358633,
FT                   5360665..5360734,5363691..5363740)
FT                   /codon_start=1
FT                   /gene="Slc4a1ap"
FT                   /locus_tag="mCG_23471"
FT                   /product="solute carrier family 4 (anion exchanger), member
FT                   1, adaptor protein, isoform CRA_a"
FT                   /note="gene_id=mCG23471.2 transcript_id=mCT173712.0
FT                   protein_id=mCP96632.0 isoform=CRA_a"
FT                   /protein_id="EDL37372.1"
FT                   /translation="KLPPKRPELPPALMQMKDEPEVEEEEEEEEEEEEKVKEEHEERVE
FT                   DGGVRLLQEPELELEAAVEHPSAPSEPSCSKETKSHESISQLSQVEQSKDYQEMGKIVS
FT                   SCEDPSAAPANEYKQDRDEPKKKKSPGPGKFPPILSSKYPEDDPDYCIWVPPEGQSGDG
FT                   RTHLNDKYGY"
FT   CDS             join(<5353699..5353942,5358563..5358633,5360665..5360734,
FT                   5363691..5363740)
FT                   /codon_start=1
FT                   /gene="Slc4a1ap"
FT                   /locus_tag="mCG_23471"
FT                   /product="solute carrier family 4 (anion exchanger), member
FT                   1, adaptor protein, isoform CRA_b"
FT                   /note="gene_id=mCG23471.2 transcript_id=mCT175270.0
FT                   protein_id=mCP98189.0 isoform=CRA_b"
FT                   /protein_id="EDL37373.1"
FT                   /translation="KLPPKRPELPPALMQMKDEPEVEEEEEEEEEEEEKVKEEHEERVE
FT                   DGGVRLLQEPELELEAAVEHPSAPSEPSCSKETKSHAAPANEYKQDRDEPKKKKSPGPG
FT                   KFPPILSSKYPEDDPDYCIWVPPEGQSGDGRTHLNDKYGY"
FT   assembly_gap    5357419..5357841
FT                   /estimated_length=423
FT                   /gap_type="unknown"
FT   gene            complement(5379548..>5381344)
FT                   /locus_tag="mCG_1046215"
FT                   /note="gene_id=mCG1046215.1"
FT   mRNA            complement(join(5379548..5380383,5380753..5380872,
FT                   5381137..>5381344))
FT                   /locus_tag="mCG_1046215"
FT                   /product="mCG1046215"
FT                   /note="gene_id=mCG1046215.1 transcript_id=mCT163919.1
FT                   created on 14-OCT-2002"
FT   CDS             complement(5379918..>5380217)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1046215"
FT                   /product="mCG1046215"
FT                   /note="gene_id=mCG1046215.1 transcript_id=mCT163919.1
FT                   protein_id=mCP64692.1"
FT                   /protein_id="EDL37377.1"
FT                   /translation="VPQSNIKWSLGTLVEELWEGLQALKEIGTLQEDQQSQLTWTTRGS
FT                   QKLNHQPKSIHRLDLGLLAHMEQICSLVFMWISQQLEQGLSLNLLPACGSCSLN"
FT   gene            <5406949..5464959
FT                   /locus_tag="mCG_146108"
FT                   /note="gene_id=mCG146108.0"
FT   mRNA            join(<5406949..5407036,5418234..5418361,5451663..5453099,
FT                   5464566..5464959)
FT                   /locus_tag="mCG_146108"
FT                   /product="mCG146108"
FT                   /note="gene_id=mCG146108.0 transcript_id=mCT186211.0
FT                   created on 14-JUL-2003"
FT   assembly_gap    5407988..5408236
FT                   /estimated_length=249
FT                   /gap_type="unknown"
FT   assembly_gap    5413093..5413112
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            5423940..5432922
FT                   /gene="Mrpl33"
FT                   /locus_tag="mCG_11595"
FT                   /note="gene_id=mCG11595.2"
FT   mRNA            join(5423940..5424030,5424611..5424629,5426389..5426495,
FT                   5432386..5432922)
FT                   /gene="Mrpl33"
FT                   /locus_tag="mCG_11595"
FT                   /product="mitochondrial ribosomal protein L33, transcript
FT                   variant mCT11915"
FT                   /note="gene_id=mCG11595.2 transcript_id=mCT11915.2 created
FT                   on 18-FEB-2003"
FT   CDS             join(5424009..5424030,5424611..5424629,5426389..5426495,
FT                   5432386..5432435)
FT                   /codon_start=1
FT                   /gene="Mrpl33"
FT                   /locus_tag="mCG_11595"
FT                   /product="mitochondrial ribosomal protein L33, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG11595.2 transcript_id=mCT11915.2
FT                   protein_id=mCP3931.2 isoform=CRA_a"
FT                   /protein_id="EDL37379.1"
FT                   /translation="MLLSAVSFAKSKSKTILVKLVSQAGTGFSFNHKRSRLREKLSLLH
FT                   YDPIVNKKVLFVEQKKIRSL"
FT   mRNA            join(<5424020..5426495,5432386..5432651)
FT                   /gene="Mrpl33"
FT                   /locus_tag="mCG_11595"
FT                   /product="mitochondrial ribosomal protein L33, transcript
FT                   variant mCT193637"
FT                   /note="gene_id=mCG11595.2 transcript_id=mCT193637.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(<5424035..5424164,5424611..5424629,5426389..5426495,
FT                   5432386..5432629)
FT                   /gene="Mrpl33"
FT                   /locus_tag="mCG_11595"
FT                   /product="mitochondrial ribosomal protein L33, transcript
FT                   variant mCT180101"
FT                   /note="gene_id=mCG11595.2 transcript_id=mCT180101.0 created
FT                   on 18-FEB-2003"
FT   CDS             join(<5424035..5424164,5424611..5424629,5426389..5426495,
FT                   5432386..5432435)
FT                   /codon_start=1
FT                   /gene="Mrpl33"
FT                   /locus_tag="mCG_11595"
FT                   /product="mitochondrial ribosomal protein L33, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG11595.2 transcript_id=mCT180101.0
FT                   protein_id=mCP103023.0 isoform=CRA_b"
FT                   /protein_id="EDL37380.1"
FT                   /translation="VGLRRRQGLRRGAEAVTRRSRGGARRGGGPGAAAATPRRASGSVA
FT                   KSKSKTILVKLVSQAGTGFSFNHKRSRLREKLSLLHYDPIVNKKVLFVEQKKIRSL"
FT   CDS             <5424084..5424452
FT                   /codon_start=1
FT                   /gene="Mrpl33"
FT                   /locus_tag="mCG_11595"
FT                   /product="mitochondrial ribosomal protein L33, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG11595.2 transcript_id=mCT193637.0
FT                   protein_id=mCP114610.0 isoform=CRA_c"
FT                   /protein_id="EDL37381.1"
FT                   /translation="PAGPEVEPGGVEDLARRLPPRGAPPGLVRRRREPRRPLQGCPKNV
FT                   YWPLWYYPAAWLLADILIRVSISGDFAAVCKVQTRAVLQYKYLHYRRVGIEQILLRTML
FT                   RWQTTVDYTKTTTTTKHS"
FT   gene            complement(5434446..5507598)
FT                   /gene="Rbks"
FT                   /locus_tag="mCG_11589"
FT                   /note="gene_id=mCG11589.1"
FT   mRNA            complement(join(5434446..5434666,5457639..5457827,
FT                   5461907..5461998,5470005..5470169,5475844..5475906,
FT                   5476986..5477049,5483440..5483572,5507480..5507598))
FT                   /gene="Rbks"
FT                   /locus_tag="mCG_11589"
FT                   /product="ribokinase"
FT                   /note="gene_id=mCG11589.1 transcript_id=mCT11909.1 created
FT                   on 25-SEP-2002"
FT   CDS             complement(join(5434493..5434666,5457639..5457827,
FT                   5461907..5461998,5470005..5470169,5475844..5475906,
FT                   5476986..5477049,5483440..5483572,5507480..5507571))
FT                   /codon_start=1
FT                   /gene="Rbks"
FT                   /locus_tag="mCG_11589"
FT                   /product="ribokinase"
FT                   /note="gene_id=mCG11589.1 transcript_id=mCT11909.1
FT                   protein_id=mCP3996.1"
FT                   /protein_id="EDL37382.1"
FT                   /translation="MAACGEPGRPWQEEEAAAVVVVGSCMTDLVSLTSRLPKTGETIHG
FT                   HEFFIGFGGKGANQCVQAARLGAKAAIVCKVGNDSFGNDYIENLKQNHISTEFTYQTRD
FT                   AATGTASIIVNNEGQNIIVIVAGANLLLNSEDLKKAASVISRAKVMICQLEISPAASLE
FT                   ALTMARRSGVKTLFNPAPAMADLDPQFYTLSSIFCCNESEAEILTGHAVSDPTTAGKAA
FT                   MILLERGCQVVVITLGASGCVILSQAEPVPKHIPTEAVKAVDTTGAGDSFVGALAFYLA
FT                   YYPNLSLEEMLKRSNFIAAVSVQATGTQSSYPYKKDLPLALF"
FT   assembly_gap    5439901..5439976
FT                   /estimated_length=76
FT                   /gap_type="unknown"
FT   CDS             <5452426..5452779
FT                   /codon_start=1
FT                   /locus_tag="mCG_146108"
FT                   /product="mCG146108"
FT                   /note="gene_id=mCG146108.0 transcript_id=mCT186211.0
FT                   protein_id=mCP107473.0"
FT                   /protein_id="EDL37378.1"
FT                   /translation="EGTSLLWQEDIISEGVEGDSVCLHRDFRVLERLFARSSVKVSSVM
FT                   MTLPCLLDVASSQKLLARPQRDVYFKQQSNTLKTQVYGQERHEVESGIPSLSCQANPFL
FT                   SSHQNGSVSWLQR"
FT   assembly_gap    5457164..5457190
FT                   /estimated_length=27
FT                   /gap_type="unknown"
FT   assembly_gap    5459923..5460332
FT                   /estimated_length=410
FT                   /gap_type="unknown"
FT   gene            <5465594..5473556
FT                   /locus_tag="mCG_145570"
FT                   /note="gene_id=mCG145570.0"
FT   mRNA            join(<5465594..5465618,5467883..5468073,5472256..5472339,
FT                   5473015..5473556)
FT                   /locus_tag="mCG_145570"
FT                   /product="mCG145570"
FT                   /note="gene_id=mCG145570.0 transcript_id=mCT184994.0
FT                   created on 05-JUN-2003"
FT   assembly_gap    5471261..5471280
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             <5473280..5473453
FT                   /codon_start=1
FT                   /locus_tag="mCG_145570"
FT                   /product="mCG145570"
FT                   /note="gene_id=mCG145570.0 transcript_id=mCT184994.0
FT                   protein_id=mCP105600.0"
FT                   /protein_id="EDL37383.1"
FT                   /translation="PSLALSSLQSSCVSLLSVGIIDLCCHVLHNLYSRILPYYKPGTAY
FT                   HNRHFGSQERKN"
FT   gene            <5508020..5887816
FT                   /gene="Bre"
FT                   /locus_tag="mCG_142373"
FT                   /note="gene_id=mCG142373.0"
FT   mRNA            join(5508020..5508047,5511796..5511947,5540931..5541007,
FT                   5595584..5595678,5630668..5630862,5641248..5641322,
FT                   5711284..5711393,5804407..5804506,5807756..5807826,
FT                   5810281..5810363,5860634..5860787,5887658..5887816)
FT                   /gene="Bre"
FT                   /locus_tag="mCG_142373"
FT                   /product="brain and reproductive organ-expressed protein,
FT                   transcript variant mCT180049"
FT                   /note="gene_id=mCG142373.0 transcript_id=mCT180049.0
FT                   created on 11-FEB-2003"
FT   mRNA            join(<5508020..5508047,5511796..5511897,5512001..5512073,
FT                   5540432..5540519,5540931..5541007,5595584..5595678,
FT                   5630668..5630862,5641248..5641322,5711284..5711393,
FT                   5804407..5804506,5807756..5807826,5810281..5810363,
FT                   5860634..5860787,5887658..5887816)
FT                   /gene="Bre"
FT                   /locus_tag="mCG_142373"
FT                   /product="brain and reproductive organ-expressed protein,
FT                   transcript variant mCT193614"
FT                   /note="gene_id=mCG142373.0 transcript_id=mCT193614.0
FT                   created on 09-MAR-2004"
FT   mRNA            join(<5508020..5508047,5512001..5512073,5540432..5540519,
FT                   5540931..5541007,5595584..5595678,5630668..5630862,
FT                   5641248..5641322,5711284..5711393,5804407..5804506,
FT                   5807756..5807826,5810281..5810363,5860634..5860787,
FT                   5887658..5887816)
FT                   /gene="Bre"
FT                   /locus_tag="mCG_142373"
FT                   /product="brain and reproductive organ-expressed protein,
FT                   transcript variant mCT193615"
FT                   /note="gene_id=mCG142373.0 transcript_id=mCT193615.0
FT                   created on 09-MAR-2004"
FT   mRNA            join(<5508020..5508047,5512001..5512073,5540931..5541007,
FT                   5595584..5595678,5630668..5630862,5641248..5641322,
FT                   5711284..5711393,5804407..5804506,5807756..5807826,
FT                   5810281..5810363,5860634..5860787,5887658..5887816)
FT                   /gene="Bre"
FT                   /locus_tag="mCG_142373"
FT                   /product="brain and reproductive organ-expressed protein,
FT                   transcript variant mCT193612"
FT                   /note="gene_id=mCG142373.0 transcript_id=mCT193612.0
FT                   created on 09-MAR-2004"
FT   mRNA            join(<5508020..5508047,5512001..5512073,5595584..5595678,
FT                   5630668..5630862,5641248..5641322,5711284..5711393,
FT                   5804407..5804506,5807756..5807826,5810281..5810363,
FT                   5860634..5860787,5887658..5887816)
FT                   /gene="Bre"
FT                   /locus_tag="mCG_142373"
FT                   /product="brain and reproductive organ-expressed protein,
FT                   transcript variant mCT193613"
FT                   /note="gene_id=mCG142373.0 transcript_id=mCT193613.0
FT                   created on 09-MAR-2004"
FT   CDS             join(<5508021..5508047,5512001..5512073,5540432..5540519,
FT                   5540931..5541007,5595584..5595678,5630668..5630862,
FT                   5641248..5641322,5711284..5711393,5804407..5804506,
FT                   5807756..5807826,5810281..5810363,5860634..5860787,
FT                   5887658..5887721)
FT                   /codon_start=1
FT                   /gene="Bre"
FT                   /locus_tag="mCG_142373"
FT                   /product="brain and reproductive organ-expressed protein,
FT                   isoform CRA_d"
FT                   /note="gene_id=mCG142373.0 transcript_id=mCT193615.0
FT                   protein_id=mCP114572.0 isoform=CRA_d"
FT                   /protein_id="EDL37387.1"
FT                   /translation="RLLIGLKFQIHEKGPSQKLSFKSCSYHLPMCACNEWYGVPDLEKA
FT                   SYLWRKKENHLPLEKGQNCTSLTPGPNCDRFKLHIPYAGETLKWDIIFNAQYPELPPDF
FT                   IFGEDAEFLPDPSALHNLASWNPSNPECLLLVVKELVQQYHQFQCGRLRESSRLMFEYQ
FT                   TLLEEPQYGENMEIYAGKKNNWTGEFSARFLLKLPVDFSNIPTYLLKDVNEDPGEDVAL
FT                   LSVSFEDTEATQVYPKLYLSPRIEHALGGSSALHIPAFPGGGCLIDYVPQVCHLLTNKV
FT                   QYVIQGYHKRREYIAAFLSHFGTGVVEYDAEGFTKLTLLLMWKDFCFLVHIDLPLFFPR
FT                   DQPTLTFQSVYHFTNSGQLYSQAQKNYPYSPRWDGNEMAKRAKAYFKTFVPQFQEAAFA
FT                   NGKL"
FT   CDS             join(<5508021..5508047,5512001..5512073,5595584..5595678,
FT                   5630668..5630862,5641248..5641322,5711284..5711393,
FT                   5804407..5804506,5807756..5807826,5810281..5810363,
FT                   5860634..5860787,5887658..5887721)
FT                   /codon_start=1
FT                   /gene="Bre"
FT                   /locus_tag="mCG_142373"
FT                   /product="brain and reproductive organ-expressed protein,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG142373.0 transcript_id=mCT193613.0
FT                   protein_id=mCP114570.0 isoform=CRA_b"
FT                   /protein_id="EDL37385.1"
FT                   /translation="RLLIGLKFQIHEKGPSQKLSFKSCSYHLPMCACRDIIFNAQYPEL
FT                   PPDFIFGEDAEFLPDPSALHNLASWNPSNPECLLLVVKELVQQYHQFQCGRLRESSRLM
FT                   FEYQTLLEEPQYGENMEIYAGKKNNWTGEFSARFLLKLPVDFSNIPTYLLKDVNEDPGE
FT                   DVALLSVSFEDTEATQVYPKLYLSPRIEHALGGSSALHIPAFPGGGCLIDYVPQVCHLL
FT                   TNKVQYVIQGYHKRREYIAAFLSHFGTGVVEYDAEGFTKLTLLLMWKDFCFLVHIDLPL
FT                   FFPRDQPTLTFQSVYHFTNSGQLYSQAQKNYPYSPRWDGNEMAKRAKAYFKTFVPQFQE
FT                   AAFANGKL"
FT   CDS             join(<5511802..5511897,5512001..5512073,5540432..5540519,
FT                   5540931..5541007,5595584..5595678,5630668..5630862,
FT                   5641248..5641322,5711284..5711393,5804407..5804506,
FT                   5807756..5807826,5810281..5810363,5860634..5860787,
FT                   5887658..5887721)
FT                   /codon_start=1
FT                   /gene="Bre"
FT                   /locus_tag="mCG_142373"
FT                   /product="brain and reproductive organ-expressed protein,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG142373.0 transcript_id=mCT193614.0
FT                   protein_id=mCP114571.0 isoform=CRA_c"
FT                   /protein_id="EDL37386.1"
FT                   /translation="LINQVKMSPEIALNRISPMLSPFISSVVRNGKIHEKGPSQKLSFK
FT                   SCSYHLPMCACNEWYGVPDLEKASYLWRKKENHLPLEKGQNCTSLTPGPNCDRFKLHIP
FT                   YAGETLKWDIIFNAQYPELPPDFIFGEDAEFLPDPSALHNLASWNPSNPECLLLVVKEL
FT                   VQQYHQFQCGRLRESSRLMFEYQTLLEEPQYGENMEIYAGKKNNWTGEFSARFLLKLPV
FT                   DFSNIPTYLLKDVNEDPGEDVALLSVSFEDTEATQVYPKLYLSPRIEHALGGSSALHIP
FT                   AFPGGGCLIDYVPQVCHLLTNKVQYVIQGYHKRREYIAAFLSHFGTGVVEYDAEGFTKL
FT                   TLLLMWKDFCFLVHIDLPLFFPRDQPTLTFQSVYHFTNSGQLYSQAQKNYPYSPRWDGN
FT                   EMAKRAKAYFKTFVPQFQEAAFANGKL"
FT   CDS             join(5511820..5511947,5540931..5541007,5595584..5595678,
FT                   5630668..5630862,5641248..5641322,5711284..5711393,
FT                   5804407..5804506,5807756..5807826,5810281..5810363,
FT                   5860634..5860787,5887658..5887721)
FT                   /codon_start=1
FT                   /gene="Bre"
FT                   /locus_tag="mCG_142373"
FT                   /product="brain and reproductive organ-expressed protein,
FT                   isoform CRA_e"
FT                   /note="gene_id=mCG142373.0 transcript_id=mCT180049.0
FT                   protein_id=mCP102971.0 isoform=CRA_e"
FT                   /protein_id="EDL37388.1"
FT                   /translation="MSPEIALNRISPMLSPFISSVVRNGKVGLDATNCLRITDLKSGCT
FT                   SLTPGPNCDRFKLHIPYAGETLKWDIIFNAQYPELPPDFIFGEDAEFLPDPSALHNLAS
FT                   WNPSNPECLLLVVKELVQQYHQFQCGRLRESSRLMFEYQTLLEEPQYGENMEIYAGKKN
FT                   NWTGEFSARFLLKLPVDFSNIPTYLLKDVNEDPGEDVALLSVSFEDTEATQVYPKLYLS
FT                   PRIEHALGGSSALHIPAFPGGGCLIDYVPQVCHLLTNKVQYVIQGYHKRREYIAAFLSH
FT                   FGTGVVEYDAEGFTKLTLLLMWKDFCFLVHIDLPLFFPRDQPTLTFQSVYHFTNSGQLY
FT                   SQAQKNYPYSPRWDGNEMAKRAKAYFKTFVPQFQEAAFANGKL"
FT   CDS             join(<5512009..5512073,5540931..5541007,5595584..5595678,
FT                   5630668..5630862,5641248..5641322,5711284..5711393,
FT                   5804407..5804506,5807756..5807826,5810281..5810363,
FT                   5860634..5860787,5887658..5887721)
FT                   /codon_start=1
FT                   /gene="Bre"
FT                   /locus_tag="mCG_142373"
FT                   /product="brain and reproductive organ-expressed protein,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG142373.0 transcript_id=mCT193612.0
FT                   protein_id=mCP114569.0 isoform=CRA_a"
FT                   /protein_id="EDL37384.1"
FT                   /translation="KRAVTEAFIQVLLLSSADVCLYCTSLTPGPNCDRFKLHIPYAGET
FT                   LKWDIIFNAQYPELPPDFIFGEDAEFLPDPSALHNLASWNPSNPECLLLVVKELVQQYH
FT                   QFQCGRLRESSRLMFEYQTLLEEPQYGENMEIYAGKKNNWTGEFSARFLLKLPVDFSNI
FT                   PTYLLKDVNEDPGEDVALLSVSFEDTEATQVYPKLYLSPRIEHALGGSSALHIPAFPGG
FT                   GCLIDYVPQVCHLLTNKVQYVIQGYHKRREYIAAFLSHFGTGVVEYDAEGFTKLTLLLM
FT                   WKDFCFLVHIDLPLFFPRDQPTLTFQSVYHFTNSGQLYSQAQKNYPYSPRWDGNEMAKR
FT                   AKAYFKTFVPQFQEAAFANGKL"
FT   assembly_gap    5550494..5550546
FT                   /estimated_length=53
FT                   /gap_type="unknown"
FT   assembly_gap    5569598..5569617
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5574885..5574904
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5591229..5591367
FT                   /estimated_length=139
FT                   /gap_type="unknown"
FT   assembly_gap    5611257..5611417
FT                   /estimated_length=161
FT                   /gap_type="unknown"
FT   assembly_gap    5660502..5660521
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5674676..5674695
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5697836..5697905
FT                   /estimated_length=70
FT                   /gap_type="unknown"
FT   assembly_gap    5738343..5738479
FT                   /estimated_length=137
FT                   /gap_type="unknown"
FT   assembly_gap    5791315..5791334
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5796186..5796463
FT                   /estimated_length=278
FT                   /gap_type="unknown"
FT   assembly_gap    5797082..5797192
FT                   /estimated_length=111
FT                   /gap_type="unknown"
FT   gene            complement(5809023..>5813914)
FT                   /locus_tag="mCG_146318"
FT                   /note="gene_id=mCG146318.0"
FT   mRNA            complement(join(5809023..5811539,5813118..5813189,
FT                   5813817..>5813914))
FT                   /locus_tag="mCG_146318"
FT                   /product="mCG146318"
FT                   /note="gene_id=mCG146318.0 transcript_id=mCT186421.0
FT                   created on 14-JUL-2003"
FT   CDS             complement(5811251..>5811511)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146318"
FT                   /product="mCG146318"
FT                   /note="gene_id=mCG146318.0 transcript_id=mCT186421.0
FT                   protein_id=mCP107487.0"
FT                   /protein_id="EDL37389.1"
FT                   /translation="WRMCYQARAPYNAGAPYKLGITLRRKKFHPQTHSQLSTGSVRYAS
FT                   IRFQREPFLPSCGHLGASSLTICWYEIRFQKKKKEFETILI"
FT   assembly_gap    5901255..5901274
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5926588..5926804
FT                   /estimated_length=217
FT                   /gap_type="unknown"
FT   assembly_gap    5931337..5931454
FT                   /estimated_length=118
FT                   /gap_type="unknown"
FT   assembly_gap    5938682..5940045
FT                   /estimated_length=1364
FT                   /gap_type="unknown"
FT   gene            <5949943..5960937
FT                   /gene="Fosl2"
FT                   /locus_tag="mCG_11594"
FT                   /note="gene_id=mCG11594.3"
FT   mRNA            join(<5949943..5950194,5953539..5953646,5955789..5960937)
FT                   /gene="Fosl2"
FT                   /locus_tag="mCG_11594"
FT                   /product="fos-like antigen 2"
FT                   /note="gene_id=mCG11594.3 transcript_id=mCT11914.3 created
FT                   on 24-NOV-2004"
FT   CDS             join(<5949943..5950194,5953539..5953646,5955789..5956307)
FT                   /codon_start=1
FT                   /gene="Fosl2"
FT                   /locus_tag="mCG_11594"
FT                   /product="fos-like antigen 2"
FT                   /note="gene_id=mCG11594.3 transcript_id=mCT11914.3
FT                   protein_id=mCP3929.2 partial"
FT                   /protein_id="EDL37390.1"
FT                   /translation="KFRVDMPGSGSAFIPTINAITTSQDLQWMVQPTVITSMSNPYPRS
FT                   HPYSPLPGLASVPGHMALPRPGVIKTIGTTVGRRRRDEQLSPEEEEKRRIRRERNKLAA
FT                   AKCRNRRRELTEKLQAETEELEEEKSGLQKEIAELQKEKEKLEFMLVAHGPVCKISPEE
FT                   RRSPPTSGLQSLRGTGSAVGPVVVKQEPPEEDSPSSSAGMDKTQRSVIKPISIAGGGFY
FT                   GEEPLHTPIVVTSTPAITPGTSNLVFTYPNVLEQESPSSPSESCSKAHRRSSSSGDQSS
FT                   DSLNSPTLLAL"
FT   assembly_gap    5956567..5956586
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5962139..5963110
FT                   /estimated_length=972
FT                   /gap_type="unknown"
FT   assembly_gap    5979656..5979718
FT                   /estimated_length=63
FT                   /gap_type="unknown"
FT   assembly_gap    5986623..5986642
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5998559..5999339
FT                   /estimated_length=781
FT                   /gap_type="unknown"
FT   assembly_gap    6028152..6028323
FT                   /estimated_length=172
FT                   /gap_type="unknown"
FT   gene            6035738..6167336
FT                   /locus_tag="mCG_141231"
FT                   /note="gene_id=mCG141231.0"
FT   mRNA            join(6035738..6035821,6050054..6050259,6065318..6065379,
FT                   6066630..6066702,6067843..6067901,6072765..6072811,
FT                   6073313..6073356,6075979..6076069,6076375..6076426,
FT                   6078907..6078993,6083955..6084017,6084591..6084670,
FT                   6087736..6087808,6088654..6088752,6089655..6089711,
FT                   6092690..6092761,6094061..6094135,6096063..6096126,
FT                   6101397..6101459,6105540..6105609,6106207..6106250,
FT                   6109481..6109589,6112069..6112120,6113743..6113823,
FT                   6116569..6116634,6116900..6117005,6119498..6119577,
FT                   6119929..6120033,6120133..6120228,6120370..6120446,
FT                   6121455..6121476,6121895..6121955,6123185..6123243,
FT                   6124174..6124247,6128299..6128342,6128971..6129079,
FT                   6130864..6130915,6131285..6131365,6131901..6131966,
FT                   6132721..6132821,6133437..6133518,6134115..6134219,
FT                   6135997..6136092,6136636..6136707,6141143..6141208,
FT                   6144978..6145038,6145555..6145613,6147854..6147921,
FT                   6148386..6148429,6152534..6152655,6153520..6153600,
FT                   6154675..6154740,6155150..6155244,6156608..6156686,
FT                   6157768..6157872,6158299..6158394,6165511..6165585,
FT                   6166979..6167336)
FT                   /locus_tag="mCG_141231"
FT                   /product="mCG141231"
FT                   /note="gene_id=mCG141231.0 transcript_id=mCT173993.0
FT                   created on 02-OCT-2002"
FT   assembly_gap    6039510..6039919
FT                   /estimated_length=410
FT                   /gap_type="unknown"
FT   CDS             join(6050199..6050259,6065318..6065379,6066630..6066702,
FT                   6067843..6067901,6072765..6072811,6073313..6073356,
FT                   6075979..6076069,6076375..6076426,6078907..6078993,
FT                   6083955..6084017,6084591..6084670,6087736..6087808,
FT                   6088654..6088752,6089655..6089711,6092690..6092761,
FT                   6094061..6094135,6096063..6096126,6101397..6101459,
FT                   6105540..6105609,6106207..6106250,6109481..6109589,
FT                   6112069..6112120,6113743..6113823,6116569..6116634,
FT                   6116900..6117005,6119498..6119577,6119929..6120033,
FT                   6120133..6120228,6120370..6120446,6121455..6121476,
FT                   6121895..6121955,6123185..6123243,6124174..6124247,
FT                   6128299..6128342,6128971..6129079,6130864..6130915,
FT                   6131285..6131365,6131901..6131966,6132721..6132821,
FT                   6133437..6133518,6134115..6134219,6135997..6136092,
FT                   6136636..6136707,6141143..6141208,6144978..6145038,
FT                   6145555..6145613,6147854..6147921,6148386..6148429,
FT                   6152534..6152655,6153520..6153600,6154675..6154740,
FT                   6155150..6155244,6156608..6156686,6157768..6157872,
FT                   6158299..6158394,6165511..6165585,6166979..6167227)
FT                   /codon_start=1
FT                   /locus_tag="mCG_141231"
FT                   /product="mCG141231"
FT                   /note="gene_id=mCG141231.0 transcript_id=mCT173993.0
FT                   protein_id=mCP96912.0"
FT                   /protein_id="EDL37391.1"
FT                   /translation="MELYPGVSPVGLLLLLLLGQGPSQIHGSSGENTLAWQSQQVFWTL
FT                   KNFPFPCKPKKLELSVLSESVHSLRPSDIKLVAAIGNPEIPLAPGSGTINMEKPQSIKN
FT                   QPQDVCMGIMTVLSDIIRHFSPSVLMPTCSPGKGTAVHTTAEDLWIQAKELVRRLKDNP
FT                   QLDFEKDWKLITVFFSNTSQCHLCPSAQQKSHLMRHMEMLWGVLDYLHHEVPRAFVNLV
FT                   DLSEVLAMDLQHQETGFSPAPEVCKCTETTTLSKAVMQWSYQEAWEDLLASSKFNKHET
FT                   FAVVFQPFFDEIEPPLKRSSPQDPTTLALRIWNSMMEPVGQKDGLLNTAERKTMKCPSE
FT                   ESPYLFTYKNSNYQARRLKPITKLQMKEGSEFTCPDKNPSNSIPTTVHSLRPADIKIIG
FT                   ALGDSLTVGNGAGASPWNILDVLTEYRGLSWSVGGDETIKTVTTLPNILREFNPSLKGF
FT                   SVGTGKESTSRASFNQAVAGAKSDGLAGQARKLVDLMKADKTINFQEDWKIITVFIGGN
FT                   DLCASCSNSTRFSPQNFIDNIKNALDILHAEVPRAFVNMAMVMEITPLRELFNEPTVSC
FT                   PRNILRSGLCPCVLGLGDNSEELSSLVQRNRDYQKKTEELINSGRYDTRDNFTVVVQPL
FT                   FENVSMPRTPEGVPDKSFFAPDCFHFNAKTHARSAIALWKNMLEPVGHKTRHNNFEIKA
FT                   PIVCPNQVDTTKNSNLGNGTWMVCEERAPSASPPTSVHTLRPADIQVVAALGDSLTAGN
FT                   GISSQEGNLTDVSTQYRGLSYSAGGDKTLENVTTLPNILRKFNGNLTGYSVGTGDSSSA
FT                   NAFLNQAVPGAKAENLTSQVRTLVQKMKSDNRVNFNRDWKVITVMIGASDLCDFCTDSN
FT                   HYSAANFFDHLQNALDILHKEVPRALVNLVDFINPSIIREVFLKNPDKCPVNQSSVLCN
FT                   CVLTPRKDSYELARLEAFTKSYQSSMLQLVESGRYDTREDFSVVLQPFLLNTKLPVLEN
FT                   GKPDTSFFAPDCIHLNQKFHTQLARALWANMLEPLGKKTDTLDPKGHISLACPTKDQPF
FT                   LRTFRNSNYKYPTKPAIENWGSDFLCTEKSPSSQVPTSVHELRPADIKVVAAMGDFLTT
FT                   ATGARPSGYKRLATPWRGLSWSIGGDGKLETHTTLPILLESSLGSPSQASLKVTFVPLS
FT                   RDMPAQAKTLVKKMKSTPTINLQEDWKLITLLIGNNDLCLYCENPEDNSTKEYVKYIQQ
FT                   ALDILYEELPRVFINVVEVMELAGLHHVQGGKCAMPLAVQKNCSCLRHSQNLTAMQELK
FT                   KLNWNLQSGISELSYWHRYMEREDFAVTVQPFFRNTFIPLNEREGLDLTFFSEDCFYFS
FT                   DRGHAEMAIALWNNMLEPVGWKTSSNNFIYNRTKLKCPSPERPFLYTLRNSQLLPDKAE
FT                   EPSNALYWAVPVAAIGGLAVGILGVMLWRTVKPVQQEEEEEDTLPNTSVTQDAVSEKRL
FT                   KAGN"
FT   assembly_gap    6064951..6064970
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6128820..6128839
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6135274..6135293
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6138800..6139079
FT                   /estimated_length=280
FT                   /gap_type="unknown"
FT   assembly_gap    6147767..6147786
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6183839..6183858
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6185601..6185620
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6187507..6187526
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6191019..6191038
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6193680..6193699
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6195356..6195375
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6211378..6211397
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6213689..6213879
FT                   /estimated_length=191
FT                   /gap_type="unknown"
FT   gene            6228536..6229936
FT                   /locus_tag="mCG_11593"
FT                   /note="gene_id=mCG11593.1"
FT   mRNA            6228536..6229936
FT                   /locus_tag="mCG_11593"
FT                   /product="mCG11593"
FT                   /note="gene_id=mCG11593.1 transcript_id=mCT11913.1 created
FT                   on 02-OCT-2002"
FT   CDS             6228608..6229468
FT                   /codon_start=1
FT                   /locus_tag="mCG_11593"
FT                   /product="mCG11593"
FT                   /note="gene_id=mCG11593.1 transcript_id=mCT11913.1
FT                   protein_id=mCP3927.2"
FT                   /protein_id="EDL37392.1"
FT                   /translation="MTTQQIILQGPGPWGFRLVDGKDFEQPLAVSRVTPGSKAAIANLC
FT                   IGDLITAIDGEGTSSMTHLEAQNKIKGCADNMTLTVSRSEQKIWSPLVTEEGKRHPYKM
FT                   NLASEPQEVLHIGSAHNRSAMPFTASPAPSTRVITNQYNSPTDLYSSENISNFNNAVES
FT                   KTSASGKEANSRPLVQPHPSGSLIIDKESEVYKMLQEKQELNEPPKQSTSFLVLQEILE
FT                   SDGKGDPNKPSGFRSVKAPVTKVAASVGNAQKLPICDKCGTGIVGVFVKLRDHHRHPEC
FT                   YVCTD"
FT   assembly_gap    6230441..6230460
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6248937..6248956
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <6264342..6298934
FT                   /gene="Ppp1cb"
FT                   /locus_tag="mCG_11588"
FT                   /note="gene_id=mCG11588.1"
FT   mRNA            join(<6264342..6264508,6283283..6283415,6285908..6286138,
FT                   6288578..6288682,6290478..6290549,6291100..6291251,
FT                   6292790..6292924,6296170..6298934)
FT                   /gene="Ppp1cb"
FT                   /locus_tag="mCG_11588"
FT                   /product="protein phosphatase 1, catalytic subunit, beta
FT                   isoform"
FT                   /note="gene_id=mCG11588.1 transcript_id=mCT11908.1 created
FT                   on 25-SEP-2002"
FT   assembly_gap    6264509..6265036
FT                   /estimated_length=528
FT                   /gap_type="unknown"
FT   assembly_gap    6276213..6276232
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(<6283283..6283415,6285908..6286138,6288578..6288682,
FT                   6290478..6290549,6291100..6291251,6292790..6292924,
FT                   6296170..6296274)
FT                   /codon_start=1
FT                   /gene="Ppp1cb"
FT                   /locus_tag="mCG_11588"
FT                   /product="protein phosphatase 1, catalytic subunit, beta
FT                   isoform"
FT                   /note="gene_id=mCG11588.1 transcript_id=mCT11908.1
FT                   protein_id=mCP3975.2"
FT                   /protein_id="EDL37393.1"
FT                   /translation="VRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICG
FT                   DIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLR
FT                   GNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQ
FT                   SMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHD
FT                   LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPS
FT                   EKKAKYQYGGLNSGRPVTPPRTANPPKKR"
FT   assembly_gap    6303253..6303306
FT                   /estimated_length=54
FT                   /gap_type="unknown"
FT   assembly_gap    6307808..6307827
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6324397..6325035
FT                   /estimated_length=639
FT                   /gap_type="unknown"
FT   assembly_gap    6330699..6331200
FT                   /estimated_length=502
FT                   /gap_type="unknown"
FT   gene            complement(6355063..6362572)
FT                   /pseudo
FT                   /locus_tag="mCG_1046117"
FT                   /note="gene_id=mCG1046117.0"
FT   mRNA            complement(join(6355063..6355123,6355786..6355870,
FT                   6357639..6357716,6358937..6359329,6362467..6362572))
FT                   /pseudo
FT                   /locus_tag="mCG_1046117"
FT                   /note="gene_id=mCG1046117.0 transcript_id=mCT163821.0
FT                   created on 11-OCT-2002"
FT   assembly_gap    6389821..6389840
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6391969..6391988
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6396627..6396646
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <6416806..6484346
FT                   /gene="Yes1"
FT                   /locus_tag="mCG_121794"
FT                   /note="gene_id=mCG121794.1"
FT   mRNA            join(<6416806..6416962,6444047..6444319,6448721..6448820,
FT                   6455368..6455466,6456674..6456777,6456868..6457017,
FT                   6458817..6458972,6459139..6459318,6462746..6462822,
FT                   6464455..6464608,6467972..6468103,6481840..6482867)
FT                   /gene="Yes1"
FT                   /locus_tag="mCG_121794"
FT                   /product="Yamaguchi sarcoma viral (v-yes) oncogene homolog
FT                   1, transcript variant mCT193622"
FT                   /note="gene_id=mCG121794.1 transcript_id=mCT193622.0
FT                   created on 09-MAR-2004"
FT   CDS             join(<6416806..6416962,6444047..6444319,6448721..6448820,
FT                   6455368..6455466,6456674..6456777,6456868..6457017,
FT                   6458817..6458972,6459139..6459318,6462746..6462822,
FT                   6464455..6464608,6467972..6468103,6481840..6482048)
FT                   /codon_start=1
FT                   /gene="Yes1"
FT                   /locus_tag="mCG_121794"
FT                   /product="Yamaguchi sarcoma viral (v-yes) oncogene homolog
FT                   1, isoform CRA_b"
FT                   /note="gene_id=mCG121794.1 transcript_id=mCT193622.0
FT                   protein_id=mCP114564.0 isoform=CRA_b"
FT                   /protein_id="EDL37395.1"
FT                   /translation="PPQVKRPGPAAPPSLPPGAPRPGGGEGRGTRGRPPRPAAFSPRRP
FT                   VRVRPDSDLIMGCIKSKENKSPAIKYTPENLTEPVSPSASHYGVEHATVAPTSSTKGAS
FT                   VNFNSLSMTPFGGSSGVTPFGGASSSFSVVSSSYPTGLTGGVTIFVALYDYEARTTEDL
FT                   SFKKGERFQIINNTEGDWWEARSIATGKSGYIPSNYVVPADSIQAEEWYFGKMGRKDAE
FT                   RLLLNPGNQRGIFLVRESETTKGAYSLSIRDWDEVRGDNVKHYKIRKLDNGGYYITTRA
FT                   QFDTLQKLVKHYTEHADGLCHKLTTVCPTVKPQTQGLAKDAWEIPRESLRLEVKLGQGC
FT                   FGEVWMGTWNGTTKVAIKTLKPGTMMPEAFLQEAQIMKKLRHDKLVPLYAVVSEEPIYI
FT                   VTEFMSKGSLLDFLKEGDGKYLKLPQLVDMAAQIADGMAYIERMNYIHRDLRAANILVG
FT                   ENLICKIADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILQTE
FT                   LVTKGRVPYPGMVNREVLEQVERGYRMPCPQGCPESLHELMNLCWKKDPDERPTFEYIQ
FT                   SFLEDYFTATEPQYQPGENL"
FT   mRNA            join(6416820..6417424,6444047..6444319,6448721..6448820,
FT                   6455368..6455466,6456674..6456777,6456868..6457017,
FT                   6458817..6458972,6459139..6459318,6462746..6462822,
FT                   6464455..6464608,6467972..6468103,6481840..6484346)
FT                   /gene="Yes1"
FT                   /locus_tag="mCG_121794"
FT                   /product="Yamaguchi sarcoma viral (v-yes) oncogene homolog
FT                   1, transcript variant mCT123006"
FT                   /note="gene_id=mCG121794.1 transcript_id=mCT123006.0
FT                   created on 17-SEP-2002"
FT   mRNA            join(<6416922..6416962,6444047..6444319,6448721..6448820,
FT                   6455368..6455466,6456674..6456777,6456868..6457017,
FT                   6458817..6458972,6459139..6459318,6462746..6462822,
FT                   6464455..6464608,6467972..6468103,6481840..6482095,
FT                   6483811..6484346)
FT                   /gene="Yes1"
FT                   /locus_tag="mCG_121794"
FT                   /product="Yamaguchi sarcoma viral (v-yes) oncogene homolog
FT                   1, transcript variant mCT193623"
FT                   /note="gene_id=mCG121794.1 transcript_id=mCT193623.0
FT                   created on 09-MAR-2004"
FT   CDS             join(<6416923..6416962,6444047..6444319,6448721..6448820,
FT                   6455368..6455466,6456674..6456777,6456868..6457017,
FT                   6458817..6458972,6459139..6459318,6462746..6462822,
FT                   6464455..6464608,6467972..6468103,6481840..6482048)
FT                   /codon_start=1
FT                   /gene="Yes1"
FT                   /locus_tag="mCG_121794"
FT                   /product="Yamaguchi sarcoma viral (v-yes) oncogene homolog
FT                   1, isoform CRA_c"
FT                   /note="gene_id=mCG121794.1 transcript_id=mCT193623.0
FT                   protein_id=mCP114565.0 isoform=CRA_c"
FT                   /protein_id="EDL37396.1"
FT                   /translation="FSPRRPVRVRPDSDLIMGCIKSKENKSPAIKYTPENLTEPVSPSA
FT                   SHYGVEHATVAPTSSTKGASVNFNSLSMTPFGGSSGVTPFGGASSSFSVVSSSYPTGLT
FT                   GGVTIFVALYDYEARTTEDLSFKKGERFQIINNTEGDWWEARSIATGKSGYIPSNYVVP
FT                   ADSIQAEEWYFGKMGRKDAERLLLNPGNQRGIFLVRESETTKGAYSLSIRDWDEVRGDN
FT                   VKHYKIRKLDNGGYYITTRAQFDTLQKLVKHYTEHADGLCHKLTTVCPTVKPQTQGLAK
FT                   DAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTKVAIKTLKPGTMMPEAFLQEAQIMKK
FT                   LRHDKLVPLYAVVSEEPIYIVTEFMSKGSLLDFLKEGDGKYLKLPQLVDMAAQIADGMA
FT                   YIERMNYIHRDLRAANILVGENLICKIADFGLARLIEDNEYTARQGAKFPIKWTAPEAA
FT                   LYGRFTIKSDVWSFGILQTELVTKGRVPYPGMVNREVLEQVERGYRMPCPQGCPESLHE
FT                   LMNLCWKKDPDERPTFEYIQSFLEDYFTATEPQYQPGENL"
FT   CDS             join(6444055..6444319,6448721..6448820,6455368..6455466,
FT                   6456674..6456777,6456868..6457017,6458817..6458972,
FT                   6459139..6459318,6462746..6462822,6464455..6464608,
FT                   6467972..6468103,6481840..6482048)
FT                   /codon_start=1
FT                   /gene="Yes1"
FT                   /locus_tag="mCG_121794"
FT                   /product="Yamaguchi sarcoma viral (v-yes) oncogene homolog
FT                   1, isoform CRA_a"
FT                   /note="gene_id=mCG121794.1 transcript_id=mCT123006.0
FT                   protein_id=mCP64908.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q3TJI7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000980"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR008266"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR020635"
FT                   /db_xref="InterPro:IPR028459"
FT                   /db_xref="MGI:MGI:99147"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TJI7"
FT                   /protein_id="EDL37394.1"
FT                   /translation="MGCIKSKENKSPAIKYTPENLTEPVSPSASHYGVEHATVAPTSST
FT                   KGASVNFNSLSMTPFGGSSGVTPFGGASSSFSVVSSSYPTGLTGGVTIFVALYDYEART
FT                   TEDLSFKKGERFQIINNTEGDWWEARSIATGKSGYIPSNYVVPADSIQAEEWYFGKMGR
FT                   KDAERLLLNPGNQRGIFLVRESETTKGAYSLSIRDWDEVRGDNVKHYKIRKLDNGGYYI
FT                   TTRAQFDTLQKLVKHYTEHADGLCHKLTTVCPTVKPQTQGLAKDAWEIPRESLRLEVKL
FT                   GQGCFGEVWMGTWNGTTKVAIKTLKPGTMMPEAFLQEAQIMKKLRHDKLVPLYAVVSEE
FT                   PIYIVTEFMSKGSLLDFLKEGDGKYLKLPQLVDMAAQIADGMAYIERMNYIHRDLRAAN
FT                   ILVGENLICKIADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGI
FT                   LQTELVTKGRVPYPGMVNREVLEQVERGYRMPCPQGCPESLHELMNLCWKKDPDERPTF
FT                   EYIQSFLEDYFTATEPQYQPGENL"
FT   assembly_gap    6454219..6454238
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6496452..6496474
FT                   /estimated_length=23
FT                   /gap_type="unknown"
FT   assembly_gap    6498197..6499034
FT                   /estimated_length=838
FT                   /gap_type="unknown"
FT   assembly_gap    6500361..6512308
FT                   /estimated_length=11948
FT                   /gap_type="unknown"
FT   gene            6515621..6530848
FT                   /pseudo
FT                   /locus_tag="mCG_121797"
FT                   /note="gene_id=mCG121797.1"
FT   mRNA            join(6515621..6515751,6516581..6516662,6516917..6517095,
FT                   6518570..6518646,6519526..6519628,6521762..6521858,
FT                   6524337..6524467,6524849..6524920,6525540..6525613,
FT                   6525726..6525905,6528903..6528951,6529058..6529136,
FT                   6529642..6529807,6529871..6530848)
FT                   /pseudo
FT                   /locus_tag="mCG_121797"
FT                   /note="gene_id=mCG121797.1 transcript_id=mCT123009.1
FT                   created on 14-JAN-2003"
FT   gene            complement(6530044..6580086)
FT                   /locus_tag="mCG_2531"
FT                   /note="gene_id=mCG2531.2"
FT   mRNA            complement(join(6530044..6531184,6531716..6531876,
FT                   6532118..6532264,6532512..6532650,6532867..6533103,
FT                   6558604..6558779,6568216..6568286,6579998..6580086))
FT                   /locus_tag="mCG_2531"
FT                   /product="mCG2531, transcript variant mCT180275"
FT                   /note="gene_id=mCG2531.2 transcript_id=mCT180275.1 created
FT                   on 13-JUN-2003"
FT   mRNA            complement(join(6530044..6531184,6531716..6531876,
FT                   6532118..6532264,6532512..6532650,6532867..6533103,
FT                   6558604..6558779,6579998..6580085))
FT                   /locus_tag="mCG_2531"
FT                   /product="mCG2531, transcript variant mCT185408"
FT                   /note="gene_id=mCG2531.2 transcript_id=mCT185408.0 created
FT                   on 13-JUN-2003"
FT   mRNA            complement(join(6530045..6531184,6531716..6531876,
FT                   6532118..6532264,6532512..6532650,6532867..6533103,
FT                   6534354..6534519,6535940..6535992,6558604..6558779,
FT                   6568216..6568286,6579998..6580076))
FT                   /locus_tag="mCG_2531"
FT                   /product="mCG2531, transcript variant mCT1819"
FT                   /note="gene_id=mCG2531.2 transcript_id=mCT1819.1 created on
FT                   13-JUN-2003"
FT   CDS             complement(join(6530960..6531184,6531716..6531876,
FT                   6532118..6532264,6532512..6532650,6532867..6533103,
FT                   6558604..6558779,6568216..6568286,6579998..6580062))
FT                   /codon_start=1
FT                   /locus_tag="mCG_2531"
FT                   /product="mCG2531, isoform CRA_g"
FT                   /note="gene_id=mCG2531.2 transcript_id=mCT180275.1
FT                   protein_id=mCP103197.1 isoform=CRA_g"
FT                   /db_xref="GOA:Q505E1"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033177"
FT                   /db_xref="MGI:MGI:2445114"
FT                   /db_xref="UniProtKB/TrEMBL:Q505E1"
FT                   /protein_id="EDL37403.1"
FT                   /translation="MAASGGRACVRSLRGGVLWRSSPCHYESTATRHFLGTLQKLPLQA
FT                   GVRNFHTAPVRSLFLLRPVPILLATGGGYAGYRQYEKYRERKLEKLGLEIPPKLASHWE
FT                   VSLYKSVPTRLLSRACGRLNQVELPYWLRRPVYSLYIWTFGVNMTEAAVEDLHHYRNLS
FT                   EFFRRKLKPQARPVCGLHCVTSPSDGKILTFGQVKNSEVEQVKGVTYSLESFLGPRANT
FT                   EDLPFPPASSSDSFRNQLVTREGNELYHCVIYLAPGDYHCFHSPTDWTISHRRHFPGSL
FT                   MSVNPGMARWIKELFCHNERVVLTGDWKHGFFSLTAVGATNVGSIRIHFDRDLHTNSPR
FT                   YSKGSYNDLSFVTHANKEGIPMRKGEPLGEFNLGSTIVLIFEAPKDFNFRLKAGQKIRF
FT                   GEALGSL"
FT   CDS             complement(join(6530960..6531184,6531716..6531876,
FT                   6532118..6532264,6532512..6532650,6532867..6533103,
FT                   6534354..6534519,6535940..6535992,6558604..6558779,
FT                   6568216..6568286,6579998..6580062))
FT                   /codon_start=1
FT                   /locus_tag="mCG_2531"
FT                   /product="mCG2531, isoform CRA_a"
FT                   /note="gene_id=mCG2531.2 transcript_id=mCT1819.1
FT                   protein_id=mCP3897.3 isoform=CRA_a"
FT                   /protein_id="EDL37397.1"
FT                   /translation="MAASGGRACVRSLRGGVLWRSSPCHYESTATRHFLGTLQKLPLQA
FT                   GVRNFHTAPVRSLFLLRPVPILLATGGGYAGYRQYEKYRERKLEKLGLEIPPKLASHWE
FT                   MCQSEKQPGPELQAAAKWLYFPQLALRRRLGQLSCMSRPALKLRSWPLTILHYLLPFRA
FT                   LGPLSQVGWRPMSRVSLYKSVPTRLLSRACGRLNQVELPYWLRRPVYSLYIWTFGVNMT
FT                   EAAVEDLHHYRNLSEFFRRKLKPQARPVCGLHCVTSPSDGKILTFGQVKNSEVEQVKGV
FT                   TYSLESFLGPRANTEDLPFPPASSSDSFRNQLVTREGNELYHCVIYLAPGDYHCFHSPT
FT                   DWTISHRRHFPGSLMSVNPGMARWIKELFCHNERVVLTGDWKHGFFSLTAVGATNVGSI
FT                   RIHFDRDLHTNSPRYSKGSYNDLSFVTHANKEGIPMRKGEPLGEFNLGSTIVLIFEAPK
FT                   DFNFRLKAGQKIRFGEALGSL"
FT   CDS             complement(join(6530960..6531184,6531716..6531876,
FT                   6532118..6532264,6532512..6532650,6532867..6532974))
FT                   /codon_start=1
FT                   /locus_tag="mCG_2531"
FT                   /product="mCG2531, isoform CRA_h"
FT                   /note="gene_id=mCG2531.2 transcript_id=mCT185408.0
FT                   protein_id=mCP106666.0 isoform=CRA_h"
FT                   /db_xref="GOA:Q3TJ76"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033177"
FT                   /db_xref="MGI:MGI:2445114"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TJ76"
FT                   /protein_id="EDL37404.1"
FT                   /translation="MTEAAVEDLHHYRNLSEFFRRKLKPQARPVCGLHCVTSPSDGKIL
FT                   TFGQVKNSEVEQVKGVTYSLESFLGPRANTEDLPFPPASSSDSFRNQLVTREGNELYHC
FT                   VIYLAPGDYHCFHSPTDWTISHRRHFPGSLMSVNPGMARWIKELFCHNERVVLTGDWKH
FT                   GFFSLTAVGATNVGSIRIHFDRDLHTNSPRYSKGSYNDLSFVTHANKEGIPMRKGEPLG
FT                   EFNLGSTIVLIFEAPKDFNFRLKAGQKIRFGEALGSL"
FT   mRNA            complement(join(6531577..6531876,6532118..6532264,
FT                   6532512..>6532806))
FT                   /locus_tag="mCG_2531"
FT                   /product="mCG2531, transcript variant mCT185409"
FT                   /note="gene_id=mCG2531.2 transcript_id=mCT185409.0 created
FT                   on 13-JUN-2003"
FT   CDS             complement(join(6531605..6531876,6532118..6532264,
FT                   6532512..>6532806))
FT                   /codon_start=1
FT                   /locus_tag="mCG_2531"
FT                   /product="mCG2531, isoform CRA_b"
FT                   /note="gene_id=mCG2531.2 transcript_id=mCT185409.0
FT                   protein_id=mCP106667.0 isoform=CRA_b"
FT                   /protein_id="EDL37398.1"
FT                   /translation="ARLSSTAWPWHSGRLPPDLDWSSLRTWQVVEFGEPLKVRTTPSLP
FT                   SKLCLLQTSPSDGKILTFGQVKNSEVEQVKGVTYSLESFLGPRANTEDLPFPPASSSDS
FT                   FRNQLVTREGNELYHCVIYLAPGDYHCFHSPTDWTISHRRHFPGSLMSVNPGMARWIKE
FT                   LFCHNERVVLTGDWKHGFFSLTAVGATNVGSIRIHFDRVSKAHRPNLLGPTTSFAVQPY
FT                   LWAYKFCGGGGGGMF"
FT   mRNA            complement(join(6531643..6532264,6532512..6532650,
FT                   6532867..6533103,6558604..6558779,6568216..6568286,
FT                   6579998..6580076))
FT                   /locus_tag="mCG_2531"
FT                   /product="mCG2531, transcript variant mCT185410"
FT                   /note="gene_id=mCG2531.2 transcript_id=mCT185410.0 created
FT                   on 13-JUN-2003"
FT   CDS             complement(join(6532095..6532264,6532512..6532650,
FT                   6532867..6533103,6558604..6558779,6568216..6568286,
FT                   6579998..6580062))
FT                   /codon_start=1
FT                   /locus_tag="mCG_2531"
FT                   /product="mCG2531, isoform CRA_c"
FT                   /note="gene_id=mCG2531.2 transcript_id=mCT185410.0
FT                   protein_id=mCP106669.0 isoform=CRA_c"
FT                   /protein_id="EDL37399.1"
FT                   /translation="MAASGGRACVRSLRGGVLWRSSPCHYESTATRHFLGTLQKLPLQA
FT                   GVRNFHTAPVRSLFLLRPVPILLATGGGYAGYRQYEKYRERKLEKLGLEIPPKLASHWE
FT                   VSLYKSVPTRLLSRACGRLNQVELPYWLRRPVYSLYIWTFGVNMTEAAVEDLHHYRNLS
FT                   EFFRRKLKPQARPVCGLHCVTSPSDGKILTFGQVKNSEVEQVKGVTYSLESFLGPRANT
FT                   EDLPFPPASSSDSFRNQLVTREGNELYHCVIYLAPGDYHCFHSPTDWTISHRRHFPGLP
FT                   RGGH"
FT   mRNA            complement(join(6532607..6533103,6534354..6534519,
FT                   6534775..6534862,6535940..6536205,6558604..6558779,
FT                   6568216..6568286,6579998..6580071))
FT                   /locus_tag="mCG_2531"
FT                   /product="mCG2531, transcript variant mCT185412"
FT                   /note="gene_id=mCG2531.2 transcript_id=mCT185412.0 created
FT                   on 13-JUN-2003"
FT   mRNA            complement(join(6532679..6533103,6534354..6534519,
FT                   6535940..6536205,6539199..6539412,6539943..6540072))
FT                   /locus_tag="mCG_2531"
FT                   /product="mCG2531, transcript variant mCT185411"
FT                   /note="gene_id=mCG2531.2 transcript_id=mCT185411.0 created
FT                   on 13-JUN-2003"
FT   CDS             complement(join(6532807..6533103,6534354..6534519,
FT                   6535940..6535992))
FT                   /codon_start=1
FT                   /locus_tag="mCG_2531"
FT                   /product="mCG2531, isoform CRA_d"
FT                   /note="gene_id=mCG2531.2 transcript_id=mCT185411.0
FT                   protein_id=mCP106668.0 isoform=CRA_d"
FT                   /protein_id="EDL37400.1"
FT                   /translation="MCQSEKQPGPELQAAAKWLYFPQLALRRRLGQLSCMSRPALKLRS
FT                   WPLTILHYLLPFRALGPLSQVGWRPMSRVSLYKSVPTRLLSRACGRLNQVELPYWLRRP
FT                   VYSLYIWTFGVNMTEAAVEDLHHYRNLSEFFRRKLKPQARPVCGLHCVVRPGPCLHSSL
FT                   GNEILVCL"
FT   CDS             complement(join(6532807..6533103,6534354..6534467))
FT                   /codon_start=1
FT                   /locus_tag="mCG_2531"
FT                   /product="mCG2531, isoform CRA_e"
FT                   /note="gene_id=mCG2531.2 transcript_id=mCT185412.0
FT                   protein_id=mCP106670.0 isoform=CRA_e"
FT                   /protein_id="EDL37401.1"
FT                   /translation="MSRPALKLRSWPLTILHYLLPFRALGPLSQVGWRPMSRVSLYKSV
FT                   PTRLLSRACGRLNQVELPYWLRRPVYSLYIWTFGVNMTEAAVEDLHHYRNLSEFFRRKL
FT                   KPQARPVCGLHCVVRPGPCLHSSLGNEILVCL"
FT   assembly_gap    6539750..6539821
FT                   /estimated_length=72
FT                   /gap_type="unknown"
FT   assembly_gap    6550333..6550536
FT                   /estimated_length=204
FT                   /gap_type="unknown"
FT   mRNA            complement(join(6558264..6558779,6568216..6568286,
FT                   6579998..6580075))
FT                   /locus_tag="mCG_2531"
FT                   /product="mCG2531, transcript variant mCT185413"
FT                   /note="gene_id=mCG2531.2 transcript_id=mCT185413.0 created
FT                   on 13-JUN-2003"
FT   CDS             complement(join(6558568..6558779,6568216..6568286,
FT                   6579998..6580062))
FT                   /codon_start=1
FT                   /locus_tag="mCG_2531"
FT                   /product="mCG2531, isoform CRA_f"
FT                   /note="gene_id=mCG2531.2 transcript_id=mCT185413.0
FT                   protein_id=mCP106671.0 isoform=CRA_f"
FT                   /protein_id="EDL37402.1"
FT                   /translation="MAASGGRACVRSLRGGVLWRSSPCHYESTATRHFLGTLQKLPLQA
FT                   GVRNFHTAPVRSLFLLRPVPILLATGGGYAGYRQYEKYRERKLEKLGLEIPPKLASHWE
FT                   VGLMSSHLRQL"
FT   assembly_gap    6574965..6574984
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6579114..6579653
FT                   /estimated_length=540
FT                   /gap_type="unknown"
FT   assembly_gap    6582652..6583279
FT                   /estimated_length=628
FT                   /gap_type="unknown"
FT   gene            complement(6583280..>6648783)
FT                   /gene="C330019G07Rik"
FT                   /locus_tag="mCG_51681"
FT                   /note="gene_id=mCG51681.2"
FT   mRNA            complement(join(6583280..6588431,6590189..6590260,
FT                   6614433..6614539,6615160..6615331,6616634..6616705,
FT                   6621640..6621796,6622196..6622374,6638652..6638741,
FT                   6648643..>6648783))
FT                   /gene="C330019G07Rik"
FT                   /locus_tag="mCG_51681"
FT                   /product="RIKEN cDNA C330019G07"
FT                   /note="gene_id=mCG51681.2 transcript_id=mCT51864.2 created
FT                   on 02-OCT-2002"
FT   CDS             complement(join(6588131..6588431,6590189..6590260,
FT                   6614433..6614539,6615160..6615331,6616634..6616705,
FT                   6621640..6621796,6622196..6622374,6638652..>6638740))
FT                   /codon_start=1
FT                   /gene="C330019G07Rik"
FT                   /locus_tag="mCG_51681"
FT                   /product="RIKEN cDNA C330019G07"
FT                   /note="gene_id=mCG51681.2 transcript_id=mCT51864.2
FT                   protein_id=mCP27000.2"
FT                   /protein_id="EDL37405.1"
FT                   /translation="PKSMEPKVFRDQGDQAQVFRDPCEGAKEDPLTTATKPQELRCRRD
FT                   SSSLVPLAKNYKRLRYKKLLDGFSHNAMQLDPYLAATGWNRGSNTLCSPGCYRIWTKRR
FT                   NFSSNMPIMQRLFLTQFTQGLKGLRSPASIADKVFCSLHTTIPNVPLPGMGAAHTTNSS
FT                   HLRLEPVFPALVPKSCLVTEAAVSTLLLSASELAVPGCDELDGVSAACPRPQSSPAQQK
FT                   EAEPEKRPKKVSQIRIRKTIPKPDPNLTPMGLPRPKRLKKKEFSLEEIYTNKNYKSPPA
FT                   SRCLETIFEEPKERNGTLISISQQKRKRVLEFQDFTVPRKRRARGKVKLAGSFTRAQKA
FT                   ALQTQELDALLIQKLMELETFFAKEGEQEHQPAAENSSGSPL"
FT   gene            6658317..6802032
FT                   /gene="Depdc5"
FT                   /locus_tag="mCG_141233"
FT                   /note="gene_id=mCG141233.0"
FT   mRNA            join(6658317..6658370,6659126..6659248,6662521..6662608,
FT                   6663368..6663414,6669826..6669915,6671615..6671697,
FT                   6673172..6673221,6681527..6681596,6687927..6688005,
FT                   6690463..6690524,6692462..6692531,6693575..6693647,
FT                   6696037..6696140,6696411..6696485,6698370..6698504,
FT                   6698868..6698929,6699052..6699125,6705064..6705133,
FT                   6706816..6706852,6707707..6707827,6712531..6712751,
FT                   6718768..6718971,6722154..6722289,6723109..6723203,
FT                   6729248..6729313,6732854..6733010,6733451..6733611,
FT                   6738536..6738653,6739275..6739442,6740226..6740445,
FT                   6742529..6742662,6764428..6764533,6772951..6773102,
FT                   6775936..6776013,6776836..6776968,6781793..6781901,
FT                   6783261..6783488,6787321..6787490,6791650..6791821,
FT                   6794728..6794788,6798536..6798618,6798739..6802032)
FT                   /gene="Depdc5"
FT                   /locus_tag="mCG_141233"
FT                   /product="DEP domain containing 5"
FT                   /note="gene_id=mCG141233.0 transcript_id=mCT174000.0
FT                   created on 29-OCT-2002"
FT   CDS             join(6659191..6659248,6662521..6662608,6663368..6663414,
FT                   6669826..6669915,6671615..6671697,6673172..6673221,
FT                   6681527..6681596,6687927..6688005,6690463..6690524,
FT                   6692462..6692531,6693575..6693647,6696037..6696140,
FT                   6696411..6696485,6698370..6698504,6698868..6698929,
FT                   6699052..6699125,6705064..6705133,6706816..6706852,
FT                   6707707..6707827,6712531..6712751,6718768..6718971,
FT                   6722154..6722289,6723109..6723203,6729248..6729313,
FT                   6732854..6733010,6733451..6733611,6738536..6738653,
FT                   6739275..6739442,6740226..6740445,6742529..6742662,
FT                   6764428..6764533,6772951..6773102,6775936..6776013,
FT                   6776836..6776968,6781793..6781901,6783261..6783488,
FT                   6787321..6787490,6791650..6791821,6794728..6794788,
FT                   6798536..6798618,6798739..6799031)
FT                   /codon_start=1
FT                   /gene="Depdc5"
FT                   /locus_tag="mCG_141233"
FT                   /product="DEP domain containing 5"
FT                   /note="gene_id=mCG141233.0 transcript_id=mCT174000.0
FT                   protein_id=mCP96919.0"
FT                   /protein_id="EDL37406.1"
FT                   /translation="MRTTKVYKLVIHKKGFGGSDDELVVNPKVFPHIKLGDIVEIAHPN
FT                   DEYSPLLLQVKSLKEDLQKETISVDQTVTQVFRLRPYQDVYVNVVDPKANVTLDLVELT
FT                   FKDQYIGRGDMWRLKKSLVSTCAYITQKVEFAGIRAQAGELWVKNEKVMCGYISEETRV
FT                   VFRSTSAMVYIFIQMSCEMWDFDIYGDLYFEKAVNGFLADLFTKWKEKNCSHEVTVVLF
FT                   SRTFYDAKSIDEFPEINRASIQEDHKGRFYEDFYKVVVQNERREEWTSLLVTIKKLFIQ
FT                   YPVLVRLEQAGGFPQGDNSTSAQGNYLEAINLSFNVFDKHYINRNFDRTGQMSVVITPG
FT                   VGVFEVDRLLMILTKQRMIDNGIGVDLVCMGEQPLHAVPLFKLHNRSVPRDSRLGDDYN
FT                   IPHWINHSFYTSKSQLFCNSFTPRIKLAGKKSASEKTKNGRDTSLGTPKESENTLPIQV
FT                   DYDAYDAQVFRLPGPSRAQRLATCRSVREQENHSRKSASSCDVSSSPSLPSRALPTEEV
FT                   RSQASDDSSLGKSTNILMIPNPHLHQYEVSSSLGYTSTRDVLENMIEPPQRDSSAPGRF
FT                   HVGSAESMLHVRPGGYTPQRALINPFAPSRMPMKLTSNRRRWMHTFPVGPSGEAIQIHH
FT                   QTRQNMAELQGSRQRDPTHSSAELLELAYHEAAGRHSTSRQPGDSMSLNFSGTEELSVS
FT                   LLSNSSTGVNPRTQNKDSLEDSVSTSPDPMPGFCCTVGVDWKSLTTPACLPLTTDYFPD
FT                   RQGLQNDYTEGCYDLLPEADMDRRDEEGVQMTAQQVFEEFICQRLMQGYQIIVQPKTQK
FT                   PNTTVPPPLSSSPLYSRGLVSRNRPEEEGQYWLSMGRTFHKVTLKDKMITVTRYLPKYP
FT                   YESAQIHYTYSLCPSHSDSEFVSCWVDFCHERLEEYKWNYLDQYICSAGSEDFSLIESL
FT                   KFWRTRFLLLPACVTATKRITEGEVHCDIYGDKPRADEDEWQLLDGFIRFVEGLNRIRR
FT                   RHRSDRMIRKGTAMKGLQMTGPISAHSLESTGPPVGKKGTSALSALLEMEASQKSLGEQ
FT                   QTTVHGKSSTQPAENSSVAMTPTYVDSPRKASVDQTAPLVLDSTSLGVSTGQPMDRGNN
FT                   QTFGNSQNIEQAFPSANSGDYSSQQHVASSLTSSSTLVEILEAMKHPSTGVQLLSEQKG
FT                   LSPCCFISAEVVHWLMNNVEGVQTQAMGIDIMQKMLEEQLITHASGEAWRTFIYGFYFY
FT                   KIVMDKEPERVAMQQPSAPWYTAGADDFASFQRKWFEVAFVAEELVHSEIPAFLLPWLP
FT                   SRPASYASRHSSFSRSFGGRSQAAALLAATVPEQRTVTLDVDVNNRTDRLEWCSCYYHG
FT                   NFSLNAAFEIKLHWMAVTATVLFEMVQGWHRKATSCGFLLVPVLEGPFALPSYLYGDPL
FT                   RAQLFIPLNLSCLLKEGSEHLFDSFEPETYWDRMHLFQEAIAHRFGFVQDKYSVSAFNF
FT                   PAENKPQYIHVTGTVFLQLPYSKRKFSGQQRRRRNSTSSTNQNMFCEERVGYNWAYNTM
FT                   LTKTWRSSATGDEKFADRLLKDFTDFCINRDNRLVTFWTNCLEKMHASAP"
FT   assembly_gap    6719337..6719356
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6740884..6740903
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6742046..6742065
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6744942..6750991
FT                   /estimated_length=6050
FT                   /gap_type="unknown"
FT   assembly_gap    6753063..6753082
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6761635..6762242
FT                   /estimated_length=608
FT                   /gap_type="unknown"
FT   assembly_gap    6765436..6765789
FT                   /estimated_length=354
FT                   /gap_type="unknown"
FT   assembly_gap    6774703..6774772
FT                   /estimated_length=70
FT                   /gap_type="unknown"
FT   assembly_gap    6789750..6790026
FT                   /estimated_length=277
FT                   /gap_type="unknown"
FT   gene            6792361..6793609
FT                   /locus_tag="mCG_148297"
FT                   /note="gene_id=mCG148297.0"
FT   mRNA            6792361..6793609
FT                   /locus_tag="mCG_148297"
FT                   /product="mCG148297"
FT                   /note="gene_id=mCG148297.0 transcript_id=mCT188560.0
FT                   created on 13-JAN-2004"
FT   CDS             6792441..6792890
FT                   /codon_start=1
FT                   /locus_tag="mCG_148297"
FT                   /product="mCG148297"
FT                   /note="gene_id=mCG148297.0 transcript_id=mCT188560.0
FT                   protein_id=mCP109211.0"
FT                   /protein_id="EDL37407.1"
FT                   /translation="MLLSFELLLHGLARATLPALQGQCEANSGWERGLFAVHLYTIAVS
FT                   CVLPATCSACLNLRRAFCMLVPRKTIKSKTGSGVLLCKVVAGFVSPRLPVCVSRAVSQV
FT                   RALPSVRKGLSQQTTPMCLLLTPSPHLHLPLLSPSTHADEFINSS"
FT   assembly_gap    6821032..6821157
FT                   /estimated_length=126
FT                   /gap_type="unknown"
FT   gene            6826619..6835696
FT                   /gene="Ywhah"
FT                   /locus_tag="mCG_2700"
FT                   /note="gene_id=mCG2700.1"
FT   mRNA            join(6826619..6826885,6834272..6835696)
FT                   /gene="Ywhah"
FT                   /locus_tag="mCG_2700"
FT                   /product="tyrosine 3-monooxygenase/tryptophan
FT                   5-monooxygenase activation protein, eta polypeptide"
FT                   /note="gene_id=mCG2700.1 transcript_id=mCT1824.1 created on
FT                   17-SEP-2002"
FT   CDS             join(6826799..6826885,6834272..6834925)
FT                   /codon_start=1
FT                   /gene="Ywhah"
FT                   /locus_tag="mCG_2700"
FT                   /product="tyrosine 3-monooxygenase/tryptophan
FT                   5-monooxygenase activation protein, eta polypeptide"
FT                   /note="gene_id=mCG2700.1 transcript_id=mCT1824.1
FT                   protein_id=mCP3894.2"
FT                   /protein_id="EDL37408.1"
FT                   /translation="MGDREQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLL
FT                   SVAYKNVVGARRSSWRVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLALL
FT                   DKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKE
FT                   HMQPTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQAFDDAIAELDTLNEDSYKDSTLI
FT                   MQLLRDNLTLWTSDQQDEEAGEGN"
FT   assembly_gap    6844726..6844783
FT                   /estimated_length=58
FT                   /gap_type="unknown"
FT   assembly_gap    6865455..6866085
FT                   /estimated_length=631
FT                   /gap_type="unknown"
FT   assembly_gap    6870465..6870484
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6873665..6873684
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6882757..6882818
FT                   /estimated_length=62
FT                   /gap_type="unknown"
FT   gene            6883733..6884181
FT                   /locus_tag="mCG_121795"
FT                   /note="gene_id=mCG121795.1"
FT   mRNA            6883733..6884181
FT                   /locus_tag="mCG_121795"
FT                   /product="mCG121795"
FT                   /note="gene_id=mCG121795.1 transcript_id=mCT123007.1
FT                   created on 02-OCT-2002"
FT   CDS             6883791..6884123
FT                   /codon_start=1
FT                   /locus_tag="mCG_121795"
FT                   /product="mCG121795"
FT                   /note="gene_id=mCG121795.1 transcript_id=mCT123007.1
FT                   protein_id=mCP64918.1"
FT                   /db_xref="GOA:Q6ZWX1"
FT                   /db_xref="InterPro:IPR001780"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR018266"
FT                   /db_xref="MGI:MGI:1928894"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ZWX1"
FT                   /protein_id="EDL37409.1"
FT                   /translation="MSGRLWCKAIFAGYKRGLRNQREHTALLKIEGVYARDETEFYLGK
FT                   RCAYVYKAKNNTVTPGGKPNKTRVIWGKVTRAHGNSGMVRAKFRSNLPAKAIGHRIRVM
FT                   LYPSRI"
FT   assembly_gap    6901731..6901788
FT                   /estimated_length=58
FT                   /gap_type="unknown"
FT   assembly_gap    6907961..6907980
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            6912004..6969094
FT                   /gene="Slc5a1"
FT                   /locus_tag="mCG_2536"
FT                   /note="gene_id=mCG2536.2"
FT   mRNA            join(6912004..6912364,6939183..6939280,6940615..6940674,
FT                   6941814..6941918,6951212..6951317,6952496..6952576,
FT                   6953754..6953974,6954190..6954325,6956192..6956299,
FT                   6959852..6960002,6961639..6961807,6965329..6965544,
FT                   6966318..6966426,6968020..6969094)
FT                   /gene="Slc5a1"
FT                   /locus_tag="mCG_2536"
FT                   /product="solute carrier family 5 (sodium/glucose
FT                   cotransporter), member 1"
FT                   /note="gene_id=mCG2536.2 transcript_id=mCT1812.2 created on
FT                   17-SEP-2002"
FT   CDS             join(6912229..6912364,6939183..6939280,6940615..6940674,
FT                   6941814..6941918,6951212..6951317,6952496..6952576,
FT                   6953754..6953974,6954190..6954325,6956192..6956299,
FT                   6959852..6960002,6961639..6961807,6965329..6965544,
FT                   6966318..6966426,6968020..6968243)
FT                   /codon_start=1
FT                   /gene="Slc5a1"
FT                   /locus_tag="mCG_2536"
FT                   /product="solute carrier family 5 (sodium/glucose
FT                   cotransporter), member 1"
FT                   /note="gene_id=mCG2536.2 transcript_id=mCT1812.2
FT                   protein_id=mCP3966.2"
FT                   /protein_id="EDL37410.1"
FT                   /translation="MDSSTLSPAVTATDAPIPSYERIRNAADISVIVIYFVVVMAVGLW
FT                   ASLFASNIGSGHFVGLAGTGAAAGIAMGGFEWNALVLVVVLGWIFVPIYIKAGVVTMPE
FT                   YLRKRFGGKRIQIYLSVLSLLLYIFTKISADIFSGAIFINLALGLDIYLAIFILLAITA
FT                   LYTITGGLAAVIYTDTLQTAIMLVGSFILTGFAFNEVGGYEAFMDKYMKAIPTKVSNGN
FT                   FTAKEECYTPRADSFHIFRDPITGDMPWPGLIFGLAILALWYWCTDQVIVQRCLSAKNM
FT                   SHVKAGCTLCGYLKLLPMFLMVMPGMISRILYTEKIACVLPEECQKYCGTPVGCTNIAY
FT                   PTLVVELMPNGLRGLMLSVMMASLMSSLTSIFNSASTLFTMDIYTKIRKKASEKELMIA
FT                   GRLFILVLIGISIAWVPIVQSAQSGQLFDYIQSITSYLGPPIAAVFLLAIFCKRVNEQG
FT                   AFWGLILGFLIGISRMITEFAYGTGSCMEPSNCPKIICGVHYLYFAIILFVISVITILI
FT                   ISFLTKPIPDVHLYRLCWSLRNSKEERIDLDAGEEEDIPEDSKDTIEIDTEAPQKKKGC
FT                   FRRAYDLFCGLDQDKGPKMTKEEEEAMKMKMTDTSEKPLWRTVVNINGIILLAVAVFCH
FT                   AYFA"
FT   assembly_gap    6923173..6925851
FT                   /estimated_length=2679
FT                   /gap_type="unknown"
FT   assembly_gap    6933646..6933675
FT                   /estimated_length=30
FT                   /gap_type="unknown"
FT   assembly_gap    6954676..6954827
FT                   /estimated_length=152
FT                   /gap_type="unknown"
FT   assembly_gap    6964172..6964324
FT                   /estimated_length=153
FT                   /gap_type="unknown"
FT   assembly_gap    6982637..6983718
FT                   /estimated_length=1082
FT                   /gap_type="unknown"
FT   assembly_gap    6984390..6985356
FT                   /estimated_length=967
FT                   /gap_type="unknown"
FT   assembly_gap    6987855..6987874
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6989315..6989334
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6990483..6990938
FT                   /estimated_length=456
FT                   /gap_type="unknown"
FT   gene            6990940..6991384
FT                   /pseudo
FT                   /locus_tag="mCG_1046057"
FT                   /note="gene_id=mCG1046057.1"
FT   mRNA            6990940..6991384
FT                   /pseudo
FT                   /locus_tag="mCG_1046057"
FT                   /note="gene_id=mCG1046057.1 transcript_id=mCT163761.1
FT                   created on 14-OCT-2002"
FT   assembly_gap    6992082..6994946
FT                   /estimated_length=2865
FT                   /gap_type="unknown"
FT   assembly_gap    6996636..6998006
FT                   /estimated_length=1371
FT                   /gap_type="unknown"
FT   assembly_gap    7001996..7002015
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7003131..7003150
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7010416..7010460
FT                   /estimated_length=45
FT                   /gap_type="unknown"
FT   gene            complement(7023903..7028603)
FT                   /gene="Spon2"
FT                   /locus_tag="mCG_2535"
FT                   /note="gene_id=mCG2535.1"
FT   mRNA            complement(join(7023903..7025038,7025935..7026109,
FT                   7026716..7026907,7026980..7027203,7027627..7027846,
FT                   7028331..7028603))
FT                   /gene="Spon2"
FT                   /locus_tag="mCG_2535"
FT                   /product="spondin 2, extracellular matrix protein,
FT                   transcript variant mCT1814"
FT                   /note="gene_id=mCG2535.1 transcript_id=mCT1814.1 created on
FT                   17-SEP-2002"
FT   mRNA            complement(join(7024320..7025038,7025935..7026109,
FT                   7026716..7027203,7027627..7027846,7028331..>7028570))
FT                   /gene="Spon2"
FT                   /locus_tag="mCG_2535"
FT                   /product="spondin 2, extracellular matrix protein,
FT                   transcript variant mCT193587"
FT                   /note="gene_id=mCG2535.1 transcript_id=mCT193587.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(7024854..7025038,7025935..7026109,
FT                   7026716..7026907,7026980..7027203,7027627..7027843))
FT                   /codon_start=1
FT                   /gene="Spon2"
FT                   /locus_tag="mCG_2535"
FT                   /product="spondin 2, extracellular matrix protein, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG2535.1 transcript_id=mCT1814.1
FT                   protein_id=mCP3940.1 isoform=CRA_c"
FT                   /protein_id="EDL37413.1"
FT                   /translation="MENVSLALGRALWVFLLAMIGSTTSQPLGGESVCTARPLARYSIT
FT                   FIGKWSQTAFPKQYPLFRPPAQWSSLLGAAHSSDYSMWRKNEYVSNGLRDFAERGEAWA
FT                   LMKEIEAAGEKLQSVHAVFSAPAIPSGTGQTSTELEVHPRHSLVSFVVRIVPSPDWFVG
FT                   IDSLDLCEGGRWKEQVVLDLYPHDAGTDSGFTFSSPNFATIPQDTVTEITASSPSHPAN
FT                   SFYYPRLKSLPPIAKVTFVRLQQSPRAFAPPSLDLASRGNEIVDSLSVPETPLDCEVSL
FT                   WSSWGLCGGPCGKLGAKSRTRYVRVQPANNGTPCPELEEEAECAPDNCV"
FT   CDS             complement(join(7024854..7025038,7025935..7026109,
FT                   7026716..>7026964))
FT                   /codon_start=1
FT                   /gene="Spon2"
FT                   /locus_tag="mCG_2535"
FT                   /product="spondin 2, extracellular matrix protein, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG2535.1 transcript_id=mCT193587.0
FT                   protein_id=mCP114593.0 isoform=CRA_b"
FT                   /protein_id="EDL37412.1"
FT                   /translation="PGRGYVPMAAAAKSSGPIQVSFVVRIVPSPDWFVGIDSLDLCEGG
FT                   RWKEQVVLDLYPHDAGTDSGFTFSSPNFATIPQDTVTEITASSPSHPANSFYYPRLKSL
FT                   PPIAKVTFVRLQQSPRAFAPPSLDLASRGNEIVDSLSVPETPLDCEVSLWSSWGLCGGP
FT                   CGKLGAKSRTRYVRVQPANNGTPCPELEEEAECAPDNCV"
FT   mRNA            complement(join(<7027122..7027203,7027627..7027846,
FT                   7027956..7028043,7028331..7028526))
FT                   /gene="Spon2"
FT                   /locus_tag="mCG_2535"
FT                   /product="spondin 2, extracellular matrix protein,
FT                   transcript variant mCT173413"
FT                   /note="gene_id=mCG2535.1 transcript_id=mCT173413.0 created
FT                   on 17-SEP-2002"
FT   CDS             complement(join(<7027122..7027203,7027627..7027843))
FT                   /codon_start=1
FT                   /gene="Spon2"
FT                   /locus_tag="mCG_2535"
FT                   /product="spondin 2, extracellular matrix protein, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG2535.1 transcript_id=mCT173413.0
FT                   protein_id=mCP96332.0 isoform=CRA_a"
FT                   /protein_id="EDL37411.1"
FT                   /translation="MENVSLALGRALWVFLLAMIGSTTSQPLGGESVCTARPLARYSIT
FT                   FIGKWSQTAFPKQYPLFRPPAQWSSLLGAAHSSDYSMWRKNEYVSNGLRDFAERG"
FT   assembly_gap    7034430..7034563
FT                   /estimated_length=134
FT                   /gap_type="unknown"
FT   gene            complement(7058210..7080117)
FT                   /gene="Ctbp1"
FT                   /locus_tag="mCG_2534"
FT                   /note="gene_id=mCG2534.2"
FT   mRNA            complement(join(7058210..7059172,7059593..7059710,
FT                   7060073..7060200,7060857..7060987,7061344..7061558,
FT                   7069619..7069825,7071490..7071634,7077364..7077518,
FT                   7079924..7080117))
FT                   /gene="Ctbp1"
FT                   /locus_tag="mCG_2534"
FT                   /product="C-terminal binding protein 1, transcript variant
FT                   mCT1813"
FT                   /note="gene_id=mCG2534.2 transcript_id=mCT1813.2 created on
FT                   18-FEB-2003"
FT   mRNA            complement(join(7058213..7059169,7059593..7059710,
FT                   7060073..7060200,7060857..7060987,7061344..7061558,
FT                   7069619..7069825,7071490..7071634,7077364..>7077522))
FT                   /gene="Ctbp1"
FT                   /locus_tag="mCG_2534"
FT                   /product="C-terminal binding protein 1, transcript variant
FT                   mCT193586"
FT                   /note="gene_id=mCG2534.2 transcript_id=mCT193586.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(7058986..7059172,7059593..7059710,
FT                   7060073..7060200,7060857..7060987,7061344..7061558,
FT                   7069619..7069825,7071490..7071634,7077364..7077518,
FT                   7079924..7079930))
FT                   /codon_start=1
FT                   /gene="Ctbp1"
FT                   /locus_tag="mCG_2534"
FT                   /product="C-terminal binding protein 1, isoform CRA_b"
FT                   /note="gene_id=mCG2534.2 transcript_id=mCT1813.2
FT                   protein_id=mCP3953.2 isoform=CRA_b"
FT                   /protein_id="EDL37415.1"
FT                   /translation="MSGVRPPIMNGPMHPRPLVALLDGRDCTVEMPILKDVATVAFCDA
FT                   QSTQEIHEKVLNEAVGALMYHTITLTREDLEKFKALRIIVRIGSGFDNIDIKSAGDLGI
FT                   AVCNVPAASVEETADSTLCHILNLYRRTTWLHQALREGTRVQSVEQIREVASGAARIRG
FT                   ETLGIIGLGRVGQAVALRAKAFGFNVLFYDPYLSDGIERALGLQRVSTLQDLLFHSDCV
FT                   TLHCGLNEHNHHLINDFTVKQMRQGAFLVNTARGGLVDEKALAQALKEGRIRGAALDVH
FT                   ESEPFSFSQGPLKDAPNLICTPHAAWYSEQASIEMREEAAREIRRAITGRIPDSLKNCV
FT                   NKDHLTAATHWASMDPAVVHPELNGAAYSRYPPGVVSVAPTGIPAAVEGIVPSAMSLSH
FT                   GLPPVAHPPHAPSPGQTVKPEADRDHTSDQL"
FT   CDS             complement(join(7058986..7059169,7059593..7059710,
FT                   7060073..7060200,7060857..7060987,7061344..7061558,
FT                   7069619..7069825,7071490..7071634,7077364..>7077522))
FT                   /codon_start=1
FT                   /gene="Ctbp1"
FT                   /locus_tag="mCG_2534"
FT                   /product="C-terminal binding protein 1, isoform CRA_c"
FT                   /note="gene_id=mCG2534.2 transcript_id=mCT193586.0
FT                   protein_id=mCP114592.0 isoform=CRA_c"
FT                   /protein_id="EDL37416.1"
FT                   /translation="AGVRPPIMNGPMHPRPLVALLDGRDCTVEMPILKDVATVAFCDAQ
FT                   STQEIHEKVLNEAVGALMYHTITLTREDLEKFKALRIIVRIGSGFDNIDIKSAGDLGIA
FT                   VCNVPAASVEETADSTLCHILNLYRRTTWLHQALREGTRVQSVEQIREVASGAARIRGE
FT                   TLGIIGLGRVGQAVALRAKAFGFNVLFYDPYLSDGIERALGLQRVSTLQDLLFHSDCVT
FT                   LHCGLNEHNHHLINDFTVKQMRQGAFLVNTARGGLVDEKALAQALKEGRIRGAALDVHE
FT                   SEPFSFSQGPLKDAPNLICTPHAAWYSEQASIEMREEAAREIRRAITGRIPDSLKNCVN
FT                   KDHLTAATHWASMDPAVVHPELNGAAYRYPPGVVSVAPTGIPAAVEGIVPSAMSLSHGL
FT                   PPVAHPPHAPSPGQTVKPEADRDHTSDQL"
FT   mRNA            complement(join(7060869..7060987,7061344..7061558,
FT                   7069619..7069825,7077364..7077518,7079924..7080017))
FT                   /gene="Ctbp1"
FT                   /locus_tag="mCG_2534"
FT                   /product="C-terminal binding protein 1, transcript variant
FT                   mCT180272"
FT                   /note="gene_id=mCG2534.2 transcript_id=mCT180272.0 created
FT                   on 18-FEB-2003"
FT   CDS             complement(join(7069754..7069825,7077364..7077518,
FT                   7079924..7079930))
FT                   /codon_start=1
FT                   /gene="Ctbp1"
FT                   /locus_tag="mCG_2534"
FT                   /product="C-terminal binding protein 1, isoform CRA_a"
FT                   /note="gene_id=mCG2534.2 transcript_id=mCT180272.0
FT                   protein_id=mCP103194.0 isoform=CRA_a"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="MGI:MGI:1201685"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0J9YU66"
FT                   /protein_id="EDL37414.1"
FT                   /translation="MSGVRPPIMNGPMHPRPLVALLDGRDCTVEMPILKDVATVAFCDA
FT                   QSTQEIHEKASQCAMCRQHLWKKRQTPPCATS"
FT   assembly_gap    7085198..7085781
FT                   /estimated_length=584
FT                   /gap_type="unknown"
FT   assembly_gap    7089046..7089131
FT                   /estimated_length=86
FT                   /gap_type="unknown"
FT   assembly_gap    7096298..7096342
FT                   /estimated_length=45
FT                   /gap_type="unknown"
FT   assembly_gap    7120598..7120617
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            7146115..7183854
FT                   /gene="Maea"
FT                   /locus_tag="mCG_2530"
FT                   /note="gene_id=mCG2530.2"
FT   mRNA            join(7146115..7146198,7169014..7169196,7170926..7171129,
FT                   7173269..7173391,7176296..7176372,7179212..7179320,
FT                   7181005..7181138,7182188..7182383,7182841..7183854)
FT                   /gene="Maea"
FT                   /locus_tag="mCG_2530"
FT                   /product="macrophage erythroblast attacher"
FT                   /note="gene_id=mCG2530.2 transcript_id=mCT1818.1 created on
FT                   17-SEP-2002"
FT   CDS             join(7146163..7146198,7169014..7169196,7170926..7171129,
FT                   7173269..7173391,7176296..7176372,7179212..7179320,
FT                   7181005..7181138,7182188..7182383,7182841..7182936)
FT                   /codon_start=1
FT                   /gene="Maea"
FT                   /locus_tag="mCG_2530"
FT                   /product="macrophage erythroblast attacher"
FT                   /note="gene_id=mCG2530.2 transcript_id=mCT1818.1
FT                   protein_id=mCP3930.0"
FT                   /protein_id="EDL37417.1"
FT                   /translation="MTLKVQEYPTLKVPYETLNKRFRAAQKNIDRETSHVTMVVAELEK
FT                   TLSSCPAVDSVVSLLDGVVEKLSVLKRKAVESIQAEDESAKLCKRRIEHLKEHSSDQPA
FT                   AASMWKRKRMDRMMVEHLLRCGYYNTAVKLARQSGIEDLVNIEMFLTAKEVEESLERRE
FT                   TATCLAWCHDNKSRLRKMKSCLEFSLRIQEFIELVRQNKRLDAVRHARKHFSQAEGSQL
FT                   DEVRQVMGMLAFPPDTHISPYKDLLDPARWRMLIQQFRYDNYRLHQLGNSSVFTLTLQA
FT                   GLSAIKTPQCYKEDGSSKSPDCPVCSRSLNKLAQPLPMAHCANSRLVCKISGDVMNENN
FT                   PPMMLPNGYVYGYNSLLSIRQDDKVVCPRTKEVFHFSQAEKVYIM"
FT   assembly_gap    7150037..7150137
FT                   /estimated_length=101
FT                   /gap_type="unknown"
FT   gene            <7189123..7225376
FT                   /locus_tag="mCG_2528"
FT                   /note="gene_id=mCG2528.3"
FT   mRNA            join(<7189123..7189899,7198128..7198458,7199188..7199308,
FT                   7200114..7200509,7202214..7202326,7202526..7202654,
FT                   7212962..7213067,7219277..7219448,7219895..7220987)
FT                   /locus_tag="mCG_2528"
FT                   /product="mCG2528, transcript variant mCT193558"
FT                   /note="gene_id=mCG2528.3 transcript_id=mCT193558.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(7189129..7189576,7189800..7189899,7198128..7198458,
FT                   7199188..7199308,7200114..7200509,7202214..7202326,
FT                   7202526..7202654,7212962..7213067,7219277..7219448,
FT                   7219895..7220017,7221327..7221510,7222029..7222140,
FT                   7224367..7224541,7225266..7225376)
FT                   /locus_tag="mCG_2528"
FT                   /product="mCG2528, transcript variant mCT1821"
FT                   /note="gene_id=mCG2528.3 transcript_id=mCT1821.2 created on
FT                   25-SEP-2002"
FT   CDS             join(<7189706..7189899,7198128..7198458,7199188..7199308,
FT                   7200114..7200509,7202214..7202326,7202526..7202654,
FT                   7212962..7213067,7219277..7219448,7219895..7220021)
FT                   /codon_start=1
FT                   /locus_tag="mCG_2528"
FT                   /product="mCG2528, isoform CRA_b"
FT                   /note="gene_id=mCG2528.3 transcript_id=mCT193558.0
FT                   protein_id=mCP114547.0 isoform=CRA_b"
FT                   /protein_id="EDL37419.1"
FT                   /translation="SPVFGVPHKLKTKTVKYLLYVNSASPRPLFLDMDQKLSQLIEELT
FT                   TSGESQLNAQKMKELKKICKSSEEQLSHAYRLLITQLTQGHAEIRLSAFQIVDELFTRS
FT                   HQFRMLLVSDFQEFLELTLGTDSDRPLPPPREAAQRLRQAAMQAVEGWNEKFGQAYKKL
FT                   ALGYHFLKHTKKVDFRDINVRTVAERKREEEKQKHLDKIHRESADRAKREMEEMYDEIE
FT                   CCLTEVENCFKLLVPLDFVPCPEDKFFGEASSMTEGYAPCPLSPDLATPRESGLSGPQD
FT                   EEQPCCSKDLVASAYHVGSVVGLKALPQTAMKDSSRDEDEPSDPDDFLRSHGLGSHKYT
FT                   LDVEVPSDGLKVQENEDNLAVLHAARDSLKLIQNKFLPTVCSWVQRFTRAGTYSAHLKQ
FT                   AIDLKMELELALKKYEELNIEPGRGQRSRTEALEDSEDEDQDFVEVPEKEGYEPRIPDH
FT                   LRAEYGLEPKAPLKTLEKGTAVCKLQERTRMRREEEASDPTSAAAQMLRLQDCLSSPSP
FT                   SSTRVLPGPEEAQKQAERARAPIVPFGVDLCYWGQEQLTAGKILK"
FT   CDS             join(7189802..7189899,7198128..7198458,7199188..7199308,
FT                   7200114..7200509,7202214..7202326,7202526..7202654,
FT                   7212962..7213067,7219277..7219448,7219895..7220017,
FT                   7221327..7221510,7222029..7222140,7224367..7224541,
FT                   7225266..7225359)
FT                   /codon_start=1
FT                   /locus_tag="mCG_2528"
FT                   /product="mCG2528, isoform CRA_a"
FT                   /note="gene_id=mCG2528.3 transcript_id=mCT1821.2
FT                   protein_id=mCP4008.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q9D479"
FT                   /db_xref="InterPro:IPR008942"
FT                   /db_xref="InterPro:IPR018610"
FT                   /db_xref="MGI:MGI:1918351"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9D479"
FT                   /protein_id="EDL37418.1"
FT                   /translation="MDQKLSQLIEELTTSGESQLNAQKMKELKKICKSSEEQLSHAYRL
FT                   LITQLTQGHAEIRLSAFQIVDELFTRSHQFRMLLVSDFQEFLELTLGTDSDRPLPPPRE
FT                   AAQRLRQAAMQAVEGWNEKFGQAYKKLALGYHFLKHTKKVDFRDINVRTVAERKREEEK
FT                   QKHLDKIHRESADRAKREMEEMYDEIECCLTEVENCFKLLVPLDFVPCPEDKFFGEASS
FT                   MTEGYAPCPLSPDLATPRESGLSGPQDEEQPCCSKDLVASAYHVGSVVGLKALPQTAMK
FT                   DSSRDEDEPSDPDDFLRSHGLGSHKYTLDVEVPSDGLKVQENEDNLAVLHAARDSLKLI
FT                   QNKFLPTVCSWVQRFTRAGTYSAHLKQAIDLKMELELALKKYEELNIEPGRGQRSRTEA
FT                   LEDSEDEDQDFVEVPEKEGYEPRIPDHLRAEYGLEPKAPLKTLEKGTAVCKLQERTRMR
FT                   REEEASDPTSAAAQMLRLQDCLSSPSPSSTRVLPGPEEAQKQAERARAPIVPFGVDLCY
FT                   WGQEQLTAGKILKSDSQHRFWKPSEVEEEVDSAHVSEMLHSRHITFSGTFEPVQHKCRA
FT                   LRPNGRLCERQDRLKCPFHGKIIPRDDKGQPLNPEDRAREQRQQLQRQQAHPDWQDPEF
FT                   LKDVEAATGVDLGSSRSSKKGKGKKKKHPNLTDLRERTNTARARLEKKVFAKAAVQRVV
FT                   AAMNQMDQKKHEKFANQFNYALK"
FT   assembly_gap    7190467..7190505
FT                   /estimated_length=39
FT                   /gap_type="unknown"
FT   assembly_gap    7196768..7196941
FT                   /estimated_length=174
FT                   /gap_type="unknown"
FT   assembly_gap    7233920..7233939
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(7241167..7242300)
FT                   /pseudo
FT                   /locus_tag="mCG_122510"
FT                   /note="gene_id=mCG122510.1"
FT   mRNA            complement(7241167..7242300)
FT                   /pseudo
FT                   /locus_tag="mCG_122510"
FT                   /note="gene_id=mCG122510.1 transcript_id=mCT123715.1
FT                   created on 02-OCT-2002"
FT   assembly_gap    7244324..7244547
FT                   /estimated_length=224
FT                   /gap_type="unknown"
FT   assembly_gap    7246359..7246926
FT                   /estimated_length=568
FT                   /gap_type="unknown"
FT   assembly_gap    7304361..7304380
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7315247..7315266
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7374254..7374645
FT                   /estimated_length=392
FT                   /gap_type="unknown"
FT   assembly_gap    7383143..7383162
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7388036..7390206
FT                   /estimated_length=2171
FT                   /gap_type="unknown"
FT   assembly_gap    7393253..7393272
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7398088..7398107
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(7407777..7437045)
FT                   /gene="2410018C17Rik"
FT                   /locus_tag="mCG_122502"
FT                   /note="gene_id=mCG122502.0"
FT   mRNA            complement(join(7407777..7408306,7414890..7415653,
FT                   7417858..7417912,7422029..7422156,7436268..7436358,
FT                   7436857..7437045))
FT                   /gene="2410018C17Rik"
FT                   /locus_tag="mCG_122502"
FT                   /product="RIKEN cDNA 2410018C17, transcript variant
FT                   mCT123703"
FT                   /note="gene_id=mCG122502.0 transcript_id=mCT123703.1
FT                   created on 13-FEB-2003"
FT   mRNA            complement(join(7407780..7408306,7414890..7415653,
FT                   7417858..7417912,7422029..7422260,7436272..7436396,
FT                   7436756..>7436992))
FT                   /gene="2410018C17Rik"
FT                   /locus_tag="mCG_122502"
FT                   /product="RIKEN cDNA 2410018C17, transcript variant
FT                   mCT180110"
FT                   /note="gene_id=mCG122502.0 transcript_id=mCT180110.0
FT                   created on 13-FEB-2003"
FT   mRNA            complement(join(7407782..7408306,7414890..7415653,
FT                   7417858..7417912,7422029..7422260,7436272..>7437043))
FT                   /gene="2410018C17Rik"
FT                   /locus_tag="mCG_122502"
FT                   /product="RIKEN cDNA 2410018C17, transcript variant
FT                   mCT180109"
FT                   /note="gene_id=mCG122502.0 transcript_id=mCT180109.0
FT                   created on 13-FEB-2003"
FT   CDS             complement(join(7407995..7408306,7414890..7415653,
FT                   7417858..7417912,7422029..7422156,7436268..7436358,
FT                   7436857..7437018))
FT                   /codon_start=1
FT                   /gene="2410018C17Rik"
FT                   /locus_tag="mCG_122502"
FT                   /product="RIKEN cDNA 2410018C17, isoform CRA_a"
FT                   /note="gene_id=mCG122502.0 transcript_id=mCT123703.1
FT                   protein_id=mCP64732.1 isoform=CRA_a"
FT                   /protein_id="EDL37420.1"
FT                   /translation="MRGARPARPAPCPSYGARCSLASRRVLCAVVRLLIAKSSSHRNAV
FT                   SLRCDPGVSGIPRADPPQRPVEGDLEVYSEATFLRRLRVLFWKSSAHRCGLRKSPAMVT
FT                   LITEKLQNQSLDDLTRRACEAGPYSAEKLNKSGHLFPLEISVDKSPWKALRGGWPTGSQ
FT                   AASGPFSVGPHGVSHTEGLKWQLESPGPMDVGHFLDLHDSTGPPAAPPTKRHCRSLSEP
FT                   EELARCRSPWRPGSSKVWTPISKRRCNSGGSATLQCCSGVGNPTLQGTLVPGLPRRPVS
FT                   PAGPTSPLTPRPASASSGFVDGSEGSTSSGPPWLSTGPCPFSSRRRLSLSQEHLVDTGA
FT                   CLPSASSTPTSTPELGRHHGLLRCRSQPCVLDGRRVRRKRRREEDARWTRPSLDFLKMT
FT                   RTLKNSKSLCSLDYEDDEDDTQEKTLVSSPCNSQGLVGIITPSSSPRIPRPGPDSPSVW
FT                   ASGEPEASPGEGGSSGDPSDWDSAGEEGIFPLDHGDLDLEQIENN"
FT   CDS             complement(join(7407995..7408306,7414890..7415653,
FT                   7417858..7417912,7422029..>7422163))
FT                   /codon_start=1
FT                   /gene="2410018C17Rik"
FT                   /locus_tag="mCG_122502"
FT                   /product="RIKEN cDNA 2410018C17, isoform CRA_b"
FT                   /note="gene_id=mCG122502.0 transcript_id=mCT180110.0
FT                   protein_id=mCP103031.0 isoform=CRA_b"
FT                   /protein_id="EDL37421.1"
FT                   /translation="CPVFWKSSAHRCGLRKSPAMVTLITEKLQNQSLDDLTRRACEAGP
FT                   YSAEKLNKSGHLFPLEISVDKSPWKALRGGWPTGSQAASGPFSVGPHGVSHTEGLKWQL
FT                   ESPGPMDVGHFLDLHDSTGPPAAPPTKRHCRSLSEPEELARCRSPWRPGSSKVWTPISK
FT                   RRCNSGGSATLQCCSGVGNPTLQGTLVPGLPRRPVSPAGPTSPLTPRPASASSGFVDGS
FT                   EGSTSSGPPWLSTGPCPFSSRRRLSLSQEHLVDTGACLPSASSTPTSTPELGRHHGLLR
FT                   CRSQPCVLDGRRVRRKRRREEDARWTRPSLDFLKMTRTLKNSKSLCSLDYEDDEDDTQE
FT                   KTLVSSPCNSQGLVGIITPSSSPRIPRPGPDSPSVWASGEPEASPGEGGSSGDPSDWDS
FT                   AGEEGIFPLDHGDLDLEQIENN"
FT   CDS             complement(join(7407995..7408306,7414890..7415653,
FT                   7417858..7417912,7422029..>7422163))
FT                   /codon_start=1
FT                   /gene="2410018C17Rik"
FT                   /locus_tag="mCG_122502"
FT                   /product="RIKEN cDNA 2410018C17, isoform CRA_b"
FT                   /note="gene_id=mCG122502.0 transcript_id=mCT180109.0
FT                   protein_id=mCP103032.0 isoform=CRA_b"
FT                   /protein_id="EDL37422.1"
FT                   /translation="CPVFWKSSAHRCGLRKSPAMVTLITEKLQNQSLDDLTRRACEAGP
FT                   YSAEKLNKSGHLFPLEISVDKSPWKALRGGWPTGSQAASGPFSVGPHGVSHTEGLKWQL
FT                   ESPGPMDVGHFLDLHDSTGPPAAPPTKRHCRSLSEPEELARCRSPWRPGSSKVWTPISK
FT                   RRCNSGGSATLQCCSGVGNPTLQGTLVPGLPRRPVSPAGPTSPLTPRPASASSGFVDGS
FT                   EGSTSSGPPWLSTGPCPFSSRRRLSLSQEHLVDTGACLPSASSTPTSTPELGRHHGLLR
FT                   CRSQPCVLDGRRVRRKRRREEDARWTRPSLDFLKMTRTLKNSKSLCSLDYEDDEDDTQE
FT                   KTLVSSPCNSQGLVGIITPSSSPRIPRPGPDSPSVWASGEPEASPGEGGSSGDPSDWDS
FT                   AGEEGIFPLDHGDLDLEQIENN"
FT   gene            7437343..7439511
FT                   /gene="LOC433873"
FT                   /locus_tag="mCG_148302"
FT                   /note="gene_id=mCG148302.0"
FT   mRNA            join(7437343..7437713,7438135..7439511)
FT                   /gene="LOC433873"
FT                   /locus_tag="mCG_148302"
FT                   /product="hypothetical protein EG433873"
FT                   /note="gene_id=mCG148302.0 transcript_id=mCT188565.0
FT                   created on 13-JAN-2004"
FT   CDS             join(7437568..7437713,7438135..7438378)
FT                   /codon_start=1
FT                   /gene="LOC433873"
FT                   /locus_tag="mCG_148302"
FT                   /product="hypothetical protein EG433873"
FT                   /note="gene_id=mCG148302.0 transcript_id=mCT188565.0
FT                   protein_id=mCP109216.0"
FT                   /db_xref="MGI:MGI:3646113"
FT                   /db_xref="UniProtKB/TrEMBL:Q8C9Y8"
FT                   /protein_id="EDL37423.1"
FT                   /translation="MPSFSCPLLVMCLWAGPFPLGVSFLDLPCDWKALLCIGYRCCEGK
FT                   LLCRFLEDRGLATWITAGRSQIRTETSGRHLCLRGTLPRTVLNHTLPGQIWTNGGLLKS
FT                   PRSPCVSQALQLIKLHTPHSSAVFE"
FT   gene            complement(7447477..7459989)
FT                   /locus_tag="mCG_16335"
FT                   /note="gene_id=mCG16335.3"
FT   mRNA            complement(join(7447477..7448348,7449321..7449402,
FT                   7451153..7451302,7452916..7453053,7457159..7457263,
FT                   7459378..7459494,7459610..7459721))
FT                   /locus_tag="mCG_16335"
FT                   /product="mCG16335, transcript variant mCT180242"
FT                   /note="gene_id=mCG16335.3 transcript_id=mCT180242.0 created
FT                   on 18-FEB-2003"
FT   mRNA            complement(join(7447483..7448348,7449321..7449402,
FT                   7451153..7451302,7452916..7453053,7453426..7453485,
FT                   7457159..7457263,7459378..7459494,7459610..7459989))
FT                   /locus_tag="mCG_16335"
FT                   /product="mCG16335, transcript variant mCT17784"
FT                   /note="gene_id=mCG16335.3 transcript_id=mCT17784.2 created
FT                   on 18-FEB-2003"
FT   mRNA            complement(join(7447485..7448348,7449321..7449402,
FT                   7451153..7451302,7452916..7453053,7453426..7453485,
FT                   7459378..7459494,7459610..7459989))
FT                   /locus_tag="mCG_16335"
FT                   /product="mCG16335, transcript variant mCT173411"
FT                   /note="gene_id=mCG16335.3 transcript_id=mCT173411.0 created
FT                   on 18-FEB-2003"
FT   CDS             complement(join(7448232..7448348,7449321..7449402,
FT                   7451153..7451302,7452916..7453053,7453426..7453485,
FT                   7459378..7459494,7459610..7459668))
FT                   /codon_start=1
FT                   /locus_tag="mCG_16335"
FT                   /product="mCG16335, isoform CRA_a"
FT                   /note="gene_id=mCG16335.3 transcript_id=mCT173411.0
FT                   protein_id=mCP96330.0 isoform=CRA_a"
FT                   /protein_id="EDL37424.1"
FT                   /translation="MACRPRSPPGYGSRRDGGASPRSPARWSLGRKRRADGRDRKPEDS
FT                   EEGELQTADHRPERYKRKLLINDFGRERKSSSGSSDSKESMSSVPADVETDESVLMRRQ
FT                   KQINYGKNTIAYDRYIKEVPRHLRQPGIHPRTPNKFKKYSRRSWDQQIKLWKVALHFWD
FT                   PPAEEGCDLQEIQPVDLGEMETEFTESSSESQTSSQDNFDVYAGTPTKVRHVDCQVEDE
FT                   FDLEACLTEPLKDFSAMS"
FT   CDS             complement(join(7448232..7448348,7449321..7449402,
FT                   7451153..7451302,7452916..7453053,7457159..7457263,
FT                   7459378..7459494,7459610..7459668))
FT                   /codon_start=1
FT                   /locus_tag="mCG_16335"
FT                   /product="mCG16335, isoform CRA_c"
FT                   /note="gene_id=mCG16335.3 transcript_id=mCT180242.0
FT                   protein_id=mCP103164.0 isoform=CRA_c"
FT                   /db_xref="GOA:Q8K2W7"
FT                   /db_xref="InterPro:IPR026502"
FT                   /db_xref="InterPro:IPR029344"
FT                   /db_xref="MGI:MGI:108402"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K2W7"
FT                   /protein_id="EDL37426.1"
FT                   /translation="MACRPRSPPGYGSRRDGGASPRSPARWSLGRKRRADGRDRKPEDS
FT                   EEGELQTADHRPESFTTPEGHKPRSRCSDWASAVEEDEMRTRVNKEIASSDSKESMSSV
FT                   PADVETDESVLMRRQKQINYGKNTIAYDRYIKEVPRHLRQPGIHPRTPNKFKKYSRRSW
FT                   DQQIKLWKVALHFWDPPAEEGCDLQEIQPVDLGEMETEFTESSSESQTSSQDNFDVYAG
FT                   TPTKVRHVDCQVEDEFDLEACLTEPLKDFSAMS"
FT   CDS             complement(join(7448232..7448348,7449321..7449402,
FT                   7451153..7451302,7452916..7453053,7453426..7453485,
FT                   7457159..7457263,7459378..7459494,7459610..7459668))
FT                   /codon_start=1
FT                   /locus_tag="mCG_16335"
FT                   /product="mCG16335, isoform CRA_b"
FT                   /note="gene_id=mCG16335.3 transcript_id=mCT17784.2
FT                   protein_id=mCP3896.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q3U4T7"
FT                   /db_xref="InterPro:IPR026502"
FT                   /db_xref="InterPro:IPR029344"
FT                   /db_xref="MGI:MGI:108402"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U4T7"
FT                   /protein_id="EDL37425.1"
FT                   /translation="MACRPRSPPGYGSRRDGGASPRSPARWSLGRKRRADGRDRKPEDS
FT                   EEGELQTADHRPESFTTPEGHKPRSRCSDWASAVEEDEMRTRVNKEIARYKRKLLINDF
FT                   GRERKSSSGSSDSKESMSSVPADVETDESVLMRRQKQINYGKNTIAYDRYIKEVPRHLR
FT                   QPGIHPRTPNKFKKYSRRSWDQQIKLWKVALHFWDPPAEEGCDLQEIQPVDLGEMETEF
FT                   TESSSESQTSSQDNFDVYAGTPTKVRHVDCQVEDEFDLEACLTEPLKDFSAMS"
FT   gene            complement(7460634..7465312)
FT                   /gene="Tmem129"
FT                   /locus_tag="mCG_16347"
FT                   /note="gene_id=mCG16347.1"
FT   mRNA            complement(join(7460634..7462029,7462128..7462287,
FT                   7462738..7463212,7465038..7465312))
FT                   /gene="Tmem129"
FT                   /locus_tag="mCG_16347"
FT                   /product="transmembrane protein 129"
FT                   /note="gene_id=mCG16347.1 transcript_id=mCT17796.1 created
FT                   on 25-SEP-2002"
FT   CDS             complement(join(7461781..7462029,7462128..7462287,
FT                   7462738..7463212,7465038..7465242))
FT                   /codon_start=1
FT                   /gene="Tmem129"
FT                   /locus_tag="mCG_16347"
FT                   /product="transmembrane protein 129"
FT                   /note="gene_id=mCG16347.1 transcript_id=mCT17796.1
FT                   protein_id=mCP3998.2"
FT                   /protein_id="EDL37427.1"
FT                   /translation="MDSPEVTFTLAYLVFAVCFVFTPNEFYSAGLTVQNLLSGWLGSED
FT                   AAFVPYHLRRTSATLLCHSLLPLGYYMGMCFAASEKQLYSPGQAPEAWQLFLLLAVTLP
FT                   LLSCTLIYYWSWDRWTRHPLAQTLALYALPQSGWQAVASSINTEFRRIDKFATGAPGAR
FT                   VIVTDTWVMKVTTYRVHVAQQQDVHLTVTESRQHDLSPDSNLPVQLLTIRVASTSPGTQ
FT                   PFDIRLNSSEYGELCEKLHAPIRSAANVVIRQSLGDLFLETFASHVEVNPAYSVPSNQE
FT                   LEPCIGCMQTRASVKLVKTCQEPAVGECQQCYCRPMWCLTCMGKWFASRQDPQRPDTWL
FT                   ASRVPCPTCRARFCILDVCCVR"
FT   gene            <7465541..7486412
FT                   /gene="Tacc3"
FT                   /locus_tag="mCG_16333"
FT                   /note="gene_id=mCG16333.3"
FT   mRNA            join(<7465541..7466142,7468637..7468799,7468936..7469060,
FT                   7471236..7471317,7471682..7472270,7474108..7474160,
FT                   7474479..7474582,7475378..7475468,7475549..7475650,
FT                   7476077..7476153,7476233..7476276,7476893..7477062,
FT                   7478819..7478925,7479080..7479200,7479397..7479491,
FT                   7486035..7486412)
FT                   /gene="Tacc3"
FT                   /locus_tag="mCG_16333"
FT                   /product="transforming, acidic coiled-coil containing
FT                   protein 3, transcript variant mCT193582"
FT                   /note="gene_id=mCG16333.3 transcript_id=mCT193582.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<7465943..7466142,7468637..7468799,7468936..7469060,
FT                   7471236..7471317,7471682..7472270,7474108..7474160,
FT                   7474479..7474582,7475378..7475468,7475549..7475650,
FT                   7476077..7476153,7476233..7476276,7476893..7477062,
FT                   7478819..7478925,7479080..7479200,7479397..7479462)
FT                   /codon_start=1
FT                   /gene="Tacc3"
FT                   /locus_tag="mCG_16333"
FT                   /product="transforming, acidic coiled-coil containing
FT                   protein 3, isoform CRA_b"
FT                   /note="gene_id=mCG16333.3 transcript_id=mCT193582.0
FT                   protein_id=mCP114580.0 isoform=CRA_b"
FT                   /protein_id="EDL37429.1"
FT                   /translation="LAVERQLSVFESGAGVADDVPGLRERTLLGFLRLGFSCSVFLARS
FT                   GHGAPPLRWASARAQGLATVVRMSLHVLNDENVPNEKSSQCRDFQFLPPELTGRSSVLC
FT                   LSQKENVPPQSQAKATNVTFQTPPRDPQTHRILSPNMTNKREAPFGLQNDHCVFLQKEN
FT                   QRPLAPVDDAPVVQMAAEILRAEGELQEGILTSSSLSASTSLLDSELVTPPIEPVLEPS
FT                   HQGLEPVLESELVTPPVEPVLEPSHQELEPVLESELVTPPIEPVLEPSHQGLEPVLDSE
FT                   LVTPPIEPVLEPSHQGLEPVLESELVTPPIEPVLEPSHQGLEPVLDSELVTPPIEPVLE
FT                   PSHQGLEPVLDSELVTPPIEPLLEPSHQGLEPVVDLKEESFRDPSEVLGTGAEVDYLEQ
FT                   FGTSSFKESAWRKQSLYVKFDPLLKDSPLRPMPVAPITNSTQDTEEESGSGKPTEAELV
FT                   NLDFLGDLDVPVSAPPLCVLEPRGLLPAEPIVDVLKYSQKDLDAVVNVMQQENLELKSK
FT                   YEDLNTKYLEMGKSVDEFEKIAYKSLEEAEKQRELKEIAEDKIQKVLKERDQLNADLNS
FT                   MEKSFSDLFKRFEKRKEVIEGYQKNEESLKKYVGECIVKIEKEGQRYQALKIHAEEKLR
FT                   LANEEIAQVHSKAQAEVLALQASLRKAQMQNHSLEMTLEQKTKEIDELTRICDDLISKM
FT                   EKI"
FT   mRNA            join(7465998..7466142,7468637..7468799,7468936..7469060,
FT                   7471236..7471317,7471682..7472270,7474114..7474160,
FT                   7474458..7474582,7475378..7475468,7475549..7475650,
FT                   7476077..7476153,7476233..7476276,7476893..7477062,
FT                   7478819..7478925,7479080..7479200,7479397..7479491,
FT                   7486035..7486409)
FT                   /gene="Tacc3"
FT                   /locus_tag="mCG_16333"
FT                   /product="transforming, acidic coiled-coil containing
FT                   protein 3, transcript variant mCT173410"
FT                   /note="gene_id=mCG16333.3 transcript_id=mCT173410.0 created
FT                   on 17-SEP-2002"
FT   mRNA            join(7466011..7466142,7468637..7468799,7468936..7469060,
FT                   7471236..7471317,7471682..7471939,7472216..7472270,
FT                   7474108..7474160,7474458..7474582,7475378..7475468,
FT                   7475549..7475650,7476077..7476153,7476233..7476276,
FT                   7476893..7477062,7478819..7478925,7479080..7479200,
FT                   7479397..7479610)
FT                   /gene="Tacc3"
FT                   /locus_tag="mCG_16333"
FT                   /product="transforming, acidic coiled-coil containing
FT                   protein 3, transcript variant mCT17782"
FT                   /note="gene_id=mCG16333.3 transcript_id=mCT17782.2 created
FT                   on 17-SEP-2002"
FT   CDS             join(7468638..7468799,7468936..7469060,7471236..7471317,
FT                   7471682..7472270,7474114..7474160,7474458..7474582,
FT                   7475378..7475468,7475549..7475650,7476077..7476153,
FT                   7476233..7476276,7476893..7477062,7478819..7478925,
FT                   7479080..7479200,7479397..7479462)
FT                   /codon_start=1
FT                   /gene="Tacc3"
FT                   /locus_tag="mCG_16333"
FT                   /product="transforming, acidic coiled-coil containing
FT                   protein 3, isoform CRA_c"
FT                   /note="gene_id=mCG16333.3 transcript_id=mCT173410.0
FT                   protein_id=mCP96329.0 isoform=CRA_c"
FT                   /protein_id="EDL37430.1"
FT                   /translation="MSLHVLNDENVPNEKSSQCRDFQFLPPELTGRSSVLCLSQKENVP
FT                   PQSQAKATNVTFQTPPRDPQTHRILSPNMTNKREAPFGLQNDHCVFLQKENQRPLAPVD
FT                   DAPVVQMAAEILRAEGELQEGILTSSSLSASTSLLDSELVTPPIEPVLEPSHQGLEPVL
FT                   ESELVTPPVEPVLEPSHQELEPVLESELVTPPIEPVLEPSHQGLEPVLDSELVTPPIEP
FT                   VLEPSHQGLEPVLESELVTPPIEPVLEPSHQGLEPVLDSELVTPPIEPVLEPSHQGLEP
FT                   VLDSELVTPPIEPLLEPSHQGLEPVVDLKEESFRDPSEGTGAEVDYLEQFGTSSSHLSN
FT                   SQFKESAWRKQSLYVKFDPLLKDSPLRPMPVAPITNSTQDTEEESGSGKPTEAELVNLD
FT                   FLGDLDVPVSAPPLCVLEPRGLLPAEPIVDVLKYSQKDLDAVVNVMQQENLELKSKYED
FT                   LNTKYLEMGKSVDEFEKIAYKSLEEAEKQRELKEIAEDKIQKVLKERDQLNADLNSMEK
FT                   SFSDLFKRFEKRKEVIEGYQKNEESLKKYVGECIVKIEKEGQRYQALKIHAEEKLRLAN
FT                   EEIAQVHSKAQAEVLALQASLRKAQMQNHSLEMTLEQKTKEIDELTRICDDLISKMEKI
FT                   "
FT   CDS             join(7468638..7468799,7468936..7469060,7471236..7471317,
FT                   7471682..7471939,7472216..7472270,7474108..7474160,
FT                   7474458..7474582,7475378..7475468,7475549..7475650,
FT                   7476077..7476153,7476233..7476276,7476893..7477062,
FT                   7478819..7478925,7479080..7479200,7479397..7479462)
FT                   /codon_start=1
FT                   /gene="Tacc3"
FT                   /locus_tag="mCG_16333"
FT                   /product="transforming, acidic coiled-coil containing
FT                   protein 3, isoform CRA_a"
FT                   /note="gene_id=mCG16333.3 transcript_id=mCT17782.2
FT                   protein_id=mCP4010.2 isoform=CRA_a"
FT                   /protein_id="EDL37428.1"
FT                   /translation="MSLHVLNDENVPNEKSSQCRDFQFLPPELTGRSSVLCLSQKENVP
FT                   PQSQAKATNVTFQTPPRDPQTHRILSPNMTNKREAPFGLQNDHCVFLQKENQRPLAPVD
FT                   DAPVVQMAAEILRAEGELQEGILTSSSLSASTSLLDSELVTPPIEPVLEPSHQGLEPVL
FT                   ESELVTPPVEPVLEPSHQELEPVLESELVTPPIEPVLEPSHQGLEPGLEPVVDLKEESF
FT                   RDPSEVLGTGAEVDYLEQFGTSSSHLSNSQFKESAWRKQSLYVKFDPLLKDSPLRPMPV
FT                   APITNSTQDTEEESGSGKPTEAELVNLDFLGDLDVPVSAPPLCVLEPRGLLPAEPIVDV
FT                   LKYSQKDLDAVVNVMQQENLELKSKYEDLNTKYLEMGKSVDEFEKIAYKSLEEAEKQRE
FT                   LKEIAEDKIQKVLKERDQLNADLNSMEKSFSDLFKRFEKRKEVIEGYQKNEESLKKYVG
FT                   ECIVKIEKEGQRYQALKIHAEEKLRLANEEIAQVHSKAQAEVLALQASLRKAQMQNHSL
FT                   EMTLEQKTKEIDELTRICDDLISKMEKI"
FT   gene            7529146..7544481
FT                   /gene="Fgfr3"
FT                   /locus_tag="mCG_16331"
FT                   /note="gene_id=mCG16331.2"
FT   mRNA            join(7529146..7529369,7529721..7529926,7535062..7535331,
FT                   7535607..7535660,7537096..7537265,7537351..7537474,
FT                   7537559..7537749,7539532..7539676,7540137..7540327,
FT                   7540672..7540817,7541075..7541196,7541271..7541381,
FT                   7541462..7541652,7541762..7541884,7541968..7542038,
FT                   7542266..7542403,7542548..7542653,7542829..7544451)
FT                   /gene="Fgfr3"
FT                   /locus_tag="mCG_16331"
FT                   /product="fibroblast growth factor receptor 3, transcript
FT                   variant mCT17780"
FT                   /note="gene_id=mCG16331.2 transcript_id=mCT17780.1 created
FT                   on 17-SEP-2002"
FT   mRNA            join(<7529227..7529343,7529721..7529926,7535062..7535331,
FT                   7535607..7535660,7537096..7537265,7537351..7537474,
FT                   7537559..7537749,7539532..7539676,7540137..7540327,
FT                   7540672..7540817,7541075..7541196,7541271..7541381,
FT                   7541462..7541652,7541762..7541884,7541968..7542038,
FT                   7542266..7542403,7542548..7542653,7542829..7544481)
FT                   /gene="Fgfr3"
FT                   /locus_tag="mCG_16331"
FT                   /product="fibroblast growth factor receptor 3, transcript
FT                   variant mCT193581"
FT                   /note="gene_id=mCG16331.2 transcript_id=mCT193581.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<7529797..7529926,7535062..7535331,7535607..7535660,
FT                   7537096..7537265,7537351..7537474,7537559..7537749,
FT                   7539532..7539676,7540137..7540327,7540672..7540817,
FT                   7541075..7541196,7541271..7541381,7541462..7541652,
FT                   7541762..7541884,7541968..7542038,7542266..7542403,
FT                   7542548..7542653,7542829..7542975)
FT                   /codon_start=1
FT                   /gene="Fgfr3"
FT                   /locus_tag="mCG_16331"
FT                   /product="fibroblast growth factor receptor 3, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG16331.2 transcript_id=mCT193581.0
FT                   protein_id=mCP114530.0 isoform=CRA_c"
FT                   /protein_id="EDL37433.1"
FT                   /translation="GRRGPRSGAMVVPACVLVFCVAVVAGATSEPPGPEQRVVRRAAEV
FT                   PGPEPSQQEQVAFGSGDTVELSCHPPGGAPTGPTVWAKDGTGLVASHRILVGPQRLQVL
FT                   NASHEDAGVYSCQHRLTRRVLCHFSVRVTDAPSSGDDEDGEDVAEDTGAPYWTRPERMD
FT                   KKLLAVPAANTVRFRCPAAGNPTPSISWLKNGKEFRGEHRIGGIKLRHQQWSLVMESVV
FT                   PSDRGNYTCVVENKFGSIRQTYTLDVLERSPHRPILQAGLPANQTAILGSDVEFHCKVY
FT                   SDAQPHIQWLKHVEVNGSKVGPDGTPYVTVLKTAGANTTDKELEVLSLHNVTFEDAGEY
FT                   TCLAGNSIGFSHHSAWLVVLPAEEELMETDEAGSVYAGVLSYGVVFFLFILVVAAVILC
FT                   RLRSPPKKGLGSPTVHKVSRFPLKRQVSLESNSSMNSNTPLVRIARLSSGEGPVLANVS
FT                   ELELPADPKWELSRTRLTLGKPLGEGCFGQVVMAEAIGIDKDRTAKPVTVAVKMLKDDA
FT                   TDKDLSDLVSEMEMMKMIGKHKNIINLLGACTQGGPLYVLVEYAAKGNLREFLRARRPP
FT                   GMDYSFDACRLPEEQLTCKDLVSCAYQVARGMEYLASQKCIHRDLAARNVLVTEDNVMK
FT                   IADFGLARDVHNLDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLLWEIFTLG
FT                   GSPYPGIPVEELFKLLKEGHRMDKPASCTHDLYMIMRECWHAVPSQRPTFKQLVEDLDR
FT                   ILTVTSTDEYLDLSVPFEQYSPGGQDTPSSSSSGDDSVFTHDLLPPGPPSNGGPRT"
FT   mRNA            join(7529813..7529926,7535062..7535331,7537096..7537265,
FT                   7537351..7537474,7537559..7537749,7539532..7539676,
FT                   7540137..7540327,7540672..7540817,7541075..7541196,
FT                   7541271..7541381,7541462..7541652,7541762..7541884,
FT                   7541968..7542038,7542266..7542403,7542548..7542653,
FT                   7542829..7544451)
FT                   /gene="Fgfr3"
FT                   /locus_tag="mCG_16331"
FT                   /product="fibroblast growth factor receptor 3, transcript
FT                   variant mCT173409"
FT                   /note="gene_id=mCG16331.2 transcript_id=mCT173409.0 created
FT                   on 17-SEP-2002"
FT   CDS             join(7529824..7529926,7535062..7535331,7535607..7535660,
FT                   7537096..7537265,7537351..7537474,7537559..7537749,
FT                   7539532..7539676,7540137..7540327,7540672..7540817,
FT                   7541075..7541196,7541271..7541381,7541462..7541652,
FT                   7541762..7541884,7541968..7542038,7542266..7542403,
FT                   7542548..7542653,7542829..7542975)
FT                   /codon_start=1
FT                   /gene="Fgfr3"
FT                   /locus_tag="mCG_16331"
FT                   /product="fibroblast growth factor receptor 3, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG16331.2 transcript_id=mCT17780.1
FT                   protein_id=mCP3984.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q7TSI8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR003598"
FT                   /db_xref="InterPro:IPR003599"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR008266"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR013098"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016248"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR020635"
FT                   /db_xref="MGI:MGI:95524"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TSI8"
FT                   /protein_id="EDL37432.1"
FT                   /translation="MVVPACVLVFCVAVVAGATSEPPGPEQRVVRRAAEVPGPEPSQQE
FT                   QVAFGSGDTVELSCHPPGGAPTGPTVWAKDGTGLVASHRILVGPQRLQVLNASHEDAGV
FT                   YSCQHRLTRRVLCHFSVRVTDAPSSGDDEDGEDVAEDTGAPYWTRPERMDKKLLAVPAA
FT                   NTVRFRCPAAGNPTPSISWLKNGKEFRGEHRIGGIKLRHQQWSLVMESVVPSDRGNYTC
FT                   VVENKFGSIRQTYTLDVLERSPHRPILQAGLPANQTAILGSDVEFHCKVYSDAQPHIQW
FT                   LKHVEVNGSKVGPDGTPYVTVLKTAGANTTDKELEVLSLHNVTFEDAGEYTCLAGNSIG
FT                   FSHHSAWLVVLPAEEELMETDEAGSVYAGVLSYGVVFFLFILVVAAVILCRLRSPPKKG
FT                   LGSPTVHKVSRFPLKRQVSLESNSSMNSNTPLVRIARLSSGEGPVLANVSELELPADPK
FT                   WELSRTRLTLGKPLGEGCFGQVVMAEAIGIDKDRTAKPVTVAVKMLKDDATDKDLSDLV
FT                   SEMEMMKMIGKHKNIINLLGACTQGGPLYVLVEYAAKGNLREFLRARRPPGMDYSFDAC
FT                   RLPEEQLTCKDLVSCAYQVARGMEYLASQKCIHRDLAARNVLVTEDNVMKIADFGLARD
FT                   VHNLDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLLWEIFTLGGSPYPGIPV
FT                   EELFKLLKEGHRMDKPASCTHDLYMIMRECWHAVPSQRPTFKQLVEDLDRILTVTSTDE
FT                   YLDLSVPFEQYSPGGQDTPSSSSSGDDSVFTHDLLPPGPPSNGGPRT"
FT   CDS             join(7529824..7529926,7535062..7535331,7537096..7537265,
FT                   7537351..7537474,7537559..7537749,7539532..7539676,
FT                   7540137..7540327,7540672..7540817,7541075..7541196,
FT                   7541271..7541381,7541462..7541652,7541762..7541884,
FT                   7541968..7542038,7542266..7542403,7542548..7542653,
FT                   7542829..7542975)
FT                   /codon_start=1
FT                   /gene="Fgfr3"
FT                   /locus_tag="mCG_16331"
FT                   /product="fibroblast growth factor receptor 3, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG16331.2 transcript_id=mCT173409.0
FT                   protein_id=mCP96328.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q61563"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR003598"
FT                   /db_xref="InterPro:IPR003599"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR008266"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR013098"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016248"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR020635"
FT                   /db_xref="MGI:MGI:95524"
FT                   /db_xref="UniProtKB/TrEMBL:Q61563"
FT                   /protein_id="EDL37431.1"
FT                   /translation="MVVPACVLVFCVAVVAGATSEPPGPEQRVVRRAAEVPGPEPSQQE
FT                   QVAFGSGDTVELSCHPPGGAPTGPTVWAKDGTGLVASHRILVGPQRLQVLNASHEDAGV
FT                   YSCQHRLTRRVLCHFSVRVTGAPYWTRPERMDKKLLAVPAANTVRFRCPAAGNPTPSIS
FT                   WLKNGKEFRGEHRIGGIKLRHQQWSLVMESVVPSDRGNYTCVVENKFGSIRQTYTLDVL
FT                   ERSPHRPILQAGLPANQTAILGSDVEFHCKVYSDAQPHIQWLKHVEVNGSKVGPDGTPY
FT                   VTVLKTAGANTTDKELEVLSLHNVTFEDAGEYTCLAGNSIGFSHHSAWLVVLPAEEELM
FT                   ETDEAGSVYAGVLSYGVVFFLFILVVAAVILCRLRSPPKKGLGSPTVHKVSRFPLKRQV
FT                   SLESNSSMNSNTPLVRIARLSSGEGPVLANVSELELPADPKWELSRTRLTLGKPLGEGC
FT                   FGQVVMAEAIGIDKDRTAKPVTVAVKMLKDDATDKDLSDLVSEMEMMKMIGKHKNIINL
FT                   LGACTQGGPLYVLVEYAAKGNLREFLRARRPPGMDYSFDACRLPEEQLTCKDLVSCAYQ
FT                   VARGMEYLASQKCIHRDLAARNVLVTEDNVMKIADFGLARDVHNLDYYKKTTNGRLPVK
FT                   WMAPEALFDRVYTHQSDVWSFGVLLWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPAS
FT                   CTHDLYMIMRECWHAVPSQRPTFKQLVEDLDRILTVTSTDEYLDLSVPFEQYSPGGQDT
FT                   PSSSSSGDDSVFTHDLLPPGPPSNGGPRT"
FT   gene            complement(7548767..>7590130)
FT                   /gene="Letm1"
FT                   /locus_tag="mCG_16329"
FT                   /note="gene_id=mCG16329.2"
FT   mRNA            complement(join(7548767..7550027,7551057..7551195,
FT                   7552431..7552618,7553655..7553789,7554791..7554925,
FT                   7555576..7555716,7556157..7556288,7559893..7560012,
FT                   7568124..7568327,7568981..7569118,7569860..7570003,
FT                   7576762..7577212,7586011..7586071,7589873..7590103))
FT                   /gene="Letm1"
FT                   /locus_tag="mCG_16329"
FT                   /product="leucine zipper-EF-hand containing transmembrane
FT                   protein 1, transcript variant mCT17779"
FT                   /note="gene_id=mCG16329.2 transcript_id=mCT17779.1 created
FT                   on 17-SEP-2002"
FT   mRNA            complement(join(7549738..7550027,7551057..7551189,
FT                   7555591..>7555702))
FT                   /gene="Letm1"
FT                   /locus_tag="mCG_16329"
FT                   /product="leucine zipper-EF-hand containing transmembrane
FT                   protein 1, transcript variant mCT173407"
FT                   /note="gene_id=mCG16329.2 transcript_id=mCT173407.0 created
FT                   on 17-SEP-2002"
FT   CDS             complement(join(7549878..7550027,7551057..7551195,
FT                   7552431..7552618,7553655..7553789,7554791..7554925,
FT                   7555576..7555716,7556157..7556288,7559893..7560012,
FT                   7568124..7568327,7568981..7569118,7569860..7570003,
FT                   7576762..7577212,7586011..7586071,7589873..7589951))
FT                   /codon_start=1
FT                   /gene="Letm1"
FT                   /locus_tag="mCG_16329"
FT                   /product="leucine zipper-EF-hand containing transmembrane
FT                   protein 1, isoform CRA_c"
FT                   /note="gene_id=mCG16329.2 transcript_id=mCT17779.1
FT                   protein_id=mCP3941.1 isoform=CRA_c"
FT                   /protein_id="EDL37436.1"
FT                   /translation="MASILLRSCRGRGPARLAPPRAASPRGSLRDRACLSCTRTLGLTS
FT                   RESVLSRCCTPAHPVYLCFKGEPLSCWTQRPECQGTAARTTWTPASARLVVTGPQYLPV
FT                   RGWHSSSPLGEDSVIEKSLKSLKDKNKKLEEGGPVYSPPAQVVVRKSLGQKVLDELRHY
FT                   YHGFRLLWIDTKIAARMLWRILNGHTLTRRERRQFLRICADLFRLVPFLVFVVVPFMEF
FT                   LLPVVVKLFPNMLPSTFETQSIKEERLKKELRVKLELAKFLQDTIEEMALKNKAAKGNA
FT                   TKDFSAFFQKIRETGERPSNEEIMRFSKLFEDELTLDNLTRPQLVALCKLLELQSIGTN
FT                   NFLRFQLTMRLRSIKADDKLISEEGVDSLTVKELQAACRARGMRALGVTEDRLKGQLKQ
FT                   WLDLHLHHEIPTSLLILSRAMYLPDTLSPADQLKSTLQTLPEIVAKEAQVKVAEVEGEK
FT                   VDNKAKLEATLQEEAAIQQEHLEELKRASEAVKDIQPEVAEATLPGRPGPEPQPPVDDV
FT                   ILPSEVLTDTAPVLEGLKGEEITKEEIDILSDACSKLQEQKKSLTKEKEELELLKEDVQ
FT                   DYSEDLQEIKKELSKTGEEKYIEESAASKRLSKRVQQMIGQIDGLITQLETTQQDGKLG
FT                   PSQSTPTGESVISITELISAMKQIKHIPEHKLISLTSALDDNKDGNINIDDLVKVIDLV
FT                   NKEDVQISTTQVAEIVATLEKEEKIEEKEKAKEKAEKEAAEVKN"
FT   CDS             complement(join(7549878..7550027,7551057..7551189,
FT                   7555591..>7555595))
FT                   /codon_start=1
FT                   /gene="Letm1"
FT                   /locus_tag="mCG_16329"
FT                   /product="leucine zipper-EF-hand containing transmembrane
FT                   protein 1, isoform CRA_a"
FT                   /note="gene_id=mCG16329.2 transcript_id=mCT173407.0
FT                   protein_id=mCP96327.0 isoform=CRA_a"
FT                   /protein_id="EDL37434.1"
FT                   /translation="RDVISITELISAMKQIKHIPEHKLISLTSALDDNKDGNINIDDLV
FT                   KVIDLVNKEDVQISTTQVAEIVATLEKEEKIEEKEKAKEKAEKEAAEVKN"
FT   gene            7566736..7567052
FT                   /pseudo
FT                   /locus_tag="mCG_16330"
FT                   /note="gene_id=mCG16330.1"
FT   mRNA            7566736..7567052
FT                   /pseudo
FT                   /locus_tag="mCG_16330"
FT                   /note="gene_id=mCG16330.1 transcript_id=mCT17519.1 created
FT                   on 02-OCT-2002"
FT   mRNA            complement(join(<7577118..7577212,7589873..>7590130))
FT                   /gene="Letm1"
FT                   /locus_tag="mCG_16329"
FT                   /product="leucine zipper-EF-hand containing transmembrane
FT                   protein 1, transcript variant mCT173408"
FT                   /note="gene_id=mCG16329.2 transcript_id=mCT173408.0 created
FT                   on 17-SEP-2002"
FT   CDS             complement(join(<7577118..7577212,7589873..>7590128))
FT                   /codon_start=1
FT                   /gene="Letm1"
FT                   /locus_tag="mCG_16329"
FT                   /product="leucine zipper-EF-hand containing transmembrane
FT                   protein 1, isoform CRA_b"
FT                   /note="gene_id=mCG16329.2 transcript_id=mCT173408.0
FT                   protein_id=mCP96326.0 isoform=CRA_b"
FT                   /protein_id="EDL37435.1"
FT                   /translation="LRTFVPGHGRCGCRVLELSACCRSQPLPSTVRAGWAQAPGRPRSA
FT                   EEAEAAIERRRGGRMASILLRSCRGRGPARLAPPRAASPRGVFCLVAVLQPTLCTSASK
FT                   VSPSAVGLRGLSA"
FT   assembly_gap    7595847..7595866
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7623271..7623290
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7629128..7629147
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            7629326..7706510
FT                   /locus_tag="mCG_16344"
FT                   /note="gene_id=mCG16344.2"
FT   mRNA            join(7629326..7629351,7651582..7652207,7654575..7654737,
FT                   7663187..7663353,7663831..7664313,7669592..7669736,
FT                   7677312..7677436,7687615..7687746,7688609..7688732,
FT                   7689544..7689744,7690545..7690724,7691084..7691240,
FT                   7691356..7691561,7693544..7693647,7693935..7694204,
FT                   7695805..7695921,7700059..7700200,7700493..7700599,
FT                   7701957..7702161,7703456..7706510)
FT                   /locus_tag="mCG_16344"
FT                   /product="mCG16344"
FT                   /note="gene_id=mCG16344.2 transcript_id=mCT123713.0 created
FT                   on 19-JUN-2003"
FT   CDS             join(7651611..7652207,7654575..7654737,7663187..7663353,
FT                   7663831..7664313,7669592..7669736,7677312..7677436,
FT                   7687615..7687746,7688609..7688732,7689544..7689744,
FT                   7690545..7690724,7691084..7691240,7691356..7691561,
FT                   7693544..7693647,7693935..7694204,7695805..7695921,
FT                   7700059..7700200,7700493..7700599,7701957..7702161,
FT                   7703456..7703727)
FT                   /codon_start=1
FT                   /locus_tag="mCG_16344"
FT                   /product="mCG16344"
FT                   /note="gene_id=mCG16344.2 transcript_id=mCT123713.0
FT                   protein_id=mCP65164.1"
FT                   /protein_id="EDL37437.1"
FT                   /translation="MEFSIRKSPLSVQKVVKCMKMKQTPEILGSANGKTQNCEVNHECS
FT                   VFLSKAQLSNSLQEGVMQKFNGHDALPFLPAEKLKDLTSCVFNGEPGAHDTKLCFEAQE
FT                   VKGIGTPPNTTPIKNGSPEIKLKITKTYMNGKPLFESSICGDGAADVSQSEENEQKSDN
FT                   KTRRNRKRSIKYDSLLEQGLVEAALVSKISSPADKKIPVKKESCPNTGRDRDLLLKYNV
FT                   GDLVWSKVSGYPWWPCMVSADPLLHNHTKLKGQKKSARQYHVQFFGDAPERAWIFEKSL
FT                   VAFEGEEQFEKLCQESAKQAPTKAEKIKLLKPISGRLRAQWEMGIVQAEEAASMSIEER
FT                   KAKFTFLYVGDQLHLNPQVAKEAGIVTEPLGEMVDSSGASEEAAVDPGSVREEDIPTKR
FT                   RRRTKRSSSAENQEGDPGTDKSTPPKMAEAEPKRGVGSPAGRKKSTGSAPRSRKGDSAA
FT                   QFLVFCQKHRDEVVAEHPDASGEEIEELLGSQWSMLNEKQKARYNTKFSLMISAQSEED
FT                   SATKNLSDACKPLKKRNRASATASSALGFNKSSSPSASLTEHEVSDSPGDEPSESPYES
FT                   ADETQTEASVSSKKSERGMAAKKEYVCQLCEKTGSLLLCEGPCCGAFHLACLGLSRRPE
FT                   GRFTCTECASGIHSCFVCKESKMEVKRCVVNQCGKFYHEACVKKYPLTVFESRGFRCPL
FT                   HSCMSCHASNPSNPRPSKGKMMRCVRCPVAYHGGDACLAAGCSVIASNSIICTGHFTAR
FT                   KGKRHHTHVNVSWCFVCSKGGSLLCCEACPAAFHPDCLNIEMPDGSWFCNDCRAGKKLH
FT                   FQDIIWVKLGNYRWWPAEVCHPKNVPPNIQKMKHEIGEFPVFFFGSKDYYWTHQARVFP
FT                   YMEGDRGSRYQGVRGIGRVFKNALQEAEARFNEVKLQREARETQESERKPPPYKHIKVN
FT                   KPYGKVQIYTADISEIPKCNCKPTDENPCGSDSECLNRMLMFECHPQVCPAGEYCQNQC
FT                   FTKRQYPETKIIKTDGKGWGLVAKRDIRKGEFVNEYVGELIDEEECMARIKYAHENDIT
FT                   HFYMLTIDKDRIIDAGPKGNYSRFMNHSCQPNCETLKWTVNGDTRVGLFAVCDIPAGTE
FT                   LTFNYNLDCLGNEKTVCRCGASNCSGFLGDRPKTSASLSSEEKGKKAKKKTRRRRAKGE
FT                   GKRQSEDECFRCGDGGQLVLCDRKFCTKAYHLSCLGLGKRPFGKWECPWHHCDVCGKPS
FT                   TSFCHLCPNSFCKEHQDGTAFRSTQDGQSYCCEHDLRADSSSSTKTEKPFPESLKSKGK
FT                   RKKRRCWRRVTDGK"
FT   assembly_gap    7655662..7656023
FT                   /estimated_length=362
FT                   /gap_type="unknown"
FT   gene            complement(7705679..7736724)
FT                   /gene="Whsc2"
FT                   /locus_tag="mCG_16346"
FT                   /note="gene_id=mCG16346.1"
FT   mRNA            complement(join(7705679..7707459,7707562..7707661,
FT                   7707832..7708103,7708963..7709074,7709741..7709829,
FT                   7710138..7710207,7710295..7710425,7711921..7712010,
FT                   7720889..7721050,7722243..7722414,7736428..7736724))
FT                   /gene="Whsc2"
FT                   /locus_tag="mCG_16346"
FT                   /product="Wolf-Hirschhorn syndrome candidate 2 (human)"
FT                   /note="gene_id=mCG16346.1 transcript_id=mCT17794.2 created
FT                   on 25-SEP-2002"
FT   CDS             complement(join(7707275..7707459,7707562..7707661,
FT                   7707832..7708103,7708963..7709074,7709741..7709829,
FT                   7710138..7710207,7710295..7710425,7711921..7712010,
FT                   7720889..7721050,7722243..7722414,7736428..7736637))
FT                   /codon_start=1
FT                   /gene="Whsc2"
FT                   /locus_tag="mCG_16346"
FT                   /product="Wolf-Hirschhorn syndrome candidate 2 (human)"
FT                   /note="gene_id=mCG16346.1 transcript_id=mCT17794.2
FT                   protein_id=mCP3980.1"
FT                   /protein_id="EDL37438.1"
FT                   /translation="MASMRESDTGLWLHNKLGATDELWAPPSIASLLTAAVIDNIRLCF
FT                   HRLSSAVKLKLLLGTLHLPRRTVDEMKAALMDIIQLATLDSDPWVLMVADILKSFPDTG
FT                   SLNLDLEEQNPNVQDILGELREKVSECEASAMLPLECQYLNKNALTTLAGPLTPPVKHF
FT                   QLKRKPKSATLRAELLQKSTETAQQLKRSAGVPFHAKGRGLLRKMDTTTPLKGIPKQAP
FT                   FRSPTTPSVFSPSGNRTPIPPSRTPLQKERGVKLLDISELNTVGAGREAKRRRKTLDTE
FT                   VVEKPTKEETVVENATPDYAAGLVSTQKLGSLNSEPTLPSTSYLPSTPSVVPASSYIPS
FT                   SETPPAPPSREASRPPEEPSAPSPTLPTQFKQRAPMYNSGLSPATPAPAAPTSPLTPTT
FT                   PPAVTPTAQTPPVAMVAPQTQAPAPVQQQPKKNLSLTREQMFAAQEMFKTANKVTRPEK
FT                   ALILGFMAGSRENPCPEQGDVIQIKLSEHTEDLPKADGQGSTTMLVDTVFEMNYATGQW
FT                   TRFKKYKPMTNVS"
FT   assembly_gap    7746368..7746552
FT                   /estimated_length=185
FT                   /gap_type="unknown"
FT   assembly_gap    7769558..7769577
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7777386..7777405
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <7784452..7786033
FT                   /locus_tag="mCG_16345"
FT                   /note="gene_id=mCG16345.2"
FT   mRNA            join(<7784452..7784911,7785067..7785155,7785923..7786033)
FT                   /locus_tag="mCG_16345"
FT                   /product="mCG16345, transcript variant mCT173998"
FT                   /note="gene_id=mCG16345.2 transcript_id=mCT173998.0 created
FT                   on 13-FEB-2003"
FT   mRNA            join(<7784452..7784654,7784772..7784911,7785067..7785155,
FT                   7785923..7786033)
FT                   /locus_tag="mCG_16345"
FT                   /product="mCG16345, transcript variant mCT17793"
FT                   /note="gene_id=mCG16345.2 transcript_id=mCT17793.2 created
FT                   on 13-FEB-2003"
FT   mRNA            join(<7784481..7784579,7784772..7784911,7785067..7785155,
FT                   7785923..7786030)
FT                   /locus_tag="mCG_16345"
FT                   /product="mCG16345, transcript variant mCT180264"
FT                   /note="gene_id=mCG16345.2 transcript_id=mCT180264.0 created
FT                   on 13-FEB-2003"
FT   CDS             join(<7784482..7784579,7784772..7784911,7785067..7785155,
FT                   7785923..7785988)
FT                   /codon_start=1
FT                   /locus_tag="mCG_16345"
FT                   /product="mCG16345, isoform CRA_b"
FT                   /note="gene_id=mCG16345.2 transcript_id=mCT180264.0
FT                   protein_id=mCP103186.0 isoform=CRA_b"
FT                   /protein_id="EDL37440.1"
FT                   /translation="PGWGRLGRMRARAGRGRSSRVARAACSRFLEPRAAWAPSAMAPAL
FT                   RSLLSPRTLLLLLLSLALLGARAEPATGSAVPAQSRPCVDCHAFEFMQRALQDLRKTAY
FT                   SLDARTETLLLQAERRALCACWPAGR"
FT   mRNA            join(<7784562..7784658,7784772..7784911,7785067..7785155,
FT                   7785923..7786033)
FT                   /locus_tag="mCG_16345"
FT                   /product="mCG16345, transcript variant mCT180265"
FT                   /note="gene_id=mCG16345.2 transcript_id=mCT180265.0 created
FT                   on 13-FEB-2003"
FT   CDS             join(<7784632..7784654,7784772..7784911,7785067..7785155,
FT                   7785923..7785988)
FT                   /codon_start=1
FT                   /locus_tag="mCG_16345"
FT                   /product="mCG16345, isoform CRA_a"
FT                   /note="gene_id=mCG16345.2 transcript_id=mCT17793.2
FT                   protein_id=mCP3991.0 isoform=CRA_a"
FT                   /protein_id="EDL37439.1"
FT                   /translation="AHLSSRDTAAWAPSAMAPALRSLLSPRTLLLLLLSLALLGARAEP
FT                   ATGSAVPAQSRPCVDCHAFEFMQRALQDLRKTAYSLDARTETLLLQAERRALCACWPAG
FT                   R"
FT   CDS             join(<7784642..7784658,7784772..7784911,7785067..7785155,
FT                   7785923..7785988)
FT                   /codon_start=1
FT                   /locus_tag="mCG_16345"
FT                   /product="mCG16345, isoform CRA_c"
FT                   /note="gene_id=mCG16345.2 transcript_id=mCT180265.0
FT                   protein_id=mCP103187.0 isoform=CRA_c"
FT                   /protein_id="EDL37441.1"
FT                   /translation="ARGTREAAWAPSAMAPALRSLLSPRTLLLLLLSLALLGARAEPAT
FT                   GSAVPAQSRPCVDCHAFEFMQRALQDLRKTAYSLDARTETLLLQAERRALCACWPAGR"
FT   CDS             join(<7784659..7784911,7785067..7785155,7785923..7785988)
FT                   /codon_start=1
FT                   /locus_tag="mCG_16345"
FT                   /product="mCG16345, isoform CRA_d"
FT                   /note="gene_id=mCG16345.2 transcript_id=mCT173998.0
FT                   protein_id=mCP96917.0 isoform=CRA_d"
FT                   /protein_id="EDL37442.1"
FT                   /translation="VRLGCGWRAVGGRGRGITSGTVRGAARCAAPLTATRCRAAWAPSA
FT                   MAPALRSLLSPRTLLLLLLSLALLGARAEPATGSAVPAQSRPCVDCHAFEFMQRALQDL
FT                   RKTAYSLDARTETLLLQAERRALCACWPAGR"
FT   assembly_gap    7797755..7797805
FT                   /estimated_length=51
FT                   /gap_type="unknown"
FT   gene            7797939..7804099
FT                   /gene="1110038O08Rik"
FT                   /locus_tag="mCG_16342"
FT                   /note="gene_id=mCG16342.2"
FT   mRNA            join(7797939..7798246,7799405..7799569,7801816..7804099)
FT                   /gene="1110038O08Rik"
FT                   /locus_tag="mCG_16342"
FT                   /product="RIKEN cDNA 1110038O08"
FT                   /note="gene_id=mCG16342.2 transcript_id=mCT17790.2 created
FT                   on 02-OCT-2002"
FT   CDS             join(7797991..7798246,7799405..7799569,7801816..7802183)
FT                   /codon_start=1
FT                   /gene="1110038O08Rik"
FT                   /locus_tag="mCG_16342"
FT                   /product="RIKEN cDNA 1110038O08"
FT                   /note="gene_id=mCG16342.2 transcript_id=mCT17790.2
FT                   protein_id=mCP3920.2"
FT                   /protein_id="EDL37443.1"
FT                   /translation="MWPPLPAAPGPAAAPPPAAGPQPHGGTGGAGPPEGRGVCIREFRA
FT                   AEQEAARRIFYDGILERIPNTAFRGLRQHPRTQLLYALLAALCFAVTRSLLLTCLVPAG
FT                   LLALRYYYSRKVILAYLECALHTDMADIEQYYMKPPGSCFWVAVLDGNVVGIVAARAHE
FT                   EDNTVELLRMSVDSRFRGKGIAKALGRRVLEFAMLHNYSAVVLGTTAVKVAAHKLYESL
FT                   GFRHMGASDHYVLPGMTLSLAERLFFQVRYHRYRLQLREE"
FT   gene            complement(7808222..>7917613)
FT                   /gene="Poln"
FT                   /locus_tag="mCG_16349"
FT                   /note="gene_id=mCG16349.2"
FT   mRNA            complement(join(7808222..7808542,7809873..7809934,
FT                   7810620..7810687,7816571..7816649,7817312..7817422,
FT                   7827375..7827506,7835784..7835866,7879811..7879925,
FT                   7881476..7881553,7882462..7882519,7906099..7906164,
FT                   7907886..7907984,7910515..7910610,7911550..7911633,
FT                   7915496..7915560,7916266..7916326,7917547..>7917613))
FT                   /gene="Poln"
FT                   /locus_tag="mCG_16349"
FT                   /product="DNA polymerase N"
FT                   /note="gene_id=mCG16349.2 transcript_id=mCT17797.2 created
FT                   on 02-OCT-2002"
FT   CDS             complement(join(7808462..7808542,7809873..7809934,
FT                   7810620..7810687,7816571..7816649,7817312..7817422,
FT                   7827375..7827506,7835784..7835866,7879811..7879925,
FT                   7881476..7881553,7882462..7882519,7906099..7906164,
FT                   7907886..7907984,7910515..7910610,7911550..7911633,
FT                   7915496..7915560,7916266..7916326,7917547..>7917612))
FT                   /codon_start=1
FT                   /gene="Poln"
FT                   /locus_tag="mCG_16349"
FT                   /product="DNA polymerase N"
FT                   /note="gene_id=mCG16349.2 transcript_id=mCT17797.2
FT                   protein_id=mCP4014.2"
FT                   /protein_id="EDL37444.1"
FT                   /translation="QNVCMNLKILYDLTMDLCSKLKAYGLWQLFCTLELPLIPILAVME
FT                   NHKIPVDKEEMERTSALLGARLKELEQEAHFVAGEQFLIMSNNQLREILFGKLKLHLLS
FT                   QRKHLPRTGLQNQLSTSEAMTQWRTSGVPAGPHCCATTADSCLLSWLYPIGLLGSISST
FT                   WNQTGTVTGRLSAKHPNIQGISKHPIKISKPWNFKGKEEETVTISPRTLFVSSEGHTFL
FT                   AADFSQIELRILAHLSGDPELLKLFQESERDDVFSTLTSQWKDIPIERVTHMDREQTKK
FT                   VVYSVVYGAGKERLAACLGVTVLEATHFLERFLQKYKKIKDFAQTVIGQCHSAGYVTSI
FT                   LGRRRPLPRICAQDQQLRAQAERQAVNFVVQGSAADLCKLAMIRISTAVATSPTLTARL
FT                   VAQIHDELLFEVEDTQVPEFAALVRRIMESLQQVQTLELQLQVPLKVNLSVGRSWGHLT
FT                   PLQEILGSA"
FT   assembly_gap    7814676..7814695
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7816026..7816045
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7846781..7850440
FT                   /estimated_length=3660
FT                   /gap_type="unknown"
FT   assembly_gap    7865540..7865761
FT                   /estimated_length=222
FT                   /gap_type="unknown"
FT   assembly_gap    7891420..7891660
FT                   /estimated_length=241
FT                   /gap_type="unknown"
FT   assembly_gap    7895237..7895656
FT                   /estimated_length=420
FT                   /gap_type="unknown"
FT   assembly_gap    7896484..7896785
FT                   /estimated_length=302
FT                   /gap_type="unknown"
FT   gene            7898859..7899269
FT                   /pseudo
FT                   /locus_tag="mCG_1046219"
FT                   /note="gene_id=mCG1046219.1"
FT   mRNA            7898859..7899269
FT                   /pseudo
FT                   /locus_tag="mCG_1046219"
FT                   /note="gene_id=mCG1046219.1 transcript_id=mCT163923.1
FT                   created on 15-OCT-2002"
FT   gene            <7920883..7937267
FT                   /locus_tag="mCG_146324"
FT                   /note="gene_id=mCG146324.0"
FT   mRNA            join(<7920883..7921265,7921351..7921779,7936255..7936367,
FT                   7937117..7937267)
FT                   /locus_tag="mCG_146324"
FT                   /product="mCG146324"
FT                   /note="gene_id=mCG146324.0 transcript_id=mCT186427.0
FT                   created on 14-JUL-2003"
FT   CDS             join(<7921170..7921265,7921351..7921623)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146324"
FT                   /product="mCG146324"
FT                   /note="gene_id=mCG146324.0 transcript_id=mCT186427.0
FT                   protein_id=mCP107486.0"
FT                   /protein_id="EDL37445.1"
FT                   /translation="IVIWVLEKYCNIKFYLSLCSIYTPRLTSESYELLCRIHTLDLVQA
FT                   SKCSTSRHARSFLLPLHGATPTHTAEDGICSCMSTLLHPQLVQPAQEMFWASSLPTHLS
FT                   QKDPHVLNCSFFHHLMNF"
FT   assembly_gap    7924035..7924054
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7932263..7932572
FT                   /estimated_length=310
FT                   /gap_type="unknown"
FT   gene            complement(7955770..7971346)
FT                   /gene="BC023882"
FT                   /locus_tag="mCG_16332"
FT                   /note="gene_id=mCG16332.2"
FT   mRNA            complement(join(7955770..7955996,7965419..7965647,
FT                   7967816..7968255,7969306..7970344,7971291..7971346))
FT                   /gene="BC023882"
FT                   /locus_tag="mCG_16332"
FT                   /product="cDNA sequence BC023882"
FT                   /note="gene_id=mCG16332.2 transcript_id=mCT17520.2 created
FT                   on 02-OCT-2002"
FT   CDS             complement(join(7955862..7955996,7965419..7965647,
FT                   7967816..7968255,7969306..7970214))
FT                   /codon_start=1
FT                   /gene="BC023882"
FT                   /locus_tag="mCG_16332"
FT                   /product="cDNA sequence BC023882"
FT                   /note="gene_id=mCG16332.2 transcript_id=mCT17520.2
FT                   protein_id=mCP3978.2"
FT                   /protein_id="EDL37446.1"
FT                   /translation="MSCGNEFVETLKKIGYPKADILNGEDFDWLFEDVEDESFLKWFCG
FT                   NVNEQNVLSEKELEAFSDLQRSGKPILEGTALDEVLRTCKTFDLKTCKLDDKEIQILED
FT                   EVQTLQKLNNSKIQRRNKYQLMVSETSYRFLALNAKQEEATKKLKQKQGFLNSVNTKLS
FT                   NELQGLTEEVNNLMIFFRNSNLSERTNPMVFLSQFPLGKYISQEEQSTAALTLYTKKQF
FT                   FQGMHEVVESSNEDNFQLLDIQTPSICDNEEILRERRLEMARLQMACICVQKQIIYLKT
FT                   SNLSMKSSIKWAEENLNRLTNEVIDKENLDAEISSLNSEILKLEEQITHIKDKVLPAVV
FT                   KEYAQLLNMPVVKGDFELQIAKQDYYTARQELVLNELIKQKASFELVQLSYEIELRKHW
FT                   DTYRQLESLVQQLSQRNTVLCQHLAVLSDIPASEQLTSRTPIDTKDHSTHRLYELLEGD
FT                   NKKKELFITHEHLEEVAEKLKQDVSVIQDQLAVSTQEHFFFLSKLNNDVDMLCDALYRG
FT                   GNQLLLCDQELKEHFHQVESQLNELHHLLTDILADVKTKRRILATNKLHQVER"
FT   assembly_gap    7978390..7978409
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(7978410..>7989649)
FT                   /gene="Mxd4"
FT                   /locus_tag="mCG_16343"
FT                   /note="gene_id=mCG16343.2"
FT   mRNA            complement(join(7978410..7979029,7979478..7979640,
FT                   7980690..7980804,7989336..7989364,7989448..>7989649))
FT                   /gene="Mxd4"
FT                   /locus_tag="mCG_16343"
FT                   /product="Max dimerization protein 4"
FT                   /note="gene_id=mCG16343.2 transcript_id=mCT17791.2 created
FT                   on 17-SEP-2002"
FT   CDS             complement(join(7978872..7979029,7979478..7979640,
FT                   7980690..7980804,7989336..7989364,7989448..>7989501))
FT                   /codon_start=1
FT                   /gene="Mxd4"
FT                   /locus_tag="mCG_16343"
FT                   /product="Max dimerization protein 4"
FT                   /note="gene_id=mCG16343.2 transcript_id=mCT17791.2
FT                   protein_id=mCP3922.1"
FT                   /protein_id="EDL37447.1"
FT                   /translation="TLCCCCWRRPSTWSVGTEAEHGYASVLPRAKLRLYLEQLKQLVPL
FT                   GPDSTRHTTLSLLKRAKMHIKKLEEQDRRALSIKEQLQREHRFLKRRLEQLSVQSVERV
FT                   RTDSTGSAVSTDDSEQEVDIEGMEFGPGELDSAGSSSDADDHYSLQSSGCSDSSYGHPC
FT                   RRPGCPGLS"
FT   assembly_gap    7989200..7989335
FT                   /estimated_length=136
FT                   /gap_type="unknown"
FT   gene            complement(7996806..>8090159)
FT                   /gene="Zfyve28"
FT                   /locus_tag="mCG_141232"
FT                   /note="gene_id=mCG141232.0"
FT   mRNA            complement(join(7996806..7998032,7998509..7998612,
FT                   7999414..7999518,8000711..8000827,8001525..8001676,
FT                   8018498..8019802,8026889..8026990,8034090..8034179,
FT                   8035241..8035330,8036221..8036423,8037939..8038076,
FT                   8045109..8045249,8090055..>8090159))
FT                   /gene="Zfyve28"
FT                   /locus_tag="mCG_141232"
FT                   /product="zinc finger, FYVE domain containing 28"
FT                   /note="gene_id=mCG141232.0 transcript_id=mCT173999.0
FT                   created on 02-OCT-2002"
FT   CDS             complement(join(7997901..7998032,7998509..7998612,
FT                   7999414..7999518,8000711..8000827,8001525..8001676,
FT                   8018498..8019802,8026889..8026990,8034090..8034179,
FT                   8035241..8035330,8036221..8036423,8037939..8038076,
FT                   8045109..8045249,8090055..>8090159))
FT                   /codon_start=1
FT                   /gene="Zfyve28"
FT                   /locus_tag="mCG_141232"
FT                   /product="zinc finger, FYVE domain containing 28"
FT                   /note="gene_id=mCG141232.0 transcript_id=mCT173999.0
FT                   protein_id=mCP96918.0"
FT                   /protein_id="EDL37448.1"
FT                   /translation="PDPGAALQRARAARSVARAGAAMMNRFRKWLYKPKRSDPQLLAQF
FT                   YYADEELNQVAAELDSLDGRKEPQRCTLLVSQFRSCQDNVLNIINQIMEECIPQDRAPR
FT                   DFCVKFPEEIRHDNLAGQLWFGAECLAAGSIIMNRELESMAMRPLAKELTRSLEDVRGT
FT                   LRDQALRDLNTYTEKMREALRRFDVLFAEFELSYVSAMVPVKSPREYYVQQEVIVLFCE
FT                   TVERALDFGYLTQDMIDDYEPALMFTIPRLAIVCGLVVYADGPLNLDRKVEDMSELFRP
FT                   FHTLLRKIRDLLQALTEEELHTLERSLCVSQDVELPIRADTQAPSALAPTFSASLPPEE
FT                   TLSASANNPEAELACSMQYDDQELEELSRMVHRAGDEMSSLLSPPSACQSPAHRPGSEA
FT                   SPRGEASPARARLKSGSDEEERVFFMDDVEVTESPARPESPGNTFELTQGNAQQRGQDG
FT                   QSGEVGVEAPALVKEEDWSNNNVEGDKIKLASLMGSTSCSCLDSQLYLDGWEVSAEDAE
FT                   TAEMIAHRTGGMKLSATVIFNPKSPTSQDSAVAAQEAPGHGTSPLEPRAEGTGDNSHKL
FT                   STTATNCLLHSCVCCGSCGDSRDDAVERLREKCGPGSVISASNPSVSLAKGGDKEPERI
FT                   DEAQPSDVTLPAEDASNRQEPKAPASSKCLAHTSGPQVDTASRLQGEGEVKGQPEPEAR
FT                   KQDPEKSPVVSGDSPRGDVAQTEHQHLLGSSSTVGSCSLDNTRLDVATAAMPVTPMATR
FT                   EKIRSRFHGSHDLIHRLFVCISGVADQLQTNYASDLRSILKTLFEVMATKPETDDKEKL
FT                   KKVTQTLRSAALEDCALCQETVSSSELAAKTRDGDFEDPPEWVPDEACGFCTSCKAPFT
FT                   VIRRKHHCRSCGKIFCSRCSSHSAPLPRYGQVKPVRVCTHCYMFHVTPFYSDKTGM"
FT   assembly_gap    8064034..8065574
FT                   /estimated_length=1541
FT                   /gap_type="unknown"
FT   assembly_gap    8083609..8083749
FT                   /estimated_length=141
FT                   /gap_type="unknown"
FT   assembly_gap    8088348..8088517
FT                   /estimated_length=170
FT                   /gap_type="unknown"
FT   assembly_gap    8090790..8091037
FT                   /estimated_length=248
FT                   /gap_type="unknown"
FT   assembly_gap    8118665..8118734
FT                   /estimated_length=70
FT                   /gap_type="unknown"
FT   assembly_gap    8131018..8131037
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8133800..8133824
FT                   /estimated_length=25
FT                   /gap_type="unknown"
FT   gene            8138225..8155336
FT                   /locus_tag="mCG_16337"
FT                   /note="gene_id=mCG16337.2"
FT   mRNA            join(8138225..8138361,8144407..8144564,8148678..8148804,
FT                   8150567..8150640,8151787..8151974,8152693..8152741,
FT                   8153134..8155336)
FT                   /locus_tag="mCG_16337"
FT                   /product="mCG16337, transcript variant mCT17786"
FT                   /note="gene_id=mCG16337.2 transcript_id=mCT17786.2 created
FT                   on 13-FEB-2003"
FT   mRNA            join(<8138231..8138361,8144407..8144564,8148678..8148804,
FT                   8150567..8150646,8151815..8151974,8152693..8152741,
FT                   8153134..8155336)
FT                   /locus_tag="mCG_16337"
FT                   /product="mCG16337, transcript variant mCT193584"
FT                   /note="gene_id=mCG16337.2 transcript_id=mCT193584.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(8138255..8138304,8144407..8144564,8148678..8148804,
FT                   8150567..8150646,8151815..8151974,8152693..8152741,
FT                   8153134..8153147)
FT                   /locus_tag="mCG_16337"
FT                   /product="mCG16337, transcript variant mCT180262"
FT                   /note="gene_id=mCG16337.2 transcript_id=mCT180262.0 created
FT                   on 13-FEB-2003"
FT   mRNA            join(8138750..8138917,8144407..8144564,8148678..8148804,
FT                   8150567..8150646,8151815..8151974,8152693..8152741,
FT                   8153134..8155327)
FT                   /locus_tag="mCG_16337"
FT                   /product="mCG16337, transcript variant mCT180263"
FT                   /note="gene_id=mCG16337.2 transcript_id=mCT180263.0 created
FT                   on 13-FEB-2003"
FT   assembly_gap    8140682..8140851
FT                   /estimated_length=170
FT                   /gap_type="unknown"
FT   CDS             join(<8144460..8144564,8148678..8148804,8150567..8150646,
FT                   8151815..8151880)
FT                   /codon_start=1
FT                   /locus_tag="mCG_16337"
FT                   /product="mCG16337, isoform CRA_c"
FT                   /note="gene_id=mCG16337.2 transcript_id=mCT193584.0
FT                   protein_id=mCP114581.0 isoform=CRA_c"
FT                   /protein_id="EDL37451.1"
FT                   /translation="VFSGHERLRTSYHTINLGVDHFLFCGLKPESTMSTRNPQRKRRGG
FT                   TVNSRQTQKRTRETTSTPEVSLETEPIELVETVGDEIVDLTCESLEPVVVDLTHNDSVV
FT                   KGEGQGEMGGGCAKTMLTAVW"
FT   CDS             join(8144556..8144564,8148678..8148804,8150567..8150640,
FT                   8151787..8151974,8152693..8152741,8153134..8153283)
FT                   /codon_start=1
FT                   /locus_tag="mCG_16337"
FT                   /product="mCG16337, isoform CRA_a"
FT                   /note="gene_id=mCG16337.2 transcript_id=mCT17786.2
FT                   protein_id=mCP3915.2 isoform=CRA_a"
FT                   /protein_id="EDL37449.1"
FT                   /translation="MSTRNPQRKRRGGTVNSRQTQKRTRETTSTPEVSLETEPIELVET
FT                   VGDEIVDLTCESLEPVVVDLTHNDSMAENVAFSLERRRPRRNGRRLRQDHADSCVVSSD
FT                   DEELSRDKDVYVTTHTPRSTKDDGATGPRPSGTVSCPICMDGYSEIVQNGRLIVSTECG
FT                   HVFCSQCLRDSLKNANTCPTCRKKINHKRYHPIYI"
FT   CDS             join(8144556..8144564,8148678..8148804,8150567..8150646,
FT                   8151815..8151880)
FT                   /codon_start=1
FT                   /locus_tag="mCG_16337"
FT                   /product="mCG16337, isoform CRA_b"
FT                   /note="gene_id=mCG16337.2 transcript_id=mCT180262.0
FT                   protein_id=mCP103185.0 isoform=CRA_b"
FT                   /protein_id="EDL37450.1"
FT                   /translation="MSTRNPQRKRRGGTVNSRQTQKRTRETTSTPEVSLETEPIELVET
FT                   VGDEIVDLTCESLEPVVVDLTHNDSVVKGEGQGEMGGGCAKTMLTAVW"
FT   CDS             join(8144556..8144564,8148678..8148804,8150567..8150646,
FT                   8151815..8151880)
FT                   /codon_start=1
FT                   /locus_tag="mCG_16337"
FT                   /product="mCG16337, isoform CRA_b"
FT                   /note="gene_id=mCG16337.2 transcript_id=mCT180263.0
FT                   protein_id=mCP103184.0 isoform=CRA_b"
FT                   /protein_id="EDL37452.1"
FT                   /translation="MSTRNPQRKRRGGTVNSRQTQKRTRETTSTPEVSLETEPIELVET
FT                   VGDEIVDLTCESLEPVVVDLTHNDSVVKGEGQGEMGGGCAKTMLTAVW"
FT   assembly_gap    8145573..8145592
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8171736..8172553
FT                   /estimated_length=818
FT                   /gap_type="unknown"
FT   assembly_gap    8193093..8193112
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8198805..8199645
FT                   /estimated_length=841
FT                   /gap_type="unknown"
FT   gene            8212854..8288723
FT                   /locus_tag="mCG_16334"
FT                   /note="gene_id=mCG16334.1"
FT   mRNA            join(8212854..8213025,8222252..8222364,8222993..8223160,
FT                   8228479..8228713,8233342..8233466,8238661..8238808,
FT                   8241521..8241598,8242331..8242443,8242558..8242800,
FT                   8245507..8245660,8245794..8245964,8246868..8247119,
FT                   8260111..8260309,8261204..8261494,8263302..8263584,
FT                   8264291..8264474,8266181..8266411,8267811..8268654,
FT                   8277928..8278009,8287856..8288723)
FT                   /locus_tag="mCG_16334"
FT                   /product="mCG16334"
FT                   /note="gene_id=mCG16334.1 transcript_id=mCT17783.2 created
FT                   on 03-OCT-2002"
FT   CDS             join(8212921..8213025,8222252..8222364,8222993..8223160,
FT                   8228479..8228713,8233342..8233466,8238661..8238808,
FT                   8241521..8241598,8242331..8242443,8242558..8242800,
FT                   8245507..8245660,8245794..8245964,8246868..8247119,
FT                   8260111..8260309,8261204..8261494,8263302..8263584,
FT                   8264291..8264474,8266181..8266411,8267811..8268654,
FT                   8277928..8278009,8287856..8287949)
FT                   /codon_start=1
FT                   /locus_tag="mCG_16334"
FT                   /product="mCG16334"
FT                   /note="gene_id=mCG16334.1 transcript_id=mCT17783.2
FT                   protein_id=mCP3995.2"
FT                   /protein_id="EDL37453.1"
FT                   /translation="MAPKGNSVLHLPLWVCPDCRRTVEKEERHSGLDQPPETSGAGRLA
FT                   LGTQTMTSSGLGTTPSDACSCEACSERRDISAETEREPQQLQNYWSEVRYMVRCIYRQA
FT                   GTPLAEDQDQSLVPDKEGVKELVDRLCERDPYQLYQRLEQQAREYVLEMKVRLLRQLSA
FT                   AAKAKAPSGLQGPPQAHHFVSLLLEEYAALCQAARSISTFLGTLENEHLKKFQVTWELH
FT                   NKHLFENLVFSEPLLQSNLPALVSQIRLGTTTHDTCTEDMYSTLLQRYQRSEEELRKVA
FT                   EEWLECQKRIDAYVDEQMTMKTKQRMLTEDWEIFKQRRLIEEQLTNKKVVTGENNFTDT
FT                   RRHMLSSRLSMPDCPNCNYRRRCACDDCSLSHILTCGIMDTPVTDDIHIHQLPLQVDSA
FT                   PDYLSEMRPPSVSSASSGSGSSSPITIQQHPRLILTDNGSAPTFCSDDEDVAPLSAKFA
FT                   DIYPLTNYDDTNVVANMNGIHSELNGGGENMALKDEVSSTSRSSSEADDEDADGESSGE
FT                   PPGAPKQEEAIGNGNPKTEESNVNTPPPSYPAQQAEQTPNTCECHVCKQEASGLPASAM
FT                   TAGALPPGHQFLSPEKPTHPALHLYPHIHGHVPLHTVPHLPRPLIHPTLYPAPPFTHSK
FT                   ALPPAPVQSHTNKPQAFNASLQDHIYPSCFGNTPDWNSSKFISLWESEMMNDKNWNPGT
FT                   FLPDTISGNDILGPVLSETRPEALPPPPSNEAPAVSDIKEKKNAAKKKCLYNFQDAFME
FT                   ANEVAMANTVAMATSSATSSVSCTATTVQSSSSQFKVSSRRPPSIGDVFHGLNKEDHRH
FT                   SAPAAPRNSPTGLAPLPALSPSALSPASTPHLPNLAAPSFPKTATTAPGFVDTRKSFCP
FT                   TPVAPPPSTTDGSISAPPSVCSDPDCEGHRCENGVYDPQQDDGDESADEDSCSEHSSST
FT                   STSTNQKEGKYCDCCYCEFFGHGGPPAAPTSRNYAEMREKLRLRLTKRKEEQPKKMEQI
FT                   SEREGVVDHRRVEDLLQFINSSEAKPVSSSRAAKRARHKQRKARAREHLHHQEEQKQRE
FT                   EEEDEEEEDEEQHFKEEFQRLQELQKLRAAKKKKKDRPSKDCSKLDMLARNFQAATESI
FT                   SNSENIHNGSLEQTEEPETSSHSPSRHMNHSEPRPGPGANGDATDPVDPRDPSKLLLPK
FT                   EVNGKQHEPLAFLLDMMHHHKEGNSKQKLKQTSKTSNEPARKPTEPPKTTEVQLKPRAQ
FT                   PELKPKVVDLALLTEQKREERKTNSNNNNKKQLSHIKEEKLSTVTPEPPSPSQLLQNGR
FT                   LILASSPQPKGKNKKNKKKKGDRTSSSLDDVFLPKDIDLDSVDMDETEREVEYFKRFCL
FT                   DSARQNRQRLSINWSNFSLKKATFAAH"
FT   assembly_gap    8214744..8214831
FT                   /estimated_length=88
FT                   /gap_type="unknown"
FT   assembly_gap    8270866..8270937
FT                   /estimated_length=72
FT                   /gap_type="unknown"
FT   gene            complement(8283596..8284780)
FT                   /pseudo
FT                   /locus_tag="mCG_16350"
FT                   /note="gene_id=mCG16350.2"
FT   mRNA            complement(8283596..8284780)
FT                   /pseudo
FT                   /locus_tag="mCG_16350"
FT                   /note="gene_id=mCG16350.2 transcript_id=mCT17798.2 created
FT                   on 03-OCT-2002"
FT   gene            complement(8298218..8316141)
FT                   /gene="Tnip2"
FT                   /locus_tag="mCG_16338"
FT                   /note="gene_id=mCG16338.2"
FT   mRNA            complement(join(8298218..8299153,8301383..8301502,
FT                   8301691..8301939,8303111..8303200,8305740..8306030,
FT                   8315781..8316141))
FT                   /gene="Tnip2"
FT                   /locus_tag="mCG_16338"
FT                   /product="TNFAIP3 interacting protein 2, transcript variant
FT                   mCT17787"
FT                   /note="gene_id=mCG16338.2 transcript_id=mCT17787.2 created
FT                   on 25-SEP-2002"
FT   mRNA            complement(join(8298290..8299153,8301383..8301502,
FT                   8301691..8301939,8303111..8303200,8303661..8303723,
FT                   8305740..8306030,8315781..>8316125))
FT                   /gene="Tnip2"
FT                   /locus_tag="mCG_16338"
FT                   /product="TNFAIP3 interacting protein 2, transcript variant
FT                   mCT193585"
FT                   /note="gene_id=mCG16338.2 transcript_id=mCT193585.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(8298890..8299153,8301383..8301502,
FT                   8301691..8301939,8303111..8303200,8303661..8303723,
FT                   8305740..8306030,8315781..>8316125))
FT                   /codon_start=1
FT                   /gene="Tnip2"
FT                   /locus_tag="mCG_16338"
FT                   /product="TNFAIP3 interacting protein 2, isoform CRA_a"
FT                   /note="gene_id=mCG16338.2 transcript_id=mCT193585.0
FT                   protein_id=mCP114582.0 isoform=CRA_a"
FT                   /protein_id="EDL37454.1"
FT                   /translation="LVFAPPVWRSWRRPSPHGRPTAMSSGDPRSGRQDGAPRAAAALCG
FT                   LYHEAGQQLQRLKDQLAARDALIASLRTRLAALEGHTAPSLVDALLDQVERFREQLRRQ
FT                   EEGASETQLRQEVERLTERLEEKEREMQQLMSQPQHEQEKEVVLLRRSVAEKEKARAAS
FT                   DVLCRSLADETHQLRRTLAATAHMCQHLAKCLDERQCAQGDAGEKSPAEEVRWICGQAY
FT                   TKDLKKPPGCWLEQTSSDASGQSVIKKLQEENRLLKQKVTHVEDLNAKWQRYDASRDEY
FT                   VKGLHAQLKRRQVPLEPELMKKEISRLNRQLEEKISDCAEANQELTAMRMSRDTALERV
FT                   QMLEQQILAYKDDFKSERADRERAHSRIQELEEKIMSLMYQVSQRQDSREPGPCRIHTG
FT                   NKTAKYLEMDALEHVTPGGWRPESRSQQMEPSAEGGHVCTAQRGQGDLQCPHCLRCFSD
FT                   EQGEAFLRHLSECCQ"
FT   CDS             complement(join(8298890..8299153,8301383..8301502,
FT                   8301691..8301939,8303111..8303200,8305740..8306030,
FT                   8315781..8316059))
FT                   /codon_start=1
FT                   /gene="Tnip2"
FT                   /locus_tag="mCG_16338"
FT                   /product="TNFAIP3 interacting protein 2, isoform CRA_b"
FT                   /note="gene_id=mCG16338.2 transcript_id=mCT17787.2
FT                   protein_id=mCP3885.2 isoform=CRA_b"
FT                   /protein_id="EDL37455.1"
FT                   /translation="MSSGDPRSGRQDGAPRAAAALCGLYHEAGQQLQRLKDQLAARDAL
FT                   IASLRTRLAALEGHTAPSLVDALLDQVERFREQLRRQEEGASETQLRQEVERLTERLEE
FT                   KEREMQQLMSQPQHEQEKEVVLLRRSVAEKEKARAASDVLCRSLADETHQLRRTLAATA
FT                   HMCQHLAKCLDERQCAQGDAGEKSPAELEQTSSDASGQSVIKKLQEENRLLKQKVTHVE
FT                   DLNAKWQRYDASRDEYVKGLHAQLKRRQVPLEPELMKKEISRLNRQLEEKISDCAEANQ
FT                   ELTAMRMSRDTALERVQMLEQQILAYKDDFKSERADRERAHSRIQELEEKIMSLMYQVS
FT                   QRQDSREPGPCRIHTGNKTAKYLEMDALEHVTPGGWRPESRSQQMEPSAEGGHVCTAQR
FT                   GQGDLQCPHCLRCFSDEQGEAFLRHLSECCQ"
FT   assembly_gap    8313851..8313870
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8327099..8327446
FT                   /estimated_length=348
FT                   /gap_type="unknown"
FT   gene            8328057..8365816
FT                   /gene="Sh3bp2"
FT                   /locus_tag="mCG_16341"
FT                   /note="gene_id=mCG16341.2"
FT   mRNA            join(8328057..8328164,8353821..8353961,8354998..8355100,
FT                   8357718..8357835,8358203..8358273,8359152..8359240,
FT                   8361262..>8361389)
FT                   /gene="Sh3bp2"
FT                   /locus_tag="mCG_16341"
FT                   /product="SH3-domain binding protein 2, transcript variant
FT                   mCT173412"
FT                   /note="gene_id=mCG16341.2 transcript_id=mCT173412.0 created
FT                   on 17-SEP-2002"
FT   mRNA            join(8328112..8328164,8353822..8353961,8354998..8355100,
FT                   8357718..8357835,8358203..8358273,8359152..8359240,
FT                   8359556..8359624,8361262..8361910,8362605..8362713,
FT                   8362950..8363005,8363287..8363368,8363864..8363923,
FT                   8364620..8365816)
FT                   /gene="Sh3bp2"
FT                   /locus_tag="mCG_16341"
FT                   /product="SH3-domain binding protein 2, transcript variant
FT                   mCT17789"
FT                   /note="gene_id=mCG16341.2 transcript_id=mCT17789.0 created
FT                   on 17-SEP-2002"
FT   CDS             join(8353826..8353961,8354998..8355100,8357718..8357835,
FT                   8358203..8358273,8359152..8359240,8359556..8359624,
FT                   8361262..8361910,8362605..8362713,8362950..8363005,
FT                   8363287..8363368,8363864..8363923,8364620..8364757)
FT                   /codon_start=1
FT                   /gene="Sh3bp2"
FT                   /locus_tag="mCG_16341"
FT                   /product="SH3-domain binding protein 2, isoform CRA_a"
FT                   /note="gene_id=mCG16341.2 transcript_id=mCT17789.0
FT                   protein_id=mCP3899.1 isoform=CRA_a"
FT                   /db_xref="InterPro:IPR000980"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="MGI:MGI:1346349"
FT                   /db_xref="UniProtKB/TrEMBL:Q5U3L0"
FT                   /protein_id="EDL37456.1"
FT                   /translation="MAAEEMQWPVPMKAIGAQNLLTMPGGVAKAGYLHKKGGTQLQLLK
FT                   WPLRFVIIHKRCIYYFKSSTSASPQGAFSLSGYNRVMRAAEETTSNNVFPFKIIHISKK
FT                   HRTWFFSASSEDERKSWMALLRREIGHFHEKKELPLDTSDSSSDTDSFYGAVERPIDIS
FT                   LSSYPMDNEDYEHEDEDDSYLEPDSPGPMKLEDALTYPPAYPPPPVPVPRKPAFSDLPR
FT                   AHSFTSKSPSPLLPPPPPKRGLPDTGSAPEDAKDALGLRRVEPGLRVPATPRRMSDPPM
FT                   SNVPTVPNLRKHPCFRDSVNPGLEPWTPGHGTSSVSSSTTMAVATSRNCDKLKSFHLSS
FT                   RGPPTSEPPPVPANKPKFLKIAEEPSPREAAKFAPVPPVAPRPPVQKMPMPEATVRPAV
FT                   LPRPENTPLPHLQRSPPDGQSFRGFSFEKARQPSQADTGEEDSDEDYEKVPLPNSVFVN
FT                   TTESCEVERLFKATDPRGEPQDGLYCIRNSSTKSGKVLVVWDESSNKVRNYRIFEKDSK
FT                   FYLEGEVLFASVGSMVEHYHTHVLPSHQSLLLRHPYGYAGPR"
FT   CDS             join(8353826..8353961,8354998..8355100,8357718..8357835,
FT                   8358203..8358273,8359152..8359240,8361262..>8361389)
FT                   /codon_start=1
FT                   /gene="Sh3bp2"
FT                   /locus_tag="mCG_16341"
FT                   /product="SH3-domain binding protein 2, isoform CRA_b"
FT                   /note="gene_id=mCG16341.2 transcript_id=mCT173412.0
FT                   protein_id=mCP96331.0 isoform=CRA_b"
FT                   /protein_id="EDL37457.1"
FT                   /translation="MAAEEMQWPVPMKAIGAQNLLTMPGGVAKAGYLHKKGGTQLQLLK
FT                   WPLRFVIIHKRCIYYFKSSTSASPQGAFSLSGYNRVMRAAEETTSNNVFPFKIIHISKK
FT                   HRTWFFSASSEDERKSWMALLRREIGHFHEKKELPLDTSDSSSDTDSFYGAVERPIDIS
FT                   LSSYPMDNEDALTYPPAYPPPPVPVPRKPAFSDLPRAHSFTSKSPSPLLPPP"
FT   gene            8376082..8434539
FT                   /gene="Add1"
FT                   /locus_tag="mCG_122447"
FT                   /note="gene_id=mCG122447.2"
FT   mRNA            join(8376082..8376156,8403559..8403773,8406925..8407087,
FT                   8408063..8408214,8412427..8412507,8412725..8412874,
FT                   8415523..8415666,8415754..8415852,8416419..8416595,
FT                   8418797..8419048,8421584..8421685,8422279..8422368,
FT                   8427513..8427669,8430649..8430747,8431370..8431406,
FT                   8432704..8433849)
FT                   /gene="Add1"
FT                   /locus_tag="mCG_122447"
FT                   /product="adducin 1 (alpha), transcript variant mCT123665"
FT                   /note="gene_id=mCG122447.2 transcript_id=mCT123665.0
FT                   created on 18-SEP-2002"
FT   mRNA            join(<8376104..8376156,8403559..8403773,8406925..8407087,
FT                   8408063..8408214,8412427..8412507,8412725..8412874,
FT                   8415523..8415666,8415754..8415852,8416419..8416595,
FT                   8418797..8419141,8421584..8421685,8422279..8422368,
FT                   8427513..8427669,8430649..8430747,8431370..8431406,
FT                   8432704..8434539)
FT                   /gene="Add1"
FT                   /locus_tag="mCG_122447"
FT                   /product="adducin 1 (alpha), transcript variant mCT193603"
FT                   /note="gene_id=mCG122447.2 transcript_id=mCT193603.0
FT                   created on 09-MAR-2004"
FT   mRNA            join(8376117..8376156,8400404..8400682,8403559..8403773,
FT                   8406925..8407087,8408063..8408214,8412427..8412507,
FT                   8412725..8412874,8415523..8415666,8415754..8415852,
FT                   8416419..8416595,8418797..8419048,8421584..8421685,
FT                   8422279..8422368,8427513..8427669,8430649..8430747,
FT                   8432704..8434531)
FT                   /gene="Add1"
FT                   /locus_tag="mCG_122447"
FT                   /product="adducin 1 (alpha), transcript variant mCT173396"
FT                   /note="gene_id=mCG122447.2 transcript_id=mCT173396.0
FT                   created on 18-SEP-2002"
FT   CDS             join(<8403567..8403773,8406925..8407087,8408063..8408214,
FT                   8412427..8412507,8412725..8412874,8415523..8415666,
FT                   8415754..8415852,8416419..8416595,8418797..8419141,
FT                   8421584..8421685,8422279..8422368,8427513..8427669,
FT                   8430649..8430747,8431370..8431406,8432704)
FT                   /codon_start=1
FT                   /gene="Add1"
FT                   /locus_tag="mCG_122447"
FT                   /product="adducin 1 (alpha), isoform CRA_b"
FT                   /note="gene_id=mCG122447.2 transcript_id=mCT193603.0
FT                   protein_id=mCP114566.0 isoform=CRA_b"
FT                   /protein_id="EDL37459.1"
FT                   /translation="ENCAMNGDTRAAVVTSPPPTTAPHKERYFDRVDENNPEYLRERNM
FT                   APDLRQDFNMMEQKKRVSMILQSPAFCEELESMIQEQFKKGKNPTGLLALQQIADFMTA
FT                   SVPNVYPAAPQGGMAALNMSLGMVTPVNDLRGSDSIAYDKGEKLLRCKLAAFYRLADLF
FT                   GWSQLIYNHITTRVNSEQEHFLIVPFGLLYSEVTASSLVKVNLQGDIVDRGSTNLGVNQ
FT                   AGFTLHSAVYAARPDAKCIVHIHTPAGAAVSAMKCGLLPISPEALSLGDVAYHDYHGIL
FT                   VDEEEKILIQKNLGPKSKVLILRNHGLVSVGESVEEAFYYIHNLVVACEIQVRTLASAG
FT                   GPDNLVLLDPGKYKAKSRSPGTPAGEGSGSPPKWQIGEQEFEALMRMLDNLGYRTGYPY
FT                   RYPALRERSKKYSDVEVPASVTGHSFASDGDSGTCSPLRHSFQKQQREKTRWLHSGRGD
FT                   DASEEGQNGSSPKSKTKVWTNITHDHVKPLLQSLSSGVCVPSCITNCLWTKEDGHRTST
FT                   SAVPNLFVPLNTNPKEVQEMRNKIREQNLQDIKTAGPQSQVLCGVMMDRSLVQGELVTA
FT                   SKAIIEKEYQPHVIVSTTGPNPFNTLTDRELEEYRREVERKQKGSEENLDETREQKEKS
FT                   PPDQSAVPNTPPSTPVKLEEAGDGCAKEYLLP"
FT   CDS             join(8403579..8403773,8406925..8407087,8408063..8408214,
FT                   8412427..8412507,8412725..8412874,8415523..8415666,
FT                   8415754..8415852,8416419..8416595,8418797..8419048,
FT                   8421584..8421685,8422279..8422368,8427513..8427669,
FT                   8430649..8430747,8432704..8433050)
FT                   /codon_start=1
FT                   /gene="Add1"
FT                   /locus_tag="mCG_122447"
FT                   /product="adducin 1 (alpha), isoform CRA_c"
FT                   /note="gene_id=mCG122447.2 transcript_id=mCT173396.0
FT                   protein_id=mCP96315.0 isoform=CRA_c"
FT                   /protein_id="EDL37460.1"
FT                   /translation="MNGDTRAAVVTSPPPTTAPHKERYFDRVDENNPEYLRERNMAPDL
FT                   RQDFNMMEQKKRVSMILQSPAFCEELESMIQEQFKKGKNPTGLLALQQIADFMTASVPN
FT                   VYPAAPQGGMAALNMSLGMVTPVNDLRGSDSIAYDKGEKLLRCKLAAFYRLADLFGWSQ
FT                   LIYNHITTRVNSEQEHFLIVPFGLLYSEVTASSLVKVNLQGDIVDRGSTNLGVNQAGFT
FT                   LHSAVYAARPDAKCIVHIHTPAGAAVSAMKCGLLPISPEALSLGDVAYHDYHGILVDEE
FT                   EKILIQKNLGPKSKVLILRNHGLVSVGESVEEAFYYIHNLVVACEIQVRTLASAGGPDN
FT                   LVLLDPGKYKAKSRSPGTPAGEGSGSPPKWQIGEQEFEALMRMLDNLGYRTGYPYRYPA
FT                   LRERSKKYSDVEVPASVTGHSFASDGDSGTCSPLRHSFQKQQREKTRWLHSGRGDDASE
FT                   EGQNGSSPKSKTKWTKEDGHRTSTSAVPNLFVPLNTNPKEVQEMRNKIREQNLQDIKTA
FT                   GPQSQVLCGVMMDRSLVQGELVTASKAIIEKEYQPHVIVSTTGPNPFNTLTDRELEEYR
FT                   REVERKQKGSEENLDETREQKEKSPPDQSAVPNTPPSTPVKLEEDLPQEPTSRDDSDAT
FT                   TFKPTPPDLSPDEPSEALAFPAVEEEAHASPDPTQPPAEADPEPASAPTPGAEEVASPA
FT                   TEEGSPMDPGSDGSPGKSPSKKKKKFRTPSFLKKSKKKSDS"
FT   CDS             join(8403579..8403773,8406925..8407087,8408063..8408214,
FT                   8412427..8412507,8412725..8412874,8415523..8415666,
FT                   8415754..8415852,8416419..8416595,8418797..8419048,
FT                   8421584..8421685,8422279..8422368,8427513..8427669,
FT                   8430649..8430747,8431370..8431406,8432704)
FT                   /codon_start=1
FT                   /gene="Add1"
FT                   /locus_tag="mCG_122447"
FT                   /product="adducin 1 (alpha), isoform CRA_a"
FT                   /note="gene_id=mCG122447.2 transcript_id=mCT123665.0
FT                   protein_id=mCP65087.1 isoform=CRA_a"
FT                   /protein_id="EDL37458.1"
FT                   /translation="MNGDTRAAVVTSPPPTTAPHKERYFDRVDENNPEYLRERNMAPDL
FT                   RQDFNMMEQKKRVSMILQSPAFCEELESMIQEQFKKGKNPTGLLALQQIADFMTASVPN
FT                   VYPAAPQGGMAALNMSLGMVTPVNDLRGSDSIAYDKGEKLLRCKLAAFYRLADLFGWSQ
FT                   LIYNHITTRVNSEQEHFLIVPFGLLYSEVTASSLVKVNLQGDIVDRGSTNLGVNQAGFT
FT                   LHSAVYAARPDAKCIVHIHTPAGAAVSAMKCGLLPISPEALSLGDVAYHDYHGILVDEE
FT                   EKILIQKNLGPKSKVLILRNHGLVSVGESVEEAFYYIHNLVVACEIQVRTLASAGGPDN
FT                   LVLLDPGKYKAKSRSPGTPAGEGSGSPPKWQIGEQEFEALMRMLDNLGYRTGYPYRYPA
FT                   LRERSKKYSDVEVPASVTGHSFASDGDSGTCSPLRHSFQKQQREKTRWLHSGRGDDASE
FT                   EGQNGSSPKSKTKWTKEDGHRTSTSAVPNLFVPLNTNPKEVQEMRNKIREQNLQDIKTA
FT                   GPQSQVLCGVMMDRSLVQGELVTASKAIIEKEYQPHVIVSTTGPNPFNTLTDRELEEYR
FT                   REVERKQKGSEENLDETREQKEKSPPDQSAVPNTPPSTPVKLEEAGDGCAKEYLLP"
FT   gene            complement(8435880..>8439418)
FT                   /gene="0610009O03Rik"
FT                   /locus_tag="mCG_2550"
FT                   /note="gene_id=mCG2550.2"
FT   mRNA            complement(join(8435880..8436248,8436365..8436454,
FT                   8436527..8436574,8436657..8436747,8436825..8436933,
FT                   8437085..8437196,8437285..8437393,8437604..8437765,
FT                   8437843..8438001,8438255..8438358,8438644..8438740,
FT                   8438828..8439017,8439333..>8439418))
FT                   /gene="0610009O03Rik"
FT                   /locus_tag="mCG_2550"
FT                   /product="RIKEN cDNA 0610009O03, transcript variant
FT                   mCT193644"
FT                   /note="gene_id=mCG2550.2 transcript_id=mCT193644.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(8435883..8436248,8436365..8436454,
FT                   8436527..8436574,8436657..8436747,8436825..8436933,
FT                   8437085..8437196,8437285..8437393,8437604..8437765,
FT                   8437843..8438001,8438255..8438358,8438644..8438740,
FT                   8438828..8439017,8439161..8439361))
FT                   /gene="0610009O03Rik"
FT                   /locus_tag="mCG_2550"
FT                   /product="RIKEN cDNA 0610009O03, transcript variant
FT                   mCT1553"
FT                   /note="gene_id=mCG2550.2 transcript_id=mCT1553.1 created on
FT                   18-SEP-2002"
FT   CDS             complement(join(8436133..8436248,8436365..8436454,
FT                   8436527..8436574,8436657..8436747,8436825..8436933,
FT                   8437085..8437196,8437285..8437393,8437604..8437765,
FT                   8437843..8438001,8438255..8438358,8438644..8438740,
FT                   8438828..8439017,8439333..>8439418))
FT                   /codon_start=1
FT                   /gene="0610009O03Rik"
FT                   /locus_tag="mCG_2550"
FT                   /product="RIKEN cDNA 0610009O03, isoform CRA_a"
FT                   /note="gene_id=mCG2550.2 transcript_id=mCT193644.0
FT                   protein_id=mCP114617.0 isoform=CRA_a"
FT                   /protein_id="EDL37461.1"
FT                   /translation="VAAIQGGSLFIHPFVPAWSCGTCAQVPAGVGASTMGWAGDAGCTP
FT                   RPPIRPRPASERRVIIVLFLGLLLDLLAFTLLLPLLPGLLERHGREQDPLYGSWQRGVD
FT                   WFASAIGMPAEKRYNSVLFGGLIGSAFSLLQFFSAPLTGAASDYLGRRPVMMLSLTGLA
FT                   ISYAVWATSRSFKAFLASRVIGGISKGNVNLSTAIVADLGSPPTRSQGMAVIGVAFSLA
FT                   FTLGPMLGAFLSVEMVPWISLLFAISDMLFIFCFLPETLPQEKRASSVTLGFHTAAHLL
FT                   SPLALLRFAAVTHSQDPPAEHRLRNLRRLGLVYFLYLFLFSGLEYTLSFLAHQRFQFSS
FT                   LQQGKMFFFIGLTMATIQGTYARRISPGKEAAAVTRAMLLLVPAFLLIGWAHSLPTLGL
FT                   GLMLYSFAAAVVVPGLSTMVSSYGSPGQKGTIMGILRSLGALGRALGPVVAASVYWLTG
FT                   AQVCFTVCSALFLLPFLLLWKLKHPAETSKEE"
FT   CDS             complement(join(8436133..8436248,8436365..8436454,
FT                   8436527..8436574,8436657..8436747,8436825..8436933,
FT                   8437085..8437196,8437285..8437393,8437604..8437765,
FT                   8437843..8438001,8438255..8438358,8438644..8438740,
FT                   8438828..8439001))
FT                   /codon_start=1
FT                   /gene="0610009O03Rik"
FT                   /locus_tag="mCG_2550"
FT                   /product="RIKEN cDNA 0610009O03, isoform CRA_b"
FT                   /note="gene_id=mCG2550.2 transcript_id=mCT1553.1
FT                   protein_id=mCP3901.2 isoform=CRA_b"
FT                   /protein_id="EDL37462.1"
FT                   /translation="MGWAGDAGCTPRPPIRPRPASERRVIIVLFLGLLLDLLAFTLLLP
FT                   LLPGLLERHGREQDPLYGSWQRGVDWFASAIGMPAEKRYNSVLFGGLIGSAFSLLQFFS
FT                   APLTGAASDYLGRRPVMMLSLTGLAISYAVWATSRSFKAFLASRVIGGISKGNVNLSTA
FT                   IVADLGSPPTRSQGMAVIGVAFSLAFTLGPMLGAFLSVEMVPWISLLFAISDMLFIFCF
FT                   LPETLPQEKRASSVTLGFHTAAHLLSPLALLRFAAVTHSQDPPAEHRLRNLRRLGLVYF
FT                   LYLFLFSGLEYTLSFLAHQRFQFSSLQQGKMFFFIGLTMATIQGTYARRISPGKEAAAV
FT                   TRAMLLLVPAFLLIGWAHSLPTLGLGLMLYSFAAAVVVPGLSTMVSSYGSPGQKGTIMG
FT                   ILRSLGALGRALGPVVAASVYWLTGAQVCFTVCSALFLLPFLLLWKLKHPAETSKEE"
FT   gene            complement(8440770..8465031)
FT                   /gene="2610033H07Rik"
FT                   /locus_tag="mCG_2543"
FT                   /note="gene_id=mCG2543.1"
FT   mRNA            complement(join(8440770..8440885,8441125..8441280,
FT                   8441419..8441537,8443104..8443251,8446748..8446907,
FT                   8448807..8448960,8449594..8449695,8452046..8452181,
FT                   8453276..8453361,8454227..8454357,8455234..8455528,
FT                   8456658..8456789,8457204..8457326,8458791..8458925,
FT                   8459344..8459477,8461649..8461790,8462783..8462917,
FT                   8464759..8465031))
FT                   /gene="2610033H07Rik"
FT                   /locus_tag="mCG_2543"
FT                   /product="RIKEN cDNA 2610033H07, transcript variant
FT                   mCT1559"
FT                   /note="gene_id=mCG2543.1 transcript_id=mCT1559.2 created on
FT                   25-SEP-2002"
FT   mRNA            complement(join(8440771..8440885,8441125..8441280,
FT                   8441419..8441537,8443104..8443251,8445562..8445721,
FT                   8448807..8448960,8449594..8449695,8452046..8452181,
FT                   8453276..8453361,8454227..8454357,8455234..8455528,
FT                   8456658..8456789,8457204..8457326,8458791..8458925,
FT                   8459344..8459477,8461649..8461790,8462783..8462917,
FT                   8464759..>8464977))
FT                   /gene="2610033H07Rik"
FT                   /locus_tag="mCG_2543"
FT                   /product="RIKEN cDNA 2610033H07, transcript variant
FT                   mCT193626"
FT                   /note="gene_id=mCG2543.1 transcript_id=mCT193626.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(8440771..8440885,8441125..8441280,
FT                   8441419..8441537,8443104..8443251,8443557..8443716,
FT                   8448807..>8448919))
FT                   /gene="2610033H07Rik"
FT                   /locus_tag="mCG_2543"
FT                   /product="RIKEN cDNA 2610033H07, transcript variant
FT                   mCT173699"
FT                   /note="gene_id=mCG2543.1 transcript_id=mCT173699.0 created
FT                   on 25-SEP-2002"
FT   CDS             complement(join(8440786..8440885,8441125..8441280,
FT                   8441419..8441537,8443104..8443251,8445562..8445721,
FT                   8448807..8448960,8449594..8449695,8452046..8452181,
FT                   8453276..8453361,8454227..8454357,8455234..8455528,
FT                   8456658..8456789,8457204..8457326,8458791..8458925,
FT                   8459344..8459477,8461649..8461790,8462783..8462917,
FT                   8464759..>8464977))
FT                   /codon_start=1
FT                   /gene="2610033H07Rik"
FT                   /locus_tag="mCG_2543"
FT                   /product="RIKEN cDNA 2610033H07, isoform CRA_b"
FT                   /note="gene_id=mCG2543.1 transcript_id=mCT193626.0
FT                   protein_id=mCP114597.0 isoform=CRA_b"
FT                   /protein_id="EDL37464.1"
FT                   /translation="PKCGGVNVMGKAKRTGARRQVHKAPAGASGGPAKTNPNPFEVKVN
FT                   RQKFQILGRKTRHDVGLPGVSRARAIRKRTQTLLKEYKERNKSNVFADKRFGEYNSNIS
FT                   PEEKMMKRFALEQQRYHEKKNIYNLNEDEELTHYGQSLADIEKHNDIVDSDSDTEDRGA
FT                   LSAELTASHFGGGVHKNSSQKEGEDGDKPKTRKELIEELIAKSKQEKRERQAQREDALE
FT                   LTEKLDQDWKEIQILMSRKPKKSEDKEKKEKPQPDEYDMMVRELGFEMKAQPSNRMKTE
FT                   EELAKEEQERLKKLEAERLRRMLGKDEHENKKKPKHTSADDLNDGFILDKDDRRLLSYK
FT                   DGKMNIEDVQEEQSKEADGQENDQKEGEDDSEEEDESHEDSEESEDPDSHSDLESNIES
FT                   EEENETPKKEQRQTPGGKLPKDDQKAQKAVAAELPYVFAAPESFEELKFLLSGRSMEEQ
FT                   LLVVERIQKCNHPSLAVGNKAKLEKLFGFLLQYIGDLATDSTPDLKTIDKLVVHLYSLC
FT                   QMFPESASDSIRFVLRDAMHEMEEMIETKGRAAFPGLDVLIYLKITGLLFPTSDFWHPV
FT                   VTPALLCMSQMLTKCPVMSLQDVIKGLFVCCLFLEYVSLSRRFIPELFNFLLGILYIAT
FT                   PNTKSQGSTLVHPFRALGKNSELLVVSDKADVTTWQRGSLPLHWANRLSTLTATEANHT
FT                   RLSCVASCLSLMKHCVLMYQALPSFHAIFRPHQALLSKHLADCSLPQELQELAQSILSA
FT                   MEGQKQHCRPLVCEKSKPVPLKQFTPRLVKVLEFGRKQGSSKEEQERKRLIHKHKREFK
FT                   GAVREIRKDNQFLARMQLSEIMERDAERKRKVKQLFNSLATQEGEWKALKRKKFKK"
FT   CDS             complement(join(8440786..8440885,8441125..8441280,
FT                   8441419..8441537,8443104..8443251,8446748..8446907,
FT                   8448807..8448960,8449594..8449695,8452046..8452181,
FT                   8453276..8453361,8454227..8454357,8455234..8455528,
FT                   8456658..8456789,8457204..8457326,8458791..8458925,
FT                   8459344..8459477,8461649..8461790,8462783..8462917,
FT                   8464759..8464953))
FT                   /codon_start=1
FT                   /gene="2610033H07Rik"
FT                   /locus_tag="mCG_2543"
FT                   /product="RIKEN cDNA 2610033H07, isoform CRA_a"
FT                   /note="gene_id=mCG2543.1 transcript_id=mCT1559.2
FT                   protein_id=mCP3945.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q8R3N1"
FT                   /db_xref="InterPro:IPR007276"
FT                   /db_xref="MGI:MGI:1922666"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8R3N1"
FT                   /protein_id="EDL37463.1"
FT                   /translation="MGKAKRTGARRQVHKAPAGASGGPAKTNPNPFEVKVNRQKFQILG
FT                   RKTRHDVGLPGVSRARAIRKRTQTLLKEYKERNKSNVFADKRFGEYNSNISPEEKMMKR
FT                   FALEQQRYHEKKNIYNLNEDEELTHYGQSLADIEKHNDIVDSDSDTEDRGALSAELTAS
FT                   HFGGGVHKNSSQKEGEDGDKPKTRKELIEELIAKSKQEKRERQAQREDALELTEKLDQD
FT                   WKEIQILMSRKPKKSEDKEKKEKPQPDEYDMMVRELGFEMKAQPSNRMKTEEELAKEEQ
FT                   ERLKKLEAERLRRMLGKDEHENKKKPKHTSADDLNDGFILDKDDRRLLSYKDGKMNIED
FT                   VQEEQSKEADGQENDQKEGEDDSEEEDESHEDSEESEDPDSHSDLESNIESEEENETPK
FT                   KEQRQTPGGKLPKDDQKAQKAVAAELPYVFAAPESFEELKFLLSGRSMEEQLLVVERIQ
FT                   KCNHPSLAVGNKAKLEKLFGFLLQYIGDLATDSTPDLKTIDKLVVHLYSLCQMFPESAS
FT                   DSIRFVLRDAMHEMEEMIETKGRAAFPGLDVLIYLKITGLLFPTSDFWHPVVTPALLCM
FT                   SQMLTKCPVMSLQDVIKGLFVCCLFLEYVSLSRRFIPELFNFLLGILYIATPNTKSQGS
FT                   TLVHPFRALGKNSELLVVSDKADVTTWQRGSLPLHWANRLSTLTATEANHTRLSCVASC
FT                   LSLMKHCVLMYQALPSFHAIFRPHQALLSKHLADCSLPQELQELAQSILSAMEGQKQHC
FT                   RPLVCEKSKPVPLKQFTPRLVKVLEFGRKQGSSKEEQERKRLIHKHKREFKGAVREIRK
FT                   DNQFLARMQLSEIMERDAERKRKVKQLFNSLATQEGEWKALKRKKFKK"
FT   CDS             complement(join(8440786..8440885,8441125..8441280,
FT                   8441419..8441537,8443104..8443251,8443557..8443716,
FT                   8448807..>8448918))
FT                   /codon_start=1
FT                   /gene="2610033H07Rik"
FT                   /locus_tag="mCG_2543"
FT                   /product="RIKEN cDNA 2610033H07, isoform CRA_c"
FT                   /note="gene_id=mCG2543.1 transcript_id=mCT173699.0
FT                   protein_id=mCP96618.0 isoform=CRA_c"
FT                   /protein_id="EDL37465.1"
FT                   /translation="VCCLFLEYVSLSRRFIPELFNFLLGILYIATPNTKSQGSTLVHPF
FT                   RALGKNSELLVVSDKADVTTWQRGSLPLHWANRLSTLTATEANHTRLSCVASCLSLMKH
FT                   CVLMYQALPSFHAIFRPHQALLSKHLADCSLPQELQELAQSILSAMEGQKQHCRPLVCE
FT                   KSKPVPLKQFTPRLVKVLEFGRKQGSSKEEQERKRLIHKHKREFKGAVREIRKDNQFLA
FT                   RMQLSEIMERDAERKRKVKQLFNSLATQEGEWKALKRKKFKK"
FT   assembly_gap    8443973..8443992
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8445536..8445555
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8446643..8446662
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            8465286..8560724
FT                   /gene="Gprk2l"
FT                   /locus_tag="mCG_2548"
FT                   /note="gene_id=mCG2548.2"
FT   mRNA            join(8465286..8465912,8474018..8474110,8479438..8479550,
FT                   8481014..8481088,8499773..8499879,8515160..8515252,
FT                   8516725..8516788,8521216..8521356,8524728..8524918,
FT                   8535030..8535067,8536506..8536595,8550137..8550345,
FT                   8553153..8553290,8556529..8556666,8557110..8557241,
FT                   8560565..8560724)
FT                   /gene="Gprk2l"
FT                   /locus_tag="mCG_2548"
FT                   /product="G protein-coupled receptor kinase 2, groucho gene
FT                   related (Drosophila)"
FT                   /note="gene_id=mCG2548.2 transcript_id=mCT1552.1 created on
FT                   18-SEP-2002"
FT   CDS             join(8465861..8465912,8474018..8474110,8479438..8479550,
FT                   8481014..8481088,8499773..8499879,8515160..8515252,
FT                   8516725..8516788,8521216..8521356,8524728..8524918,
FT                   8535030..8535067,8536506..8536595,8550137..8550345,
FT                   8553153..8553290,8556529..8556666,8557110..8557241,
FT                   8560565..8560615)
FT                   /codon_start=1
FT                   /gene="Gprk2l"
FT                   /locus_tag="mCG_2548"
FT                   /product="G protein-coupled receptor kinase 2, groucho gene
FT                   related (Drosophila)"
FT                   /note="gene_id=mCG2548.2 transcript_id=mCT1552.1
FT                   protein_id=mCP4016.0"
FT                   /db_xref="GOA:O70291"
FT                   /db_xref="InterPro:IPR000239"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000961"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR016137"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="MGI:MGI:95801"
FT                   /db_xref="UniProtKB/Swiss-Prot:O70291"
FT                   /protein_id="EDL37466.1"
FT                   /translation="MELENFVANNLLLKARLGFNKQTGRSKKWRELLKFPPVSMCTELR
FT                   WSIEKDFSSLCDKQPIGRLLFRQFCDTKPDLKRCIEFLDAVAEYEVTIEEEQREFGLAI
FT                   FSRFFKEKSEVPLPEIPPDIVKECKWNLKQNSPSQNVFEECAGIVCKYLSETPFEEYQE
FT                   STYFNRFLQWKWLERRPVTKNTFRQYRVLGKGGFGEVCACQVRATGKMYACKKLEKKRI
FT                   KKRKGEAMALNEKRILEKLHSRFVVSLAYTYETKDALCLVLTIMNGGDLKYHIYNLGDP
FT                   GFEEPRAVFYAAELCCGLEDLQRKRIVYRDLKPENILLDDHGHIRISDLGLAMEVPEGE
FT                   MVRGRVGTVGYMAPEIINHEKYTFSPDWWGLGCLIYEMIAGHSPFRKYKEKVNREELER
FT                   RVKNETEEYSERFSEDAKSICSMLLIKDPSKRLGCQRDGVSAVKQHPIFKDINFSRLEA
FT                   NMLDPPFIPDPQAIYCRNILDIGQFSVVKGVNLDTNDEIFYAEFATGSVTIPWQNEMIE
FT                   SGCFKDLNENEDDLSSLEKYKMCSSILRPKRNFFRRLFRRTGCLNIALSEEREPTEH"
FT   assembly_gap    8483722..8484017
FT                   /estimated_length=296
FT                   /gap_type="unknown"
FT   assembly_gap    8497186..8497205
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8543200..8543571
FT                   /estimated_length=372
FT                   /gap_type="unknown"
FT   assembly_gap    8557849..8557868
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            8567165..8718141
FT                   /gene="Hdh"
FT                   /locus_tag="mCG_2547"
FT                   /note="gene_id=mCG2547.2"
FT   mRNA            join(8567165..8567530,8588164..8588247,8595669..8595789,
FT                   8599507..8599566,8601293..8601372,8604778..8604916,
FT                   8608979..8609120,8609763..8609941,8611834..8612038,
FT                   8613130..8613177,8616696..8616776,8618113..8618453,
FT                   8622404..8622530,8622959..8623077,8623860..8623971,
FT                   8624158..8624295,8625212..8625370,8625463..8625560,
FT                   8626973..8627112,8629123..8629186,8629620..8629720,
FT                   8630077..8630223,8631209..8631329,8632517..8632593,
FT                   8633734..8633885,8634932..8635134,8637822..8637948,
FT                   8639516..8639643,8648047..8648157,8651246..8651323,
FT                   8652710..8652933,8653987..8654065,8654193..8654354,
FT                   8656462..8656517,8657326..8657474,8658003..8658139,
FT                   8659918..8660034,8669397..8669519,8669797..8670029,
FT                   8671726..8671868,8675861..8676068,8681057..8681198,
FT                   8681881..8682060,8682176..8682352,8682579..8682655,
FT                   8683954..8684092,8684955..8685077,8688001..8688214,
FT                   8689123..8689268,8690503..8690680,8691656..8691751,
FT                   8694481..8694668,8696502..8696628,8699496..8699596,
FT                   8700490..8700644,8701035..8701174,8702039..8702121,
FT                   8703680..8703810,8703948..8704077,8704923..8705078,
FT                   8708360..8708550,8710474..8710588,8710691..8710904,
FT                   8711259..8711364,8712244..8712406,8712593..8712753,
FT                   8713792..8718141)
FT                   /gene="Hdh"
FT                   /locus_tag="mCG_2547"
FT                   /product="Huntington disease gene homolog, transcript
FT                   variant mCT1562"
FT                   /note="gene_id=mCG2547.2 transcript_id=mCT1562.2 created on
FT                   03-OCT-2002"
FT   mRNA            join(<8567211..8567530,8588164..8588247,8595669..8595789,
FT                   8599507..8599566,8601293..8601372,8604778..8604916,
FT                   8608979..8609120,8609763..8609941,8611834..8612038,
FT                   8613130..8613177,8616696..8616776,8618113..8618453,
FT                   8622404..8622530,8622959..8623077,8623860..8623971,
FT                   8624158..8624295,8625212..8625370,8625463..8625560,
FT                   8626973..8627112,8629123..8629186,8629620..8629720,
FT                   8630077..8630223,8631209..8631329,8632517..8632593,
FT                   8633734..8633885,8634932..8635134,8637822..8637948,
FT                   8639516..8639643,8648047..8648157,8651246..8651323,
FT                   8652710..8652933,8653987..8654065,8654193..8654354,
FT                   8656462..8656517,8657326..8657495,8682579..8682655,
FT                   8683954..8684092,8684955..8685077,8688001..8688214,
FT                   8689123..8689268,8690503..8690680,8691656..8691751,
FT                   8694481..8694668,8696502..8696628,8699496..8699596,
FT                   8700490..8700644,8701035..8701174,8702039..8702121,
FT                   8703680..8703810,8703948..8704077,8704923..8705078,
FT                   8708360..8708550,8710474..8710588,8710691..8710904,
FT                   8711259..8711364,8712244..8712406,8712593..8712753,
FT                   8713792..8714203,8714239..8714556)
FT                   /gene="Hdh"
FT                   /locus_tag="mCG_2547"
FT                   /product="Huntington disease gene homolog, transcript
FT                   variant mCT193629"
FT                   /note="gene_id=mCG2547.2 transcript_id=mCT193629.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(<8567211..8567530,8588164..8588247,8595669..8595789,
FT                   8599507..8599566,8601293..8601372,8604778..8604916,
FT                   8608979..8609120,8609763..8609941,8611834..8612038,
FT                   8613130..8613177,8616696..8616776,8618113..8618453,
FT                   8622404..8622530,8622959..8623077,8623860..8623971,
FT                   8624158..8624295,8625212..8625370,8625463..8625560,
FT                   8626973..8627112,8629123..8629186,8629620..8629720,
FT                   8630077..8630223,8631209..8631329,8632517..8632593,
FT                   8633734..8633885,8634932..8635134,8637822..8637948,
FT                   8639516..8639643,8648047..8648157,8651246..8651323,
FT                   8652710..8652933,8653987..8654065,8654193..8654354,
FT                   8656462..8656517,8657326..8657474,8658003..8658139,
FT                   8659918..8660034,8669397..8669519,8669797..8670029,
FT                   8671726..8671868,8675861..8676068,8681057..8681198,
FT                   8681881..8682060,8682176..8682352,8682579..8682655,
FT                   8683954..8684092,8684955..8685077,8688001..8688214,
FT                   8689123..8689268,8690503..8690680,8691656..8691751,
FT                   8694481..8694668,8696502..8696628,8699496..8699596,
FT                   8700490..8700644,8701035..8701174,8702039..8702121,
FT                   8703680..8703810,8703948..8704077,8704923..8705078,
FT                   8708360..8708550,8710474..8710588,8710691..8710904,
FT                   8711259..8711364,8712244..8712406,8712593..8712753,
FT                   8713792..8714203,8714239..8714556)
FT                   /gene="Hdh"
FT                   /locus_tag="mCG_2547"
FT                   /product="Huntington disease gene homolog, transcript
FT                   variant mCT193628"
FT                   /note="gene_id=mCG2547.2 transcript_id=mCT193628.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<8567262..8567530,8588164..8588247,8595669..8595789,
FT                   8599507..8599566,8601293..8601372,8604778..8604916,
FT                   8608979..8609120,8609763..8609941,8611834..8612038,
FT                   8613130..8613177,8616696..8616776,8618113..8618453,
FT                   8622404..8622530,8622959..8623077,8623860..8623971,
FT                   8624158..8624295,8625212..8625370,8625463..8625560,
FT                   8626973..8627112,8629123..8629186,8629620..8629720,
FT                   8630077..8630223,8631209..8631329,8632517..8632593,
FT                   8633734..8633885,8634932..8635134,8637822..8637948,
FT                   8639516..8639643,8648047..8648157,8651246..8651323,
FT                   8652710..8652933,8653987..8654065,8654193..8654354,
FT                   8656462..8656517,8657326..8657474,8658003..8658139,
FT                   8659918..8660034,8669397..8669519,8669797..8670029,
FT                   8671726..8671868,8675861..8676068,8681057..8681198,
FT                   8681881..8682060,8682176..8682352,8682579..8682655,
FT                   8683954..8684092,8684955..8685077,8688001..8688214,
FT                   8689123..8689268,8690503..8690680,8691656..8691751,
FT                   8694481..8694668,8696502..8696628,8699496..8699596,
FT                   8700490..8700644,8701035..8701174,8702039..8702121,
FT                   8703680..8703810,8703948..8704077,8704923..8705078,
FT                   8708360..8708550,8710474..8710588,8710691..8710904,
FT                   8711259..8711364,8712244..8712406,8712593..8712753,
FT                   8713792..8714005)
FT                   /codon_start=1
FT                   /gene="Hdh"
FT                   /locus_tag="mCG_2547"
FT                   /product="Huntington disease gene homolog, isoform CRA_b"
FT                   /note="gene_id=mCG2547.2 transcript_id=mCT193628.0
FT                   protein_id=mCP114598.0 isoform=CRA_b"
FT                   /protein_id="EDL37468.1"
FT                   /translation="VAPRSASRLQVFRVCPIGQEAVMATLEKLMKAFESLKSFQQQQQQ
FT                   QPPPQAPPPPPPPPPPQPPQPPPQGQPPPPPPPLPGPAEEPLHRPKKELSATKKDRVNH
FT                   CLTICENIVAQSLRNSPEFQKLLGIAMELFLLCSDDAESDVRMVADECLNKVIKALMDS
FT                   NLPRLQLELYKEIKKNGAPRSLRAALWRFAELAHLVRPQKCRPYLVNLLPCLTRTSKRP
FT                   EESVQETLAAAVPKIMASFGNFANDNEIKVLLKAFIANLKSSSPTVRRTAAGSAVSICQ
FT                   HSRRTQYFYNWLLNVLLGLLVPMEEEHSTLLILGVLLTLRCLVPLLQQQVKDTSLKGSF
FT                   GVTRKEMEVSPSTEQLVQVYELTLHHTQHQDHNVVTGALELLQQLFRTPPPELLQALTT
FT                   PGGLGQLTLVQEEARGRGRSGSIVELLAGGGSSCSPVLSRKQKGKVLLGEEEALEDDSE
FT                   SRSDVSSSAFAASVKSEIGGELAASSGVSTPGSVGHDIITEQPRSQHTLQADSVDLSGC
FT                   DLTSAATDGDEEDILSHSSSQFSAVPSDPAMDLNDGTQASSPISDSSQTTTEGPDSAVT
FT                   PSDSSEIVLDGADSQYLGMQIGQPQEDDEEGAAGVLSGEVSDVFRNSSLALQQAHLLER
FT                   MGHSRQPSDSSIDKYVTRDEVAEASDPESKPCRIKGDIGQPNDDDSAPLVHCVRLLSAS
FT                   FLLTGEKKALVPDRDVRVSVKALALSCIGAAVALHPESFFSRLYKVPLNTTESTEEQYV
FT                   SDILNYIDHGDPQVRGATAILCGTLVYSILSRSRLRVGDWLGNIRTLTGNTFSLVDCIP
FT                   LLQKTLKDESSVTCKLACTAVRHCVLSLCSSSYSDLGLQLLIDMLPLKNSSYWLVRTEL
FT                   LDTLAEIDFRLVSFLEAKAESLHRGAHHYTGFLKLQERVLNNVVIYLLGDEDPRVRHVA
FT                   ATSLTRLVPKLFYKCDQGQADPVVAVARDQSSVYLKLLMHETQPPSHFSVSTITRIYRG
FT                   YSLLPSITDVTMENNLSRVVAAVSHELITSTTRALTFGCCEALCLLSAAFPVCTWSLGW
FT                   HCGVPPLSASDESRKSCTVGMASMILTLLSSAWFPLDLSAHQDALILAGNLLAASAPKS
FT                   LRSSWTSEEEANSAATRQEEIWPALGDRTLVPLVEQLFSHLLKVINICAHVLDDVTPGP
FT                   AIKAALPSLTNPPSLSPIRRKGKEKEPGEQASTPMSPKKVGEASAASRQSDTSGPVTAS
FT                   KSSSLGSFYHLPSYLKLHDVLKATHANYKVTLDLQNSTEKFGGFLRSALDVLSQILELA
FT                   TLQDIGKCVEEVLGYLKSCFSREPMMATVCVQQLLKTLFGTNLASQFDGLSSNPSKSQC
FT                   RAQRLGSSSVRPGLYHYCFMAPYTHFTQALADASLRNMVQAEQERDASGWFDVLQKVSA
FT                   QLKTNLTSVTKNRADKNAIHNHIRLFEPLVIKALKQYTTTTSVQLQKQVLDLLAQLVQL
FT                   RVNYCLLDSDQVFIGFVLKQFEYIEVGQFRESEAIIPNIFFFLVLLSYERYHSKQIIGI
FT                   PKIIQLCDGIMASGRKAVTHAIPALQPIVHDLFVLRGTNKADAGKELETQKEVVVSMLL
FT                   RLIQYHQVLEMFILVLQQCHKENEDKWKRLSRQVADIILPMLAKQQMHIDSHEALGVLN
FT                   TLFEILAPSSLRPVDMLLRSMFITPSTMASVSTVQLWISGILAILRVLISQSTEDIVLC
FT                   RIQELSFSPHLLSCPVINRLRGGGGNVTLGECSEGKQKSLPEDTFSRFLLQLVGILLED
FT                   IVTKQLKVDMSEQQHTFYCQELGTLLMCLIHIFKSGMFRRITAAATRLFTSDGCEGSFY
FT                   TLESLNARVRSMVPTHPALVLLWCQILLLINHTDHRWWAEVQQTPKRHSLSCTKSLNPQ
FT                   KSGEEEDSGSAAQLGMCNREIVRRGALILFCDYVCQNLHDSEHLTWLIVNHIQDLISLS
FT                   HEPPVQDFISAIHRNSAASGLFIQAIQSRCENLSTPTTLKKTLQCLEGIHLSQSGAVLT
FT                   LYVDRLLGTPFRALARMVDTLACRRVEMLLAANLQSSMAQLPEEELNRIQEHLQNSGLA
FT                   QRHQRLYSLLDRFRLSTVQDSLSPLPPVTSHPLDGDGHTSLETVSPDKDWYLQLVRSQC
FT                   WTRSDSALLEGAELVNRIPAEDMNDFMMSSEFNLSLLAPCLSLGMSEIANGQKSPLFEA
FT                   ARGVILNRVTSVVQQLPAVHQVFQPFLPIEPTAYWNKLNDLLGDTTSYQSLTILARALA
FT                   QYLVVLSKVPAHLHLPPEKEGDTVKFVVMTVEALSWHLIHEQIPLSLDLQAGLDCCCLA
FT                   LQVPGLWGVLSSPEYVTHACSLIHCVRFILEAIAVQPGDQLLGPESRSHTPRAVRKEEV
FT                   DSDIQNLSHVTSACEMVADMVESLQSVLALGHKRNSTLPSFLTAVLKNIVISLARLPLV
FT                   NSYTRVPPLVWKLGWSPKPGGDFGTVFPEIPVEFLQEKEILKEFIYRINTLGWTNRTQF
FT                   EETWATLLGVLVTQPLVMEQEESPPEEDTERTQIHVLAVQAITSLVLSAMTVPVAGNPA
FT                   VSCLEQQPRNKPLKALDTRFGRKLSMIRGIVEQEIQEMVSQRENTATHHSHQAWDPVPS
FT                   LLPATTGALISHDKLLLQINPEREPGNMSYKLGQVSIHSVWLGNNITPLREEEWDEEEE
FT                   EESDVPAPTSPPVSPVNSRKHRAGVDIHSCSQFLLELYSRWILPSSAARRTPVILISEV
FT                   VRSLLVVSDLFTERTQFEMMYLTLTELRRVHPSEDEILIQYLVPATCKAAAVLGMDKTV
FT                   AEPVSRLLESTLRSSHLPSQIGALHGILYVLECDLLDDTAKQLIPVVSDYLLSNLKGIA
FT                   HCVNIHSQQHVLVMCATAFYLMENYPLDVGPEFSASVIQMCGVMLSGSEESTPSIIYHC
FT                   ALRGLERLLLSEQLSRLDTESLVKLSVDRVNVQSPHRAMAALGLMLTCMYTGKEKASPG
FT                   RASDPSPATPDSESVIVAMERVSVLFDRIRKGFPCEARVVARILPQFLDDFFPPQDVMN
FT                   KVIGEFLSNQQPYPQFMATVVYKVFQTLHSAGQSSMVRDWVMLSLSNFTQRTPVAMAMW
FT                   SLSCFLVSASTSPWVSAILPHVISRMGKLEQVDVNLFCLVATDFYRHQIEEEFDRRAFQ
FT                   SVFEVVAAPGSPYHRLLACLQNVHKVTTC"
FT   CDS             join(<8567262..8567530,8588164..8588247,8595669..8595789,
FT                   8599507..8599566,8601293..8601372,8604778..8604916,
FT                   8608979..8609120,8609763..8609941,8611834..8612038,
FT                   8613130..8613177,8616696..8616776,8618113..8618453,
FT                   8622404..8622530,8622959..8623077,8623860..8623971,
FT                   8624158..8624295,8625212..8625370,8625463..8625560,
FT                   8626973..8627112,8629123..8629186,8629620..8629720,
FT                   8630077..8630223,8631209..8631329,8632517..8632593,
FT                   8633734..8633885,8634932..8635134,8637822..8637948,
FT                   8639516..8639643,8648047..8648157,8651246..8651323,
FT                   8652710..8652933,8653987..8654065,8654193..8654354,
FT                   8656462..8656517,8657326..8657495,8682579..8682580)
FT                   /codon_start=1
FT                   /gene="Hdh"
FT                   /locus_tag="mCG_2547"
FT                   /product="Huntington disease gene homolog, isoform CRA_c"
FT                   /note="gene_id=mCG2547.2 transcript_id=mCT193629.0
FT                   protein_id=mCP114599.0 isoform=CRA_c"
FT                   /protein_id="EDL37469.1"
FT                   /translation="VAPRSASRLQVFRVCPIGQEAVMATLEKLMKAFESLKSFQQQQQQ
FT                   QPPPQAPPPPPPPPPPQPPQPPPQGQPPPPPPPLPGPAEEPLHRPKKELSATKKDRVNH
FT                   CLTICENIVAQSLRNSPEFQKLLGIAMELFLLCSDDAESDVRMVADECLNKVIKALMDS
FT                   NLPRLQLELYKEIKKNGAPRSLRAALWRFAELAHLVRPQKCRPYLVNLLPCLTRTSKRP
FT                   EESVQETLAAAVPKIMASFGNFANDNEIKVLLKAFIANLKSSSPTVRRTAAGSAVSICQ
FT                   HSRRTQYFYNWLLNVLLGLLVPMEEEHSTLLILGVLLTLRCLVPLLQQQVKDTSLKGSF
FT                   GVTRKEMEVSPSTEQLVQVYELTLHHTQHQDHNVVTGALELLQQLFRTPPPELLQALTT
FT                   PGGLGQLTLVQEEARGRGRSGSIVELLAGGGSSCSPVLSRKQKGKVLLGEEEALEDDSE
FT                   SRSDVSSSAFAASVKSEIGGELAASSGVSTPGSVGHDIITEQPRSQHTLQADSVDLSGC
FT                   DLTSAATDGDEEDILSHSSSQFSAVPSDPAMDLNDGTQASSPISDSSQTTTEGPDSAVT
FT                   PSDSSEIVLDGADSQYLGMQIGQPQEDDEEGAAGVLSGEVSDVFRNSSLALQQAHLLER
FT                   MGHSRQPSDSSIDKYVTRDEVAEASDPESKPCRIKGDIGQPNDDDSAPLVHCVRLLSAS
FT                   FLLTGEKKALVPDRDVRVSVKALALSCIGAAVALHPESFFSRLYKVPLNTTESTEEQYV
FT                   SDILNYIDHGDPQVRGATAILCGTLVYSILSRSRLRVGDWLGNIRTLTGNTFSLVDCIP
FT                   LLQKTLKDESSVTCKLACTAVRHCVLSLCSSSYSDLGLQLLIDMLPLKNSSYWLVRTEL
FT                   LDTLAEIDFRLVSFLEAKAESLHRGAHHYTGFLKLQERVLNNVVIYLLGDEDPRVRHVA
FT                   ATSLTRLVPKLFYKCDQGQADPVVAVARDQSSVYLKLLMHETQPPSHFSVSTITRIYRG
FT                   YSLLPSITDVTMENNLSRVVAAVSHELITSTTRALTFGCCEALCLLSAAFPVCTWSLGW
FT                   HCGVPPLSASDESRKSCTVGMASMILTLLSSAWFPLDLSAHQDALILAGNLLAASAPKS
FT                   LRSSWTSEEEANSAATRQEEIWPALGDRTLVPLVEQLFSHLLKVINICAHVLDDVTPGP
FT                   AIKAALPSLTNPPSLSPIRRKGKEKEPGEQASTPMSPKKVGEASAASRQSDTSGPVTAS
FT                   KSSSLGSFYHLPSYLKLHDVLKATHANYKVTLDLQNSTEKFGGFLRSALDVLSQILELA
FT                   TLQDIGKCVEEVLGYLKSCFSREPMMATVCVQQLLKTLFGTNLASQFDGLSSNPSKSQC
FT                   RAQRLGSSSVRPGLYHYCFMAPYTHFTQALADASLRNMVQAEQERDASGWFDVLQKVSA
FT                   QLKTNLTSVTKNRADKNAIHNHIRLFEPLVIKALKQYTTTTSVQLQKQVLDLLAQLVQL
FT                   RVNYCLLDSDQVFIGFVLKQFEYIEVGQFRESEAIIPNIFFFLVLLSYERYHSKQIIGI
FT                   PKIIQLCDGIMASGRKAVTHGNVCISA"
FT   CDS             join(8567328..8567530,8588164..8588247,8595669..8595789,
FT                   8599507..8599566,8601293..8601372,8604778..8604916,
FT                   8608979..8609120,8609763..8609941,8611834..8612038,
FT                   8613130..8613177,8616696..8616776,8618113..8618453,
FT                   8622404..8622530,8622959..8623077,8623860..8623971,
FT                   8624158..8624295,8625212..8625370,8625463..8625560,
FT                   8626973..8627112,8629123..8629186,8629620..8629720,
FT                   8630077..8630223,8631209..8631329,8632517..8632593,
FT                   8633734..8633885,8634932..8635134,8637822..8637948,
FT                   8639516..8639643,8648047..8648157,8651246..8651323,
FT                   8652710..8652933,8653987..8654065,8654193..8654354,
FT                   8656462..8656517,8657326..8657474,8658003..8658139,
FT                   8659918..8660034,8669397..8669519,8669797..8670029,
FT                   8671726..8671868,8675861..8676068,8681057..8681198,
FT                   8681881..8682060,8682176..8682352,8682579..8682655,
FT                   8683954..8684092,8684955..8685077,8688001..8688214,
FT                   8689123..8689268,8690503..8690680,8691656..8691751,
FT                   8694481..8694668,8696502..8696628,8699496..8699596,
FT                   8700490..8700644,8701035..8701174,8702039..8702121,
FT                   8703680..8703810,8703948..8704077,8704923..8705078,
FT                   8708360..8708550,8710474..8710588,8710691..8710904,
FT                   8711259..8711364,8712244..8712406,8712593..8712753,
FT                   8713792..8714005)
FT                   /codon_start=1
FT                   /gene="Hdh"
FT                   /locus_tag="mCG_2547"
FT                   /product="Huntington disease gene homolog, isoform CRA_a"
FT                   /note="gene_id=mCG2547.2 transcript_id=mCT1562.2
FT                   protein_id=mCP4004.2 isoform=CRA_a partial"
FT                   /db_xref="GOA:G3X9H5"
FT                   /db_xref="InterPro:IPR000091"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR024613"
FT                   /db_xref="InterPro:IPR028426"
FT                   /db_xref="MGI:MGI:96067"
FT                   /db_xref="UniProtKB/TrEMBL:G3X9H5"
FT                   /protein_id="EDL37467.1"
FT                   /translation="MATLEKLMKAFESLKSFQQQQQQQPPPQAPPPPPPPPPPQPPQPP
FT                   PQGQPPPPPPPLPGPAEEPLHRPKKELSATKKDRVNHCLTICENIVAQSLRNSPEFQKL
FT                   LGIAMELFLLCSDDAESDVRMVADECLNKVIKALMDSNLPRLQLELYKEIKKNGAPRSL
FT                   RAALWRFAELAHLVRPQKCRPYLVNLLPCLTRTSKRPEESVQETLAAAVPKIMASFGNF
FT                   ANDNEIKVLLKAFIANLKSSSPTVRRTAAGSAVSICQHSRRTQYFYNWLLNVLLGLLVP
FT                   MEEEHSTLLILGVLLTLRCLVPLLQQQVKDTSLKGSFGVTRKEMEVSPSTEQLVQVYEL
FT                   TLHHTQHQDHNVVTGALELLQQLFRTPPPELLQALTTPGGLGQLTLVQEEARGRGRSGS
FT                   IVELLAGGGSSCSPVLSRKQKGKVLLGEEEALEDDSESRSDVSSSAFAASVKSEIGGEL
FT                   AASSGVSTPGSVGHDIITEQPRSQHTLQADSVDLSGCDLTSAATDGDEEDILSHSSSQF
FT                   SAVPSDPAMDLNDGTQASSPISDSSQTTTEGPDSAVTPSDSSEIVLDGADSQYLGMQIG
FT                   QPQEDDEEGAAGVLSGEVSDVFRNSSLALQQAHLLERMGHSRQPSDSSIDKYVTRDEVA
FT                   EASDPESKPCRIKGDIGQPNDDDSAPLVHCVRLLSASFLLTGEKKALVPDRDVRVSVKA
FT                   LALSCIGAAVALHPESFFSRLYKVPLNTTESTEEQYVSDILNYIDHGDPQVRGATAILC
FT                   GTLVYSILSRSRLRVGDWLGNIRTLTGNTFSLVDCIPLLQKTLKDESSVTCKLACTAVR
FT                   HCVLSLCSSSYSDLGLQLLIDMLPLKNSSYWLVRTELLDTLAEIDFRLVSFLEAKAESL
FT                   HRGAHHYTGFLKLQERVLNNVVIYLLGDEDPRVRHVAATSLTRLVPKLFYKCDQGQADP
FT                   VVAVARDQSSVYLKLLMHETQPPSHFSVSTITRIYRGYSLLPSITDVTMENNLSRVVAA
FT                   VSHELITSTTRALTFGCCEALCLLSAAFPVCTWSLGWHCGVPPLSASDESRKSCTVGMA
FT                   SMILTLLSSAWFPLDLSAHQDALILAGNLLAASAPKSLRSSWTSEEEANSAATRQEEIW
FT                   PALGDRTLVPLVEQLFSHLLKVINICAHVLDDVTPGPAIKAALPSLTNPPSLSPIRRKG
FT                   KEKEPGEQASTPMSPKKVGEASAASRQSDTSGPVTASKSSSLGSFYHLPSYLKLHDVLK
FT                   ATHANYKVTLDLQNSTEKFGGFLRSALDVLSQILELATLQDIGKCVEEVLGYLKSCFSR
FT                   EPMMATVCVQQLLKTLFGTNLASQFDGLSSNPSKSQCRAQRLGSSSVRPGLYHYCFMAP
FT                   YTHFTQALADASLRNMVQAEQERDASGWFDVLQKVSAQLKTNLTSVTKNRADKNAIHNH
FT                   IRLFEPLVIKALKQYTTTTSVQLQKQVLDLLAQLVQLRVNYCLLDSDQVFIGFVLKQFE
FT                   YIEVGQFRESEAIIPNIFFFLVLLSYERYHSKQIIGIPKIIQLCDGIMASGRKAVTHAI
FT                   PALQPIVHDLFVLRGTNKADAGKELETQKEVVVSMLLRLIQYHQVLEMFILVLQQCHKE
FT                   NEDKWKRLSRQVADIILPMLAKQQMHIDSHEALGVLNTLFEILAPSSLRPVDMLLRSMF
FT                   ITPSTMASVSTVQLWISGILAILRVLISQSTEDIVLCRIQELSFSPHLLSCPVINRLRG
FT                   GGGNVTLGECSEGKQKSLPEDTFSRFLLQLVGILLEDIVTKQLKVDMSEQQHTFYCQEL
FT                   GTLLMCLIHIFKSGMFRRITAAATRLFTSDGCEGSFYTLESLNARVRSMVPTHPALVLL
FT                   WCQILLLINHTDHRWWAEVQQTPKRHSLSCTKSLNPQKSGEEEDSGSAAQLGMCNREIV
FT                   RRGALILFCDYVCQNLHDSEHLTWLIVNHIQDLISLSHEPPVQDFISAIHRNSAASGLF
FT                   IQAIQSRCENLSTPTTLKKTLQCLEGIHLSQSGAVLTLYVDRLLGTPFRALARMVDTLA
FT                   CRRVEMLLAANLQSSMAQLPEEELNRIQEHLQNSGLAQRHQRLYSLLDRFRLSTVQDSL
FT                   SPLPPVTSHPLDGDGHTSLETVSPDKDWYLQLVRSQCWTRSDSALLEGAELVNRIPAED
FT                   MNDFMMSSEFNLSLLAPCLSLGMSEIANGQKSPLFEAARGVILNRVTSVVQQLPAVHQV
FT                   FQPFLPIEPTAYWNKLNDLLGDTTSYQSLTILARALAQYLVVLSKVPAHLHLPPEKEGD
FT                   TVKFVVMTVEALSWHLIHEQIPLSLDLQAGLDCCCLALQVPGLWGVLSSPEYVTHACSL
FT                   IHCVRFILEAIAVQPGDQLLGPESRSHTPRAVRKEEVDSDIQNLSHVTSACEMVADMVE
FT                   SLQSVLALGHKRNSTLPSFLTAVLKNIVISLARLPLVNSYTRVPPLVWKLGWSPKPGGD
FT                   FGTVFPEIPVEFLQEKEILKEFIYRINTLGWTNRTQFEETWATLLGVLVTQPLVMEQEE
FT                   SPPEEDTERTQIHVLAVQAITSLVLSAMTVPVAGNPAVSCLEQQPRNKPLKALDTRFGR
FT                   KLSMIRGIVEQEIQEMVSQRENTATHHSHQAWDPVPSLLPATTGALISHDKLLLQINPE
FT                   REPGNMSYKLGQVSIHSVWLGNNITPLREEEWDEEEEEESDVPAPTSPPVSPVNSRKHR
FT                   AGVDIHSCSQFLLELYSRWILPSSAARRTPVILISEVVRSLLVVSDLFTERTQFEMMYL
FT                   TLTELRRVHPSEDEILIQYLVPATCKAAAVLGMDKTVAEPVSRLLESTLRSSHLPSQIG
FT                   ALHGILYVLECDLLDDTAKQLIPVVSDYLLSNLKGIAHCVNIHSQQHVLVMCATAFYLM
FT                   ENYPLDVGPEFSASVIQMCGVMLSGSEESTPSIIYHCALRGLERLLLSEQLSRLDTESL
FT                   VKLSVDRVNVQSPHRAMAALGLMLTCMYTGKEKASPGRASDPSPATPDSESVIVAMERV
FT                   SVLFDRIRKGFPCEARVVARILPQFLDDFFPPQDVMNKVIGEFLSNQQPYPQFMATVVY
FT                   KVFQTLHSAGQSSMVRDWVMLSLSNFTQRTPVAMAMWSLSCFLVSASTSPWVSAILPHV
FT                   ISRMGKLEQVDVNLFCLVATDFYRHQIEEEFDRRAFQSVFEVVAAPGSPYHRLLACLQN
FT                   VHKVTTC"
FT   assembly_gap    8606747..8606766
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8655859..8655878
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8669164..8669183
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8717085..8717104
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            8722738..8729035
FT                   /gene="A930005I04Rik"
FT                   /locus_tag="mCG_2553"
FT                   /note="gene_id=mCG2553.1"
FT   mRNA            join(8722738..8723111,8726601..8726876,8728521..8729035)
FT                   /gene="A930005I04Rik"
FT                   /locus_tag="mCG_2553"
FT                   /product="RIKEN cDNA A930005I04, transcript variant
FT                   mCT1551"
FT                   /note="gene_id=mCG2553.1 transcript_id=mCT1551.1 created on
FT                   18-FEB-2003"
FT   mRNA            join(8722739..8723111,8728521..8728837)
FT                   /gene="A930005I04Rik"
FT                   /locus_tag="mCG_2553"
FT                   /product="RIKEN cDNA A930005I04, transcript variant
FT                   mCT180190"
FT                   /note="gene_id=mCG2553.1 transcript_id=mCT180190.0 created
FT                   on 18-FEB-2003"
FT   CDS             join(8722792..8723111,8726601..8726876,8728521..8728761)
FT                   /codon_start=1
FT                   /gene="A930005I04Rik"
FT                   /locus_tag="mCG_2553"
FT                   /product="RIKEN cDNA A930005I04, isoform CRA_b"
FT                   /note="gene_id=mCG2553.1 transcript_id=mCT1551.1
FT                   protein_id=mCP4021.1 isoform=CRA_b"
FT                   /protein_id="EDL37471.1"
FT                   /translation="MVRWPGLRPCLSAILNPAGASNMAAAEVPGYLVSPQTEKHRRARN
FT                   WTDAEMRGLMLVWEEFFDELKQTKRNAKVYEKMASKLFEMTGERRLGEEIKIKITNMTF
FT                   QYRKLKCMTDSESIPPDWPYYLAIDRILAKVPESCEGKLPDGQQPGPSTSQTEASLSPS
FT                   AKSTPLYLPYTQCSYEGHFEDDRSDSSSSLLSLKFRSEERPVKKRKMRSCHLQKKKLRL
FT                   LEAMLEEQRRLSRAMEETCREVRRVLDQQNILQVQSLQLQERMMSLLEKIIAKSNV"
FT   CDS             join(8722792..8723111,8728521..8728761)
FT                   /codon_start=1
FT                   /gene="A930005I04Rik"
FT                   /locus_tag="mCG_2553"
FT                   /product="RIKEN cDNA A930005I04, isoform CRA_a"
FT                   /note="gene_id=mCG2553.1 transcript_id=mCT180190.0
FT                   protein_id=mCP103112.0 isoform=CRA_a"
FT                   /db_xref="InterPro:IPR026095"
FT                   /db_xref="MGI:MGI:2684990"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0J9YU52"
FT                   /protein_id="EDL37470.1"
FT                   /translation="MVRWPGLRPCLSAILNPAGASNMAAAEVPGYLVSPQTEKHRRARN
FT                   WTDAEMRGLMLVWEEFFDELKQTKRNAKVYEKMASKLFEMTGERRLGEEIKIKITNMTF
FT                   QYRSEERPVKKRKMRSCHLQKKKLRLLEAMLEEQRRLSRAMEETCREVRRVLDQQNILQ
FT                   VQSLQLQERMMSLLEKIIAKSNV"
FT   assembly_gap    8733755..8733774
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8738040..8738091
FT                   /estimated_length=52
FT                   /gap_type="unknown"
FT   gene            8754570..8845732
FT                   /gene="Rgs12"
FT                   /locus_tag="mCG_2541"
FT                   /note="gene_id=mCG2541.1"
FT   mRNA            join(8754570..8754644,8769893..8771302,8771600..8771875,
FT                   8780847..8780963,8804747..8804768,8825433..8825602,
FT                   8826403..8826495,8827205..8827348,8828681..8828860,
FT                   8829118..8829271,8830366..8830442,8831938..8832132,
FT                   8832417..8832490,8832952..8833078,8834625..8834721,
FT                   8836100..8836179,8836557..8836710,8837960..8838523,
FT                   8845252..8845732)
FT                   /gene="Rgs12"
FT                   /locus_tag="mCG_2541"
FT                   /product="regulator of G-protein signaling 12, transcript
FT                   variant mCT1560"
FT                   /note="gene_id=mCG2541.1 transcript_id=mCT1560.2 created on
FT                   25-SEP-2002"
FT   mRNA            join(<8754571..8754644,8769893..8771875,8780847..8780963,
FT                   8804747..8804768,8825433..8825602,8826403..8826495,
FT                   8827205..8827348,8828681..8828860,8829118..8829271,
FT                   8830366..8830442,8831938..8832132,8832417..8832490,
FT                   8832952..8833078,8834625..8834721,8836100..8836179,
FT                   8836557..8836710,8837960..8839680)
FT                   /gene="Rgs12"
FT                   /locus_tag="mCG_2541"
FT                   /product="regulator of G-protein signaling 12, transcript
FT                   variant mCT193624"
FT                   /note="gene_id=mCG2541.1 transcript_id=mCT193624.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<8769983..8771875,8780847..8780963,8804747..8804768,
FT                   8825433..8825602,8826403..8826495,8827205..8827348,
FT                   8828681..8828860,8829118..8829271,8830366..8830442,
FT                   8831938..8832132,8832417..8832490,8832952..8833078,
FT                   8834625..8834721,8836100..8836179,8836557..8836710,
FT                   8837960..8838540)
FT                   /codon_start=1
FT                   /gene="Rgs12"
FT                   /locus_tag="mCG_2541"
FT                   /product="regulator of G-protein signaling 12, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG2541.1 transcript_id=mCT193624.0
FT                   protein_id=mCP114596.0 isoform=CRA_b"
FT                   /protein_id="EDL37473.1"
FT                   /translation="QYSRMYRAGEPGKRQPGPAPPRVRSVEVARGRAGYGFTLSGQAPC
FT                   VLSCVMRGSPADFVGLRAGDQILAINEINVKKASHEDVVKLIGKCSGVLHMVIAEGTSH
FT                   VESCSSDEEGGLYEGKGWLRPKLDSKALGINRAERVVEEVQSGGIFNMIFESSSLCASG
FT                   PEPLKLKQRSLSESAALRLDAGQAGLCAPHPSMLSKEDISKVINDDSVFTVGLDSHDDF
FT                   GLDASILNVAMVVGYLGSIELPSTSSNLEHDSLQAIRGCMRRLRAEQKIHSLVTMKVMH
FT                   DCVQLVTDRAGVVAEYPAEKLAFSAVCPDDRRFFGLVTMQTNDDGGLAQEDEGALRTSC
FT                   HVFMVDPDLFHHKIHQGIARRFGFACTADPDTSGCLEFPASSLPVLQFISVLYRDMGEL
FT                   IEGVRARAFLDGDADAHQNNSTSSNSDSGIGNFNQEEKSNRVLVVDLGGGSSRHGQGSS
FT                   PGWESGGGRGSQPWSAPWNGAFCHDSEAGSPLETSPNTDRFWDLTKHSGPVSHMEVPPA
FT                   TLRSSIPPSKRGAAGSSCGFNQRWLPVHVLQEWQCGHASDQESYTDSTDGWSSVNCGTL
FT                   PPPMSKIPADRYRVEGSFAQAPLSTQKRDWSRKAFGMQNLFGPHRNVRKTKEDKKSSKL
FT                   GRGVALAQTSQRTSARRSFGRSRRFSITRSLDDLESATVSDGELTGADLKDCISNNSLS
FT                   SNASLPSVQSCRRLRERRVASWAVSFERLLQDPVGVRYFSDFLRKEFSEENILFWQACE
FT                   CFSHVPAHDKKELSYRAREIFSKFLCSKATTPVNIDSQAQLADDILNAPHPDMFKEQQL
FT                   QIFNLMKFDSYTRFLKSQLYQECVLAEVEGRTLPDSQQVPSSPASKHSISSDHSNVSTP
FT                   KKLSGKSKSGRSLNEDVGEEDSEKKRRGAFFSWSRSRSTGRSQKKKDHGDHAHDAPHAN
FT                   GGLCRRESQGSVSSAGSLDLSEACRTSALEKDKAAKHCCVHLPDGTSCVVAVKSGFSIK
FT                   EILSGLCERHGINGAAVDLFLVGGDKPLVLHQDSSILATRDLRLEKRTLFRLDLVPINR
FT                   SVGLKAKPTKPVTEVLRPVVAKYGLDLGSLLVRLSGEKEPLDLGAPISSLDGQRVILEE
FT                   RDPSRGKVSTDKQKGAPVKQNSAVNSSPRNHLAMGEERTLGKSNSIKIRGENGKSARDP
FT                   RLSKREESIAKIGKKKYQKINLDEAEEFFELISKAQSNRADDQRGLLRKEDLVLPEFLR
FT                   LPAGSSELALSSPPPVKGYSKRAVTGHGQEGAAQTEESYSDSPATSPASAQSPCSAYSP
FT                   GSAHSPGSAHSTPGPPGTTQPGEKPTKPSCVSMVQEGTTQAWRRLSPEMEAGGIQTVED
FT                   EQVADLTLMGEGDISSPNSTLLPPPPTPQDTPGPPRPGTSRF"
FT   CDS             join(8769995..8771302,8771600..8771875,8780847..8780963,
FT                   8804747..8804768,8825433..8825602,8826403..8826495,
FT                   8827205..8827348,8828681..8828860,8829118..8829271,
FT                   8830366..8830442,8831938..8832132,8832417..8832490,
FT                   8832952..8833078,8834625..8834721,8836100..8836179,
FT                   8836557..8836710,8837960..8838523,8845252..8845478)
FT                   /codon_start=1
FT                   /gene="Rgs12"
FT                   /locus_tag="mCG_2541"
FT                   /product="regulator of G-protein signaling 12, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG2541.1 transcript_id=mCT1560.2
FT                   protein_id=mCP4030.2 isoform=CRA_a"
FT                   /protein_id="EDL37472.1"
FT                   /translation="MYRAGEPGKRQPGPAPPRVRSVEVARGRAGYGFTLSGQAPCVLSC
FT                   VMRGSPADFVGLRAGDQILAINEINVKKASHEDVVKLIGKCSGVLHMVIAEGTSHVESC
FT                   SSDEEGGLYEGKGWLRPKLDSKALGINRAERVVEEVQSGGIFNMIFESSSLCASGPEPL
FT                   KLKQRSLSESAALRLDAGQAGLCAPHPSMLSKEDISKVINDDSVFTVGLDSHDDFGLDA
FT                   SILNVAMVVGYLGSIELPSTSSNLEHDSLQAIRGCMRRLRAEQKIHSLVTMKVMHDCVQ
FT                   LVTDRAGVVAEYPAEKLAFSAVCPDDRRFFGLVTMQTNDDGGLAQEDEGALRTSCHVFM
FT                   VDPDLFHHKIHQGIARRFGFACTADPDTSGCLEFPASSLPVLQFISVLYRDMGELIEGV
FT                   RARAFLDGDADAHQNNSTSSNSDSGIGNFNQEEKSNRRWLPVHVLQEWQCGHASDQESY
FT                   TDSTDGWSSVNCGTLPPPMSKIPADRYRVEGSFAQAPLSTQKRDWSRKAFGMQNLFGPH
FT                   RNVRKTKEDKKSSKLGRGVALAQTSQRTSARRSFGRSRRFSITRSLDDLESATVSDGEL
FT                   TGADLKDCISNNSLSSNASLPSVQSCRRLRERRVASWAVSFERLLQDPVGVRYFSDFLR
FT                   KEFSEENILFWQACECFSHVPAHDKKELSYRAREIFSKFLCSKATTPVNIDSQAQLADD
FT                   ILNAPHPDMFKEQQLQIFNLMKFDSYTRFLKSQLYQECVLAEVEGRTLPDSQQVPSSPA
FT                   SKHSISSDHSNVSTPKKLSGKSKSGRSLNEDVGEEDSEKKRRGAFFSWSRSRSTGRSQK
FT                   KKDHGDHAHDAPHANGGLCRRESQGSVSSAGSLDLSEACRTSALEKDKAAKHCCVHLPD
FT                   GTSCVVAVKSGFSIKEILSGLCERHGINGAAVDLFLVGGDKPLVLHQDSSILATRDLRL
FT                   EKRTLFRLDLVPINRSVGLKAKPTKPVTEVLRPVVAKYGLDLGSLLVRLSGEKEPLDLG
FT                   APISSLDGQRVILEERDPSRGKVSTDKQKGAPVKQNSAVNSSPRNHLAMGEERTLGKSN
FT                   SIKIRGENGKSARDPRLSKREESIAKIGKKKYQKINLDEAEEFFELISKAQSNRADDQR
FT                   GLLRKEDLVLPEFLRLPAGSSELALSSPPPVKGYSKRAVTGHGQEGAAQTEESYSDSPA
FT                   TSPASAQSPCSAYSPGSAHSPGSAHSTPGPPGTTQPGEKPTKPSCVSMVQEGTTQAWRR
FT                   LSPEMEAGGIQTVEDEQVADLTLMGEGDISSPNSTLLPPPPTPQDTPGPPRPGGGARVS
FT                   GGLPVNRIIDVDLVSGVSPGWGGSILGVQLGPRRVKANGPSLPNGPGLSTIPGEPTKPK
FT                   TSTHHATFV"
FT   assembly_gap    8774943..8775635
FT                   /estimated_length=693
FT                   /gap_type="unknown"
FT   assembly_gap    8809605..8809722
FT                   /estimated_length=118
FT                   /gap_type="unknown"
FT   gene            8847677..8854515
FT                   /gene="Hgfac"
FT                   /locus_tag="mCG_2546"
FT                   /note="gene_id=mCG2546.2"
FT   mRNA            join(8847677..8847799,8848380..8848554,8848656..8848752,
FT                   8848945..8849024,8849650..8849772,8849914..8850045,
FT                   8850238..8850348,8850447..8850621,8850854..8850939,
FT                   8851341..8851596,8852579..8852718,8852974..8853114,
FT                   8853206..8853354,8854247..8854515)
FT                   /gene="Hgfac"
FT                   /locus_tag="mCG_2546"
FT                   /product="hepatocyte growth factor activator"
FT                   /note="gene_id=mCG2546.2 transcript_id=mCT1556.2 created on
FT                   18-SEP-2002"
FT   CDS             join(8847686..8847799,8848380..8848554,8848656..8848752,
FT                   8848945..8849024,8849650..8849772,8849914..8850045,
FT                   8850238..8850348,8850447..8850621,8850854..8850939,
FT                   8851341..8851596,8852579..8852718,8852974..8853114,
FT                   8853206..8853354,8854247..8854429)
FT                   /codon_start=1
FT                   /gene="Hgfac"
FT                   /locus_tag="mCG_2546"
FT                   /product="hepatocyte growth factor activator"
FT                   /note="gene_id=mCG2546.2 transcript_id=mCT1556.2
FT                   protein_id=mCP3987.1"
FT                   /db_xref="GOA:Q8VCS4"
FT                   /db_xref="InterPro:IPR000001"
FT                   /db_xref="InterPro:IPR000083"
FT                   /db_xref="InterPro:IPR000562"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR001314"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR013032"
FT                   /db_xref="InterPro:IPR013806"
FT                   /db_xref="InterPro:IPR014394"
FT                   /db_xref="InterPro:IPR018056"
FT                   /db_xref="InterPro:IPR018114"
FT                   /db_xref="InterPro:IPR033116"
FT                   /db_xref="MGI:MGI:1859281"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VCS4"
FT                   /protein_id="EDL37474.1"
FT                   /translation="MGRQAWISSLCPLPRPCPFLLLLLLLVVPRGAQPQAGRNHTEPPG
FT                   PNVTATPVTPTIPVISGNVSTSTESAPAAETEGPQSERYPPPSSSSPPGGQVLTESGQP
FT                   CRFPFRYGGRMLHSCTSEGSAYRKWCATTHNYDRDRAWGYCAEVTLPVEGPAILDPCAS
FT                   GPCLNGGTCSSTHDHGSYHCSCPLAFTGKDCGTEKCFDETRYEYFEVGDHWARVSEGHV
FT                   EQCGCMEGQARCEDTHHTACLSSPCLNGGTCHLIVGTGTSVCTCPLGYAGRFCNIVPTE
FT                   HCFLGNGTEYRGVASTAASGLSCLAWNSDLLYQELHVDSVAAAVLLGLGPHAYCRNPDK
FT                   DERPWCYVVKDNALSWEYCRLTACESLARVHSQSPEILAALPESAPAVRPTCGKRHKKR
FT                   TFLRPRIIGGSSSLPGSHPWLAAIYIGNSFCAGSLVHTCWVVSAAHCFANSPPRDSITV
FT                   VLGQHFFNRTTDVTQTFGIEKYVPYTLYSVFNPNNHDLVLIRLKKKGERCAVRSQFVQP
FT                   ICLPEAGSSFPTGHKCQIAGWGHMDENVSSYSNSLLEALVPLVADHKCSSPEVYGADIS
FT                   PNMLCAGYFDCKSDACQGDSGGPLVCEKNGVAYLYGIISWGDGCGRLNKPGVYTRVANY
FT                   VDWINDRIRPPKRPVATS"
FT   assembly_gap    8862938..8863123
FT                   /estimated_length=186
FT                   /gap_type="unknown"
FT   gene            8863167..8893753
FT                   /gene="A930013K19Rik"
FT                   /locus_tag="mCG_2539"
FT                   /note="gene_id=mCG2539.2"
FT   mRNA            join(8863167..8863222,8870414..8870644,8872587..8872787,
FT                   8881437..8881556,8883282..8883401,8884954..8885678,
FT                   8889087..8889129,8892471..8892623,8892919..8893753)
FT                   /gene="A930013K19Rik"
FT                   /locus_tag="mCG_2539"
FT                   /product="RIKEN cDNA A930013K19"
FT                   /note="gene_id=mCG2539.2 transcript_id=mCT1568.2 created on
FT                   12-JUN-2003"
FT   CDS             join(8870425..8870644,8872587..8872787,8881437..8881556,
FT                   8883282..8883401,8884954..8885678,8889087..8889129,
FT                   8892471..8892623,8892919..8893049)
FT                   /codon_start=1
FT                   /gene="A930013K19Rik"
FT                   /locus_tag="mCG_2539"
FT                   /product="RIKEN cDNA A930013K19"
FT                   /note="gene_id=mCG2539.2 transcript_id=mCT1568.2
FT                   protein_id=mCP3887.1"
FT                   /db_xref="GOA:A0A0R4J0R2"
FT                   /db_xref="InterPro:IPR002404"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="MGI:MGI:3584043"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J0R2"
FT                   /protein_id="EDL37475.1"
FT                   /translation="MLVYKDKCERSKGLRERSSLTLEDICGLEPALPYEGLAHTLAIIC
FT                   LSQAVMLGFDSHEAMCAWDTRIRYALGEVHRFHVTVAPGTKLESGPATLHLCNDILVLA
FT                   RDIPPTVMGQWKLSDLRRYGAVPNGFIFEGGTRCGYWAGVFFLSSAEGEQMSFLFDCIV
FT                   RGISPTKGPFGLRPVLPDPSSGGPSASEERVAQEALEALQLEKRLSLLSHSGRPGSGGD
FT                   DRSLSSSSSEASHSDISASSRLTAWPEQSSSSAGTSQEGPGLVAAQGPGEAMLGASRPP
FT                   LKPLRPRQLQEVGRQSSSDSGIATGSHSSYSGSFSSYAGSNLDVWRAGEEFGSLLSLPP
FT                   GASAPEPRLCACPPGAAEYQVPTSLRHHYDTPRSLRQAPRDPSPASQGSSDHGSATDLG
FT                   GQAPTGCPSSWLGARRRGQATEGPGSDAALPSPSPGESWEAGSPHAGPPPAFFLSCSIC
FT                   GGLKVMATSSPGFTVTHPGSPGRVAADSPGPERPHSEMPTYVNIPISPISRPQLHYMDL
FT                   ELPGASAGVRGASTSRYAQIDIAATETAHRVGVRHAQTREERLPELEQRKKGP"
FT   assembly_gap    8871954..8872073
FT                   /estimated_length=120
FT                   /gap_type="unknown"
FT   assembly_gap    8873396..8873459
FT                   /estimated_length=64
FT                   /gap_type="unknown"
FT   assembly_gap    8884021..8884040
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(8897409..8911639)
FT                   /gene="Lrpap1"
FT                   /locus_tag="mCG_2555"
FT                   /note="gene_id=mCG2555.2"
FT   mRNA            complement(join(8897409..8899300,8900764..8900940,
FT                   8901890..8901972,8903445..8903603,8904067..8904187,
FT                   8905071..8905192,8908309..8908453,8911393..8911639))
FT                   /gene="Lrpap1"
FT                   /locus_tag="mCG_2555"
FT                   /product="low density lipoprotein receptor-related protein
FT                   associated protein 1, transcript variant mCT1549"
FT                   /note="gene_id=mCG2555.2 transcript_id=mCT1549.2 created on
FT                   03-OCT-2002"
FT   mRNA            complement(join(8897409..8899300,8900764..8900940,
FT                   8901890..8901972,8903445..8903520,8908367..>8908435))
FT                   /gene="Lrpap1"
FT                   /locus_tag="mCG_2555"
FT                   /product="low density lipoprotein receptor-related protein
FT                   associated protein 1, transcript variant mCT173996"
FT                   /note="gene_id=mCG2555.2 transcript_id=mCT173996.0 created
FT                   on 03-OCT-2002"
FT   CDS             complement(join(8899238..8899300,8900764..8900940,
FT                   8901890..8901972,8903445..8903603,8904067..8904187,
FT                   8905071..8905192,8908309..8908453,8911393..8911605))
FT                   /codon_start=1
FT                   /gene="Lrpap1"
FT                   /locus_tag="mCG_2555"
FT                   /product="low density lipoprotein receptor-related protein
FT                   associated protein 1, isoform CRA_a"
FT                   /note="gene_id=mCG2555.2 transcript_id=mCT1549.2
FT                   protein_id=mCP4024.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q52KI7"
FT                   /db_xref="InterPro:IPR009066"
FT                   /db_xref="InterPro:IPR010483"
FT                   /db_xref="MGI:MGI:96829"
FT                   /db_xref="UniProtKB/TrEMBL:Q52KI7"
FT                   /protein_id="EDL37476.1"
FT                   /translation="MAPRRERVSTLPRLQLLVLLLLPLMLVPQPIAGHGGKYSREKNEP
FT                   EMAAKRESGEEFRMEKLNQLWEKAKRLHLSPVRLAELHSDLKIQERDELNWKKLKVEGL
FT                   DKDGEKEAKLIHNLNVILARYGLDGRKDAQMVHSNALNEDTQDELGDPRLEKLWHKAKT
FT                   SGKFSSEELDKLWREFLHYKEKIQEYNVLLDTLSRAEEGYENLLSPSDMAHIKSDTLIS
FT                   KHSELKDRLRSINQGLDRLRKVSHQGYGSTTEFEEPRVIDLWDLAQSANFTEKELESFR
FT                   EELKHFEAKIEKHNHYQKQLEISHQKLKHVESIGDPEHISRNKEKYVLLEEKTKELGYK
FT                   VKKHLQDLSSRVSRARHNEL"
FT   CDS             complement(join(8899238..8899300,8900764..8900940,
FT                   8901890..8901972,8903445..8903520,8908367..>8908435))
FT                   /codon_start=1
FT                   /gene="Lrpap1"
FT                   /locus_tag="mCG_2555"
FT                   /product="low density lipoprotein receptor-related protein
FT                   associated protein 1, isoform CRA_b"
FT                   /note="gene_id=mCG2555.2 transcript_id=mCT173996.0
FT                   protein_id=mCP96915.0 isoform=CRA_b"
FT                   /protein_id="EDL37477.1"
FT                   /translation="RLAELHSDLKIQERDELNWKKLKDRLRSINQGLDRLRKVSHQGYG
FT                   STTEFEEPRVIDLWDLAQSANFTEKELESFREELKHFEAKIEKHNHYQKQLEISHQKLK
FT                   HVESIGDPEHISRNKEKYVLLEEKTKELGYKVKKHLQDLSSRVSRARHNEL"
FT   assembly_gap    8933878..8933897
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8936418..8936437
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8958415..8958434
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8970756..8970775
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8973399..8973669
FT                   /estimated_length=271
FT                   /gap_type="unknown"
FT   assembly_gap    8986506..8986642
FT                   /estimated_length=137
FT                   /gap_type="unknown"
FT   assembly_gap    9000544..9000563
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9023106..9023133
FT                   /estimated_length=28
FT                   /gap_type="unknown"
FT   assembly_gap    9067111..9067130
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9069257..9069336
FT                   /estimated_length=80
FT                   /gap_type="unknown"
FT   assembly_gap    9085851..9086251
FT                   /estimated_length=401
FT                   /gap_type="unknown"
FT   gene            9086673..9088550
FT                   /locus_tag="mCG_2544"
FT                   /note="gene_id=mCG2544.1"
FT   mRNA            9086673..9088550
FT                   /locus_tag="mCG_2544"
FT                   /product="mCG2544"
FT                   /note="gene_id=mCG2544.1 transcript_id=mCT1557.1 created on
FT                   18-SEP-2002"
FT   CDS             9086676..9088052
FT                   /codon_start=1
FT                   /locus_tag="mCG_2544"
FT                   /product="mCG2544"
FT                   /note="gene_id=mCG2544.1 transcript_id=mCT1557.1
FT                   protein_id=mCP3976.0"
FT                   /protein_id="EDL37478.1"
FT                   /translation="MASPALAAALAAAAAEGPNGSDAGEWGSGGGANASGTDWVPPPGQ
FT                   YSAGAVAGLAAVVGFLIVFTVVGNVLVVIAVLTSRALRAPQNLFLVSLASADILVATLV
FT                   MPFSLANELMAYWYFGQVWCGVYLALDVLFCTSSIVHLCAISLDRYWSVTQAVEYNLKR
FT                   TPRRVKATIVAVWLISAVISFPPLVSFYRRPDGAAYPQCGLNDETWYILSSCIGSFFAP
FT                   CLIMGLVYARIYRVAKLRTRTLSEKRGPAGPDGASPTTENGLGKAAGENGHCAPPRTEV
FT                   EPDESSAAERRRRRGALRRGGRRREGAEGDTGSADGPGPGLAAEQGARTASRSPGPGGR
FT                   LSRASSRSVEFFLSRRRRARSSVCRRKVAQAREKRFTFVLAVVMGVFVLCWFPFFFSYS
FT                   LYGICREACQLPEPLFKFFFWIGYCNSSLNPVIYTVFNQDFRRSFKHILFRRRRRGFRQ
FT                   "
FT   assembly_gap    9096245..9096264
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9155556..9157413
FT                   /estimated_length=1858
FT                   /gap_type="unknown"
FT   gene            <9168274..9174414
FT                   /locus_tag="mCG_2552"
FT                   /note="gene_id=mCG2552.2"
FT   mRNA            join(<9168274..9169378,9170671..9170769,9173676..9174413)
FT                   /locus_tag="mCG_2552"
FT                   /product="mCG2552, transcript variant mCT1555"
FT                   /note="gene_id=mCG2552.2 transcript_id=mCT1555.1 created on
FT                   18-FEB-2003"
FT   mRNA            join(<9168275..9168926,9170671..9170769,9171472..9171505,
FT                   9173579..9174180)
FT                   /locus_tag="mCG_2552"
FT                   /product="mCG2552, transcript variant mCT173698"
FT                   /note="gene_id=mCG2552.2 transcript_id=mCT173698.0 created
FT                   on 18-FEB-2003"
FT   mRNA            join(<9168287..9169378,9170671..9170769,9171472..9171505,
FT                   9173579..9174414)
FT                   /locus_tag="mCG_2552"
FT                   /product="mCG2552, transcript variant mCT180250"
FT                   /note="gene_id=mCG2552.2 transcript_id=mCT180250.0 created
FT                   on 18-FEB-2003"
FT   CDS             join(<9169274..9169378,9170671..9170769,9173676..9173807)
FT                   /codon_start=1
FT                   /locus_tag="mCG_2552"
FT                   /product="mCG2552, isoform CRA_a"
FT                   /note="gene_id=mCG2552.2 transcript_id=mCT1555.1
FT                   protein_id=mCP3969.0 isoform=CRA_a"
FT                   /protein_id="EDL37479.1"
FT                   /translation="TRQTAHSIHFGEVGLEPTWHRGPGTWRSHREAYKLANSHAAADPS
FT                   CQVPAWQKSFCSKERLRQQWDLKSVCILGKADVSIHLLKEHLQEILSSSPSETSKQGPI
FT                   RCPRGTL"
FT   CDS             join(<9170694..9170769,9171472..9171505,9173579..9173807)
FT                   /codon_start=1
FT                   /locus_tag="mCG_2552"
FT                   /product="mCG2552, isoform CRA_b"
FT                   /note="gene_id=mCG2552.2 transcript_id=mCT173698.0
FT                   protein_id=mCP96617.0 isoform=CRA_b"
FT                   /protein_id="EDL37480.1"
FT                   /translation="SILPGPSLAEVILQQGETKTAVGSQGSELSLMSSLYRVLWERKAN
FT                   QKPWCLKPLKDQSPETQAGVHLLQSVCILGKADVSIHLLKEHLQEILSSSPSETSKQGP
FT                   IRCPRGTL"
FT   CDS             join(<9170694..9170769,9171472..9171505,9173579..9173807)
FT                   /codon_start=1
FT                   /locus_tag="mCG_2552"
FT                   /product="mCG2552, isoform CRA_b"
FT                   /note="gene_id=mCG2552.2 transcript_id=mCT180250.0
FT                   protein_id=mCP103172.0 isoform=CRA_b"
FT                   /protein_id="EDL37481.1"
FT                   /translation="SILPGPSLAEVILQQGETKTAVGSQGSELSLMSSLYRVLWERKAN
FT                   QKPWCLKPLKDQSPETQAGVHLLQSVCILGKADVSIHLLKEHLQEILSSSPSETSKQGP
FT                   IRCPRGTL"
FT   assembly_gap    9183024..9183167
FT                   /estimated_length=144
FT                   /gap_type="unknown"
FT   assembly_gap    9184473..9184774
FT                   /estimated_length=302
FT                   /gap_type="unknown"
FT   gene            complement(9185825..9195151)
FT                   /gene="E130018O15Rik"
FT                   /locus_tag="mCG_148305"
FT                   /note="gene_id=mCG148305.0"
FT   mRNA            complement(join(9185825..9189548,9195098..9195151))
FT                   /gene="E130018O15Rik"
FT                   /locus_tag="mCG_148305"
FT                   /product="RIKEN cDNA E130018O15"
FT                   /note="gene_id=mCG148305.0 transcript_id=mCT188568.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(9188943..9189467)
FT                   /codon_start=1
FT                   /gene="E130018O15Rik"
FT                   /locus_tag="mCG_148305"
FT                   /product="RIKEN cDNA E130018O15"
FT                   /note="gene_id=mCG148305.0 transcript_id=mCT188568.0
FT                   protein_id=mCP109220.0"
FT                   /protein_id="EDL37482.1"
FT                   /translation="MGSPGYSTGHPFHPPANCSSCDTHPTSSRSHHGNLLLESGGGDCF
FT                   GGFPGDRILYYGELEMHKFGFQLCPLISRDPKHVIYSLQVVIRLSVLVAEVASGEWGAG
FT                   SEKKKGGKKKSSEMDDGQPDGRMLSRGLPFSWNPPGAACPVQLFGSPSSPSCGHFNTGG
FT                   MSGFNVRSISK"
FT   gene            9195787..9199545
FT                   /gene="Hmx1"
FT                   /locus_tag="mCG_2542"
FT                   /note="gene_id=mCG2542.2"
FT   mRNA            join(9195787..9196162,9198411..9199545)
FT                   /gene="Hmx1"
FT                   /locus_tag="mCG_2542"
FT                   /product="H6 homeobox 1"
FT                   /note="gene_id=mCG2542.2 transcript_id=mCT1570.2 created on
FT                   18-SEP-2002"
FT   CDS             join(9195790..9196162,9198411..9199036)
FT                   /codon_start=1
FT                   /gene="Hmx1"
FT                   /locus_tag="mCG_2542"
FT                   /product="H6 homeobox 1"
FT                   /note="gene_id=mCG2542.2 transcript_id=mCT1570.2
FT                   protein_id=mCP3974.1"
FT                   /protein_id="EDL37483.1"
FT                   /translation="MPDELTEPGRATPARASSFLIENLLAAEAKGAGRSTQGDGVREEE
FT                   EEDDDDPEDEDPEQARRRLQRRRQQRAGSGPGGEARARALGLGPRPPPGPGPPFALGCG
FT                   GTTRWYPRVHGGYGGGLSPDTSDRDSPETGEEMGRAESAWPRCPGPGTVPREVTTQGPA
FT                   TGGEEAAELAEAPAVAAAATGEARGGRRKKTRTVFSRSQVFQLESTFDLKRYLSSAERA
FT                   GLAASLQLTETQVKIWFQNRRNKWKRQLAAELEAASLSPPGAQRLVRVPVLYHESPPAA
FT                   AGPALPFPLAPPAPAPPPPLLGFSGALAYPLAAFPAAASVPFLRAQMPGLV"
FT   assembly_gap    9201333..9201352
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(9203443..>9206796)
FT                   /locus_tag="mCG_144990"
FT                   /note="gene_id=mCG144990.0"
FT   mRNA            complement(join(9203443..9204075,9204772..9204968,
FT                   9205813..9205899,9206174..9206283,9206601..>9206796))
FT                   /locus_tag="mCG_144990"
FT                   /product="mCG144990"
FT                   /note="gene_id=mCG144990.0 transcript_id=mCT184414.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(9203649..9204075,9204772..9204968,
FT                   9205813..9205899,9206174..>9206185))
FT                   /codon_start=1
FT                   /locus_tag="mCG_144990"
FT                   /product="mCG144990"
FT                   /note="gene_id=mCG144990.0 transcript_id=mCT184414.0
FT                   protein_id=mCP105599.0"
FT                   /protein_id="EDL37484.1"
FT                   /translation="SQHQSYVATRDIESHSKGKAQALDQSLGTWLHQGRSVPRDQAELL
FT                   PSGGSIFCSRPRRALPGLHQHPRSCTSASFPMPSGPRRPHLRYMPSARKGTFTIVPGEP
FT                   REPAGGGRGRETFQGERRTMASRRLDPQRWCPCNPGSRRAHGCLVCLAVSSPGLPGGPD
FT                   AALLHPPFASVACGPRASFPHSAPQIPGAPETEDLDPRPERRPQGTTPHCVARSRPLSP
FT                   FAPSKAPGPRVRSPVRSP"
FT   assembly_gap    9204424..9204595
FT                   /estimated_length=172
FT                   /gap_type="unknown"
FT   assembly_gap    9215069..9215378
FT                   /estimated_length=310
FT                   /gap_type="unknown"
FT   assembly_gap    9221698..9222003
FT                   /estimated_length=306
FT                   /gap_type="unknown"
FT   assembly_gap    9229352..9229429
FT                   /estimated_length=78
FT                   /gap_type="unknown"
FT   assembly_gap    9273879..9273990
FT                   /estimated_length=112
FT                   /gap_type="unknown"
FT   assembly_gap    9305001..9305130
FT                   /estimated_length=130
FT                   /gap_type="unknown"
FT   assembly_gap    9306573..9306603
FT                   /estimated_length=31
FT                   /gap_type="unknown"
FT   gene            complement(9308874..>9332151)
FT                   /gene="Cpz"
FT                   /locus_tag="mCG_2545"
FT                   /note="gene_id=mCG2545.1"
FT   mRNA            complement(join(9308874..9309338,9310309..9310408,
FT                   9313329..9313468,9314773..9314908,9317770..9317928,
FT                   9318450..9318611,9319158..9319354,9322061..9322273,
FT                   9324103..9324477,9325791..9325823,9332049..>9332151))
FT                   /gene="Cpz"
FT                   /locus_tag="mCG_2545"
FT                   /product="carboxypeptidase Z"
FT                   /note="gene_id=mCG2545.1 transcript_id=mCT1558.2 created on
FT                   19-SEP-2002"
FT   CDS             complement(join(9308992..9309338,9310309..9310408,
FT                   9313329..9313468,9314773..9314908,9317770..9317928,
FT                   9318450..9318611,9319158..9319354,9322061..9322273,
FT                   9324103..9324477,9325791..9325823,9332049..9332151))
FT                   /codon_start=1
FT                   /gene="Cpz"
FT                   /locus_tag="mCG_2545"
FT                   /product="carboxypeptidase Z"
FT                   /note="gene_id=mCG2545.1 transcript_id=mCT1558.2
FT                   protein_id=mCP3981.2"
FT                   /db_xref="GOA:Q8R4V4"
FT                   /db_xref="InterPro:IPR000834"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR014766"
FT                   /db_xref="InterPro:IPR020067"
FT                   /db_xref="MGI:MGI:88487"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8R4V4"
FT                   /protein_id="EDL37485.1"
FT                   /translation="MPTMPLLLAALAALAVLALAARPSPSCSPGPDPSGKCQRLVYTHS
FT                   ATCVDLHLRTCADAAYNHTSFPTPLEHRSWEAVESSPEYMLLGVIHFLLEGQCNPDLRL
FT                   LGCSVLAPRCEGGHTQRPCRHVCEGLREACQPAFDAIDMAWPYFLDCAQYFAPEEEGCY
FT                   DPLEELRGELDVEEALPSGLPPTFIRFAHHSYAQMVRVLKRTAARCSQVAKTYSIGRSF
FT                   EGKDLVVIEFSSRPGQHELMEPEVKLIGNIHGNEVAGREVLIYLAQYLCSEYLLGNPRI
FT                   QRLLNTTRIHLLPSMNPDGYEVAAAEGAGYNGWTSGRQNAQNLDLNRNFPDLTSEYYRL
FT                   ASTRGVRTDHIPISQYYWWGKVAPETKAIMKWIQTIPFVLSASLHGGDLVVSYPFDFSK
FT                   NPHEKKMFSPTPDEKMFKLLARAYADVHPMMMDRSENRCGGNFLKRGSIINGADWYSFT
FT                   GGMSDFNYLHTNCFEITVELGCVKFPPEEALYGLWQQNKEPLLNFLEMVHRGIKGMVTD
FT                   KYGKPVKNARILVKGIRHDVTTAPDGDYWRLLPPGSHIVIAQAPGYSKVMKRVTIPLRM
FT                   KKAGRVDFILHPLATGPKNFLPGPSRALPRFQDPQREPTQMDFEPPRARRQPASGSKPW
FT                   WWAYFTSLSPYKPRWLLKY"
FT   assembly_gap    9315325..9315645
FT                   /estimated_length=321
FT                   /gap_type="unknown"
FT   assembly_gap    9317100..9317274
FT                   /estimated_length=175
FT                   /gap_type="unknown"
FT   gene            9358035..9360572
FT                   /pseudo
FT                   /locus_tag="mCG_2549"
FT                   /note="gene_id=mCG2549.2"
FT   mRNA            9358035..9360572
FT                   /pseudo
FT                   /locus_tag="mCG_2549"
FT                   /note="gene_id=mCG2549.2 transcript_id=mCT1563.2 created on
FT                   03-OCT-2002"
FT   gene            complement(9361166..9379408)
FT                   /gene="2310079F23Rik"
FT                   /locus_tag="mCG_2554"
FT                   /note="gene_id=mCG2554.1"
FT   mRNA            complement(join(9361166..9362375,9366812..9366928,
FT                   9368343..9368775,9369681..9369864,9370743..9370849,
FT                   9373082..9373153,9374218..9374325,9375391..9375459,
FT                   9377050..9377269,9378427..9378541,9378906..9379408))
FT                   /gene="2310079F23Rik"
FT                   /locus_tag="mCG_2554"
FT                   /product="RIKEN cDNA 2310079F23"
FT                   /note="gene_id=mCG2554.1 transcript_id=mCT1548.2 created on
FT                   08-NOV-2002"
FT   CDS             complement(join(9362146..9362375,9366812..9366928,
FT                   9368343..9368775,9369681..9369864,9370743..9370849,
FT                   9373082..9373153,9374218..9374325,9375391..9375459,
FT                   9377050..9377269,9378427..9378541,9378906..9379392))
FT                   /codon_start=1
FT                   /gene="2310079F23Rik"
FT                   /locus_tag="mCG_2554"
FT                   /product="RIKEN cDNA 2310079F23"
FT                   /note="gene_id=mCG2554.1 transcript_id=mCT1548.2
FT                   protein_id=mCP3972.2"
FT                   /db_xref="GOA:Q9D2Q2"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR011671"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="MGI:MGI:1926140"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9D2Q2"
FT                   /protein_id="EDL37486.1"
FT                   /translation="MEELGRVRLSDPDALLPAGFWAAVTVWLERPQVANKRLCGARMEA
FT                   RGRTLRSHAQAECGPRQGQGHGLEREPGQASPKGEPESGPRASREGTAPAADLNSLWDR
FT                   VSQSLVHANPEMLAFLCGPSLGPQPEAAQELDLILRTVIPKASPHSPLTEPKKELVVQD
FT                   VSSGSVTFLPLEEDNEGNLEVKTSNVYQLHLHHNEGEWFISVLIFCPERWHSDGVVYPK
FT                   PAWLGEELLSKLARWAVENRKSEFKSTLSLVSILRYSRMYQELKEKYRDMVKVWPEVTD
FT                   PEKFVYEDVAIATYLLILWEEERAEKGVTTKQSFVDLGCGNGLLVHILSNEGHPGRGID
FT                   IRRRKIWDMYGPQTQLEEGSITPSDETLFPGVDWLIGNHSDELTPWIPVIAARSSYTCR
FT                   FFVLPCCFFDFVGRYQRQQSRKTQYREYLDFVLEVGLSCGFHVQEDCLRIPSTKRVCLI
FT                   GKSRTYPPSAEVWMDEQRTRYLHSRQGHPQSRPGGAHAPSAPQTAAHDAGLQDSCRTVN
FT                   AGSECVLEGLAAERGAGAPAPGLWVPGFCPREKAERVRNCAALPRDFVDQVVLQVANLL
FT                   LDRKKFNTGNSEARSLKPWNGGGSLSLAEVAAELNSETLQRLKRECGGLQTLLKNSHQV
FT                   FEVLNGRVHIRDWRQELQRGKPPEAKQNLSAAVFKTRICWFFAHHPDGCVLPAAQCPFA
FT                   HGPEELRLSQTLKKQRQAP"
FT   assembly_gap    9373846..9373865
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(9385574..>9393115)
FT                   /gene="4931431C16Rik"
FT                   /locus_tag="mCG_146112"
FT                   /note="gene_id=mCG146112.0"
FT   mRNA            complement(join(9385574..9387921,9392020..9392087,
FT                   9392395..9392527,9392927..>9393115))
FT                   /gene="4931431C16Rik"
FT                   /locus_tag="mCG_146112"
FT                   /product="RIKEN cDNA 4931431C16"
FT                   /note="gene_id=mCG146112.0 transcript_id=mCT186215.0
FT                   created on 14-JUL-2003"
FT   CDS             complement(9387310..>9387762)
FT                   /codon_start=1
FT                   /gene="4931431C16Rik"
FT                   /locus_tag="mCG_146112"
FT                   /product="RIKEN cDNA 4931431C16"
FT                   /note="gene_id=mCG146112.0 transcript_id=mCT186215.0
FT                   protein_id=mCP107477.0"
FT                   /protein_id="EDL37487.1"
FT                   /translation="EFAKSTMHLRSINSVLPGHSREQSSDTTNSTYKLTLFCLGIPPGR
FT                   RADCKKLRSVRSPASEYDVRQSANASSHPSLSSCKPFLSGISRARHVLTSRIQLGIRGP
FT                   SQPGVWRTLFIRNILTSEGGASWWCRPAPPRPIPDIIPPLTGVAAG"
FT   gene            <9387387..9418384
FT                   /gene="Acox3"
FT                   /locus_tag="mCG_2540"
FT                   /note="gene_id=mCG2540.3"
FT   mRNA            join(<9387387..9387481,9388223..9388322,9392508..9392662,
FT                   9392968..9393201,9393525..9393599,9394043..9394132,
FT                   9396426..9396569,9398660..9398748,9402665..9402761,
FT                   9404043..9404225,9405800..9405922,9407218..9407338,
FT                   9408903..9409025,9409496..9409609,9411371..9411486,
FT                   9412841..9413015,9413603..9413670,9414319..9414405,
FT                   9416598..9416790)
FT                   /gene="Acox3"
FT                   /locus_tag="mCG_2540"
FT                   /product="acyl-Coenzyme A oxidase 3, pristanoyl, transcript
FT                   variant mCT193619"
FT                   /note="gene_id=mCG2540.3 transcript_id=mCT193619.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(9387396..9387666,9388223..9388322,9392508..9392662,
FT                   9392968..9393201,9393525..9393599,9394043..9394132,
FT                   9396426..9396569,9398660..9398748,9402665..9402761,
FT                   9404043..9404225,9405800..9405922,9407218..9407338,
FT                   9408903..9409025,9409496..9409609,9411371..9411486,
FT                   9412841..9413015,9413603..9413670,9414319..9414405,
FT                   9416598..9418384)
FT                   /gene="Acox3"
FT                   /locus_tag="mCG_2540"
FT                   /product="acyl-Coenzyme A oxidase 3, pristanoyl, transcript
FT                   variant mCT1561"
FT                   /note="gene_id=mCG2540.3 transcript_id=mCT1561.1 created on
FT                   18-SEP-2002"
FT   mRNA            join(<9387448..9387943,9388223..9388322,9392508..9392662,
FT                   9392968..9393201,9393525..9393599,9394043..9394132,
FT                   9396426..9396569,9398660..9398748,9402665..9402761,
FT                   9404043..9404225,9405800..9405922,9407218..9407338,
FT                   9408903..9409025,9409496..9409609,9411371..9411486,
FT                   9412841..9413015,9413603..9413670,9414319..9414405,
FT                   9415663..9416451)
FT                   /gene="Acox3"
FT                   /locus_tag="mCG_2540"
FT                   /product="acyl-Coenzyme A oxidase 3, pristanoyl, transcript
FT                   variant mCT193618"
FT                   /note="gene_id=mCG2540.3 transcript_id=mCT193618.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<9388301..9388322,9392508..9392662,9392968..9393201,
FT                   9393525..9393599,9394043..9394132,9396426..9396569,
FT                   9398660..9398748,9402665..9402761,9404043..9404225,
FT                   9405800..9405922,9407218..9407338,9408903..9409025,
FT                   9409496..9409609,9411371..9411486,9412841..9413015,
FT                   9413603..9413670,9414319..9414405,9416598..9416717)
FT                   /codon_start=1
FT                   /gene="Acox3"
FT                   /locus_tag="mCG_2540"
FT                   /product="acyl-Coenzyme A oxidase 3, pristanoyl, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG2540.3 transcript_id=mCT193619.0
FT                   protein_id=mCP114595.0 isoform=CRA_c"
FT                   /protein_id="EDL37490.1"
FT                   /translation="ETGTKQVGDSTMGSLPEEKDSALWSDTPKGPLSAYRARASFNSGE
FT                   LLLFWDGQDVIHFKKTIFSTLENDPLFARSYGADLPLEKLRELNFLRCKRVFEYGFFKV
FT                   EELLKNPLKILVLINCLGMYDWSLANKCVLHMLVFGTTVFVSGSEKHFKYLEKIYSLEI
FT                   FGCFALTELSHGSNTKAMRTTAHYDPDTQEFILHSPDFEAAKFWVGNLGKTATHAVVFA
FT                   QLYMPDGQCHGLHSFLVQIRDTKTLLPMTGVMVGDIGKKLGQNGLDNGFAMFNKVRIPR
FT                   QNLLDRTGNITSEGTYNSPFKDVRQRLGASLGSLSSGRISIISMSVVNLKLAVSIAIRF
FT                   SATRCQFGPTDKEEIPVLEYPLQQWRILPYLAAAYALDHFSKTIFMDLIEVQSARLRGD
FT                   HSDQQAELGREIHALASAGKPLASWTAQRGIQECREACGGHGYLAMNRFGDLRNDNDPN
FT                   CTYEGDNNVLLQQTSNYLLSLLEPPLQDGAHFTSPLKTVDFLEAYPGILGQKFLGSSKA
FT                   DWMDSAAPLAAYRWLVCYLLQESHRRYCQEKKSRGSDFEARNNSQVYGCRPLALAFMEL
FT                   TVMQRFHEHIHSSGLSPSLRTVLGRLSTLYGLWCLSQHMALLYRGGYISGEQTGRAMED
FT                   AILTLCEQLKDDAVALVDVIAPSDFVLNSPIAKADGELYKNLWAAVLQQNGVLERAAWW
FT                   PEFSANKSVADRLKSQL"
FT   CDS             join(<9388301..9388322,9392508..9392662,9392968..9393201,
FT                   9393525..9393599,9394043..9394132,9396426..9396569,
FT                   9398660..9398748,9402665..9402761,9404043..9404225,
FT                   9405800..9405922,9407218..9407338,9408903..9409025,
FT                   9409496..9409609,9411371..9411486,9412841..9413015,
FT                   9413603..9413670,9414319..9414405,9415663..9415773)
FT                   /codon_start=1
FT                   /gene="Acox3"
FT                   /locus_tag="mCG_2540"
FT                   /product="acyl-Coenzyme A oxidase 3, pristanoyl, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG2540.3 transcript_id=mCT193618.0
FT                   protein_id=mCP114594.0 isoform=CRA_b"
FT                   /protein_id="EDL37489.1"
FT                   /translation="ETGTKQVGDSTMGSLPEEKDSALWSDTPKGPLSAYRARASFNSGE
FT                   LLLFWDGQDVIHFKKTIFSTLENDPLFARSYGADLPLEKLRELNFLRCKRVFEYGFFKV
FT                   EELLKNPLKILVLINCLGMYDWSLANKCVLHMLVFGTTVFVSGSEKHFKYLEKIYSLEI
FT                   FGCFALTELSHGSNTKAMRTTAHYDPDTQEFILHSPDFEAAKFWVGNLGKTATHAVVFA
FT                   QLYMPDGQCHGLHSFLVQIRDTKTLLPMTGVMVGDIGKKLGQNGLDNGFAMFNKVRIPR
FT                   QNLLDRTGNITSEGTYNSPFKDVRQRLGASLGSLSSGRISIISMSVVNLKLAVSIAIRF
FT                   SATRCQFGPTDKEEIPVLEYPLQQWRILPYLAAAYALDHFSKTIFMDLIEVQSARLRGD
FT                   HSDQQAELGREIHALASAGKPLASWTAQRGIQECREACGGHGYLAMNRFGDLRNDNDPN
FT                   CTYEGDNNVLLQQTSNYLLSLLEPPLQDGAHFTSPLKTVDFLEAYPGILGQKFLGSSKA
FT                   DWMDSAAPLAAYRWLVCYLLQESHRRYCQEKKSRGSDFEARNNSQVYGCRPLALAFMEL
FT                   TVMQRFHEHIHSSGLSPSLRTVLGRLSTLYGLWCLSQHMALLYRGGYISGEQTGRAMED
FT                   AILTLCEQLKDDAVALVDVIAPSDFVLNSPIAKADGEVDFSGICRQDLLGRTTTCRACC
FT                   LQKELSTCSLVKNC"
FT   CDS             join(9392519..9392662,9392968..9393201,9393525..9393599,
FT                   9394043..9394132,9396426..9396569,9398660..9398748,
FT                   9402665..9402761,9404043..9404225,9405800..9405922,
FT                   9407218..9407338,9408903..9409025,9409496..9409609,
FT                   9411371..9411486,9412841..9413015,9413603..9413670,
FT                   9414319..9414405,9416598..9416717)
FT                   /codon_start=1
FT                   /gene="Acox3"
FT                   /locus_tag="mCG_2540"
FT                   /product="acyl-Coenzyme A oxidase 3, pristanoyl, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG2540.3 transcript_id=mCT1561.1
FT                   protein_id=mCP3935.1 isoform=CRA_a"
FT                   /protein_id="EDL37488.1"
FT                   /translation="MGSLPEEKDSALWSDTPKGPLSAYRARASFNSGELLLFWDGQDVI
FT                   HFKKTIFSTLENDPLFARSYGADLPLEKLRELNFLRCKRVFEYGFFKVEELLKNPLKIL
FT                   VLINCLGMYDWSLANKCVLHMLVFGTTVFVSGSEKHFKYLEKIYSLEIFGCFALTELSH
FT                   GSNTKAMRTTAHYDPDTQEFILHSPDFEAAKFWVGNLGKTATHAVVFAQLYMPDGQCHG
FT                   LHSFLVQIRDTKTLLPMTGVMVGDIGKKLGQNGLDNGFAMFNKVRIPRQNLLDRTGNIT
FT                   SEGTYNSPFKDVRQRLGASLGSLSSGRISIISMSVVNLKLAVSIAIRFSATRCQFGPTD
FT                   KEEIPVLEYPLQQWRILPYLAAAYALDHFSKTIFMDLIEVQSARLRGDHSDQQAELGRE
FT                   IHALASAGKPLASWTAQRGIQECREACGGHGYLAMNRFGDLRNDNDPNCTYEGDNNVLL
FT                   QQTSNYLLSLLEPPLQDGAHFTSPLKTVDFLEAYPGILGQKFLGSSKADWMDSAAPLAA
FT                   YRWLVCYLLQESHRRYCQEKKSRGSDFEARNNSQVYGCRPLALAFMELTVMQRFHEHIH
FT                   SSGLSPSLRTVLGRLSTLYGLWCLSQHMALLYRGGYISGEQTGRAMEDAILTLCEQLKD
FT                   DAVALVDVIAPSDFVLNSPIAKADGELYKNLWAAVLQQNGVLERAAWWPEFSANKSVAD
FT                   RLKSQL"
FT   assembly_gap    9412137..9412463
FT                   /estimated_length=327
FT                   /gap_type="unknown"
FT   assembly_gap    9419037..9419056
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9435702..9435721
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9444650..9444766
FT                   /estimated_length=117
FT                   /gap_type="unknown"
FT   gene            complement(9456776..9484612)
FT                   /gene="Htra3"
FT                   /locus_tag="mCG_7096"
FT                   /note="gene_id=mCG7096.2"
FT   mRNA            complement(join(9456776..9457571,9457793..9457894,
FT                   9458847..9458942,9460326..9460374,9468738..9468852,
FT                   9470189..9470221,9470825..9471019,9472972..9473194,
FT                   9475823..9475922,9483738..9484612))
FT                   /gene="Htra3"
FT                   /locus_tag="mCG_7096"
FT                   /product="HtrA serine peptidase 3, transcript variant
FT                   mCT6193"
FT                   /note="gene_id=mCG7096.2 transcript_id=mCT6193.2 created on
FT                   18-FEB-2003"
FT   CDS             complement(join(9457523..9457571,9457793..9457894,
FT                   9458847..9458942,9460326..9460374,9468738..9468852,
FT                   9470189..9470221,9470825..9471019,9472972..9473194,
FT                   9475823..9475922,9483738..9484140))
FT                   /codon_start=1
FT                   /gene="Htra3"
FT                   /locus_tag="mCG_7096"
FT                   /product="HtrA serine peptidase 3, isoform CRA_a"
FT                   /note="gene_id=mCG7096.2 transcript_id=mCT6193.2
FT                   protein_id=mCP3903.2 isoform=CRA_a"
FT                   /protein_id="EDL37491.1"
FT                   /translation="MQARALLPATLAILATLAVLALAREPPAAPCPARCDVSRCPSPRC
FT                   PGGYVPDLCNCCLVCAASEGEPCGRPLDSPCGDSLECVRGVCRCRWTHTVCGTDGHTYA
FT                   DVCALQAASRRALQVSGTPVRQLQKGACPSGLHQLTSPRYKFNFIADVVEKIAPAVVHI
FT                   ELFLRHPLFGRNVPLSSGSGFIMSEAGLIVTNAHVVSSSSTASGRQQLKVQLQNGDAYE
FT                   ATIQDIDKKSDIATIVIHPKKKLPVLLLGHSADLRPGEFVVAIGSPFALQNTVTTGIVS
FT                   TAQRDGKELGLRDSDMDYIQTDAIINYGNSGGPLVNLDGEVIGINTLKVAAGISFAIPS
FT                   DRITRFLSEFQNKHVKDWKKRFIGIRMRTITPSLVEELKAANPDFPAVSSGIYVQEVVP
FT                   NSPSQRGGIQDGDIIVKVNGRPLADSSELQEAVLNESSLLPRLDLTRGPDLSLDP"
FT   assembly_gap    9457572..9457791
FT                   /estimated_length=220
FT                   /gap_type="unknown"
FT   mRNA            complement(join(<9457793..9457894,9458847..9458942,
FT                   9460326..9460374,9468738..9468852,9470189..9470221,
FT                   9470825..9470878,9483787..9484164))
FT                   /gene="Htra3"
FT                   /locus_tag="mCG_7096"
FT                   /product="HtrA serine peptidase 3, transcript variant
FT                   mCT180348"
FT                   /note="gene_id=mCG7096.2 transcript_id=mCT180348.0 created
FT                   on 18-FEB-2003"
FT   CDS             complement(join(<9457793..9457894,9458847..9458942,
FT                   9460326..9460374,9468738..9468852,9470189..9470221,
FT                   9470825..9470878,9483787..9484140))
FT                   /codon_start=1
FT                   /gene="Htra3"
FT                   /locus_tag="mCG_7096"
FT                   /product="HtrA serine peptidase 3, isoform CRA_b"
FT                   /note="gene_id=mCG7096.2 transcript_id=mCT180348.0
FT                   protein_id=mCP103270.0 isoform=CRA_b"
FT                   /protein_id="EDL37492.1"
FT                   /translation="MQARALLPATLAILATLAVLALAREPPAAPCPARCDVSRCPSPRC
FT                   PGGYVPDLCNCCLVCAASEGEPCGRPLDSPCGDSLECVRGVCRCRWTHTVCGTDGHTYA
FT                   DVCALQAASRRALQLGLRDSDMDYIQTDAIINYGNSGGPLVNLDGEVIGINTLKVAAGI
FT                   SFAIPSDRITRFLSEFQNKHVKDWKKRFIGIRMRTITPSLVEELKAANPDFPAVSSGIY
FT                   VQEVVPNSPSQRGGIQDGDIIVKVNGRPLADSSELQEAVLNESSLL"
FT   assembly_gap    9459486..9459543
FT                   /estimated_length=58
FT                   /gap_type="unknown"
FT   gene            complement(9501964..9528927)
FT                   /gene="Sh3tc1"
FT                   /locus_tag="mCG_7089"
FT                   /note="gene_id=mCG7089.1"
FT   mRNA            complement(join(9501964..9502350,9504493..9504689,
FT                   9505039..9505189,9505367..9505489,9506633..9506783,
FT                   9508133..9508313,9510644..9512323,9514423..9514464,
FT                   9515639..9515772,9518838..9519033,9519801..9519877,
FT                   9520884..9521094,9521705..9521851,9523046..9523151,
FT                   9523748..9523875,9526305..9526379,9528689..9528927))
FT                   /gene="Sh3tc1"
FT                   /locus_tag="mCG_7089"
FT                   /product="SH3 domain and tetratricopeptide repeats 1,
FT                   transcript variant mCT6197"
FT                   /note="gene_id=mCG7089.1 transcript_id=mCT6197.2 created on
FT                   03-OCT-2002"
FT   mRNA            complement(join(9501965..9502350,9504493..9504689,
FT                   9505039..9505189,9505367..9505489,9506633..9506783,
FT                   9508133..9508313,9510644..9512323,9514423..9514464,
FT                   9515639..9515772,9518838..9519033,9519801..9519877,
FT                   9520884..9521094,9521705..9521851,9523046..9523151,
FT                   9526305..9526379,9528689..>9528721))
FT                   /gene="Sh3tc1"
FT                   /locus_tag="mCG_7089"
FT                   /product="SH3 domain and tetratricopeptide repeats 1,
FT                   transcript variant mCT193605"
FT                   /note="gene_id=mCG7089.1 transcript_id=mCT193605.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(9501965..9502350,9504493..9504577,
FT                   9505039..9505189,9505367..9505489,9506633..9506783,
FT                   9508133..9508313,9510644..9512323,9514423..9514464,
FT                   9515639..9515772,9518838..9519033,9519801..9519877,
FT                   9520884..9521094,9521705..9521851,9523046..9523151,
FT                   9523748..9523875,9526305..>9526378))
FT                   /gene="Sh3tc1"
FT                   /locus_tag="mCG_7089"
FT                   /product="SH3 domain and tetratricopeptide repeats 1,
FT                   transcript variant mCT193606"
FT                   /note="gene_id=mCG7089.1 transcript_id=mCT193606.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(9501965..9502350,9504493..9505189,
FT                   9505367..9505489,9506633..9506783,9508133..9508313,
FT                   9510644..9512323,9514423..9514464,9515639..9515772,
FT                   9518838..9519033,9519801..9519877,9520884..9521094,
FT                   9521705..9521851,9523046..>9524013))
FT                   /gene="Sh3tc1"
FT                   /locus_tag="mCG_7089"
FT                   /product="SH3 domain and tetratricopeptide repeats 1,
FT                   transcript variant mCT193607"
FT                   /note="gene_id=mCG7089.1 transcript_id=mCT193607.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(9502093..9502350,9504493..9504689,
FT                   9505039..9505189,9505367..9505489,9506633..9506783,
FT                   9508133..9508313,9510644..9512323,9514423..9514464,
FT                   9515639..9515772,9518838..9519033,9519801..9519877,
FT                   9520884..9521094,9521705..9521851,9523046..9523151,
FT                   9523748..9523875,9526305..9526379,9528689..9528872))
FT                   /codon_start=1
FT                   /gene="Sh3tc1"
FT                   /locus_tag="mCG_7089"
FT                   /product="SH3 domain and tetratricopeptide repeats 1,
FT                   isoform CRA_d"
FT                   /note="gene_id=mCG7089.1 transcript_id=mCT6197.2
FT                   protein_id=mCP3895.2 isoform=CRA_d"
FT                   /db_xref="GOA:G3X9F6"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="MGI:MGI:2678949"
FT                   /db_xref="UniProtKB/TrEMBL:G3X9F6"
FT                   /protein_id="EDL37496.1"
FT                   /translation="MRSFREEEEEATSEELFTMGRGPEEPRGSCSPEDQIQSVSMGLPT
FT                   GQERTGSAEAEATVRGDVAPPRIVVGLAAEPPPSQMTVYPTDLTLQLLAVRRKSGLRSP
FT                   SLQQALRSRLRLLENDSREVARVLGELSARLLSIHSDQDRIVVTFKTFEEIWKFSTYHA
FT                   LGFTHHCLENLLVDQTFWLLSPSEEEETAILMYVNKDALKQTHKNLLTQEGSIFVLCPD
FT                   HRVRRTIGPKGAGKGPQTLRRASGVPLGVAILETDSSSPTPNMSSNVEAAEAEPEPLTP
FT                   FHQWTLRVPWDPIDESMSGPGTPDAQLMRFGLASAIADFQGSGPEEMSFSVGDVIEILG
FT                   AQVPGLPWCVGRHMASGQVGFVRTGLVSMQGPASDLESAIFLSEEERSFFRSEGHFSDE
FT                   DARRLLSRTSGTDVCTTCSLDWLEEAEGEQLEQREMSLPHLNPEPHGTLQMVKNILEKC
FT                   KACPDHPEAPVSWSLGGVSRRASSLDLEEPRFCLDPEDDWTDPEPLDSLLQVLNAPGYG
FT                   AHFRSLYDISLPWLSTALYGFDDEEELAERLAQARGVAKKVDLSMALARLCLLLGRLCA
FT                   RKLKLSQARVYFEEALGALEGSFGDLSLVAAVYSSLTTVYLKQKNAEKCVQVAPKAAAL
FT                   LLGTPGHSCNADAELLKYALRRVICGLSPQAEARACFLLARHYTHLKQPEEALPYLERL
FT                   LRLNRDAGSPQASWPEDCYLLLADIYGRKCLPHLALSCLRVSSLWTRCSLPGSLRSVDL
FT                   VLQNVPGPNSQRRAGHSLPSQIAYYLRQALASLAPGTGQALRGPLYASLAQLYSHHQQY
FT                   SQAIAFMSQAAEADTAAGVHPVVDRLVALAWLHMLCGNSLVAMDILKCISDAAVANKDQ
FT                   ECVMMNMVAMALKRMGRTRQAAEGYFRALHMAYAQGHLQSQAVVLANFGALCLQAGARS
FT                   LAQHYLREAVGLFSQVPSGVCGRDFTQVLLWLGQLCTRRALPQQAKCYYEWAFLVAVET
FT                   DHLESQLQAVQKLCLFYSKVMPNEVRCVIYHEFQLALARKTANKVLEGQLLEAISQLYL
FT                   SLGTERAYKSALDYTKRSLGIFIDLQQKEKEARAWLQAGKIYYILRQNELVDLYIQVAQ
FT                   NAALYTGDPKLGLELFEAAGDIFFNGTWEREKAVSFYRDRALPLAVTVGDQEVELRLCN
FT                   KLVALLSALEAPQEGLEFAHEALALSITLGDRLNERVAYHRLATLHHRLGHGELAEHFF
FT                   LKALSLCSSPLEFDEETLYYVKVYLVLGDIIFYDLKDPFDAAGYYQLALAAAVDLGHKK
FT                   AQLKIYTRLATIYHHFLVDREMSLFFYQKARTFASELNLRRTNLVPQRFCGRAPWLAPG
FT                   HPS"
FT   CDS             complement(join(9502093..9502350,9504493..9504689,
FT                   9505039..9505189,9505367..9505489,9506633..9506783,
FT                   9508133..9508313,9510644..9512323,9514423..9514464,
FT                   9515639..9515772,9518838..9519033,9519801..9519877,
FT                   9520884..9521094,9521705..9521851,9523046..9523151,
FT                   9526305..>9526319))
FT                   /codon_start=1
FT                   /gene="Sh3tc1"
FT                   /locus_tag="mCG_7089"
FT                   /product="SH3 domain and tetratricopeptide repeats 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG7089.1 transcript_id=mCT193605.0
FT                   protein_id=mCP114602.0 isoform=CRA_a"
FT                   /protein_id="EDL37493.1"
FT                   /translation="QCIQQELSARLLSIHSDQDRIVVTFKTFEEIWKFSTYHALGFTHH
FT                   CLENLLVDQTFWLLSPSEEEETAILMYVNKDALKQTHKNLLTQEGSIFVLCPDHRVRRT
FT                   IGPKGAGKGPQTLRRASGVPLGVAILETDSSSPTPNMSSNVEAAEAEPEPLTPFHQWTL
FT                   RVPWDPIDESMSGPGTPDAQLMRFGLASAIADFQGSGPEEMSFSVGDVIEILGAQVPGL
FT                   PWCVGRHMASGQVGFVRTGLVSMQGPASDLESAIFLSEEERSFFRSEGHFSDEDARRLL
FT                   SRTSGTDVCTTCSLDWLEEAEGEQLEQREMSLPHLNPEPHGTLQMVKNILEKCKACPDH
FT                   PEAPVSWSLGGVSRRASSLDLEEPRFCLDPEDDWTDPEPLDSLLQVLNAPGYGAHFRSL
FT                   YDISLPWLSTALYGFDDEEELAERLAQARGVAKKVDLSMALARLCLLLGRLCARKLKLS
FT                   QARVYFEEALGALEGSFGDLSLVAAVYSSLTTVYLKQKNAEKCVQVAPKAAALLLGTPG
FT                   HSCNADAELLKYALRRVICGLSPQAEARACFLLARHYTHLKQPEEALPYLERLLRLNRD
FT                   AGSPQASWPEDCYLLLADIYGRKCLPHLALSCLRVSSLWTRCSLPGSLRSVDLVLQNVP
FT                   GPNSQRRAGHSLPSQIAYYLRQALASLAPGTGQALRGPLYASLAQLYSHHQQYSQAIAF
FT                   MSQAAEADTAAGVHPVVDRLVALAWLHMLCGNSLVAMDILKCISDAAVANKDQECVMMN
FT                   MVAMALKRMGRTRQAAEGYFRALHMAYAQGHLQSQAVVLANFGALCLQAGARSLAQHYL
FT                   REAVGLFSQVPSGVCGRDFTQVLLWLGQLCTRRALPQQAKCYYEWAFLVAVETDHLESQ
FT                   LQAVQKLCLFYSKVMPNEVRCVIYHEFQLALARKTANKVLEGQLLEAISQLYLSLGTER
FT                   AYKSALDYTKRSLGIFIDLQQKEKEARAWLQAGKIYYILRQNELVDLYIQVAQNAALYT
FT                   GDPKLGLELFEAAGDIFFNGTWEREKAVSFYRDRALPLAVTVGDQEVELRLCNKLVALL
FT                   SALEAPQEGLEFAHEALALSITLGDRLNERVAYHRLATLHHRLGHGELAEHFFLKALSL
FT                   CSSPLEFDEETLYYVKVYLVLGDIIFYDLKDPFDAAGYYQLALAAAVDLGHKKAQLKIY
FT                   TRLATIYHHFLVDREMSLFFYQKARTFASELNLRRTNLVPQRFCGRAPWLAPGHPS"
FT   CDS             complement(join(9504537..9504577,9505039..9505189,
FT                   9505367..9505489,9506633..9506783,9508133..9508313,
FT                   9510644..9512323,9514423..9514464,9515639..9515772,
FT                   9518838..9519033,9519801..9519877,9520884..9521094,
FT                   9521705..9521851,9523046..9523151,9523748..9523875,
FT                   9526305..>9526377))
FT                   /codon_start=1
FT                   /gene="Sh3tc1"
FT                   /locus_tag="mCG_7089"
FT                   /product="SH3 domain and tetratricopeptide repeats 1,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG7089.1 transcript_id=mCT193606.0
FT                   protein_id=mCP114603.0 isoform=CRA_b"
FT                   /protein_id="EDL37494.1"
FT                   /translation="VAPPRIVVGLAAEPPPSQMTVYPTDLTLQLLAVRRKSGLRSPSLQ
FT                   QALRSRLRLLENDSREVARVLGELSARLLSIHSDQDRIVVTFKTFEEIWKFSTYHALGF
FT                   THHCLENLLVDQTFWLLSPSEEEETAILMYVNKDALKQTHKNLLTQEGSIFVLCPDHRV
FT                   RRTIGPKGAGKGPQTLRRASGVPLGVAILETDSSSPTPNMSSNVEAAEAEPEPLTPFHQ
FT                   WTLRVPWDPIDESMSGPGTPDAQLMRFGLASAIADFQGSGPEEMSFSVGDVIEILGAQV
FT                   PGLPWCVGRHMASGQVGFVRTGLVSMQGPASDLESAIFLSEEERSFFRSEGHFSDEDAR
FT                   RLLSRTSGTDVCTTCSLDWLEEAEGEQLEQREMSLPHLNPEPHGTLQMVKNILEKCKAC
FT                   PDHPEAPVSWSLGGVSRRASSLDLEEPRFCLDPEDDWTDPEPLDSLLQVLNAPGYGAHF
FT                   RSLYDISLPWLSTALYGFDDEEELAERLAQARGVAKKVDLSMALARLCLLLGRLCARKL
FT                   KLSQARVYFEEALGALEGSFGDLSLVAAVYSSLTTVYLKQKNAEKCVQVAPKAAALLLG
FT                   TPGHSCNADAELLKYALRRVICGLSPQAEARACFLLARHYTHLKQPEEALPYLERLLRL
FT                   NRDAGSPQASWPEDCYLLLADIYGRKCLPHLALSCLRVSSLWTRCSLPGSLRSVDLVLQ
FT                   NVPGPNSQRRAGHSLPSQIAYYLRQALASLAPGTGQALRGPLYASLAQLYSHHQQYSQA
FT                   IAFMSQAAEADTAAGVHPVVDRLVALAWLHMLCGNSLVAMDILKCISDAAVANKDQECV
FT                   MMNMVAMALKRMGRTRQAAEGYFRALHMAYAQGHLQSQAVVLANFGALCLQAGARSLAQ
FT                   HYLREAVGLFSQVPSGVCGRDFTQVLLWLGQLCTRRALPQQAKCYYEWAFLVAVETDHL
FT                   ESQLQAVQKLCLFYSKVMPNEVRCVIYHEFQLALARKTANKVLEGQLLEAISQLYLSLG
FT                   TERAYKSALDYTKRSLGIFIDLQQKEKEARAWLQAGKIYYILRQNELVDLYIQVAQNAA
FT                   LYTGDPKLGLELFEAAGDIFFNGTWEREKAVSFYRDRALPLAVTVGDQEVELRLCNKLV
FT                   ALLSALEAPQEGLEFAHEALALSITLARPWNSMRRPCTM"
FT   CDS             complement(join(9504941..9505189,9505367..9505489,
FT                   9506633..9506783,9508133..9508313,9510644..9512323,
FT                   9514423..9514464,9515639..9515772,9518838..9519033,
FT                   9519801..9519877,9520884..9521094,9521705..9521851,
FT                   9523046..>9523280))
FT                   /codon_start=1
FT                   /gene="Sh3tc1"
FT                   /locus_tag="mCG_7089"
FT                   /product="SH3 domain and tetratricopeptide repeats 1,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG7089.1 transcript_id=mCT193607.0
FT                   protein_id=mCP114604.0 isoform=CRA_c"
FT                   /protein_id="EDL37495.1"
FT                   /translation="GKAHSLALVTPTRAVLYILSRSTHLFSNGWIHNLVHSLSLPFKEL
FT                   SARLLSIHSDQDRIVVTFKTFEEIWKFSTYHALGFTHHCLENLLVDQTFWLLSPSEEEE
FT                   TAILMYVNKDALKQTHKNLLTQEGSIFVLCPDHRVRRTIGPKGAGKGPQTLRRASGVPL
FT                   GVAILETDSSSPTPNMSSNVEAAEAEPEPLTPFHQWTLRVPWDPIDESMSGPGTPDAQL
FT                   MRFGLASAIADFQGSGPEEMSFSVGDVIEILGAQVPGLPWCVGRHMASGQVGFVRTGLV
FT                   SMQGPASDLESAIFLSEEERSFFRSEGHFSDEDARRLLSRTSGTDVCTTCSLDWLEEAE
FT                   GEQLEQREMSLPHLNPEPHGTLQMVKNILEKCKACPDHPEAPVSWSLGGVSRRASSLDL
FT                   EEPRFCLDPEDDWTDPEPLDSLLQVLNAPGYGAHFRSLYDISLPWLSTALYGFDDEEEL
FT                   AERLAQARGVAKKVDLSMALARLCLLLGRLCARKLKLSQARVYFEEALGALEGSFGDLS
FT                   LVAAVYSSLTTVYLKQKNAEKCVQVAPKAAALLLGTPGHSCNADAELLKYALRRVICGL
FT                   SPQAEARACFLLARHYTHLKQPEEALPYLERLLRLNRDAGSPQASWPEDCYLLLADIYG
FT                   RKCLPHLALSCLRVSSLWTRCSLPGSLRSVDLVLQNVPGPNSQRRAGHSLPSQIAYYLR
FT                   QALASLAPGTGQALRGPLYASLAQLYSHHQQYSQAIAFMSQAAEADTAAGVHPVVDRLV
FT                   ALAWLHMLCGNSLVAMDILKCISDAAVANKDQECVMMNMVAMALKRMGRTRQAAEGYFR
FT                   ALHMAYAQGHLQSQAVVLANFGALCLQAGARSLAQHYLREAVGLFSQVPSGVCGRDFTQ
FT                   VLLWLGQLCTRRALPQQAKCYYEWAFLVAVETDHLESQLQAVQKLCLFYSKVMPNEVRC
FT                   VIYHEFQLALARKTANKVLEGQLLEAISQLYLSLGTERAYKSALDYTKRSLGIFIDLQQ
FT                   KEKEARAWLQAGKIYYILRQNELVDLYIQVAQNAALYTGDPKLGLELFEAAGDIFFNGT
FT                   WEREKAVSFYRDRALPLAVTVGDQEVELRLCNKLVALLSALEAPQEGLEFAHEALALSI
FT                   TLGESSALSSAWPPVPGVEAWLLPSPAGTAQQLC"
FT   assembly_gap    9553450..9553469
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9562239..9562258
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <9562753..9689739
FT                   /gene="Ablim2"
FT                   /locus_tag="mCG_120156"
FT                   /note="gene_id=mCG120156.2"
FT   mRNA            join(<9562753..9562905,9603216..9603359,9607124..9607307,
FT                   9611781..9611896,9613925..9614051,9616874..9616974,
FT                   9624884..9625053,9628766..9628853,9632860..9632918,
FT                   9638033..9638110,9641918..9642067,9646250..9646370,
FT                   9648131..9648229,9654463..9654516,9661996..9662048,
FT                   9662694..9662832,9671555..9671616,9677940..9678003,
FT                   9679577..9679683,9688074..9689738)
FT                   /gene="Ablim2"
FT                   /locus_tag="mCG_120156"
FT                   /product="actin-binding LIM protein 2, transcript variant
FT                   mCT121342"
FT                   /note="gene_id=mCG120156.2 transcript_id=mCT121342.1
FT                   created on 03-OCT-2002"
FT   CDS             join(<9562755..9562905,9603216..9603359,9607124..9607307,
FT                   9611781..9611896,9613925..9614051,9616874..9616974,
FT                   9624884..9625053,9628766..9628853,9632860..9632918,
FT                   9638033..9638110,9641918..9642067,9646250..9646370,
FT                   9648131..9648229,9654463..9654516,9661996..9662048,
FT                   9662694..9662832,9671555..9671616,9677940..9678003,
FT                   9679577..9679683,9688074..9688187)
FT                   /codon_start=1
FT                   /gene="Ablim2"
FT                   /locus_tag="mCG_120156"
FT                   /product="actin-binding LIM protein 2, isoform CRA_a"
FT                   /note="gene_id=mCG120156.2 transcript_id=mCT121342.1
FT                   protein_id=mCP65355.1 isoform=CRA_a"
FT                   /protein_id="EDL37497.1"
FT                   /translation="VALRAAGTVCAEPLASSVLRILPAPHLPARSSGCRSAGTTLLGAA
FT                   ADMSAVSQPQAAHAPLEKPASTAILCNTCGNVCKGEVLRVQNKYFHIRCFVCKACGCDL
FT                   AEGGFFVRQGEHICTRDYQRLYGTRCFSCDRFIEGEVVSALGKTYHPDCFVCAVCRLPF
FT                   PPGDRVTFNGKECMCQKCSPPTLLGNSAHVAQGLRSCGGCGLEIKNGQALVALDKHWHL
FT                   GCFKCKTCGKLLNAEYISKDGLPYCEADYHSKFGIRCDGCEKYITGRVLEVRATITTKL
FT                   IRAINTDAISTMVLEVSPMTKIVIVTQAICTATARVSRTTWAHMKPWPSQAGEKHYHPS
FT                   CALCVRCGQMFSEGEEMYLQGSSIWHPACRQAARTEDKSKETRTSSESIVSVPASSTSG
FT                   SPSRVIYAKLGDEILDYRDLAALPKNKAIYNIDRPDMISYSPYISHSAVGDRQSYGEGD
FT                   QDDRSYKQCRTSSPSSAGSVSLGHYTPTSRSPQHYSRPAGTVSVGTSSCLSLSQHPSPT
FT                   SVFRHHYIPYFRDTGVKDNIYRKPPIYKQHAARRLDVEDSSFDQDSRKKTTWLLLKGDA
FT                   DTRTNSPDLDSQSLSLSSGTDQEPLQRMAGDSLYSRFPYSKPDTLPGPRKDGLDLRNAN
FT                   LAPCGADPDASWGTRGTHNNPVVSFLQIYPYDSLIVTNRIRVKLPKDVDRTRLERHLSP
FT                   EEFQEVFGMSIEEFDRLALWKRNDLKKKALLF"
FT   mRNA            join(<9562776..9562905,9603216..9603359,9607124..9607307,
FT                   9611781..9611896,9613925..9614051,9616874..9616967,
FT                   9628766..9628853,9632860..9632918,9638033..9638110,
FT                   9641918..9642067,9644759..9644791,9646250..9646370,
FT                   9648131..9648229,9653751..9653852,9654463..9654516,
FT                   9661996..9662048,9662694..9662836,9679603..9679683,
FT                   9688074..9689739)
FT                   /gene="Ablim2"
FT                   /locus_tag="mCG_120156"
FT                   /product="actin-binding LIM protein 2, transcript variant
FT                   mCT193591"
FT                   /note="gene_id=mCG120156.2 transcript_id=mCT193591.0
FT                   created on 09-MAR-2004"
FT   CDS             join(<9562776..9562905,9603216..9603359,9607124..9607307,
FT                   9611781..9611896,9613925..9614051,9616874..9616967,
FT                   9628766..9628853,9632860..9632918,9638033..9638110,
FT                   9641918..9642067,9644759..9644791,9646250..9646370,
FT                   9648131..9648229,9653751..9653852,9654463..9654516,
FT                   9661996..9662048,9662694..9662836,9679603..9679630)
FT                   /codon_start=1
FT                   /gene="Ablim2"
FT                   /locus_tag="mCG_120156"
FT                   /product="actin-binding LIM protein 2, isoform CRA_c"
FT                   /note="gene_id=mCG120156.2 transcript_id=mCT193591.0
FT                   protein_id=mCP114560.0 isoform=CRA_c"
FT                   /protein_id="EDL37499.1"
FT                   /translation="TVCAEPLASSVLRILPAPHLPARSSGCRSAGTTLLGAAADMSAVS
FT                   QPQAAHAPLEKPASTAILCNTCGNVCKGEVLRVQNKYFHIRCFVCKACGCDLAEGGFFV
FT                   RQGEHICTRDYQRLYGTRCFSCDRFIEGEVVSALGKTYHPDCFVCAVCRLPFPPGDRVT
FT                   FNGKECMCQKCSPPTLLGNSAHVAQGLRSCGGCGLEIKNGQALVALDKHWHLGCFKCKT
FT                   CGKLLNAEYISKDGLPYCEADYHSKFGIRCDGCEKYITGRVLEAGEKHYHPSCALCVRC
FT                   GQMFSEGEEMYLQGSSIWHPACRQAARTEDKSKETRTSSESIVSVPASSTSGSPSRVIY
FT                   AKLGDEILDYRDLAALPKNKAIYNIDRPDMISYSPYISHSAVGDRQSYGESPQLLSPTP
FT                   TEGDQDDRSYKQCRTSSPSSAGSVSLGHYTPTSRSPQHYSRPAGTVSVGTSSCLSLSQH
FT                   PSPTSVFRHHYIPYFRGSESGRSTPSLSVHSDSRPPSSTYQQAPRHFHVPDTGVKDNIY
FT                   RKPPIYKQHAARRLDVEDSSFDQDSRKKTTWLLLKGDADTRTNSPDLDSQSLSLSSGTD
FT                   QEPLQRMAGDSLYSREYIPMIPSS"
FT   mRNA            join(<9562804..9562905,9603216..9603359,9607124..9607307,
FT                   9611781..9611896,9613925..9614051,9616874..9616967,
FT                   9628766..9628853,9632860..9632918,9638033..9638110,
FT                   9641918..9642067,9646250..9646370,9648131..9648229,
FT                   9653751..9653852,9654463..9654516,9661996..9662048,
FT                   9662694..9662836,9679603..9679683,9688074..9689234)
FT                   /gene="Ablim2"
FT                   /locus_tag="mCG_120156"
FT                   /product="actin-binding LIM protein 2, transcript variant
FT                   mCT193590"
FT                   /note="gene_id=mCG120156.2 transcript_id=mCT193590.0
FT                   created on 09-MAR-2004"
FT   CDS             join(<9562806..9562905,9603216..9603359,9607124..9607307,
FT                   9611781..9611896,9613925..9614051,9616874..9616967,
FT                   9628766..9628853,9632860..9632918,9638033..9638110,
FT                   9641918..9642067,9646250..9646370,9648131..9648229,
FT                   9653751..9653852,9654463..9654516,9661996..9662048,
FT                   9662694..9662836,9679603..9679630)
FT                   /codon_start=1
FT                   /gene="Ablim2"
FT                   /locus_tag="mCG_120156"
FT                   /product="actin-binding LIM protein 2, isoform CRA_b"
FT                   /note="gene_id=mCG120156.2 transcript_id=mCT193590.0
FT                   protein_id=mCP114559.0 isoform=CRA_b"
FT                   /protein_id="EDL37498.1"
FT                   /translation="VLRILPAPHLPARSSGCRSAGTTLLGAAADMSAVSQPQAAHAPLE
FT                   KPASTAILCNTCGNVCKGEVLRVQNKYFHIRCFVCKACGCDLAEGGFFVRQGEHICTRD
FT                   YQRLYGTRCFSCDRFIEGEVVSALGKTYHPDCFVCAVCRLPFPPGDRVTFNGKECMCQK
FT                   CSPPTLLGNSAHVAQGLRSCGGCGLEIKNGQALVALDKHWHLGCFKCKTCGKLLNAEYI
FT                   SKDGLPYCEADYHSKFGIRCDGCEKYITGRVLEAGEKHYHPSCALCVRCGQMFSEGEEM
FT                   YLQGSSIWHPACRQAARTEDKSKETRTSSESIVSVPASSTSGSPSRVIYAKLGDEILDY
FT                   RDLAALPKNKAIYNIDRPDMISYSPYISHSAVGDRQSYGEGDQDDRSYKQCRTSSPSSA
FT                   GSVSLGHYTPTSRSPQHYSRPAGTVSVGTSSCLSLSQHPSPTSVFRHHYIPYFRGSESG
FT                   RSTPSLSVHSDSRPPSSTYQQAPRHFHVPDTGVKDNIYRKPPIYKQHAARRLDVEDSSF
FT                   DQDSRKKTTWLLLKGDADTRTNSPDLDSQSLSLSSGTDQEPLQRMAGDSLYSREYIPMI
FT                   PSS"
FT   assembly_gap    9634159..9635248
FT                   /estimated_length=1090
FT                   /gap_type="unknown"
FT   assembly_gap    9636461..9636571
FT                   /estimated_length=111
FT                   /gap_type="unknown"
FT   assembly_gap    9658763..9658782
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9665727..9666011
FT                   /estimated_length=285
FT                   /gap_type="unknown"
FT   assembly_gap    9667636..9668181
FT                   /estimated_length=546
FT                   /gap_type="unknown"
FT   assembly_gap    9669294..9669453
FT                   /estimated_length=160
FT                   /gap_type="unknown"
FT   assembly_gap    9676102..9676406
FT                   /estimated_length=305
FT                   /gap_type="unknown"
FT   gene            <9697956..9812849
FT                   /gene="2600003E23Rik"
FT                   /locus_tag="mCG_120157"
FT                   /note="gene_id=mCG120157.1"
FT   mRNA            join(<9697956..9698104,9743342..9743470,9743828..9743922,
FT                   9754170..9754278,9757017..9757228,9759842..9760021,
FT                   9770771..9770872,9771230..9771311,9777584..9777733,
FT                   9783402..9783613,9785451..9785596,9793196..9793313,
FT                   9798572..9798686,9802471..9802635,9804887..9805077,
FT                   9806448..9806612,9808629..9812849)
FT                   /gene="2600003E23Rik"
FT                   /locus_tag="mCG_120157"
FT                   /product="RIKEN cDNA 2600003E23, transcript variant
FT                   mCT193592"
FT                   /note="gene_id=mCG120157.1 transcript_id=mCT193592.0
FT                   created on 09-MAR-2004"
FT   mRNA            join(9698054..9698104,9743342..9743470,9743828..9743922,
FT                   9754170..9754278,9757017..9757228,9759842..9760021,
FT                   9770771..9770872,9771230..9771311,9777584..9777733,
FT                   9783402..9783613,9785451..9785596,9798619..9798686,
FT                   9802471..9802635,9804887..9805077,9806448..9806612,
FT                   9810856..9812843)
FT                   /gene="2600003E23Rik"
FT                   /locus_tag="mCG_120157"
FT                   /product="RIKEN cDNA 2600003E23, transcript variant
FT                   mCT121343"
FT                   /note="gene_id=mCG120157.1 transcript_id=mCT121343.1
FT                   created on 26-SEP-2002"
FT   CDS             join(<9698104..9698104,9743342..9743470,9743828..9743922,
FT                   9754170..9754278,9757017..9757228,9759842..9760021,
FT                   9770771..9770872,9771230..9771311,9777584..9777733,
FT                   9783402..9783613,9785451..9785596,9793196..9793313,
FT                   9798572..9798686,9802471..9802635,9804887..9805077,
FT                   9806448..9806612,9808629..9808655)
FT                   /codon_start=1
FT                   /gene="2600003E23Rik"
FT                   /locus_tag="mCG_120157"
FT                   /product="RIKEN cDNA 2600003E23, isoform CRA_b"
FT                   /note="gene_id=mCG120157.1 transcript_id=mCT193592.0
FT                   protein_id=mCP114561.0 isoform=CRA_b"
FT                   /protein_id="EDL37501.1"
FT                   /translation="AMEELIVELRLFLELLDHEYLTSTVREKKAVLTNILLRLQSSKGF
FT                   EVKDHAQKAEANNLPAPPQMPLPEIPQPWLPPDSGPPPLPTSSLPEGYYEEAVPLSPGK
FT                   APEYITSNYDSDAMSSSYESYDEEEEDGKGKKTRHQWPSEEASMDLVKDAKICAFLLRK
FT                   KRFGQWTKLLCVIKDTKLLCYKSSKDQQPQMELPLQGCSITYIPRDSKKKKHELKITQQ
FT                   GTDPLVLAVQSKEQAEQWLKVIKEAYSGCSGPVDPECSPPPSTSAPVNKAELEKKLSSE
FT                   RPSSDGEGGVENGVTTCNGKEQAKRKKPSKSEAKGTVSKVTGKKITKIIGLGKKKPSTD
FT                   EQTSSAEEDVPTCGYLNVLSNSRWRERWCRVKDSKLILHKDRADLKTHLVSIPLRGCEV
FT                   IPGLDSKHPLTFRLLRNGQEVAVLEASSSEDMGRWIGILLAETGSSTDPGALHYDYIDV
FT                   EMSANVIQTAKQTFCFMNRRAVSTSPYLGSLSNGYAHPSGTALHYDDVPCVNGSLKNKK
FT                   PPASSNGVPVKGKAPSSQQKKVETAGGVKRTASNAEQYKYGKNRVEADAKRLQSKEEEL
FT                   LKRKEALRNRLAQLRKERKDLRAAIEVNAGRKTQAALEDKLKRLEEECKQREAERVSLE
FT                   LELTEVKESLKKALAGGVTLGLAIEPRSGTSSPQSPVFRHRTLENSPISSCDTSDAEGP
FT                   LPVNSAAVLKKSQPSSGSSPCRGHVLQKAKEWELKNGT"
FT   assembly_gap    9703991..9705565
FT                   /estimated_length=1575
FT                   /gap_type="unknown"
FT   assembly_gap    9706605..9706624
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9708125..9709066
FT                   /estimated_length=942
FT                   /gap_type="unknown"
FT   assembly_gap    9710277..9710296
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(9743344..9743470,9743828..9743922,9754170..9754278,
FT                   9757017..9757228,9759842..9760021,9770771..9770872,
FT                   9771230..9771311,9777584..9777733,9783402..9783613,
FT                   9785451..9785596,9798619..9798686,9802471..9802635,
FT                   9804887..9805077,9806448..9806612,9810856..9810993)
FT                   /codon_start=1
FT                   /gene="2600003E23Rik"
FT                   /locus_tag="mCG_120157"
FT                   /product="RIKEN cDNA 2600003E23, isoform CRA_a"
FT                   /note="gene_id=mCG120157.1 transcript_id=mCT121343.1
FT                   protein_id=mCP64576.1 isoform=CRA_a"
FT                   /protein_id="EDL37500.1"
FT                   /translation="MEELIVELRLFLELLDHEYLTSTVREKKAVLTNILLRLQSSKGFE
FT                   VKDHAQKAEANNLPAPPQMPLPEIPQPWLPPDSGPPPLPTSSLPEGYYEEAVPLSPGKA
FT                   PEYITSNYDSDAMSSSYESYDEEEEDGKGKKTRHQWPSEEASMDLVKDAKICAFLLRKK
FT                   RFGQWTKLLCVIKDTKLLCYKSSKDQQPQMELPLQGCSITYIPRDSKKKKHELKITQQG
FT                   TDPLVLAVQSKEQAEQWLKVIKEAYSGCSGPVDPECSPPPSTSAPVNKAELEKKLSSER
FT                   PSSDGEGGVENGVTTCNGKEQAKRKKPSKSEAKGTVSKVTGKKITKIIGLGKKKPSTDE
FT                   QTSSAEEDVPTCGYLNVLSNSRWRERWCRVKDSKLILHKDRADLKTHLVSIPLRGCEVI
FT                   PGLDSKHPLTFRLLRNGQEVAVLEASSSEDMGRWIGILLAETGSSTDPGALHYDYIDVE
FT                   MSANVIQTAKQTFWGKAPSSQQKKVETAGGVKRTASNAEQYKYGKNRVEADAKRLQSKE
FT                   EELLKRKEALRNRLAQLRKERKDLRAAIEVNAGRKTQAALEDKLKRLEEECKQREAERV
FT                   SLELELTEVKESLKKALAGGVTLGLAIEPRSGTSSPQSPVFRHRTLENSPISSCDTSDA
FT                   EGPLPVNSAAVLKKSQPSSGSSPCRGHVLQKAKAPMILSGFSVFSFYDPPKATSMTPAI
FT                   DDTGLPCVEPGKQRAEPFL"
FT   assembly_gap    9748131..9748150
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(9748260..9749594)
FT                   /pseudo
FT                   /locus_tag="mCG_50907"
FT                   /note="gene_id=mCG50907.2"
FT   mRNA            complement(9748260..9749594)
FT                   /pseudo
FT                   /locus_tag="mCG_50907"
FT                   /note="gene_id=mCG50907.2 transcript_id=mCT51090.2 created
FT                   on 03-OCT-2002"
FT   gene            complement(9826078..10209718)
FT                   /gene="Sorcs2"
FT                   /locus_tag="mCG_142529"
FT                   /note="gene_id=mCG142529.0"
FT   mRNA            complement(join(9826078..9828298,9830137..9830240,
FT                   9832902..9833004,9833477..9833576,9834718..9834843,
FT                   9835557..9835669,9836760..9836883,9837950..9838083,
FT                   9840050..9840236,9844593..9844764,9846321..9846449,
FT                   9847037..9847170,9848227..9848347,9851007..9851114,
FT                   9852371..9852462,9855410..9855486,9856729..9856831,
FT                   9859367..9859513,9864887..9865066,9871457..9871546,
FT                   9874258..9874376,9877011..9877075,9880272..9880345,
FT                   9886805..9886969,9963105..9963204,10041524..10041591,
FT                   10209147..10209718))
FT                   /gene="Sorcs2"
FT                   /locus_tag="mCG_142529"
FT                   /product="sortilin-related VPS10 domain containing receptor
FT                   2"
FT                   /note="gene_id=mCG142529.0 transcript_id=mCT180651.0
FT                   created on 19-FEB-2003"
FT   CDS             complement(join(9828234..9828298,9830137..9830240,
FT                   9832902..9833004,9833477..9833576,9834718..9834843,
FT                   9835557..9835669,9836760..9836883,9837950..9838083,
FT                   9840050..9840236,9844593..9844764,9846321..9846449,
FT                   9847037..9847170,9848227..9848347,9851007..9851114,
FT                   9852371..9852462,9855410..9855486,9856729..9856831,
FT                   9859367..9859513,9864887..9865066,9871457..9871546,
FT                   9874258..9874376,9877011..9877075,9880272..9880345,
FT                   9886805..9886969,9963105..9963204,10041524..10041591,
FT                   10209147..10209626))
FT                   /codon_start=1
FT                   /gene="Sorcs2"
FT                   /locus_tag="mCG_142529"
FT                   /product="sortilin-related VPS10 domain containing receptor
FT                   2"
FT                   /note="gene_id=mCG142529.0 transcript_id=mCT180651.0
FT                   protein_id=mCP103573.0"
FT                   /db_xref="GOA:Q9EPR5"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR006581"
FT                   /db_xref="InterPro:IPR031777"
FT                   /db_xref="InterPro:IPR031778"
FT                   /db_xref="MGI:MGI:1932289"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9EPR5"
FT                   /protein_id="EDL37502.1"
FT                   /translation="MAHRGPPSAPKRPGPTAPDRSFQALLPPCWPRSWPLLLLLLVLVA
FT                   ACGAMGRSPQPGRQGPGVQITRLLPAGRTESGDRKDPQARESEPSVPGLGPGSASGPST
FT                   DGAPAPGKGRRARAVPVAGAASASRAQVSLISTSFVLKGDATHNQAMVHWTGENSSVIL
FT                   ILTKYYHADMGKVLESSLWRSSDFGTTYTKLTLQPGVTTVIDNFYICPANKRKIILVSS
FT                   SLGDREQSLFLSTDEGATFQKYPVPFLVEMLLFHPKEEDKVLAYTKDSKLYVSSDLGKK
FT                   WTLLQERVTKDHVFWAVSGVDDDPNLVHVEAQDLSGGYRYYTCLIYNCSAQPHIAPFSG
FT                   PIDRGSLTVQDEYIFLKATSTNRTKYYVSYRRSDFVLMKLPKYALPKDLQIISTDEQQV
FT                   FVAVQEWNQVDTYNLYQSDLRGVRYSLVLENVRSSRQAEENVVIDILEVRGVKGVFLAN
FT                   QKVDGKVTTVITYNKGRDWDYLRPPSTDMNGKPTNCQPPDCYLHLHLRWADNPYVSGTV
FT                   HTKDTAPGLIMGAGNLGSQLVEYKEEMYITSDCGHTWRQVFEEEHHVLYLDHGGVIAAI
FT                   KDTSIPLKILKFSVDEGHTWSTHNFTSTSVFVDGLLSEPGDETLVMTVFGHISFRSDWE
FT                   LVKVDFRPSFPRQCGEDDYSSWDLTDLQGDHCIMGQQRSYRKRKSTSWCVKGRSFTSAL
FT                   TSRVCKCRDSDFLCDYGFERSSSSESTANKCSANFWFNPLSPPEDCVLGQTYTSSLGYR
FT                   KVVSNVCEGGVDLQQSPVQLQCPLQAPRGLQVSIRGEAVAVRPREDVLFVVRQEQGDVL
FT                   TTKYQVDLGDGFKAMYVNLTLTGEPIRHHYESPGIYRVSVRAENMAGHDEAVLFVQVNS
FT                   PLQALYLEVVPVIGVNQEVNLTAVLLPLNPNLTVFYWWIGHSLQPLLSLDNSVTTKFTD
FT                   AGDVRVTVQAACGNSVLQDSRLVRVLDQFQVVPLRFSRELDTFNPNTPEWREDVGLVVT
FT                   RLLSKETSIPEELLVTVVKPGLPTIADLYVLLPLPRPTRKRSLTSDKRLAAVQQALNSH
FT                   RISFILRGGLRILVELRDTDTGPQRPGGSGGYWAVVVLFVIGLFAVGAFILYKFKRKRP
FT                   GRTVYAQMHNEKEQEMTSPVSHSEDAQSTMQGNHSGVVLSINSREMHSYLVG"
FT   assembly_gap    9845446..9845576
FT                   /estimated_length=131
FT                   /gap_type="unknown"
FT   assembly_gap    9878176..9878199
FT                   /estimated_length=24
FT                   /gap_type="unknown"
FT   assembly_gap    9909812..9910000
FT                   /estimated_length=189
FT                   /gap_type="unknown"
FT   assembly_gap    9922544..9922864
FT                   /estimated_length=321
FT                   /gap_type="unknown"
FT   assembly_gap    9946331..9946572
FT                   /estimated_length=242
FT                   /gap_type="unknown"
FT   assembly_gap    9950432..9951035
FT                   /estimated_length=604
FT                   /gap_type="unknown"
FT   assembly_gap    9994092..9994111
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9997242..9997487
FT                   /estimated_length=246
FT                   /gap_type="unknown"
FT   assembly_gap    9999898..9999917
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10002201..10002220
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10011374..10011393
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            10016122..10018634
FT                   /gene="2310020A21Rik"
FT                   /locus_tag="mCG_56169"
FT                   /note="gene_id=mCG56169.1"
FT   mRNA            10016122..10018634
FT                   /gene="2310020A21Rik"
FT                   /locus_tag="mCG_56169"
FT                   /product="RIKEN cDNA 2310020A21"
FT                   /note="gene_id=mCG56169.1 transcript_id=mCT56352.1 created
FT                   on 01-OCT-2002"
FT   CDS             10016137..10017714
FT                   /codon_start=1
FT                   /gene="2310020A21Rik"
FT                   /locus_tag="mCG_56169"
FT                   /product="RIKEN cDNA 2310020A21"
FT                   /note="gene_id=mCG56169.1 transcript_id=mCT56352.1
FT                   protein_id=mCP26970.0"
FT                   /db_xref="GOA:A0A0R4J1A5"
FT                   /db_xref="InterPro:IPR003119"
FT                   /db_xref="InterPro:IPR007856"
FT                   /db_xref="InterPro:IPR008138"
FT                   /db_xref="InterPro:IPR008139"
FT                   /db_xref="InterPro:IPR008373"
FT                   /db_xref="InterPro:IPR011001"
FT                   /db_xref="InterPro:IPR021165"
FT                   /db_xref="MGI:MGI:1924193"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J1A5"
FT                   /protein_id="EDL37503.1"
FT                   /translation="MGTMLCALILWSGLLGAARASPISVPRECAKGSEVWCQDLQAAAK
FT                   CRAVRHCQSAVWNKPTVKSLPCSVCQDVAAAAGNGVNPGATESDILTSVMKTCEWLPSQ
FT                   ESSAKCKWMVNNHSAAVLSMLSGAQETDLASVCTALTLCEPLQRHLAETTSERPLTQED
FT                   ANEVMAPFLSNGALSFHPSQMPEGAVCHDCVQLISLLQDALESNLTLAEVTVQNQCQSM
FT                   GPGLAALCENYIHRQFVPAKQTLQGLPPQEVCRKGGFCERESAHWLTRVAAVDGVPSLE
FT                   MEMPRTNELQMQLGLTCDVCLNLVQELDKWLVTNSTEALISHTLERVCTVVPEPLVQQC
FT                   ITLVDTYSPELVQLMSKVTPEKVCETIKLCGSKRRARSISRAVATTPSLPVDEENQGSF
FT                   CQGCKRLLGMSSQNLDHKSTKRDILNAFKGGCRILPLPYVMQCNRFVAEYEPVLIESLK
FT                   FMMNPTDLCKKMGACHGPKTPLLGTDQCVMGPSFWCKSPEAAEMCNALEHCQRLVWKKP
FT                   VSKINEQP"
FT   assembly_gap    10028053..10028821
FT                   /estimated_length=769
FT                   /gap_type="unknown"
FT   assembly_gap    10053493..10056684
FT                   /estimated_length=3192
FT                   /gap_type="unknown"
FT   assembly_gap    10060546..10060667
FT                   /estimated_length=122
FT                   /gap_type="unknown"
FT   assembly_gap    10064987..10065006
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10073050..10073395
FT                   /estimated_length=346
FT                   /gap_type="unknown"
FT   assembly_gap    10079945..10080052
FT                   /estimated_length=108
FT                   /gap_type="unknown"
FT   assembly_gap    10086254..10086273
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10088344..10088564
FT                   /estimated_length=221
FT                   /gap_type="unknown"
FT   assembly_gap    10124547..10124566
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10129362..10129846
FT                   /estimated_length=485
FT                   /gap_type="unknown"
FT   assembly_gap    10157316..10157450
FT                   /estimated_length=135
FT                   /gap_type="unknown"
FT   assembly_gap    10159298..10159382
FT                   /estimated_length=85
FT                   /gap_type="unknown"
FT   assembly_gap    10171959..10171978
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10186018..10186136
FT                   /estimated_length=119
FT                   /gap_type="unknown"
FT   assembly_gap    10222111..10222370
FT                   /estimated_length=260
FT                   /gap_type="unknown"
FT   assembly_gap    10248029..10248217
FT                   /estimated_length=189
FT                   /gap_type="unknown"
FT   gene            complement(10270327..>10277127)
FT                   /locus_tag="mCG_1046120"
FT                   /note="gene_id=mCG1046120.1"
FT   mRNA            complement(join(10270327..10270676,10276790..>10277127))
FT                   /locus_tag="mCG_1046120"
FT                   /product="mCG1046120"
FT                   /note="gene_id=mCG1046120.1 transcript_id=mCT163824.1
FT                   created on 30-SEP-2002"
FT   CDS             complement(join(10270598..10270676,10276790..>10276914))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1046120"
FT                   /product="mCG1046120"
FT                   /note="gene_id=mCG1046120.1 transcript_id=mCT163824.1
FT                   protein_id=mCP65212.1"
FT                   /protein_id="EDL37504.1"
FT                   /translation="EKKTNSSVCRRASKIWVLMFGHCYGGGRRAESCRRTFSVLSRILE
FT                   LNLGSHACAAVSPQPPLILCLK"
FT   assembly_gap    10271844..10272526
FT                   /estimated_length=683
FT                   /gap_type="unknown"
FT   gene            10277271..10283970
FT                   /gene="Grpel1"
FT                   /locus_tag="mCG_7091"
FT                   /note="gene_id=mCG7091.1"
FT   mRNA            join(10277271..10277529,10281712..10281874,
FT                   10282876..10282957,10283330..10283970)
FT                   /gene="Grpel1"
FT                   /locus_tag="mCG_7091"
FT                   /product="GrpE-like 1, mitochondrial"
FT                   /note="gene_id=mCG7091.1 transcript_id=mCT6199.2 created on
FT                   18-SEP-2002"
FT   CDS             join(10277468..10277529,10281712..10281874,
FT                   10282876..10282957,10283330..10283676)
FT                   /codon_start=1
FT                   /gene="Grpel1"
FT                   /locus_tag="mCG_7091"
FT                   /product="GrpE-like 1, mitochondrial"
FT                   /note="gene_id=mCG7091.1 transcript_id=mCT6199.2
FT                   protein_id=mCP3957.1"
FT                   /protein_id="EDL37505.1"
FT                   /translation="MAARCVRLARRSLPALALSFRPSPRLLCTATKQKNNGQNLDEDLG
FT                   HCEPKTDPPSADKTLLEEKAKLEEQLRETMEKYKRALADTENLRQRSQKLVEEAKLYGI
FT                   QGFCKDLLEVADILEKATQSVPKEEISNNNPHLKSLYEGLVMTEVQIQKVFTKHGLLRL
FT                   DPIGAKFDPYEHEALFHTPVEGKEPGTVALVSKVGYKLHGRTLRPALVGVVKDA"
FT   gene            complement(10285917..10296369)
FT                   /locus_tag="mCG_49644"
FT                   /note="gene_id=mCG49644.2"
FT   mRNA            complement(join(10285917..10289236,10296074..10296369))
FT                   /locus_tag="mCG_49644"
FT                   /product="mCG49644"
FT                   /note="gene_id=mCG49644.2 transcript_id=mCT49827.2 created
FT                   on 03-OCT-2002"
FT   CDS             complement(join(10288244..10289236,10296074..10296343))
FT                   /codon_start=1
FT                   /locus_tag="mCG_49644"
FT                   /product="mCG49644"
FT                   /note="gene_id=mCG49644.2 transcript_id=mCT49827.2
FT                   protein_id=mCP26988.2"
FT                   /db_xref="GOA:D3Z4Z0"
FT                   /db_xref="InterPro:IPR000433"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017884"
FT                   /db_xref="MGI:MGI:3035274"
FT                   /db_xref="UniProtKB/TrEMBL:D3Z4Z0"
FT                   /protein_id="EDL37506.1"
FT                   /translation="MAELGKKYCVYCLAEVSPLRFRCTECQDIELCPECFSAGAEIGHH
FT                   RRYHGYQLVDGGRFTLWGPEAEGGWTSREEQLLLDAIEQFGFGNWEDMAAHVGASRTPQ
FT                   EVMEHYVSMYIHGNLGKACIPDTIPNRVTDHTCPSGGPLSPSLTTPLPPLDISVAEQQQ
FT                   LGYMPLRDDYEIEYDQDAETLISGLSVNYDDDDVEIELKRAHVDMYVRKLKERQRRKNI
FT                   ARDYNLVPAFLGKDKKEKEKTLKRKITKEEKELRLKLRPLYQFMSCKEFDDLFENMHKE
FT                   KMLRAKIRELQRYRRNGITKMEESAEYEAARHKRERRKENKNLASSKRGKEDGKDSEFA
FT                   AIENLPGFELLSDREKVLCSSLNLSPARYVTVKTIIIKDHLQKRQGIPSKSRLPSYLDK
FT                   VLKKRILNFLTESGWISRDAS"
FT   gene            10296874..10299487
FT                   /gene="Ccdc96"
FT                   /locus_tag="mCG_7088"
FT                   /note="gene_id=mCG7088.1"
FT   mRNA            10296874..10299487
FT                   /gene="Ccdc96"
FT                   /locus_tag="mCG_7088"
FT                   /product="coiled-coil domain containing 96"
FT                   /note="gene_id=mCG7088.1 transcript_id=mCT6205.1 created on
FT                   18-SEP-2002"
FT   CDS             10296938..10298692
FT                   /codon_start=1
FT                   /gene="Ccdc96"
FT                   /locus_tag="mCG_7088"
FT                   /product="coiled-coil domain containing 96"
FT                   /note="gene_id=mCG7088.1 transcript_id=mCT6205.1
FT                   protein_id=mCP3956.1"
FT                   /db_xref="InterPro:IPR025254"
FT                   /db_xref="MGI:MGI:1913967"
FT                   /db_xref="UniProtKB/TrEMBL:Q08AT2"
FT                   /protein_id="EDL37507.1"
FT                   /translation="MDSHYGDIEGKDRAEEGLARQSLEIKVSSEPLTPANPVEQEPEPK
FT                   PEPEPTQGREPESETQPVSDSSKAKDSEGIDYAHVEVPESPGAAETAGEAVSREPESLP
FT                   QTQPKTKPESKEPEDKDEDEDEDEDEDEDEDEDEDEDEDEGEERDRPEKPKGKGKREKR
FT                   KESRFRPSLPLTTIVEEGAAPGPQAAKEKARESLKKRDSEEIEGTDRERHKSTEEQLHP
FT                   GEAKEEEKQKGASTEEFEWTADVQKLQEQQLRGELVEQYHSLLVERNRYQRYNMYLQQK
FT                   IHETLRKKGLEAAAEPGDKSAEPESPEKEQAYLRYLAMLEELKKQEADDLEWYRQEVRE
FT                   LKQQCQEKQTRVEKEWRRFQALKKQVVMQVMGSCRTRGGRQAALREVEQLQALEDKKEK
FT                   EMSAVRLENVQLKQSLVHFETRMKAQEDLAEGLLLIDFEQLKIENQTFNEKVEERNEEL
FT                   LKLRTKVTSNVQIITHVKEKLSFIDTENSCKKAQLSEVDAQVALGRDLLTKTKQARDSL
FT                   RIDNVKLSQKCGLLGKESLLRDLEEKVEKTEMLNRRLESLKRHHAGLALSCKGVKQKIR
FT                   EAKTFLPS"
FT   assembly_gap    10303469..10304487
FT                   /estimated_length=1019
FT                   /gap_type="unknown"
FT   gene            complement(10304490..10399855)
FT                   /gene="Tbc1d14"
FT                   /locus_tag="mCG_7094"
FT                   /note="gene_id=mCG7094.1"
FT   mRNA            complement(join(10304490..10305071,10306975..10307233,
FT                   10316981..10317090,10319532..10319660,10320314..10320385,
FT                   10324408..10324502,10325993..10326073,10331225..10331331,
FT                   10332396..10332513,10334887..10334969,10336883..10337001,
FT                   10355239..10355359,10384934..10385675,10398422..10398476,
FT                   10399686..10399855))
FT                   /gene="Tbc1d14"
FT                   /locus_tag="mCG_7094"
FT                   /product="TBC1 domain family, member 14"
FT                   /note="gene_id=mCG7094.1 transcript_id=mCT6196.1 created on
FT                   03-APR-2003"
FT   CDS             complement(join(10305006..10305071,10306975..10307233,
FT                   10316981..10317090,10319532..10319660,10320314..10320385,
FT                   10324408..10324502,10325993..10326073,10331225..10331331,
FT                   10332396..10332513,10334887..10334969,10336883..10337001,
FT                   10355239..10355359,10384934..10385675,10398422..10398464))
FT                   /codon_start=1
FT                   /gene="Tbc1d14"
FT                   /locus_tag="mCG_7094"
FT                   /product="TBC1 domain family, member 14"
FT                   /note="gene_id=mCG7094.1 transcript_id=mCT6196.1
FT                   protein_id=mCP4017.2"
FT                   /db_xref="GOA:G3UVU5"
FT                   /db_xref="InterPro:IPR000195"
FT                   /db_xref="MGI:MGI:1098708"
FT                   /db_xref="UniProtKB/TrEMBL:G3UVU5"
FT                   /protein_id="EDL37508.1"
FT                   /translation="MRLYLDRFWGLMAKVSSGTKMTDGNLSTSMNGVALMGILDGRQGD
FT                   SLQDLQHLSIKAAPRSLSVPDYGPSLKLGALEDRHSLQSVDSGIPTLEIGNPEPVPCSV
FT                   VHVKRKQSESEIVPERAFQSACPLPSCTPSAPTCSEREQVVRKSSTFPRTGYDSVKLYS
FT                   PTSKALSRSDNVSVCSVSSLGTELSTTLSVSNEDILDLMVTSNSSAIVTLENDDDPQFT
FT                   DVTLSSINETSDLHQQDCVAETEEGRKLKLLHPFSHFFTRNLLARKQNARLDRQRDLGW
FT                   KLFGKVPLRETAQKDSKKTQKEYEDKAGRPSRPPSPKQNVRKNLDFEPLSTTALILEDR
FT                   PANLPAKPAEEAQKHRQQYEEMVLQAKKRELKEAQRRRKQLEERCKVEESIGNAVLTWN
FT                   NEILPNWETMWCSKKVRDLWWQGIPPSVRGKVWSLAIGNELNITHELFDICLARAKERW
FT                   RSLSTGGSEVENEDAGFSAADREASLELIKLDISRTFPNLCIFQQGGPYHDMLHSILGA
FT                   YTCYRPDVGYVQGMSFIAAVLILNLDTADAFIAFSNLLNKPCQMAFFRVDHGLMLTYFA
FT                   AFEVFFEENLPKLFAHFKKNNLTADIYLIDWIFTLYSKSLPLDLACRIWDVFCRDGEEF
FT                   LFRTALGILKLFEDILTRMDFIHSAQFLTRLPEDLPADEVFAAISTVQMQSRNKKWAQV
FT                   LSALQKDSREMEKGSPSLRH"
FT   assembly_gap    10372705..10372724
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10374731..10374750
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(10414115..10456225)
FT                   /locus_tag="mCG_7090"
FT                   /note="gene_id=mCG7090.1"
FT   mRNA            complement(join(10414115..10416430,10418138..10418235,
FT                   10421564..10421672,10426865..10430153,10432361..10432442,
FT                   10433282..10433348,10443285..10443419,10455730..10456225))
FT                   /locus_tag="mCG_7090"
FT                   /product="mCG7090, transcript variant mCT6198"
FT                   /note="gene_id=mCG7090.1 transcript_id=mCT6198.2 created on
FT                   26-SEP-2002"
FT   mRNA            complement(join(10414115..10416430,10421564..10421672,
FT                   10426865..10426970))
FT                   /locus_tag="mCG_7090"
FT                   /product="mCG7090, transcript variant mCT173730"
FT                   /note="gene_id=mCG7090.1 transcript_id=mCT173730.0 created
FT                   on 26-SEP-2002"
FT   CDS             complement(join(10416251..10416430,10418138..10418235,
FT                   10421564..10421672,10426865..10430153,10432361..10432442,
FT                   10433282..10433348,10443285..10443419,10455730..10455960))
FT                   /codon_start=1
FT                   /locus_tag="mCG_7090"
FT                   /product="mCG7090, isoform CRA_b"
FT                   /note="gene_id=mCG7090.1 transcript_id=mCT6198.2
FT                   protein_id=mCP3916.2 isoform=CRA_b"
FT                   /db_xref="InterPro:IPR027871"
FT                   /db_xref="MGI:MGI:1261849"
FT                   /db_xref="UniProtKB/TrEMBL:B9EKS3"
FT                   /protein_id="EDL37510.1"
FT                   /translation="MRPVCTVVVDGLPSESTSSSYPGPVSVSDMSLLHALGPVQTWLGQ
FT                   ELEKCGIDAMIYSRYILSLLLHDSYDYDLQEQENDILSWEKGAYKKWGRSKKKCSDLTL
FT                   EEMKKQAAVQCLRSASDESSGIETLVEELCCRLKDLQSEQEEKIHKKLEGSPSPEEELS
FT                   PTAKDQVEMYYEAFPPLSEKPVCLQEIMTVWNKSKPCSYSSSSSSSTVPPASTDTSSPK
FT                   DCNSESEAVRERSSVASVPMHEKAQSRSRHEKESKLSSSTIEEKPAFYKRQIRHKPEGK
FT                   TRPRSWSSGSSEAGSSSSGNQGELKASMKYVKVRHKAREIRNRKGRNGQNRHSLKHCGK
FT                   AERGVHAGSGGSSSSSSNGSIRQLCKRGKRPAKETGRSDSGNTAVKDLYVDSRNNKEYK
FT                   EEPLWYTEPIAEYFVPLSRKSKLETTYRNREDTSTLTAEAVEDLSDSVRGLCISNSNIH
FT                   RTYLAAGTFIDGHFVEMPAVINEDIDLAGTSLCSLPEDNKYLDDIHLSELTHFYEVDID
FT                   QSMLDPGASETMQGESRILNMIRQKSKENTDFEAECCIVLDGMELQGERAIWTDSTSSV
FT                   GAEGFFLQDLGNLAQFWECCSSSSGDADGESFGGDSPVRLSPILDSTMLSSHILAGNQE
FT                   PFSNINEGSGINSCFSVFEVQCSNSVLPFSFETLNLGSEHADSSANMLGKTQSRLLIWT
FT                   KNSAFEENEHCSNLSTRTCSPWSHSEEARSDNETLNIQFEESTQFTAEDINYVVPRVSS
FT                   DFVDEELLDFLQDETCQQNSRTLGEIPTLVFKKRSKLESVCGIQLEQKAESKNFETTHA
FT                   CSESSPHGDGYSSGVIKDIWTKMVGRSSVAAVETERTGEELFSTDVNNYCCCLDTEAKM
FT                   EALQEPSRAVQRSEYHLWEGQKENMEKRAFVSSELSKVDGGDYTTPSKPWDVAQDKENT
FT                   FILGGVYGELKTFNSDGEWAVVPPGHTKGSLLQCAASDVVTIAGTDVFMTPGNSFAPGH
FT                   RQLWKPFVSFEQSDMPKRGENGVNKGFSFIFHEDLLGACSNFQVEDPGLEYSLSSFDLS
FT                   NPFSQVLHVECSFEPEGIASFSPSFKPKSILCSDSDSEVFHPRICGVERTQYRAIRISP
FT                   RTHFRPISASELSPGGGSESEFESEKDEASVPIPSHVDVFEDPQADLKPLEEDAEKEGH
FT                   YYGKLELESGKFLPRLKKSGMEKSAQTSLDSQEEATGILPKQNQCLECNFNESLEINLE
FT                   SSAANCKIMTQCEEEMSEFCSCKAGCQFPACEDNPVSSGQLEEFPVLNTDVQEVTRNQE
FT                   KQSWWEKALYSPLFPTSECEECYTNAKGENGIEECPDAKETPSREERLLDFNRVSSVYE
FT                   ARCTGERGSETKPNGLHRKMCSSASSDTGDTGSEAGGEWVGPSREELFSRTHL"
FT   CDS             complement(join(10416414..10416430,10421564..10421672,
FT                   10426865..10426969))
FT                   /codon_start=1
FT                   /locus_tag="mCG_7090"
FT                   /product="mCG7090, isoform CRA_a"
FT                   /note="gene_id=mCG7090.1 transcript_id=mCT173730.0
FT                   protein_id=mCP96649.0 isoform=CRA_a"
FT                   /protein_id="EDL37509.1"
FT                   /translation="MTQCEEEMSEFCSCKAGCQFPACEDNPVSSGQLEEFPVLNTDVQE
FT                   VTRNQEKQSWWEKALYSPLFPTSECEGVFCL"
FT   assembly_gap    10439758..10439777
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10478848..10479062
FT                   /estimated_length=215
FT                   /gap_type="unknown"
FT   assembly_gap    10480851..10481840
FT                   /estimated_length=990
FT                   /gap_type="unknown"
FT   assembly_gap    10508062..10508316
FT                   /estimated_length=255
FT                   /gap_type="unknown"
FT   assembly_gap    10523812..10523915
FT                   /estimated_length=104
FT                   /gap_type="unknown"
FT   gene            complement(10529736..10531198)
FT                   /gene="Cno"
FT                   /locus_tag="mCG_51007"
FT                   /note="gene_id=mCG51007.3"
FT   mRNA            complement(10529736..10531198)
FT                   /gene="Cno"
FT                   /locus_tag="mCG_51007"
FT                   /product="cappuccino"
FT                   /note="gene_id=mCG51007.3 transcript_id=mCT51190.3 created
FT                   on 02-JUL-2003"
FT   CDS             complement(10530531..10531178)
FT                   /codon_start=1
FT                   /gene="Cno"
FT                   /locus_tag="mCG_51007"
FT                   /product="cappuccino"
FT                   /note="gene_id=mCG51007.3 transcript_id=mCT51190.3
FT                   protein_id=mCP27229.3"
FT                   /protein_id="EDL37511.1"
FT                   /translation="MEEGPAVGTLSREVSTEEAEPLGAAWSGDSGHVSQSHSSASGPWD
FT                   DDGPEDAPGRDLPLLRRAASGYASSLLPSAGPRPEVEALDASLEELLAKVDEFVGMLDM
FT                   IRGDSSHVVGEGVPRIHAKAAEMRRIYGRIDKLEAFVRMIGSSVARMEEQVAKAEAELG
FT                   TFPRAFRRLLHTISVPALFRSAPSGPQRAAYEPPVLFRTEDHFPGCGDRPQL"
FT   assembly_gap    10537175..10537244
FT                   /estimated_length=70
FT                   /gap_type="unknown"
FT   assembly_gap    10549123..10549142
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10561234..10561495
FT                   /estimated_length=262
FT                   /gap_type="unknown"
FT   assembly_gap    10563716..10563884
FT                   /estimated_length=169
FT                   /gap_type="unknown"
FT   gene            complement(10577446..10579284)
FT                   /locus_tag="mCG_20618"
FT                   /note="gene_id=mCG20618.0"
FT   mRNA            complement(join(10577446..10578523,10578782..10579284))
FT                   /locus_tag="mCG_20618"
FT                   /product="mCG20618"
FT                   /note="gene_id=mCG20618.0 transcript_id=mCT22274.0 created
FT                   on 18-SEP-2002"
FT   CDS             complement(10578795..10579172)
FT                   /codon_start=1
FT                   /locus_tag="mCG_20618"
FT                   /product="mCG20618"
FT                   /note="gene_id=mCG20618.0 transcript_id=mCT22274.0
FT                   protein_id=mCP4177.1"
FT                   /protein_id="EDL37512.1"
FT                   /translation="MRPLDAVELAEPEEVEVLEPEEDFEQFLLPVIHEMREDIASLTRE
FT                   RGRAPARNRGKLWEMDNMLIQIKTQVEASEESALNHLQGAGGAEPRGPRAEKADEKAQE
FT                   MAKMAEMLVQLVRRIEKSESS"
FT   assembly_gap    10587787..10588174
FT                   /estimated_length=388
FT                   /gap_type="unknown"
FT   gene            complement(10589371..10613254)
FT                   /gene="Man2b2"
FT                   /locus_tag="mCG_20620"
FT                   /note="gene_id=mCG20620.3"
FT   mRNA            complement(join(10589371..10589768,10590344..10590461,
FT                   10591563..10591675,10592851..10592967,10595570..10595783,
FT                   10595892..10596002,10596355..10596601,10596952..10597143,
FT                   10597942..10598216,10598682..10598866,10600179..10600320,
FT                   10601085..10601275,10603505..10603703,10604460..10604637,
FT                   10606715..10606830,10608663..10608835,10610487..10610592,
FT                   10612251..10612397,10613062..10613251))
FT                   /gene="Man2b2"
FT                   /locus_tag="mCG_20620"
FT                   /product="mannosidase 2, alpha B2, transcript variant
FT                   mCT22275"
FT                   /note="gene_id=mCG20620.3 transcript_id=mCT22275.2 created
FT                   on 17-JUN-2003"
FT   mRNA            complement(join(10589427..10589768,10590344..10590461,
FT                   10591563..10591675,10592851..10592967,10595570..10595783,
FT                   10595892..10596002,10596355..10596601,10596952..10597143,
FT                   10597942..10598216,10598682..10598866,10600179..10600320,
FT                   10601085..10601275,10603505..10603557,10610515..10610592,
FT                   10612251..10612397,10613062..10613254))
FT                   /gene="Man2b2"
FT                   /locus_tag="mCG_20620"
FT                   /product="mannosidase 2, alpha B2, transcript variant
FT                   mCT185801"
FT                   /note="gene_id=mCG20620.3 transcript_id=mCT185801.0 created
FT                   on 17-JUN-2003"
FT   CDS             complement(join(10589674..10589768,10590344..10590461,
FT                   10591563..10591675,10592851..10592967,10595570..10595783,
FT                   10595892..10596002,10596355..10596601,10596952..10597143,
FT                   10597942..10598216,10598682..10598866,10600179..10600320,
FT                   10601085..10601275,10603505..10603703,10604460..10604637,
FT                   10606715..10606830,10608663..10608835,10610487..10610592,
FT                   10612251..10612397,10613062..10613199))
FT                   /codon_start=1
FT                   /gene="Man2b2"
FT                   /locus_tag="mCG_20620"
FT                   /product="mannosidase 2, alpha B2, isoform CRA_c"
FT                   /note="gene_id=mCG20620.3 transcript_id=mCT22275.2
FT                   protein_id=mCP4179.1 isoform=CRA_c"
FT                   /protein_id="EDL37515.1"
FT                   /translation="MGPLRWLPLLGQLLLLWPRAAQPAGPIRAFVVPHSHMDVGWVFTV
FT                   QESMRAYAANVYTTVVAELVRGGQRRFIAVEQEFFRLWWDGVASEQQKQQVRQLLHEGR
FT                   LEFVLGGQVMHDEAVTHLDDQILQLTEGHGFLYETFGIRPQFSWHVDPFGASATTPTLF
FT                   ALAGFNAHLISRIDYDLKDAMQEAQMLQFVWHGSPSLSGQQEIFTHVMDHYSYCTPSHI
FT                   PFSNRSGFYWNGVAVFPEPPPDGVYPNMSEPVTGANIHLYAEALVANVKQRAAWFRTPH
FT                   VLWPWGCDKQFFNASVQFDNMDPLLDYINQRTAQFGISVQYATLNDYFQALHATNMTWG
FT                   IRDHQDFLPYSSEPLQAWTGFYTSRSTLKGLARQASALLYAGESMFTRYMWPDPSGTLD
FT                   PTWALQQLQQLRWAVSEVQHHDAITGTESPKVKNMYTEHLRMGMLGVRKLMVSIALGGP
FT                   PGSGTGAPKDIMGPQVTPVLSVDTRPVGYSASVYNPLAWKITTIITLTVAFPNVSVTDE
FT                   LGHPVSTQIQNSTKDPSAYDLLILTTIPGLNYRHYQVMHARGDQAGTRELVAPRANTLK
FT                   FSLKLRNQPSQEGKRLVPVMNDCYILLFDQDTNMLHSIQDRQSNRTVRMTQEFLEYQAN
FT                   WDVKQGPISDNYLFAPNNTAEPSWEAVGMEMVAGTLVTDIRQYFYRYITDQEYIYSIHT
FT                   RLAHPSLAGELLCQRIEQQYRVGPLDLNREAILRTSSDLNSQQVLYSDNNGYQMQRRPY
FT                   KAFKSNPIPRNYYPMVQSAFIEDDKSRLVLLAERPHGVSSQGNGQVEVMLHRRLWNNLA
FT                   WDLKYNLTLNDTSIVHPVLWLMLGPKSTMTALHPRSGVALQHGPVVLLKELADEETPVH
FT                   GPHNPWPVTLPPNLHLQILSVPGWTYSRSHAQHLRNLQRGHPEKPQANLQRVLLRLRHL
FT                   YEAGEDPVLSRPATVDLKVVLRGLGSVVAVEERSLTGTWDVQMLQRWHWSTKTDHLKGH
FT                   PTSPPRPPGGSIITVYPKEIRTFFIKFQQ"
FT   mRNA            complement(join(10591364..10591675,10592851..10592967,
FT                   10595570..10595783,10595892..10595939,10603644..10603703,
FT                   10604460..10604637,10606715..10606830,10608663..10608835,
FT                   10610487..10610592,10612251..10612397,10613062..10613254))
FT                   /gene="Man2b2"
FT                   /locus_tag="mCG_20620"
FT                   /product="mannosidase 2, alpha B2, transcript variant
FT                   mCT185800"
FT                   /note="gene_id=mCG20620.3 transcript_id=mCT185800.0 created
FT                   on 17-JUN-2003"
FT   mRNA            complement(join(10591373..10591675,10592851..10592917,
FT                   10595570..10595783,10595892..10596002,10596355..10596601,
FT                   10596952..10597143,10597942..10598216,10598682..10598866,
FT                   10600179..10600320,10601085..10601275,10603505..10603703,
FT                   10604460..10604637,10606715..10606830,10608663..10608835,
FT                   10610487..10610592,10612251..10612397,10613062..10613234))
FT                   /gene="Man2b2"
FT                   /locus_tag="mCG_20620"
FT                   /product="mannosidase 2, alpha B2, transcript variant
FT                   mCT173418"
FT                   /note="gene_id=mCG20620.3 transcript_id=mCT173418.1 created
FT                   on 17-JUN-2003"
FT   CDS             complement(join(10591497..10591675,10592851..10592967,
FT                   10595570..10595783,10595892..10595939,10603644..10603703,
FT                   10604460..10604637,10606715..10606830,10608663..10608835,
FT                   10610487..10610592,10612251..10612397,10613062..10613199))
FT                   /codon_start=1
FT                   /gene="Man2b2"
FT                   /locus_tag="mCG_20620"
FT                   /product="mannosidase 2, alpha B2, isoform CRA_b"
FT                   /note="gene_id=mCG20620.3 transcript_id=mCT185800.0
FT                   protein_id=mCP107058.0 isoform=CRA_b"
FT                   /protein_id="EDL37514.1"
FT                   /translation="MGPLRWLPLLGQLLLLWPRAAQPAGPIRAFVVPHSHMDVGWVFTV
FT                   QESMRAYAANVYTTVVAELVRGGQRRFIAVEQEFFRLWWDGVASEQQKQQVRQLLHEGR
FT                   LEFVLGGQVMHDEAVTHLDDQILQLTEGHGFLYETFGIRPQFSWHVDPFGASATTPTLF
FT                   ALAGFNAHLISRIDYDLKDAMQEAQMLQFVWHGSPSLSGQQEIFTHVMDHYSYCTPSHI
FT                   PFSNRSGFYWNGVAVFPEPPPDGVYPNMSEPVTGANIHLYAEALVANVKQRAAWFRTPH
FT                   VLWPWGCDKQFFNASVQFDNMDPLLAERPHGVSSQGNGQVEVMLHRRLWNNLAWDLKYN
FT                   LTLNDTSIVHPVLWLMLGPKSTMTALHPRSGVALQHGPVVLLKELADEETPVHGPHNPW
FT                   PVTLPPNLHLQILSVPGWTYSRSHAQHLRNLQRGHPEKPQANLQRVLLRLRHLYEAGED
FT                   PVLSRPATVDLKVNSPCLPHPSKNALPRGSNPA"
FT   CDS             complement(join(10591612..10591675,10592851..10592917,
FT                   10595570..10595783,10595892..10596002,10596355..10596601,
FT                   10596952..10597143,10597942..10598216,10598682..10598866,
FT                   10600179..10600320,10601085..10601275,10603505..10603703,
FT                   10604460..10604637,10606715..10606830,10608663..10608835,
FT                   10610487..10610592,10612251..10612397,10613062..10613199))
FT                   /codon_start=1
FT                   /gene="Man2b2"
FT                   /locus_tag="mCG_20620"
FT                   /product="mannosidase 2, alpha B2, isoform CRA_a"
FT                   /note="gene_id=mCG20620.3 transcript_id=mCT173418.1
FT                   protein_id=mCP96337.1 isoform=CRA_a"
FT                   /protein_id="EDL37513.1"
FT                   /translation="MGPLRWLPLLGQLLLLWPRAAQPAGPIRAFVVPHSHMDVGWVFTV
FT                   QESMRAYAANVYTTVVAELVRGGQRRFIAVEQEFFRLWWDGVASEQQKQQVRQLLHEGR
FT                   LEFVLGGQVMHDEAVTHLDDQILQLTEGHGFLYETFGIRPQFSWHVDPFGASATTPTLF
FT                   ALAGFNAHLISRIDYDLKDAMQEAQMLQFVWHGSPSLSGQQEIFTHVMDHYSYCTPSHI
FT                   PFSNRSGFYWNGVAVFPEPPPDGVYPNMSEPVTGANIHLYAEALVANVKQRAAWFRTPH
FT                   VLWPWGCDKQFFNASVQFDNMDPLLDYINQRTAQFGISVQYATLNDYFQALHATNMTWG
FT                   IRDHQDFLPYSSEPLQAWTGFYTSRSTLKGLARQASALLYAGESMFTRYMWPDPSGTLD
FT                   PTWALQQLQQLRWAVSEVQHHDAITGTESPKVKNMYTEHLRMGMLGVRKLMVSIALGGP
FT                   PGSGTGAPKDIMGPQVTPVLSVDTRPVGYSASVYNPLAWKITTIITLTVAFPNVSVTDE
FT                   LGHPVSTQIQNSTKDPSAYDLLILTTIPGLNYRHYQVMHARGDQAGTRELVAPRANTLK
FT                   FSLKLRNQPSQEGKRLVPVMNDCYILLFDQDTNMLHSIQDRQSNRTVRMTQEFLEYQAN
FT                   WDVKQGPISDNYLFAPNNTAEPSWEAVGMEMVAGTLVTDIRQYFYRYITDQEYIYSIHT
FT                   RLAHPSLAGELLCQRIEQQYRVGPLDLNREAILRTSSDLNSQQVLYSDNNGYQMQRRPY
FT                   KAFKSNPIPRNYYPMVQSAFIEDDKSRLVLLAERPHGVSSQGNGQVEVMLHRRLWNNLA
FT                   WDLKYNLTLNDTSIVHPVLWLMLGPKSTMTALHPRSGVALQHGPVVLLKELADEETPVH
FT                   DPQRTWLDVQQEPCPAPEEPSERPPGEATGQPAKGAAAPAPPV"
FT   assembly_gap    10593852..10594025
FT                   /estimated_length=174
FT                   /gap_type="unknown"
FT   CDS             complement(join(10603534..10603557,10610515..10610592,
FT                   10612251..10612397,10613062..10613199))
FT                   /codon_start=1
FT                   /gene="Man2b2"
FT                   /locus_tag="mCG_20620"
FT                   /product="mannosidase 2, alpha B2, isoform CRA_d"
FT                   /note="gene_id=mCG20620.3 transcript_id=mCT185801.0
FT                   protein_id=mCP107059.0 isoform=CRA_d"
FT                   /protein_id="EDL37516.1"
FT                   /translation="MGPLRWLPLLGQLLLLWPRAAQPAGPIRAFVVPHSHMDVGWVFTV
FT                   QESMRAYAANVYTTVVAELVRGGQRRFIAVEQEFFRLWWDGVASEQQKQQVRQLLHEGR
FT                   LEFVLGGQVMHDEAVTHQHDLGHP"
FT   assembly_gap    10617364..10617383
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10635178..10635205
FT                   /estimated_length=28
FT                   /gap_type="unknown"
FT   assembly_gap    10636777..10636796
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10650946..10651823
FT                   /estimated_length=878
FT                   /gap_type="unknown"
FT   gene            complement(10656417..>10659701)
FT                   /locus_tag="mCG_145579"
FT                   /note="gene_id=mCG145579.0"
FT   mRNA            complement(join(10656417..10656592,10657681..10657779,
FT                   10658486..>10659701))
FT                   /locus_tag="mCG_145579"
FT                   /product="mCG145579"
FT                   /note="gene_id=mCG145579.0 transcript_id=mCT185003.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(10658784..>10659137)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145579"
FT                   /product="mCG145579"
FT                   /note="gene_id=mCG145579.0 transcript_id=mCT185003.0
FT                   protein_id=mCP105610.0"
FT                   /protein_id="EDL37517.1"
FT                   /translation="ETCLEISRLDSIVRFAPQTWCRVLANCPGCAPQDQPCSQAWKTTG
FT                   PHAKLEKQLQSCLYNDITVVIKNRPRHGDRLSGSLQAAGMGSPEDLSPANSHLPHLLSS
FT                   QQNPREKARIRSR"
FT   assembly_gap    10669556..10669575
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10676978..10676997
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10696646..10696665
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <10706212..10738159
FT                   /gene="Ppp2r2c"
FT                   /locus_tag="mCG_119862"
FT                   /note="gene_id=mCG119862.1"
FT   mRNA            join(<10706212..10706309,10709736..10709901,
FT                   10710982..10711094,10714695..10714872,10723171..10723335,
FT                   10730239..10730408,10732724..10732815,10735434..10738159)
FT                   /gene="Ppp2r2c"
FT                   /locus_tag="mCG_119862"
FT                   /product="protein phosphatase 2 (formerly 2A), regulatory
FT                   subunit B (PR 52), gamma isoform"
FT                   /note="gene_id=mCG119862.1 transcript_id=mCT121040.1
FT                   created on 03-OCT-2002"
FT   CDS             join(<10706214..10706309,10709736..10709901,
FT                   10710982..10711094,10714695..10714872,10723171..10723335,
FT                   10730239..10730408,10732724..10732815,10735434..10735725)
FT                   /codon_start=1
FT                   /gene="Ppp2r2c"
FT                   /locus_tag="mCG_119862"
FT                   /product="protein phosphatase 2 (formerly 2A), regulatory
FT                   subunit B (PR 52), gamma isoform"
FT                   /note="gene_id=mCG119862.1 transcript_id=mCT121040.1
FT                   protein_id=mCP64937.1"
FT                   /protein_id="EDL37518.1"
FT                   /translation="DVISTVEFNHTGELLATGDKGGRVVIFQREPESKNAPHSQGEYDV
FT                   YSTFQSHEPEFDYLKSLEIEEKINKIKWLPQQNAAHSLLSTNDKTIKLWKITERDKRPE
FT                   GYNLKDEEGKLKDLSTVTSLQVPVLKPMDLMVEVSPRRTFANGHTYHINSISVNSDCET
FT                   YMSADDLRINLWHLAITDRSFNIVDIKPANMEDLTEVITASEFHPHHCNLFVYSSSKGS
FT                   LRLCDMRAAALCDKHSKLFEEPEDPSNRSFFSEIISSVSDVKFSHSGRYMLTRDYLTVK
FT                   VWDLNMEARPIETYQVHDYLRSKLCSLYESDCIFDKFECAWNGSDSVIMTGAYNNFFRM
FT                   FDRNTKRDVTLEASRESSKPRAVLKPRRVCVGGKRRRDDISVDSLDFTKKILHTAWHPA
FT                   ENIIAIAATNNLYIFQDKVNSDMH"
FT   assembly_gap    10709188..10709438
FT                   /estimated_length=251
FT                   /gap_type="unknown"
FT   assembly_gap    10715320..10715513
FT                   /estimated_length=194
FT                   /gap_type="unknown"
FT   assembly_gap    10716812..10716831
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10725924..10726063
FT                   /estimated_length=140
FT                   /gap_type="unknown"
FT   gene            complement(10749150..10772097)
FT                   /gene="Wfs1"
FT                   /locus_tag="mCG_20615"
FT                   /note="gene_id=mCG20615.2"
FT   mRNA            complement(join(10749150..10751722,10754602..10754753,
FT                   10756230..10756310,10756778..10756948,10758515..10758659,
FT                   10759930..10760012,10765246..10765485,10772054..10772097))
FT                   /gene="Wfs1"
FT                   /locus_tag="mCG_20615"
FT                   /product="Wolfram syndrome 1 homolog (human)"
FT                   /note="gene_id=mCG20615.2 transcript_id=mCT22270.2 created
FT                   on 18-SEP-2002"
FT   CDS             complement(join(10749917..10751722,10754602..10754753,
FT                   10756230..10756310,10756778..10756948,10758515..10758659,
FT                   10759930..10760012,10765246..10765480))
FT                   /codon_start=1
FT                   /gene="Wfs1"
FT                   /locus_tag="mCG_20615"
FT                   /product="Wolfram syndrome 1 homolog (human)"
FT                   /note="gene_id=mCG20615.2 transcript_id=mCT22270.2
FT                   protein_id=mCP4159.2"
FT                   /db_xref="GOA:Q3TDI2"
FT                   /db_xref="InterPro:IPR026208"
FT                   /db_xref="InterPro:IPR026209"
FT                   /db_xref="MGI:MGI:1328355"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TDI2"
FT                   /protein_id="EDL37519.1"
FT                   /translation="MNSGTPPPSPSGPPPPPAPQPQARARLNATASLEQDKIEPPRAPR
FT                   PQADPSAGRSAGEAAAPEPRAPQTGSREETDRAGPMKADVEIPFEEVLEKAKAGDPKAQ
FT                   TEVGKHYLRLANDADEELNSCSAVAWLILAAKQGRREAVKLLRRCLADRKGITSENEAE
FT                   VKQLSSETDLERAVRKAALVMYWKLNPKKKKQVAVSELLENVGQVNEQDGGAQPGPVPK
FT                   SLQKQRRMLERLVSSESKNYIALDDFVELTKKYAKGIIPTNLFLQDEDEDEDELAGKSP
FT                   EDLPLRQKVVKYPLHAIMEIKEYLIDVASKAGMHWLSTIVPTHHINALIFFFIISNLTI
FT                   DFFAFFIPLVVFYLSFVSMVICTLKVFQDSKAWENFRTLTDLLLRFEPNLDVEQAEVNF
FT                   GWNHLEPYIHFLLSVVFVIFSFPLASKDCIPCSELAVISTFFTVTSYMSLSSSAEPYTR
FT                   RALVTEVAAGLLSLLPTVPVDWRFLKVLGQTFFTVPVGHFIILNVSLPCLLYVYLFYLF
FT                   FRMAQLRNFKGTYCYLVPYLVCFMWCELSVVILLQSTGLGLVRASIGYFLFLFALPILV
FT                   AGLALMGTVQFARWFLSLDLTKIMVTTVICGVPLLFRWWTKANFSVMGMVKSLTKSSMV
FT                   KLILVWLTAILLFCWFYVYRSEGMKVYNSTLTWQQYGFLCGPRAWKETNMARTQILCSH
FT                   LEGHRVTWTGRFKYVRVTEIDNSAESAINMLPFFLGDWMRCLYGEAYPSCSSGNTSTAE
FT                   EELCRLKQLAKHPCHIKKFDRYKFEITVGMPFGTNGNRGHEEDDITKDIVLRASSEFKD
FT                   VLLNLRQGSLIEFSTILEGRLGSKWPVFELKAISCLNCMTQLSPARRHVKIEQDWRSTV
FT                   HGALKFAFDFFFFPFLSAA"
FT   assembly_gap    10772341..10772360
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10775935..10776128
FT                   /estimated_length=194
FT                   /gap_type="unknown"
FT   assembly_gap    10802519..10802538
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <10811240..10926289
FT                   /gene="Jakmip1"
FT                   /locus_tag="mCG_20624"
FT                   /note="gene_id=mCG20624.1"
FT   mRNA            join(<10811240..10811381,10811443..10811553,
FT                   10868298..10868381,10868427..10868560,10874212..10874706,
FT                   10883760..10883969,10884893..10885012,10887812..10887958,
FT                   10888619..10888759,10890265..10890324,10900442..10900570,
FT                   10901779..10901907,10903941..10904024,10906279..10906341,
FT                   10907875..10907973,10910382..10910483,10917242..10917310,
FT                   10918561..10918638,10924618..10924821,10925798..10926289)
FT                   /gene="Jakmip1"
FT                   /locus_tag="mCG_20624"
FT                   /product="janus kinase and microtubule interacting protein
FT                   1"
FT                   /note="gene_id=mCG20624.1 transcript_id=mCT22279.2 created
FT                   on 26-SEP-2002"
FT   CDS             join(10811240..10811381,10811443..10811553,
FT                   10868298..10868381,10868427..10868560,10874212..10874706,
FT                   10883760..10883969,10884893..10885012,10887812..10887958,
FT                   10888619..10888759,10890265..10890324,10900442..10900570,
FT                   10901779..10901907,10903941..10904024,10906279..10906341,
FT                   10907875..10907973,10910382..10910483,10917242..10917310,
FT                   10918561..10918638,10924618..10924821,10925798..10925914)
FT                   /codon_start=1
FT                   /gene="Jakmip1"
FT                   /locus_tag="mCG_20624"
FT                   /product="janus kinase and microtubule interacting protein
FT                   1"
FT                   /note="gene_id=mCG20624.1 transcript_id=mCT22279.2
FT                   protein_id=mCP4162.2"
FT                   /protein_id="EDL37520.1"
FT                   /translation="MREGAGPIREPAPGAHRSAAASVRRRSPPFPHRTRVPHGPSLLGY
FT                   GPGSGDGDSSVGARGEGAAGECGSPLLLGLCRSVKQVGTDSPVMVCTEDERSPVRLLST
FT                   AELVAVLAGNMSKKGRSKGDKPEAETDSVQMANEELRAKLTNIQIEFQQEKSKVGKLRE
FT                   RLQEAKLEREQEQRRHTAYISELKAKLHEEKTKELQALREALIRQHEQEAARTAKIKEG
FT                   ELQRLQATLNVLRDGAADKVKTALLADAREEARRTFDGERQRLQQEILELKAARKQAEE
FT                   ALSNCMQADKAKAADLRAAYQAHQDEVHRIKRECERDIRRLMDEIKGKERVILALEKEL
FT                   GVQTGQTQRLLLQKEALDEQLVQVKEAERHHSSPKRELPPGIGDMAELMGGQDQHMDER
FT                   DVRRFQLKIAELNSVIRKLEDRNTLLADERNELLKRSRETEVQLKPLVEKNKRMNKKNE
FT                   ELLHSIQRMEEKLKSLTRENVEMKEKLSAQASLKRHTSLNDLSLTRDEQEIEFLRLQVL
FT                   EQQHVIDDLSLERERLLRSKRHRGKSLKPPKKHVVETFFGFDEESVDSETLSETSYNTD
FT                   RTDRTPATPEEDLDETTTREEADLRFCQLTREYQALQRAYALLQEQVGGTLDAEREART
FT                   REQLQADLLRCQAKIEDLEKLLVEKGQDAAWVEEKQVLMRTNQDLLEKIYRLEMEENQL
FT                   KSEMQDAKDQNELLEFRVLELEERERRSPAFNLQITTFPENNSSALQLFCHQEGVKWLK
FT                   QIEGTEAALTQKMMDLEKEKDQFSRQKGYLEQELDYRKEALDQAYLKIQDLEATLYNAL
FT                   QQEPGRRASEALSASQREDLQAAVEKVRRQLLRQSREFDSQILRERMELLQQAQQKIRE
FT                   MEGKLELQRRQLKELEEKVGGPGVLRPDSCPVQL"
FT   assembly_gap    10811690..10811783
FT                   /estimated_length=94
FT                   /gap_type="unknown"
FT   gene            complement(10821202..10824713)
FT                   /locus_tag="mCG_148300"
FT                   /note="gene_id=mCG148300.0"
FT   mRNA            complement(join(10821202..10822364,10824621..10824713))
FT                   /locus_tag="mCG_148300"
FT                   /product="mCG148300"
FT                   /note="gene_id=mCG148300.0 transcript_id=mCT188563.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(10822134..10822316)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148300"
FT                   /product="mCG148300"
FT                   /note="gene_id=mCG148300.0 transcript_id=mCT188563.0
FT                   protein_id=mCP109215.0"
FT                   /protein_id="EDL37521.1"
FT                   /translation="MDSSSNGHRTPAAVQNACCQPPRLAHLRSSSGSPHQKAGRGPQVR
FT                   FMIDQGFTPRCGGGG"
FT   assembly_gap    10823945..10824013
FT                   /estimated_length=69
FT                   /gap_type="unknown"
FT   assembly_gap    10863552..10863690
FT                   /estimated_length=139
FT                   /gap_type="unknown"
FT   assembly_gap    10872034..10872053
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10877440..10877491
FT                   /estimated_length=52
FT                   /gap_type="unknown"
FT   assembly_gap    10886049..10886068
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10938381..10943761
FT                   /estimated_length=5381
FT                   /gap_type="unknown"
FT   assembly_gap    10958476..10958863
FT                   /estimated_length=388
FT                   /gap_type="unknown"
FT   assembly_gap    10960210..10960245
FT                   /estimated_length=36
FT                   /gap_type="unknown"
FT   assembly_gap    10992408..10992427
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10993469..10993488
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10994556..10994575
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10996418..10997479
FT                   /estimated_length=1062
FT                   /gap_type="unknown"
FT   assembly_gap    11008529..11008632
FT                   /estimated_length=104
FT                   /gap_type="unknown"
FT   assembly_gap    11013375..11013695
FT                   /estimated_length=321
FT                   /gap_type="unknown"
FT   assembly_gap    11020724..11020743
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <11020744..11073155
FT                   /gene="Crmp1"
FT                   /locus_tag="mCG_20622"
FT                   /note="gene_id=mCG20622.2"
FT   mRNA            join(11020744..11021181,11043898..11043986,
FT                   11047641..11047825,11049691..11049867,11054348..11054512,
FT                   11057278..11057339,11059085..11059165,11059863..11059931,
FT                   11060659..11060788,11061467..11061623,11063852..11063993,
FT                   11065028..11065198,11067390..11067569,11069827..11069992,
FT                   11072139..11073155)
FT                   /gene="Crmp1"
FT                   /locus_tag="mCG_20622"
FT                   /product="collapsin response mediator protein 1, transcript
FT                   variant mCT22277"
FT                   /note="gene_id=mCG20622.2 transcript_id=mCT22277.2 created
FT                   on 07-FEB-2003"
FT   mRNA            join(<11020744..11021181,11043898..11043986,
FT                   11047641..11047825,11054348..11054512,11057278..11057339,
FT                   11059085..11059165,11059863..11059931,11060659..11060779,
FT                   11061467..11061623,11063852..11063993,11065028..11065198,
FT                   11067390..11067569,11069827..11069992,11072139..11073153)
FT                   /gene="Crmp1"
FT                   /locus_tag="mCG_20622"
FT                   /product="collapsin response mediator protein 1, transcript
FT                   variant mCT193630"
FT                   /note="gene_id=mCG20622.2 transcript_id=mCT193630.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<11020786..11021181,11043898..11043986,
FT                   11047641..11047825,11054348..11054512,11057278..11057339,
FT                   11059085..11059165,11059863..11059931,11060659..11060779,
FT                   11061467..11061623,11063852..11063993,11065028..11065198,
FT                   11067390..11067569,11069827..11069992,11072139..11072230)
FT                   /codon_start=1
FT                   /gene="Crmp1"
FT                   /locus_tag="mCG_20622"
FT                   /product="collapsin response mediator protein 1, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG20622.2 transcript_id=mCT193630.0
FT                   protein_id=mCP114584.0 isoform=CRA_b"
FT                   /protein_id="EDL37523.1"
FT                   /translation="PPETGMAERRRAWNTEDDLPVYLARPGSAAQTPRQKYGGMFAAVE
FT                   GAYENKTIDFDAYSVGRRGSARTPRSAGRPDAVGLPCPGGSEDTASDVSEPSGSAVSSP
FT                   GDRDDRPPALRIRCPAPRDLPLGRDNGQSDRLLIRGGRIINDDQSFYADVYLEDGLIKQ
FT                   IGENLIVPGGVKTIEANGRMVIPGGIDVNTYLQKPSQGMTSADDFFQGTKAALAGGTTM
FT                   IIDHVVPEPGSSLLTSFEKWHEAADTKSCCDYSLHVDITSWYDGVREELEVLVQDKGVN
FT                   SFQVYMAYKDLYQMSDSQLYEAFTFLKGLGAVILVHAENGDLIAQEQKRILEMGITGPE
FT                   GHALSRPEELEAEAVFRAIAIAGRINCPVYITKVMSKSAADIIALARKKGPLVFGEPIA
FT                   ASLGTDGTHYWSKNWAKAAAFVTSPPLSPDPTTPDYLTSLLACGDLQVTGSGHCPYSTA
FT                   QKAVGKDNFTLIPEGVNGIEERMTVVWDKAVATGKMDENQFVAVTSTNAAKIFNLYPRK
FT                   GRIAVGSDADVVIWDPDKMKTITAKSHKSTVEYNIFEGMECHGSPLVVISQGKIVFEDG
FT                   NISVSKGMGRFIPRKPFPEHLYQRVRIRSKVFGLHSVSRGMYDGPVYEVPATPKHAAPA
FT                   PSAKSSPSKHQPPPIRNLHQSNFSLSGAQIDDNNPRRTGHRIVAPPGGRSNITSLG"
FT   CDS             join(11020801..11021181,11043898..11043986,
FT                   11047641..11047825,11049691..11049867,11054348..11054512,
FT                   11057278..11057339,11059085..11059165,11059863..11059931,
FT                   11060659..11060788,11061467..11061623,11063852..11063993,
FT                   11065028..11065198,11067390..11067569,11069827..11069992,
FT                   11072139..11072230)
FT                   /codon_start=1
FT                   /gene="Crmp1"
FT                   /locus_tag="mCG_20622"
FT                   /product="collapsin response mediator protein 1, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG20622.2 transcript_id=mCT22277.2
FT                   protein_id=mCP4196.2 isoform=CRA_c"
FT                   /protein_id="EDL37524.1"
FT                   /translation="MAERRRAWNTEDDLPVYLARPGSAAQTPRQKYGGMFAAVEGAYEN
FT                   KTIDFDAYSVGRRGSARTPRSAGRPDAVGLPCPGGSEDTASDVSEPSGSAVSSPGDRDD
FT                   RPPALRIRCPAPRDLPLGRDNGQSDRLLIRGGRIINDDQSFYADVYLEDGLIKQIGENL
FT                   IVPGGVKTIEANGRMVIPGGIDVNTYLQKPSQGMTSADDFFQGTKAALAGGTTMIRENL
FT                   IVPGGVKTIEANGRMVIPGGIDVNTYLQKPSQGMTSADDFFQGTKAALAGGTTMIIDHV
FT                   VPEPGSSLLTSFEKWHEAADTKSCCDYSLHVDITSWYDGVREELEVLVQDKGVNSFQVY
FT                   MAYKDLYQMSDSQLYEAFTFLKGLGAVILVHAENGDLIAQEQKRILEMGITGPEGHALS
FT                   RPEELEAEAVFRAIAIAGRINCPVYITKVMSKSAADIIALARKKGRWCPLVFGEPIAAS
FT                   LGTDGTHYWSKNWAKAAAFVTSPPLSPDPTTPDYLTSLLACGDLQVTGSGHCPYSTAQK
FT                   AVGKDNFTLIPEGVNGIEERMTVVWDKAVATGKMDENQFVAVTSTNAAKIFNLYPRKGR
FT                   IAVGSDADVVIWDPDKMKTITAKSHKSTVEYNIFEGMECHGSPLVVISQGKIVFEDGNI
FT                   SVSKGMGRFIPRKPFPEHLYQRVRIRSKVFGLHSVSRGMYDGPVYEVPATPKHAAPAPS
FT                   AKSSPSKHQPPPIRNLHQSNFSLSGAQIDDNNPRRTGHRIVAPPGGRSNITSLG"
FT   mRNA            join(11024446..11024753,11043898..11043986,
FT                   11047641..11047825,11054348..11054512,11057278..11057339,
FT                   11059085..11059165,11059863..11059931,11060659..11060779,
FT                   11061467..11061623,11063852..11063993,11065028..11065198,
FT                   11067390..11067569,11069827..11069992,11072139..11072538)
FT                   /gene="Crmp1"
FT                   /locus_tag="mCG_20622"
FT                   /product="collapsin response mediator protein 1, transcript
FT                   variant mCT179728"
FT                   /note="gene_id=mCG20622.2 transcript_id=mCT179728.0 created
FT                   on 07-FEB-2003"
FT   CDS             join(11024715..11024753,11043898..11043986,
FT                   11047641..11047825,11054348..11054512,11057278..11057339,
FT                   11059085..11059165,11059863..11059931,11060659..11060779,
FT                   11061467..11061623,11063852..11063993,11065028..11065198,
FT                   11067390..11067569,11069827..11069992,11072139..11072230)
FT                   /codon_start=1
FT                   /gene="Crmp1"
FT                   /locus_tag="mCG_20622"
FT                   /product="collapsin response mediator protein 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG20622.2 transcript_id=mCT179728.0
FT                   protein_id=mCP102650.0 isoform=CRA_a"
FT                   /protein_id="EDL37522.1"
FT                   /translation="MSHQGKKSIPHITSDRLLIRGGRIINDDQSFYADVYLEDGLIKQI
FT                   GENLIVPGGVKTIEANGRMVIPGGIDVNTYLQKPSQGMTSADDFFQGTKAALAGGTTMI
FT                   IDHVVPEPGSSLLTSFEKWHEAADTKSCCDYSLHVDITSWYDGVREELEVLVQDKGVNS
FT                   FQVYMAYKDLYQMSDSQLYEAFTFLKGLGAVILVHAENGDLIAQEQKRILEMGITGPEG
FT                   HALSRPEELEAEAVFRAIAIAGRINCPVYITKVMSKSAADIIALARKKGPLVFGEPIAA
FT                   SLGTDGTHYWSKNWAKAAAFVTSPPLSPDPTTPDYLTSLLACGDLQVTGSGHCPYSTAQ
FT                   KAVGKDNFTLIPEGVNGIEERMTVVWDKAVATGKMDENQFVAVTSTNAAKIFNLYPRKG
FT                   RIAVGSDADVVIWDPDKMKTITAKSHKSTVEYNIFEGMECHGSPLVVISQGKIVFEDGN
FT                   ISVSKGMGRFIPRKPFPEHLYQRVRIRSKVFGLHSVSRGMYDGPVYEVPATPKHAAPAP
FT                   SAKSSPSKHQPPPIRNLHQSNFSLSGAQIDDNNPRRTGHRIVAPPGGRSNITSLG"
FT   assembly_gap    11025862..11025881
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11041075..11041094
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11043327..11043382
FT                   /estimated_length=56
FT                   /gap_type="unknown"
FT   assembly_gap    11047058..11047077
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11048902..11048921
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(11080193..11118833)
FT                   /gene="Evc"
FT                   /locus_tag="mCG_20623"
FT                   /note="gene_id=mCG20623.2"
FT   mRNA            complement(join(11080193..11081522,11081834..11081945,
FT                   11082580..11082673,11084217..11084343,11088254..11088365,
FT                   11090073..11090217,11091202..11091408,11092595..11092805,
FT                   11094492..11094601,11095422..11095634,11097388..11097486,
FT                   11099234..11099382,11099961..11100177,11101308..11101466,
FT                   11103125..11103262,11104774..11104872,11105912..11105996,
FT                   11107413..11107660,11109537..11109620,11114845..11114970,
FT                   11118594..11118833))
FT                   /gene="Evc"
FT                   /locus_tag="mCG_20623"
FT                   /product="Ellis van Creveld gene homolog (human),
FT                   transcript variant mCT22278"
FT                   /note="gene_id=mCG20623.2 transcript_id=mCT22278.2 created
FT                   on 18-SEP-2002"
FT   mRNA            complement(join(11080195..11081522,11081834..11081945,
FT                   11082580..11082673,11084217..11084343,11088254..11088362,
FT                   11090069..11090217,11091202..11091408,11092595..11092805,
FT                   11094492..11094601,11095422..11095634,11097388..11097486,
FT                   11099234..11099382,11099961..11100177,11101308..11101466,
FT                   11103125..11103262,11104774..11104872,11105912..11105996,
FT                   11107413..11107660,11109537..11109620,11114845..11114970,
FT                   11118594..>11118820))
FT                   /gene="Evc"
FT                   /locus_tag="mCG_20623"
FT                   /product="Ellis van Creveld gene homolog (human),
FT                   transcript variant mCT193631"
FT                   /note="gene_id=mCG20623.2 transcript_id=mCT193631.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(11081399..11081522,11081834..11081945,
FT                   11082580..11082673,11084217..11084343,11088254..11088365,
FT                   11090073..11090217,11091202..11091408,11092595..11092805,
FT                   11094492..11094601,11095422..11095634,11097388..11097486,
FT                   11099234..11099382,11099961..11100177,11101308..11101466,
FT                   11103125..11103262,11104774..11104872,11105912..11105996,
FT                   11107413..11107660,11109537..11109620,11114845..11114970,
FT                   11118594..11118752))
FT                   /codon_start=1
FT                   /gene="Evc"
FT                   /locus_tag="mCG_20623"
FT                   /product="Ellis van Creveld gene homolog (human), isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG20623.2 transcript_id=mCT22278.2
FT                   protein_id=mCP4146.2 isoform=CRA_b"
FT                   /protein_id="EDL37526.1"
FT                   /translation="MTCTKDARLQLGREALQAAPTLLVPAVLLGGVLGLGLGLWLGCRA
FT                   SHLRARLQKDDRKRLLGSSEPPAQSLRDTGSQAKARRRQRETTRDEDAPEVCEPSLSGN
FT                   ITAFALKARVVYPINQKFRPLADGSSHPSLHENLTQAAAILPHLPHQPAEASPASSLGS
FT                   LSQAGKEDGSSSSSMRSTYSDDRILQCAFLRVGSFPEILACESVDIDLCVCSLHLKDLL
FT                   QVDTALRQEKHLMFIQILKACLLDFFPKKKPDDELCQKVLSKQEHDLEELEKGLQARLA
FT                   NTEMLGTGDSGYVSLADVERKERELSEQLIDNMGAFWKQMESIQPTLMDQFKCSSSKAR
FT                   QFMMTLTGRMIVAEGLLHDSQDLHVLDTLERTMGRAHLARMVEFLRTQIQEETKCRLAA
FT                   ISRGLELLTVQGQLSGRQKEELLTQQHKAFWEEAERFGREFMQRGKDLVQASQARQAEA
FT                   AAELTQTQEEERRSFLADSQLTSDPGEFLKAFHEVLERQRLTRSDQEGDEDTRITEAMA
FT                   ALCQELYCSTMGTFQKFVDSLFLKTLPEVTSLPVAECETLRQQVQEQAARQLGQADRFR
FT                   RRQWGLLCDLLEQDKRVWLEEGTLSTVLQRQLRDHHESTIHGVLSRFSGLSEESSRGIL
FT                   QGHELLLCSALRRLALRGTTITALAQMRLSGKKRLLQELHEQLALEQGVSPCLEEHQWQ
FT                   LLRALEARIQEEAARLEDEAQQTGLRLQQQLLAEAQEAGRLLQLHMERVIGQALLVHAR
FT                   NVASKGRTREKEDFKRTLVETVVESVYVTSTSVNRLVQAHYQAVGKLLQAHEEQLLQRL
FT                   KTLQGERINAYKLWKKQEFSDPSLESQTADGTHGASQGVQQRMLSQQKRLLDQFTKHQQ
FT                   GRLNSQRQKAQELDQLQAQLETQLQEAEQTLISELSTLARVPLPENKPFSNKRGLPEKP
FT                   VRTKRKKPPPREREDLGTPNDDHLALADHTTGPLSTTYSASPPIRVHSGGRLDQQDSEA
FT                   GDGESTSKILQKGSNL"
FT   CDS             complement(join(11088317..11088362,11090069..11090217,
FT                   11091202..11091408,11092595..11092805,11094492..11094601,
FT                   11095422..11095634,11097388..11097486,11099234..11099382,
FT                   11099961..11100177,11101308..11101466,11103125..11103262,
FT                   11104774..11104872,11105912..11105996,11107413..11107660,
FT                   11109537..11109620,11114845..11114970,11118594..>11118818))
FT                   /codon_start=1
FT                   /gene="Evc"
FT                   /locus_tag="mCG_20623"
FT                   /product="Ellis van Creveld gene homolog (human), isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG20623.2 transcript_id=mCT193631.0
FT                   protein_id=mCP114585.0 isoform=CRA_a"
FT                   /protein_id="EDL37525.1"
FT                   /translation="ERVQRRGPGRRRDAAGHPPEPSMTCTKDARLQLGREALQAAPTLL
FT                   VPAVLLGGVLGLGLGLWLGCRASHLRARLQKDDRKRLLGSSEPPAQSLRDTGSQAKARR
FT                   RQRETTRDEDAPEVCEPSLSGNITAFALKARVVYPINQKFRPLADGSSHPSLHENLTQA
FT                   AAILPHLPHQPAEASPASSLGSLSQAGKEDGSSSSSMRSTYSDDRILQCAFLRVGSFPE
FT                   ILACESVDIDLCVCSLHLKDLLQVDTALRQEKHLMFIQILKACLLDFFPKKKPDDELCQ
FT                   KVLSKQEHDLEELEKGLQARLANTEMLGTGDSGYVSLADVERKERELSEQLIDNMGAFW
FT                   KQMESIQPTLMDQFKCSSSKARQFMMTLTGRMIVAEGLLHDSQDLHVLDTLERTMGRAH
FT                   LARMVEFLRTQIQEETKCRLAAISRGLELLTVQGQLSGRQKEELLTQQHKAFWEEAERF
FT                   GREFMQRGKDLVQASQARQAEAAAELTQTQEEERRSFLADSQLTSDPGEFLKAFHEVLE
FT                   RQRLTRSDQEGDEDTRITEAMAALCQELYCSTMGTFQKFVDSLFLKTLPEVTSLPVAEC
FT                   ETLRQQVQEQAARQLGQADRFRRRQWGLLCDLLEQDKRVWLEEGTLSTVLQRQLRDHHE
FT                   STIHGVLSRFSGLSEESSRGILQGHELLLCSALRRLALRGTTITALAQMRLSGKKRLLQ
FT                   ELHEQLALEQGVSPCLEEHQWQLLRALEARIQEEAARLEDEAQQTGLRLQQQLLAEAQE
FT                   AGRLLQLHMERVIGQALLVHARNVASKGRTREKEDFKRTLVETVVESVYVTSTSVNRLV
FT                   QAHYQAVGKLLQAHEEQLLQRLKTLQGRENQCLQAVEEARIQ"
FT   gene            11120450..11207329
FT                   /gene="Evc2"
FT                   /locus_tag="mCG_141192"
FT                   /note="gene_id=mCG141192.0"
FT   mRNA            join(11120450..11120686,11129668..11129736,
FT                   11130810..11130996,11132561..11132670,11133563..11133616,
FT                   11139769..11139903,11145732..11145871,11152739..11153063,
FT                   11160413..11160652,11162640..11162815,11165309..11165468,
FT                   11168916..11169370,11174224..11174428,11175311..11175427,
FT                   11192520..11192747,11198012..11198223,11199681..11199768,
FT                   11201400..11201602,11204114..11204215,11206685..11207329)
FT                   /gene="Evc2"
FT                   /locus_tag="mCG_141192"
FT                   /product="Ellis van Creveld syndrome 2 homolog (human)"
FT                   /note="gene_id=mCG141192.0 transcript_id=mCT173711.0
FT                   created on 26-SEP-2002"
FT   CDS             join(11120507..11120686,11129668..11129736,
FT                   11130810..11130996,11132561..11132670,11133563..11133616,
FT                   11139769..11139903,11145732..11145871,11152739..11153063,
FT                   11160413..11160652,11162640..11162815,11165309..11165468,
FT                   11168916..11169370,11174224..11174428,11175311..11175427,
FT                   11192520..11192747,11198012..11198223,11199681..11199768,
FT                   11201400..11201602,11204114..11204215,11206685..11206952)
FT                   /codon_start=1
FT                   /gene="Evc2"
FT                   /locus_tag="mCG_141192"
FT                   /product="Ellis van Creveld syndrome 2 homolog (human)"
FT                   /note="gene_id=mCG141192.0 transcript_id=mCT173711.0
FT                   protein_id=mCP96630.0"
FT                   /protein_id="EDL37527.1"
FT                   /translation="MGATGPTGAGGRATWVLAGNILAAALVLGSGPRALPPSFPALGPG
FT                   SPSRPGPAGPWASSQYSDISREARGPFENGVIFQKCSLVSGQSESQTMHVQLSVNNTRT
FT                   PTSVNLSNLLVLDEITGLAVKESPGNNTQDGIQTFRKSFLQVGECYSVSYTASLDPTAL
FT                   GTGESLDLPARLIFQSPSQNRTQLKAPFTITVEEKIMVLPNHGLHAAGFMAAFLISLLL
FT                   TLAALFFLARGRCLQGGMLSRCRIQHPENKLEPSPFTSANGVSQDLSLNDQVVAILTSE
FT                   EPGSMLQALEELEIATLNQADADLEACRNQISKDIIALLMKNLVSGGHLSPQTERKMAA
FT                   AFKKQFLLLENEIQEEYERKMLALTAECDLEMRKKTENQYQREMVAMEEAEEVLKRVSE
FT                   RSAAECSSLLRTLHGLEQEDMQRSLTLDQAEDFAQAHRQLAVFQRNELHSIVYTQIQSA
FT                   VSKGELRPEVAKMMLQDYSKTQESVEELMDFFQATKRYHLSKRFGHREYLVQRLQAMET
FT                   RVQGLLNTAATQLTSLIHKHERAGYLDEDQMETLLERAQTETFSIKQKLDNDLKQEKKR
FT                   LHQRLITRRRRELLQKHKEQQKEQVSLGEASSTAEDAVQYLHQWRSVMAEHTAALEELQ
FT                   ERLDQAALDDLRVLTVSLSEKATEELRRLQSTAMTQELLKRSAPWLFLQQILEEHSRES
FT                   AARTTQLEAEERERGQELVQGVRQRLQQDALEAYTEEQAELRHWEHLVFMKLCCAAISL
FT                   SEEDLLRVRQEAQGCFSQLDRSLALPRVRARVLQQQAQMAWREAEFRKLDQALAAPELQ
FT                   SKARKLRSKGRGKADLLKKNLEDKIRLFEERAPVELADQVRGELLQERVQRLEAQEAHF
FT                   AESLVALQFQKVARAAETLSVYTALLSIQDLLLGELSESETLTKSACVQILESHRPELQ
FT                   ELERKLEDQLVQQEEAEQQRVLESWQRWAADGPGLSEPEEMDPERQVSAILRQALNKGQ
FT                   KLLEQHQQRVREEWQNGAVLEDSLESIEADTMASLCSQGLRLVSYLSRMTMVPGSTLLR
FT                   LLSVVLPAASQPQLLALLDAVSEKHSDHTAENESSGEQAQAEQSKRRKHQVWWKVLDSR
FT                   FRADLVSQGLERMLWARQKKERILKKIYVPVQERVMFPGKGSWPHLSLEPIGELAPIPI
FT                   TGADAMDILNTGEKIFVFRSPREPEISLRVPPRRKKNFLNAKKANRALGLD"
FT   assembly_gap    11129078..11129097
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11133075..11133094
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11140585..11140621
FT                   /estimated_length=37
FT                   /gap_type="unknown"
FT   gene            complement(11186631..11187233)
FT                   /pseudo
FT                   /locus_tag="mCG_1046061"
FT                   /note="gene_id=mCG1046061.1"
FT   mRNA            complement(11186631..11187233)
FT                   /pseudo
FT                   /locus_tag="mCG_1046061"
FT                   /note="gene_id=mCG1046061.1 transcript_id=mCT163765.1
FT                   created on 16-OCT-2002"
FT   assembly_gap    11222400..11222898
FT                   /estimated_length=499
FT                   /gap_type="unknown"
FT   assembly_gap    11227343..11227362
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(11228943..11496777)
FT                   /gene="Stk32b"
FT                   /locus_tag="mCG_122045"
FT                   /note="gene_id=mCG122045.0"
FT   mRNA            complement(join(11228943..11230908,11237052..11237116,
FT                   11239239..11239370,11241719..11241844,11243467..11243583,
FT                   11250436..11250539,11274648..11274737,11283312..11283349,
FT                   11315992..11316165,11407131..11407282,11427270..11427325,
FT                   11496359..11496777))
FT                   /gene="Stk32b"
FT                   /locus_tag="mCG_122045"
FT                   /product="serine/threonine kinase 32B"
FT                   /note="gene_id=mCG122045.0 transcript_id=mCT123259.0
FT                   created on 26-SEP-2002"
FT   CDS             complement(join(11230770..11230908,11237052..11237116,
FT                   11239239..11239370,11241719..11241844,11243467..11243583,
FT                   11250436..11250539,11274648..11274737,11283312..11283349,
FT                   11315992..11316165,11407131..11407282,11427270..11427325,
FT                   11496359..11496410))
FT                   /codon_start=1
FT                   /gene="Stk32b"
FT                   /locus_tag="mCG_122045"
FT                   /product="serine/threonine kinase 32B"
FT                   /note="gene_id=mCG122045.0 transcript_id=mCT123259.0
FT                   protein_id=mCP65107.1"
FT                   /protein_id="EDL37528.1"
FT                   /translation="MGGNHSHKPPVFDENEEVNFDHFQILRAIGKGSFGKVCIVQKRDT
FT                   KKMYAMKYMNKQKCVERDEVRNVFRELQIMQGLEHPFLVNLWYSFQDEEDMFMVVDLLL
FT                   GGDLRYHLQQNVHFTEGTVKLYICELALALEYLQRYHIIHRDIKPDNILLDEHGHVHIT
FT                   DFNIATVLKGSEKASSMAGTKPYMAPEVFQVYVDGGPGYSYPVDWWSLGVTAYELLRGW
FT                   RPYEIHSATPIDEILNMFKVERVHYSSTWCEGMVSLLKKLLTKDPESRLSSLRDIQSMT
FT                   YLADMNWDAVFEKALMPGFVPNKGRLNCDPTFELEEMILESKPLHKKKKRLAKHRSRDS
FT                   TKDSCPLNGHLQQCLETVRKEFIIFNREKLRRQQGHNGQLSDLDGRIGSQTSSKLQDGR
FT                   NNNILTHTCPRGCSS"
FT   assembly_gap    11247244..11247263
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11248440..11248459
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11260612..11260631
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11268233..11268277
FT                   /estimated_length=45
FT                   /gap_type="unknown"
FT   assembly_gap    11269569..11269609
FT                   /estimated_length=41
FT                   /gap_type="unknown"
FT   assembly_gap    11276186..11276357
FT                   /estimated_length=172
FT                   /gap_type="unknown"
FT   assembly_gap    11277829..11277956
FT                   /estimated_length=128
FT                   /gap_type="unknown"
FT   assembly_gap    11284463..11289093
FT                   /estimated_length=4631
FT                   /gap_type="unknown"
FT   assembly_gap    11296609..11296783
FT                   /estimated_length=175
FT                   /gap_type="unknown"
FT   assembly_gap    11307951..11308058
FT                   /estimated_length=108
FT                   /gap_type="unknown"
FT   assembly_gap    11315048..11315323
FT                   /estimated_length=276
FT                   /gap_type="unknown"
FT   assembly_gap    11319546..11319707
FT                   /estimated_length=162
FT                   /gap_type="unknown"
FT   assembly_gap    11331580..11332061
FT                   /estimated_length=482
FT                   /gap_type="unknown"
FT   assembly_gap    11343559..11343627
FT                   /estimated_length=69
FT                   /gap_type="unknown"
FT   assembly_gap    11350004..11350023
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11351193..11351212
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11352337..11352356
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11366590..11366609
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11373893..11373958
FT                   /estimated_length=66
FT                   /gap_type="unknown"
FT   assembly_gap    11380200..11380219
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11385456..11386539
FT                   /estimated_length=1084
FT                   /gap_type="unknown"
FT   assembly_gap    11392956..11393205
FT                   /estimated_length=250
FT                   /gap_type="unknown"
FT   assembly_gap    11462674..11462822
FT                   /estimated_length=149
FT                   /gap_type="unknown"
FT   assembly_gap    11464612..11464831
FT                   /estimated_length=220
FT                   /gap_type="unknown"
FT   assembly_gap    11466896..11467154
FT                   /estimated_length=259
FT                   /gap_type="unknown"
FT   assembly_gap    11469499..11472621
FT                   /estimated_length=3123
FT                   /gap_type="unknown"
FT   assembly_gap    11487193..11487212
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11491357..11491376
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11492657..11492676
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11512376..11512395
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11514409..11518902
FT                   /estimated_length=4494
FT                   /gap_type="unknown"
FT   gene            <11522725..11526984
FT                   /locus_tag="mCG_3751"
FT                   /note="gene_id=mCG3751.1"
FT   mRNA            join(<11522725..11522889,11524554..11524616,
FT                   11524774..11524902,11526382..11526984)
FT                   /locus_tag="mCG_3751"
FT                   /product="mCG3751, transcript variant mCT2686"
FT                   /note="gene_id=mCG3751.1 transcript_id=mCT2686.1 created on
FT                   18-FEB-2003"
FT   CDS             join(11522725..11522889,11524554..11524616,
FT                   11524774..11524902,11526382..11526465)
FT                   /codon_start=1
FT                   /locus_tag="mCG_3751"
FT                   /product="mCG3751, isoform CRA_b"
FT                   /note="gene_id=mCG3751.1 transcript_id=mCT2686.1
FT                   protein_id=mCP4163.1 isoform=CRA_b"
FT                   /protein_id="EDL37530.1"
FT                   /translation="MSPKTLPLLLLLVVVVVIAWPLAVQSAPPTCYSRMLTLSREIMAD
FT                   FQSLQASEPEDSCVRYLPRLYLDIHVRERCLNYCVLAKLRDFVASPQCWKMAEVDTLKD
FT                   RVRKLYTIMNSFCRRDLVFLSDDCSALEDPIPEATGPPDWQS"
FT   mRNA            join(<11522729..11522889,11524554..11524598,
FT                   11524774..11524902,11526382..11526628)
FT                   /locus_tag="mCG_3751"
FT                   /product="mCG3751, transcript variant mCT180321"
FT                   /note="gene_id=mCG3751.1 transcript_id=mCT180321.0 created
FT                   on 18-FEB-2003"
FT   CDS             join(<11522731..11522889,11524554..11524598,
FT                   11524774..11524902,11526382..11526465)
FT                   /codon_start=1
FT                   /locus_tag="mCG_3751"
FT                   /product="mCG3751, isoform CRA_a"
FT                   /note="gene_id=mCG3751.1 transcript_id=mCT180321.0
FT                   protein_id=mCP103243.0 isoform=CRA_a"
FT                   /protein_id="EDL37529.1"
FT                   /translation="PKTLPLLLLLVVVVVIAWPLAVQSAPPTCYSRMLTLSREIMADFQ
FT                   SLQASEPEDSCVRYLPRLYLDIHNYCVLAKLRDFVASPQCWKMAEVDTLKDRVRKLYTI
FT                   MNSFCRRDLVFLSDDCSALEDPIPEATGPPDWQS"
FT   assembly_gap    11531730..11531816
FT                   /estimated_length=87
FT                   /gap_type="unknown"
FT   assembly_gap    11546074..11546093
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11547467..11547789
FT                   /estimated_length=323
FT                   /gap_type="unknown"
FT   assembly_gap    11548871..11549007
FT                   /estimated_length=137
FT                   /gap_type="unknown"
FT   assembly_gap    11565269..11565288
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11566323..11566523
FT                   /estimated_length=201
FT                   /gap_type="unknown"
FT   assembly_gap    11591210..11591240
FT                   /estimated_length=31
FT                   /gap_type="unknown"
FT   assembly_gap    11598149..11598192
FT                   /estimated_length=44
FT                   /gap_type="unknown"
FT   gene            complement(11607557..11611793)
FT                   /locus_tag="mCG_3750"
FT                   /note="gene_id=mCG3750.1"
FT   mRNA            complement(join(11607557..11608765,11610930..11611793))
FT                   /locus_tag="mCG_3750"
FT                   /product="mCG3750"
FT                   /note="gene_id=mCG3750.1 transcript_id=mCT2688.1 created on
FT                   18-SEP-2002"
FT   CDS             complement(join(11608323..11608765,11610930..11611398))
FT                   /codon_start=1
FT                   /locus_tag="mCG_3750"
FT                   /product="mCG3750"
FT                   /note="gene_id=mCG3750.1 transcript_id=mCT2688.1
FT                   protein_id=mCP4200.2"
FT                   /db_xref="GOA:P13297"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017970"
FT                   /db_xref="InterPro:IPR020479"
FT                   /db_xref="MGI:MGI:97168"
FT                   /db_xref="PDB:1IG7"
FT                   /db_xref="UniProtKB/Swiss-Prot:P13297"
FT                   /protein_id="EDL37531.1"
FT                   /translation="MAPAAAMTSLPLGVKVEDSAFAKPAGGGVGQAPGAAAATATAMGT
FT                   DEEGAKPKVPASLLPFSVEALMADHRKPGAKESVLVASEGAQAAGGSVQHLGTRPGSLG
FT                   APDAPSSPRPLGHFSVGGLLKLPEDALVKAESPEKLDRTPWMQSPRFSPPPARRLSPPA
FT                   CTLRKHKTNRKPRTPFTTAQLLALERKFRQKQYLSIAERAEFSSSLSLTETQVKIWFQN
FT                   RRAKAKRLQEAELEKLKMAAKPMLPPAAFGLSFPLGGPAAVAAAAGASLYSASGPFQRA
FT                   ALPVAPVGLYTAHVGYSMYHLT"
FT   assembly_gap    11627000..11627508
FT                   /estimated_length=509
FT                   /gap_type="unknown"
FT   assembly_gap    11644296..11644778
FT                   /estimated_length=483
FT                   /gap_type="unknown"
FT   assembly_gap    11659397..11659416
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11666887..11667216
FT                   /estimated_length=330
FT                   /gap_type="unknown"
FT   assembly_gap    11670895..11670985
FT                   /estimated_length=91
FT                   /gap_type="unknown"
FT   assembly_gap    11672707..11672726
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <11679811..11684095
FT                   /locus_tag="mCG_3755"
FT                   /note="gene_id=mCG3755.2"
FT   mRNA            join(<11679811..11679930,11682685..11683228)
FT                   /locus_tag="mCG_3755"
FT                   /product="mCG3755, transcript variant mCT174003"
FT                   /note="gene_id=mCG3755.2 transcript_id=mCT174003.0 created
FT                   on 03-OCT-2002"
FT   assembly_gap    11680047..11680230
FT                   /estimated_length=184
FT                   /gap_type="unknown"
FT   mRNA            join(<11680871..11680921,11682685..11682837,
FT                   11683008..11684095)
FT                   /locus_tag="mCG_3755"
FT                   /product="mCG3755, transcript variant mCT2674"
FT                   /note="gene_id=mCG3755.2 transcript_id=mCT2674.2 created on
FT                   03-OCT-2002"
FT   CDS             join(<11682766..11682837,11683008..11683148)
FT                   /codon_start=1
FT                   /locus_tag="mCG_3755"
FT                   /product="mCG3755, isoform CRA_b"
FT                   /note="gene_id=mCG3755.2 transcript_id=mCT2674.2
FT                   protein_id=mCP4178.0 isoform=CRA_b"
FT                   /protein_id="EDL37533.1"
FT                   /translation="ACFQSVVHLLPKPRPSSRTQIQAEVSWSFPAGQKVQMRGDQKPLH
FT                   TTSIAEASGIFSCHVLSHQKQLGHL"
FT   CDS             <11682785..11683120
FT                   /codon_start=1
FT                   /locus_tag="mCG_3755"
FT                   /product="mCG3755, isoform CRA_a"
FT                   /note="gene_id=mCG3755.2 transcript_id=mCT174003.0
FT                   protein_id=mCP96922.0 isoform=CRA_a"
FT                   /protein_id="EDL37532.1"
FT                   /translation="FTCFQNLDLHHEHRSKLRYSRVTPETPRQVEGRWTPGPRTVQSML
FT                   PPHSRPSLPVLWLPGPIFFSRKLMASILPGLLEFPSWTESSDERGPKAFTYNQHCRSLW
FT                   NLLLPCS"
FT   assembly_gap    11684462..11684481
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11702288..11702307
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11703780..11703864
FT                   /estimated_length=85
FT                   /gap_type="unknown"
FT   assembly_gap    11716953..11717051
FT                   /estimated_length=99
FT                   /gap_type="unknown"
FT   assembly_gap    11727356..11727375
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11742313..11742436
FT                   /estimated_length=124
FT                   /gap_type="unknown"
FT   gene            complement(<11756058..11770071)
FT                   /locus_tag="mCG_1046235"
FT                   /note="gene_id=mCG1046235.0"
FT   mRNA            complement(join(<11756058..11756466,11769992..11770071))
FT                   /locus_tag="mCG_1046235"
FT                   /product="mCG1046235"
FT                   /note="gene_id=mCG1046235.0 transcript_id=mCT163939.0
FT                   created on 30-SEP-2002"
FT   CDS             complement(11756058..11756294)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1046235"
FT                   /product="mCG1046235"
FT                   /note="gene_id=mCG1046235.0 transcript_id=mCT163939.0
FT                   protein_id=mCP65173.0"
FT                   /protein_id="EDL37534.1"
FT                   /translation="MAVPVPSNLQLCSYFLWSSFLKATMWNLLHKFVIHFFLVNLCLVV
FT                   GCQPRPPMGEDTIFYPCTLRVKPGKHKQVLIVS"
FT   assembly_gap    11761424..11764196
FT                   /estimated_length=2773
FT                   /gap_type="unknown"
FT   assembly_gap    11768150..11768169
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            11770158..11772539
FT                   /locus_tag="mCG_148317"
FT                   /note="gene_id=mCG148317.0"
FT   mRNA            join(11770158..11770470,11770581..11772539)
FT                   /locus_tag="mCG_148317"
FT                   /product="mCG148317"
FT                   /note="gene_id=mCG148317.0 transcript_id=mCT188580.0
FT                   created on 13-JAN-2004"
FT   CDS             11771516..11771866
FT                   /codon_start=1
FT                   /locus_tag="mCG_148317"
FT                   /product="mCG148317"
FT                   /note="gene_id=mCG148317.0 transcript_id=mCT188580.0
FT                   protein_id=mCP109231.0"
FT                   /protein_id="EDL37535.1"
FT                   /translation="MQLGEQQHPRLRGQHRDALGLRLVSWTYWEGFCQNGFQYRKNACC
FT                   FSRKFLLHHRKEKQMASNSVKLEAAFTLLFQEGLCCLGPVAMECQQPHLTSRTLGDCKE
FT                   LTVIKFFCPRFI"
FT   assembly_gap    11790126..11790171
FT                   /estimated_length=46
FT                   /gap_type="unknown"
FT   assembly_gap    11792714..11792733
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11795166..11795536
FT                   /estimated_length=371
FT                   /gap_type="unknown"
FT   assembly_gap    11808871..11809315
FT                   /estimated_length=445
FT                   /gap_type="unknown"
FT   gene            11825397..11918021
FT                   /gene="Stx18"
FT                   /locus_tag="mCG_3747"
FT                   /note="gene_id=mCG3747.1"
FT   mRNA            join(11825397..11825666,11877800..11877867,
FT                   11890425..11890540,11892373..11892439,11901633..11901745,
FT                   11906765..11906853,11912486..11912544,11913598..11913667,
FT                   11916425..11916505,11917466..11918021)
FT                   /gene="Stx18"
FT                   /locus_tag="mCG_3747"
FT                   /product="syntaxin 18, transcript variant mCT2706"
FT                   /note="gene_id=mCG3747.1 transcript_id=mCT2706.1 created on
FT                   18-FEB-2003"
FT   mRNA            join(11825398..11825666,11877800..11877867,
FT                   11890425..11890540,11892111..11892188,11892373..11892439,
FT                   11901633..11901745,11906765..11906853,11912486..11912544,
FT                   11913598..11913667,11916425..11916505,11917558..11918020)
FT                   /gene="Stx18"
FT                   /locus_tag="mCG_3747"
FT                   /product="syntaxin 18, transcript variant mCT179733"
FT                   /note="gene_id=mCG3747.1 transcript_id=mCT179733.0 created
FT                   on 18-FEB-2003"
FT   mRNA            join(11825415..11825666,11890425..11890529)
FT                   /gene="Stx18"
FT                   /locus_tag="mCG_3747"
FT                   /product="syntaxin 18, transcript variant mCT173722"
FT                   /note="gene_id=mCG3747.1 transcript_id=mCT173722.0 created
FT                   on 18-FEB-2003"
FT   mRNA            join(11825455..11825666,11877800..11877867,
FT                   11890425..11890540,11892111..11892188,11892373..11892439,
FT                   11901633..11901745,11906765..11906853,11912486..11912544,
FT                   11913598..11913667,11916425..11916505,11917466..11917771)
FT                   /gene="Stx18"
FT                   /locus_tag="mCG_3747"
FT                   /product="syntaxin 18, transcript variant mCT180322"
FT                   /note="gene_id=mCG3747.1 transcript_id=mCT180322.0 created
FT                   on 18-FEB-2003"
FT   CDS             join(11825499..11825666,11877800..11877867,
FT                   11890425..11890540,11892111..11892188,11892373..11892439,
FT                   11901633..11901745,11906765..11906853,11912486..11912544,
FT                   11913598..11913667,11916425..11916505,11917558..11917575)
FT                   /codon_start=1
FT                   /gene="Stx18"
FT                   /locus_tag="mCG_3747"
FT                   /product="syntaxin 18, isoform CRA_b"
FT                   /note="gene_id=mCG3747.1 transcript_id=mCT179733.0
FT                   protein_id=mCP102655.0 isoform=CRA_b"
FT                   /protein_id="EDL37537.1"
FT                   /translation="MAVDITLLFRASVKTVKTRNKALGVAVGGGADGSRDELFRRSPRP
FT                   KGDFSSRAREVISHIGKLRDFLLEHRKEYINAYSHTMSDYGRMTDTERDQIDQDAQIFI
FT                   RTCSEAIHQLRTEAHKEIHSQQVKEHRTAVLDFVDDYLKRVCKLYSEQRAIRVKRVVDK
FT                   KRLSKLEPEPHTKRKDSTSEKAPQNASQDSEGKPAAEELPEKPLAESQPELGTWGDGKG
FT                   EDELSPEEIQMFEQENQRLIGEMNSLFDEVRQIEGKVVEISRLQEIFTEKVLQQETEID
FT                   SIHQLVVGATENIKEGNEDIRELAHQG"
FT   CDS             join(11825499..11825666,11877800..11877867,
FT                   11890425..11890540,11892111..11892188,11892373..11892439,
FT                   11901633..11901745,11906765..11906853,11912486..11912544,
FT                   11913598..11913667,11916425..11916505,11917466..11917561)
FT                   /codon_start=1
FT                   /gene="Stx18"
FT                   /locus_tag="mCG_3747"
FT                   /product="syntaxin 18, isoform CRA_c"
FT                   /note="gene_id=mCG3747.1 transcript_id=mCT180322.0
FT                   protein_id=mCP103244.0 isoform=CRA_c"
FT                   /protein_id="EDL37538.1"
FT                   /translation="MAVDITLLFRASVKTVKTRNKALGVAVGGGADGSRDELFRRSPRP
FT                   KGDFSSRAREVISHIGKLRDFLLEHRKEYINAYSHTMSDYGRMTDTERDQIDQDAQIFI
FT                   RTCSEAIHQLRTEAHKEIHSQQVKEHRTAVLDFVDDYLKRVCKLYSEQRAIRVKRVVDK
FT                   KRLSKLEPEPHTKRKDSTSEKAPQNASQDSEGKPAAEELPEKPLAESQPELGTWGDGKG
FT                   EDELSPEEIQMFEQENQRLIGEMNSLFDEVRQIEGKVVEISRLQEIFTEKVLQQETEID
FT                   SIHQLVVGATENIKEGNEDIREAIKNNAGFRVWILFFLVMCSFSLLFLDWYDS"
FT   CDS             join(11825499..11825666,11877800..11877867,
FT                   11890425..11890540,11892373..11892439,11901633..11901745,
FT                   11906765..11906853,11912486..11912544,11913598..11913667,
FT                   11916425..11916505,11917466..11917561)
FT                   /codon_start=1
FT                   /gene="Stx18"
FT                   /locus_tag="mCG_3747"
FT                   /product="syntaxin 18, isoform CRA_d"
FT                   /note="gene_id=mCG3747.1 transcript_id=mCT2706.1
FT                   protein_id=mCP4193.2 isoform=CRA_d"
FT                   /protein_id="EDL37539.1"
FT                   /translation="MAVDITLLFRASVKTVKTRNKALGVAVGGGADGSRDELFRRSPRP
FT                   KGDFSSRAREVISHIGKLRDFLLEHRKEYINAYSHTMSDYGRMTDTERDQIDQDAQIFI
FT                   RTCSEAIHQLRTEGVCKLYSEQRAIRVKRVVDKKRLSKLEPEPHTKRKDSTSEKAPQNA
FT                   SQDSEGKPAAEELPEKPLAESQPELGTWGDGKGEDELSPEEIQMFEQENQRLIGEMNSL
FT                   FDEVRQIEGKVVEISRLQEIFTEKVLQQETEIDSIHQLVVGATENIKEGNEDIREAIKN
FT                   NAGFRVWILFFLVMCSFSLLFLDWYDS"
FT   CDS             join(11825499..11825666,11890425..11890439)
FT                   /codon_start=1
FT                   /gene="Stx18"
FT                   /locus_tag="mCG_3747"
FT                   /product="syntaxin 18, isoform CRA_a"
FT                   /note="gene_id=mCG3747.1 transcript_id=mCT173722.0
FT                   protein_id=mCP96641.0 isoform=CRA_a"
FT                   /protein_id="EDL37536.1"
FT                   /translation="MAVDITLLFRASVKTVKTRNKALGVAVGGGADGSRDELFRRSPRP
FT                   KGDFSSRAREVPHHV"
FT   assembly_gap    11872819..11872838
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11878858..11878877
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11880423..11880485
FT                   /estimated_length=63
FT                   /gap_type="unknown"
FT   gene            complement(11918395..11940835)
FT                   /gene="Nsg1"
FT                   /locus_tag="mCG_3752"
FT                   /note="gene_id=mCG3752.2"
FT   mRNA            complement(join(11918395..11920075,11925912..11926022,
FT                   11936806..11936922,11940075..11940229,11940589..11940643,
FT                   11940721..11940835))
FT                   /gene="Nsg1"
FT                   /locus_tag="mCG_3752"
FT                   /product="neuron specific gene family member 1, transcript
FT                   variant mCT2681"
FT                   /note="gene_id=mCG3752.2 transcript_id=mCT2681.2 created on
FT                   18-SEP-2002"
FT   mRNA            complement(join(11918397..11920075,11936806..11936922,
FT                   11940075..11940229,11940589..11940643))
FT                   /gene="Nsg1"
FT                   /locus_tag="mCG_3752"
FT                   /product="neuron specific gene family member 1, transcript
FT                   variant mCT173435"
FT                   /note="gene_id=mCG3752.2 transcript_id=mCT173435.0 created
FT                   on 18-SEP-2002"
FT   CDS             complement(join(11919875..11920075,11936806..11936922,
FT                   11940075..11940203))
FT                   /codon_start=1
FT                   /gene="Nsg1"
FT                   /locus_tag="mCG_3752"
FT                   /product="neuron specific gene family member 1, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG3752.2 transcript_id=mCT173435.0
FT                   protein_id=mCP96354.0 isoform=CRA_b"
FT                   /protein_id="EDL37541.1"
FT                   /translation="MVKLGNNFAEKGTKQPLLEDGFDTIPLMTPLDVNQLQFPPPDKVV
FT                   VKTKTEYEPDRKKGKARPPKIAEFTVSITEGVTERFKNTQCIPEGLESYYTEQDSSARE
FT                   KFYTVINHYNVAKQSITRSVSPWMSVLSEEKLSEQETEAAEKSA"
FT   CDS             complement(join(11919875..11920075,11925912..11926022,
FT                   11936806..11936922,11940075..11940203))
FT                   /codon_start=1
FT                   /gene="Nsg1"
FT                   /locus_tag="mCG_3752"
FT                   /product="neuron specific gene family member 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG3752.2 transcript_id=mCT2681.2
FT                   protein_id=mCP4204.2 isoform=CRA_a"
FT                   /protein_id="EDL37540.1"
FT                   /translation="MVKLGNNFAEKGTKQPLLEDGFDTIPLMTPLDVNQLQFPPPDKVV
FT                   VKTKTEYEPDRKKGKARPPKIAEFTVSITEGVTERFKVSVLVLFALAFLTCVVFLVVYK
FT                   VYKYDRACPDGFVLKNTQCIPEGLESYYTEQDSSAREKFYTVINHYNVAKQSITRSVSP
FT                   WMSVLSEEKLSEQETEAAEKSA"
FT   assembly_gap    11940644..11940663
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11970492..11970511
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(11980666..12001482)
FT                   /gene="Zfp509"
FT                   /locus_tag="mCG_3746"
FT                   /note="gene_id=mCG3746.3"
FT   mRNA            complement(join(11980666..11982382,11984565..11984726,
FT                   11984814..11984896,11986958..11987031,11991687..11991733,
FT                   11994377..11995452,11997516..11997690))
FT                   /gene="Zfp509"
FT                   /locus_tag="mCG_3746"
FT                   /product="zinc finger protein 509, transcript variant
FT                   mCT2711"
FT                   /note="gene_id=mCG3746.3 transcript_id=mCT2711.1 created on
FT                   18-FEB-2003"
FT   mRNA            complement(join(11981317..11982382,11984565..11984726,
FT                   11984814..11984896,11986958..11987031,11994377..11995452,
FT                   11997516..11997682,12001392..12001482))
FT                   /gene="Zfp509"
FT                   /locus_tag="mCG_3746"
FT                   /product="zinc finger protein 509, transcript variant
FT                   mCT180323"
FT                   /note="gene_id=mCG3746.3 transcript_id=mCT180323.0 created
FT                   on 18-FEB-2003"
FT   mRNA            complement(join(11981319..11982382,11984565..11984726,
FT                   11984814..11984896,11986958..11987031,11997516..11997682,
FT                   12001392..12001433))
FT                   /gene="Zfp509"
FT                   /locus_tag="mCG_3746"
FT                   /product="zinc finger protein 509, transcript variant
FT                   mCT173723"
FT                   /note="gene_id=mCG3746.3 transcript_id=mCT173723.0 created
FT                   on 18-FEB-2003"
FT   CDS             complement(join(11981706..11982382,11984565..11984726,
FT                   11984814..11984896,11986958..11987031,11991687..11991733,
FT                   11994377..11995452,11997516..11997667))
FT                   /codon_start=1
FT                   /gene="Zfp509"
FT                   /locus_tag="mCG_3746"
FT                   /product="zinc finger protein 509, isoform CRA_a"
FT                   /note="gene_id=mCG3746.3 transcript_id=mCT2711.1
FT                   protein_id=mCP4171.1 isoform=CRA_a"
FT                   /protein_id="EDL37542.1"
FT                   /translation="MDPVAVHSCHLLQQLREQRIQGLLCDCMLVVRGVCFKAHKNVLAA
FT                   FSQYFRSLFQNSSSQKNDVFHLDVTNVSGIGQILDFMYTSRLDLNQDNIQVMLDTAQCL
FT                   QVQNVLNLCHTFLKSAPAAQLPGLPCAGGFSLQSVALDGTCAVSEHYPPPSLQECPVEG
FT                   PQAKVPAEVNARAPSANFSRPTEVSKPDAAGGSCPELPCKQPNHYYKLRTLYSKQYYKQ
FT                   TACPSQVPATQQPLTRSASTDLAAADSQPPVEGRPAVLETPEHLPSTFVAPPVRNSGND
FT                   SEADPLSEPPAKQMRLKKAMHLKKLNFLKSQQSAECTSHPEPDNGLARREESAAKEDAV
FT                   ERAGSQTAEEKGRGELGPESSREEELPGAPASWEDPSQALQPQKQYACELCGKPFKHPS
FT                   NLELHKRSHTGEKPFECNICGKHFSQAGNLQTHLRRHSGEKPYICEICGKRFAASGDVQ
FT                   RHIIIHSGEKPHLCDTCGRGFSNFSNLKEHKKTHTADKVFTCDECGKSFNMQRKLVKHR
FT                   VRHTGERPYSCPACGKCFGGSGDLRRHVRTHTGEKPYSCEVCSKCFTRSAVLRRHKRMH
FT                   GRADARSPVVLGELSRPIEPSDLDRSQSSDSFSQDVSVTLMPVSVKLPVQPVESSVAGF
FT                   DGHCSGSYCKLRSMLRPPGMSDQDRLSLEPSKLAKPPELQSQPQAYAYSDVEPSAGVEQ
FT                   PQADGMAVSRSSLATLDNHCTEPLGSRAPSVTYRNSEGQFFSSMTLWGLAMKTLQNEHE
FT                   LEQ"
FT   CDS             complement(join(11984703..11984726,11984814..11984896,
FT                   11986958..11987031,11997516..11997667))
FT                   /codon_start=1
FT                   /gene="Zfp509"
FT                   /locus_tag="mCG_3746"
FT                   /product="zinc finger protein 509, isoform CRA_b"
FT                   /note="gene_id=mCG3746.3 transcript_id=mCT173723.0
FT                   protein_id=mCP96642.0 isoform=CRA_b"
FT                   /db_xref="InterPro:IPR000210"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="MGI:MGI:1922329"
FT                   /db_xref="UniProtKB/TrEMBL:D6RGL5"
FT                   /protein_id="EDL37543.1"
FT                   /translation="MDPVAVHSCHLLQQLREQRIQGLLCDCMLVVRGVCFKAHKNVLAA
FT                   FSQYFRQATFRLTYAGTLGRSHTSVKSVERGLRPLVTSSATSSFTLERSHTCVTRAAEG
FT                   SAISAI"
FT   CDS             complement(join(11986973..11987031,11994377..11995452,
FT                   11997516..11997667))
FT                   /codon_start=1
FT                   /gene="Zfp509"
FT                   /locus_tag="mCG_3746"
FT                   /product="zinc finger protein 509, isoform CRA_c"
FT                   /note="gene_id=mCG3746.3 transcript_id=mCT180323.0
FT                   protein_id=mCP103245.0 isoform=CRA_c"
FT                   /db_xref="GOA:D6RGS0"
FT                   /db_xref="InterPro:IPR000210"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="MGI:MGI:1922329"
FT                   /db_xref="UniProtKB/TrEMBL:D6RGS0"
FT                   /protein_id="EDL37544.1"
FT                   /translation="MDPVAVHSCHLLQQLREQRIQGLLCDCMLVVRGVCFKAHKNVLAA
FT                   FSQYFRSLFQNSSSQKNDVFHLDVTNVSGIGQILDFMYTSRLDLNQDNIQVMLDTAQCL
FT                   QVQNVLNLCHTFLKSAPAAQLPGLPCAGGFSLQSVALDGTCAVSEHYPPPSLQECPVEG
FT                   PQAKVPAEVNARAPSANFSRPTEVSKPDAAGGSCPELPCKQPNHYYKLRTLYSKQYYKQ
FT                   TACPSQVPATQQPLTRSASTDLAAADSQPPVEGRPAVLETPEHLPSTFVAPPVRNSGND
FT                   SEADPLSEPPAKQMRLKKAMHLKKLNFLKSQQSAECTSHPEPDNGLARREESAAKEDAV
FT                   ERAGSQTAEEKGRGELGPESSREEELPGAPASWEDPSQALQPQKQYACELCGKPFKHPS
FT                   NLELHKRSHTGRQPSDSLTPALWGEAIHL"
FT   gene            12001576..12015366
FT                   /gene="Lyar"
FT                   /locus_tag="mCG_3754"
FT                   /note="gene_id=mCG3754.2"
FT   mRNA            join(12001576..12001704,12005696..12005866,
FT                   12006958..12007072,12008924..12009031,12009119..12009202,
FT                   12011630..12012059,12012342..12012428,12014311..12014396,
FT                   12015060..12015366)
FT                   /gene="Lyar"
FT                   /locus_tag="mCG_3754"
FT                   /product="Ly1 antibody reactive clone, transcript variant
FT                   mCT2671"
FT                   /note="gene_id=mCG3754.2 transcript_id=mCT2671.2 created on
FT                   18-SEP-2002"
FT   mRNA            join(12001576..12001704,12004000..12004127,
FT                   12004203..12004300,12005696..12005866,12008924..12009018)
FT                   /gene="Lyar"
FT                   /locus_tag="mCG_3754"
FT                   /product="Ly1 antibody reactive clone, transcript variant
FT                   mCT173434"
FT                   /note="gene_id=mCG3754.2 transcript_id=mCT173434.0 created
FT                   on 18-SEP-2002"
FT   CDS             join(12005745..12005866,12006958..12007072,
FT                   12008924..12009031,12009119..12009202,12011630..12012059,
FT                   12012342..12012428,12014311..12014396,12015060..12015194)
FT                   /codon_start=1
FT                   /gene="Lyar"
FT                   /locus_tag="mCG_3754"
FT                   /product="Ly1 antibody reactive clone, isoform CRA_b"
FT                   /note="gene_id=mCG3754.2 transcript_id=mCT2671.2
FT                   protein_id=mCP4206.2 isoform=CRA_b"
FT                   /protein_id="EDL37546.1"
FT                   /translation="MVFFTCNACGESVKKIQVEKHVSNCRNCECLSCIDCGKDFWGDDY
FT                   KSHVKCISEGQKYGGKGYEAKTHKGDAKQQAWIQKINELIKKPNVSPKVRELLQQISAF
FT                   DNVPRKKAKFQNWMKNSLKVHSDSVLEQVWDIFSEASSSEQDQQQPPSHTAKPHAEMPI
FT                   TKVPSAKTNGTTEEQTEAKKNKRERKEERQKNRKKEKKELKLENHQENLRGQKPKKRKK
FT                   NQEAGHEAAGEEAAEASGPPEKKKAQGGQASEEGADRNGGPGEDAAEGQTKTAAGKRKR
FT                   PKHSGAESGYKKKKMKLPEQPEEGEAKDHEAPSKGKFNWKGTIKAVLKQAPDNEISVKK
FT                   LKKKVIAQYHAVMNDHHTSEEELLAIFNRKISRNPTFKVLKDRVKLLK"
FT   CDS             join(12005745..12005866,12008924)
FT                   /codon_start=1
FT                   /gene="Lyar"
FT                   /locus_tag="mCG_3754"
FT                   /product="Ly1 antibody reactive clone, isoform CRA_a"
FT                   /note="gene_id=mCG3754.2 transcript_id=mCT173434.0
FT                   protein_id=mCP96353.0 isoform=CRA_a"
FT                   /db_xref="MGI:MGI:107470"
FT                   /db_xref="UniProtKB/TrEMBL:D6RDT2"
FT                   /protein_id="EDL37545.1"
FT                   /translation="MVFFTCNACGESVKKIQVEKHVSNCRNCECLSCIDCGKDF"
FT   gene            12041199..12050660
FT                   /gene="Tmem128"
FT                   /locus_tag="mCG_3756"
FT                   /note="gene_id=mCG3756.2"
FT   mRNA            join(12041199..12041554,12043059..12043200,
FT                   12045872..12046030,12048239..12048344,12050101..12050660)
FT                   /gene="Tmem128"
FT                   /locus_tag="mCG_3756"
FT                   /product="transmembrane protein 128, transcript variant
FT                   mCT2669"
FT                   /note="gene_id=mCG3756.2 transcript_id=mCT2669.2 created on
FT                   18-SEP-2002"
FT   CDS             join(12041464..12041554,12043059..12043200,
FT                   12045872..12046030,12048239..12048338)
FT                   /codon_start=1
FT                   /gene="Tmem128"
FT                   /locus_tag="mCG_3756"
FT                   /product="transmembrane protein 128, isoform CRA_c"
FT                   /note="gene_id=mCG3756.2 transcript_id=mCT2669.2
FT                   protein_id=mCP4148.2 isoform=CRA_c"
FT                   /protein_id="EDL37549.1"
FT                   /translation="MDAPWAREQLRRRYLFPSEVELDCEDEAKPETPTAVEKKERPLPR
FT                   LNIHSGFWILASIVVTYYVDFFKTFKENFHTNSWFLFGGALLFVSLSIAFYCIVYLEWY
FT                   RGIEEYDVKYPTLVPITTATFIAAGICFNLALWNVWSFFTPLLLFTQFMGVVMFISLLG
FT                   "
FT   mRNA            join(<12043058..12043200,12045872..12046030,
FT                   12048239..12048344,12048757..12048962)
FT                   /gene="Tmem128"
FT                   /locus_tag="mCG_3756"
FT                   /product="transmembrane protein 128, transcript variant
FT                   mCT173433"
FT                   /note="gene_id=mCG3756.2 transcript_id=mCT173433.0 created
FT                   on 18-SEP-2002"
FT   CDS             join(<12043058..12043200,12045872..12046030,
FT                   12048239..12048338)
FT                   /codon_start=1
FT                   /gene="Tmem128"
FT                   /locus_tag="mCG_3756"
FT                   /product="transmembrane protein 128, isoform CRA_b"
FT                   /note="gene_id=mCG3756.2 transcript_id=mCT173433.0
FT                   protein_id=mCP96352.0 isoform=CRA_b"
FT                   /protein_id="EDL37548.1"
FT                   /translation="ETPTAVEKKERPLPRLNIHSGFWILASIVVTYYVDFFKTFKENFH
FT                   TNSWFLFGGALLFVSLSIAFYCIVYLEWYRGIEEYDVKYPTLVPITTATFIAAGICFNL
FT                   ALWNVWSFFTPLLLFTQFMGVVMFISLLG"
FT   mRNA            join(<12045984..12046030,12047578..12047610,
FT                   12048239..12048344,12048757..12048952)
FT                   /gene="Tmem128"
FT                   /locus_tag="mCG_3756"
FT                   /product="transmembrane protein 128, transcript variant
FT                   mCT173432"
FT                   /note="gene_id=mCG3756.2 transcript_id=mCT173432.0 created
FT                   on 18-SEP-2002"
FT   CDS             join(<12045984..12046030,12047578..12047610,
FT                   12048239..12048338)
FT                   /codon_start=1
FT                   /gene="Tmem128"
FT                   /locus_tag="mCG_3756"
FT                   /product="transmembrane protein 128, isoform CRA_a"
FT                   /note="gene_id=mCG3756.2 transcript_id=mCT173432.0
FT                   protein_id=mCP96351.0 isoform=CRA_a"
FT                   /protein_id="EDL37547.1"
FT                   /translation="TLVPITTATFIAAGICFACSWTLATVSFNLALWNVWSFFTPLLLF
FT                   TQFMGVVMFISLLG"
FT   gene            12056979..12089115
FT                   /gene="Otop1"
FT                   /locus_tag="mCG_141235"
FT                   /note="gene_id=mCG141235.2"
FT   mRNA            join(12056979..12057110,12058568..12058858,
FT                   12068930..12069066,12075522..12075580,12082793..12082923,
FT                   12084559..12085466,12087659..12089115)
FT                   /gene="Otop1"
FT                   /locus_tag="mCG_141235"
FT                   /product="otopetrin 1, transcript variant mCT182000"
FT                   /note="gene_id=mCG141235.2 transcript_id=mCT182000.1
FT                   created on 19-JUN-2003"
FT   CDS             join(12057014..12057110,12058568..12058858,
FT                   12068930..12069066,12075522..12075580,12082793..12082923,
FT                   12084559..12085466,12087659..12087829)
FT                   /codon_start=1
FT                   /gene="Otop1"
FT                   /locus_tag="mCG_141235"
FT                   /product="otopetrin 1, isoform CRA_a"
FT                   /note="gene_id=mCG141235.2 transcript_id=mCT182000.1
FT                   protein_id=mCP104922.1 isoform=CRA_a"
FT                   /protein_id="EDL37550.1"
FT                   /translation="MLTPPETLSAFLAGGFLGCLCLLEGLGCLRIAARGSPQASGPRRG
FT                   ASVPQKLAETLSSQYGLNVFVAGLLFLLAWAVHATGVGKSDLLCVLTALMLLQLLWMLW
FT                   YVGRSYMQRRLIRPKDTHAGARWLRGSITLFAFITVVLGCLKVAYFIGFSECLSATEGV
FT                   FPVTHAVHTLLQVYFLWGHAKDIIMSFKTLERFGVIHSVFTNLLLWANSVLNESKHQLN
FT                   EHKERLITLGFGNITIVLDDHTPQCNCTPPALCSALSHGIYYLYPFNIEYQILASTMLY
FT                   VLWKNIGRRVDSSQHQKMQCRFDGVLVGSVLGLTVLAATIAVVVVYMIHIGRSKSKSES
FT                   ALIMFYLYAITVLLLMGAAGLVGSWIYRVDEKSLDESKNPARKLDVDLLVATASGSWLL
FT                   SWGSILAIACAETRPPYTWYNLPYSVLVIVEKYVQNIFIIESVHLEPEGVPEDVRTLRV
FT                   VTVCSSEAAALAASTLGSQGMAQDGSPAVNGNLCLQQRCGKEDQESGWEGATGTTRCLD
FT                   FLQGGMKRRLLRNITAFLFLCNISLWIPPAFGCRPEYDNGLEEIVFGFEPWIIVVNLAM
FT                   PFSIFYRMHAAAALFEVYCKI"
FT   mRNA            join(<12058451..12058858,12068930..12069066,
FT                   12075522..12075580,12082793..12082923,12084559..12085466,
FT                   12087659..12089115)
FT                   /gene="Otop1"
FT                   /locus_tag="mCG_141235"
FT                   /product="otopetrin 1, transcript variant mCT193575"
FT                   /note="gene_id=mCG141235.2 transcript_id=mCT193575.0
FT                   created on 09-MAR-2004"
FT   CDS             join(<12058453..12058858,12068930..12069066,
FT                   12075522..12075580,12082793..12082923,12084559..12085466,
FT                   12087659..12087829)
FT                   /codon_start=1
FT                   /gene="Otop1"
FT                   /locus_tag="mCG_141235"
FT                   /product="otopetrin 1, isoform CRA_b"
FT                   /note="gene_id=mCG141235.2 transcript_id=mCT193575.0
FT                   protein_id=mCP114524.0 isoform=CRA_b"
FT                   /protein_id="EDL37551.1"
FT                   /translation="DWKMPGGPGAPSSPAASSGSSRAAPSGIAACPLSPPPLARGSPQA
FT                   SGPRRGASVPQKLAETLSSQYGLNVFVAGLLFLLAWAVHATGVGKSDLLCVLTALMLLQ
FT                   LLWMLWYVGRSYMQRRLIRPKDTHAGARWLRGSITLFAFITVVLGCLKVAYFIGFSECL
FT                   SATEGVFPVTHAVHTLLQVYFLWGHAKDIIMSFKTLERFGVIHSVFTNLLLWANSVLNE
FT                   SKHQLNEHKERLITLGFGNITIVLDDHTPQCNCTPPALCSALSHGIYYLYPFNIEYQIL
FT                   ASTMLYVLWKNIGRRVDSSQHQKMQCRFDGVLVGSVLGLTVLAATIAVVVVYMIHIGRS
FT                   KSKSESALIMFYLYAITVLLLMGAAGLVGSWIYRVDEKSLDESKNPARKLDVDLLVATA
FT                   SGSWLLSWGSILAIACAETRPPYTWYNLPYSVLVIVEKYVQNIFIIESVHLEPEGVPED
FT                   VRTLRVVTVCSSEAAALAASTLGSQGMAQDGSPAVNGNLCLQQRCGKEDQESGWEGATG
FT                   TTRCLDFLQGGMKRRLLRNITAFLFLCNISLWIPPAFGCRPEYDNGLEEIVFGFEPWII
FT                   VVNLAMPFSIFYRMHAAAALFEVYCKI"
FT   assembly_gap    12078320..12079038
FT                   /estimated_length=719
FT                   /gap_type="unknown"
FT   assembly_gap    12080408..12080427
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12081640..12081659
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(12102240..12105836)
FT                   /locus_tag="mCG_1046237"
FT                   /note="gene_id=mCG1046237.1"
FT   mRNA            complement(join(12102240..12102623,12103204..12103443,
FT                   12103810..12105836))
FT                   /locus_tag="mCG_1046237"
FT                   /product="mCG1046237"
FT                   /note="gene_id=mCG1046237.1 transcript_id=mCT163941.1
FT                   created on 18-APR-2003"
FT   gene            12104303..12107454
FT                   /gene="Drd5"
FT                   /locus_tag="mCG_61530"
FT                   /note="gene_id=mCG61530.1"
FT   mRNA            12104303..12107454
FT                   /gene="Drd5"
FT                   /locus_tag="mCG_61530"
FT                   /product="dopamine receptor 5"
FT                   /note="gene_id=mCG61530.1 transcript_id=mCT61713.1 created
FT                   on 18-OCT-2002"
FT   CDS             complement(12104418..12104996)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1046237"
FT                   /product="mCG1046237"
FT                   /note="gene_id=mCG1046237.1 transcript_id=mCT163941.1
FT                   protein_id=mCP65183.1"
FT                   /protein_id="EDL37552.1"
FT                   /translation="MIHRFRMEAVEHMMSKATQMSQNAPKGQYPATSATAFQGMTSNAT
FT                   KRSETARDTMKMLVILARRWRLRTIAAHTRTLPSKVQTIKRVRRPAVTTCAGPSGAAEP
FT                   PGASTCASCLCNPSRARCAVPLRPGGSMSRWVARAHCVRSQLRPCAPRKAPSGTPEGAP
FT                   GPAADRPQTRGALTLHCLGSFNGISLARL"
FT   CDS             12104602..12106038
FT                   /codon_start=1
FT                   /gene="Drd5"
FT                   /locus_tag="mCG_61530"
FT                   /product="dopamine receptor 5"
FT                   /note="gene_id=mCG61530.1 transcript_id=mCT61713.1
FT                   protein_id=mCP27250.1"
FT                   /db_xref="GOA:B2RQS5"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000497"
FT                   /db_xref="InterPro:IPR000929"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:94927"
FT                   /db_xref="UniProtKB/TrEMBL:B2RQS5"
FT                   /protein_id="EDL37553.1"
FT                   /translation="MLPPGRNGTAHRARLGLQRQLAQVDAPGGSAAPLGPAQVVTAGLL
FT                   TLLIVWTLLGNVLVCAAIVRSRHLRAKMTNIFIVSLAVSDLFVALLVMPWKAVAEVAGY
FT                   WPFGAFCDIWVAFDIMCSTASILNLCIISVDRYWAISRPFRYERKMTQRVALVMVALAW
FT                   TLSILISFIPVQLNWHRDKAGSQGREGLLSNETPWEEGWELDGRTENCDSSLNRTYAIS
FT                   SSLISFYIPVAIMIVTYTRIYRIAQVQIRRISSLERAAEHAQSCRSRGACEPDPSLRAS
FT                   IKKETKVFKTLSVIMGVFVCCWLPFFILNCMVPFCSSGDAQGPRTGFPCVSETTFDIFV
FT                   WFGWANSSLNPIIYAFNADFRKVFAQLLGCSHLCFRTPVQTVNISNELISYNQDTVFHR
FT                   EIAAAYVHMIPNAVSSGDREVGEEEEAEEEGPFDHMSQISPTTPDGDLAAESVWELDCE
FT                   EEVSLGKISPLTPNCFHKTA"
FT   gene            <12129322..12134132
FT                   /locus_tag="mCG_146321"
FT                   /note="gene_id=mCG146321.0"
FT   mRNA            join(<12129322..12129429,12130351..12130428,
FT                   12133976..12134132)
FT                   /locus_tag="mCG_146321"
FT                   /product="mCG146321"
FT                   /note="gene_id=mCG146321.0 transcript_id=mCT186424.0
FT                   created on 14-JUL-2003"
FT   CDS             join(<12129322..12129429,12130351..12130428,
FT                   12133976..12134032)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146321"
FT                   /product="mCG146321"
FT                   /note="gene_id=mCG146321.0 transcript_id=mCT186424.0
FT                   protein_id=mCP107485.0"
FT                   /protein_id="EDL37554.1"
FT                   /translation="LPCCAQKTLCPYSHPVPLLLILFPSSMTSKPLERHVLGGSVLPLE
FT                   PVHTTGFWWRTLWIWAQDPRNSFLCGEVSAAATSM"
FT   gene            complement(12134255..12281799)
FT                   /gene="Slc2a9"
FT                   /locus_tag="mCG_122706"
FT                   /note="gene_id=mCG122706.0"
FT   mRNA            complement(join(12134255..12134849,12136142..12136272,
FT                   12147640..12147767,12164724..12164799,12166849..12166950,
FT                   12176473..12176574,12178074..12178184,12179560..12179670,
FT                   12186546..12186733,12199119..12199251,12218440..12218585,
FT                   12222550..12222674,12235035..12235195,12255042..12255140,
FT                   12257543..12257680,12260821..12260889,12281582..12281799))
FT                   /gene="Slc2a9"
FT                   /locus_tag="mCG_122706"
FT                   /product="solute carrier family 2 (facilitated glucose
FT                   transporter), member 9, transcript variant mCT123929"
FT                   /note="gene_id=mCG122706.0 transcript_id=mCT123929.0
FT                   created on 03-OCT-2002"
FT   mRNA            complement(join(12134256..12136272,12147640..12147767,
FT                   12164724..12164799,12176473..12176574,12179560..12179670,
FT                   12218440..12218585,12222550..12222674,12235035..12235195,
FT                   12255042..12255140,12260821..12260889,12281582..12281775))
FT                   /gene="Slc2a9"
FT                   /locus_tag="mCG_122706"
FT                   /product="solute carrier family 2 (facilitated glucose
FT                   transporter), member 9, transcript variant mCT173995"
FT                   /note="gene_id=mCG122706.0 transcript_id=mCT173995.0
FT                   created on 03-OCT-2002"
FT   mRNA            complement(join(12134574..12136272,12147640..12147767,
FT                   12164724..12164799,12176473..12176574,12179560..12179670,
FT                   12199119..12199251,12218440..12218585,12222550..12222674,
FT                   12235035..12235195,12255042..12255140,12257543..>12257663))
FT                   /gene="Slc2a9"
FT                   /locus_tag="mCG_122706"
FT                   /product="solute carrier family 2 (facilitated glucose
FT                   transporter), member 9, transcript variant mCT193636"
FT                   /note="gene_id=mCG122706.0 transcript_id=mCT193636.0
FT                   created on 09-MAR-2004"
FT   CDS             complement(join(12134846..12134849,12136142..12136272,
FT                   12147640..12147767,12164724..12164799,12166849..12166950,
FT                   12176473..12176574,12178074..12178184,12179560..12179670,
FT                   12186546..12186733,12199119..12199251,12218440..12218585,
FT                   12222550..12222674,12235035..12235195,12255042..12255140,
FT                   12257543..12257680,12260821..12260868))
FT                   /codon_start=1
FT                   /gene="Slc2a9"
FT                   /locus_tag="mCG_122706"
FT                   /product="solute carrier family 2 (facilitated glucose
FT                   transporter), member 9, isoform CRA_a"
FT                   /note="gene_id=mCG122706.0 transcript_id=mCT123929.0
FT                   protein_id=mCP65036.1 isoform=CRA_a"
FT                   /protein_id="EDL37555.1"
FT                   /translation="MKLSEKNSAETKESQRRCPGKSRVLEPGRKKMDSRELALASLMCD
FT                   TGGPGELSVGHQQRRTKKWSFSLVVAALVGAFGSSFLYGYNLSVVNAPTPYIKAFYNGT
FT                   WYRRHGQPIDPDTLTLLWSVTVSIFAIGGLVGTLMVKMIGKFLGRKSTLLVNNGFAISA
FT                   ALLMACSLRAGTFEMLIVGRFIMGVDGGIALSALPMYLNEISPKEIRGSLGQVTAIFIC
FT                   IGVFSGQLLGLPELLGRESTWPYLFGVIIVPALVQLASLPFLPESPRYLLFEKHDEAGA
FT                   MKAFQTFLGKADVSQELEEALAESRVQRNLRLVSVLELLRAPFVRWQVITVIITMASYQ
FT                   LCGLNAIWFYTNSIFGKAGIPQDKIPYITLSTGGIETLAAIFSIWFYTNSIFGKAGIPQ
FT                   DKIPYITLSTGGIETLAAIFSGLVIERLGRRPLLIGGFGLMALFFGTLTATLTLQGLVI
FT                   ERLGRRPLLIGGFGLMALFFGTLTATLTLQDQAPWVPYLSIVCILAIIASFCSGPGGIP
FT                   FILTGEFFQQSERPAAFMIAGTVNWLSNFAVGLLFPFIQKSLDSYCFLVFATICIAGAT
FT                   YFYFVLPETKNRTHAEISQAFAKR"
FT   CDS             complement(join(12136018..12136272,12147640..12147767,
FT                   12164724..12164799,12176473..12176574,12179560..12179670,
FT                   12218440..12218585,12222550..12222674,12235035..12235195,
FT                   12255042..12255140,12260821..12260868))
FT                   /codon_start=1
FT                   /gene="Slc2a9"
FT                   /locus_tag="mCG_122706"
FT                   /product="solute carrier family 2 (facilitated glucose
FT                   transporter), member 9, isoform CRA_b"
FT                   /note="gene_id=mCG122706.0 transcript_id=mCT173995.0
FT                   protein_id=mCP96914.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q99JJ2"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="MGI:MGI:2152844"
FT                   /db_xref="UniProtKB/TrEMBL:Q99JJ2"
FT                   /protein_id="EDL37556.1"
FT                   /translation="MKLSEKNSAETKESQRKWSFSLVVAALVGAFGSSFLYGYNLSVVN
FT                   APTPYIKAFYNGTWYRRHGQPIDPDTLTLLWSVTVSIFAIGGLVGTLMVKMIGKFLGRK
FT                   STLLVNNGFAISAALLMACSLRAGTFEMLIVGRFIMGVDGGIALSALPMYLNEISPKEI
FT                   RGSLGQVTAIFICIGVFSGQLLGLPELLGRIWFYTNSIFGKAGIPQDKIPYITLSTGGI
FT                   ETLAAIFSGLVIERLGRRPLLIGGFGLMALFFGTLTATLTLQDQAPWVPYLSIVCILAI
FT                   IASFCSGPGGIPFILTGEFFQQSERPAAFMIAGTVNWLSNFAVGLLFPFIQKSLDSYCF
FT                   LVFATICIAGATYFYFVLPETKNRTHAEISQAFAKRNKAQPPEVKADSAMTEEKANSQT
FT                   EPDSSSTLDSYGQNKIV"
FT   assembly_gap    12176022..12176041
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12177065..12177084
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12178750..12178769
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             complement(join(12179582..12179670,12199119..12199251,
FT                   12218440..12218585,12222550..12222674,12235035..12235195,
FT                   12255042..12255140,12257543..>12257662))
FT                   /codon_start=1
FT                   /gene="Slc2a9"
FT                   /locus_tag="mCG_122706"
FT                   /product="solute carrier family 2 (facilitated glucose
FT                   transporter), member 9, isoform CRA_c"
FT                   /note="gene_id=mCG122706.0 transcript_id=mCT193636.0
FT                   protein_id=mCP114611.0 isoform=CRA_c"
FT                   /protein_id="EDL37557.1"
FT                   /translation="RVLEPGRKKMDSRELALASLMCDTGGPGELSVGHQQRRTKKWSFS
FT                   LVVAALVGAFGSSFLYGYNLSVVNAPTPYIKAFYNGTWYRRHGQPIDPDTLTLLWSVTV
FT                   SIFAIGGLVGTLMVKMIGKFLGRKSTLLVNNGFAISAALLMACSLRAGTFEMLIVGRFI
FT                   MGVDGGIALSALPMYLNEISPKEIRGSLGQVTAIFICIGVFSGQLLGLPELLGRESTWP
FT                   YLFGVIIVPALVQLASLPFLPESPRYLLFEKHDEAGAMKDLVLHQQHLWESWDPSGQDP
FT                   IHHPEHGRN"
FT   assembly_gap    12194382..12194401
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12223694..12224001
FT                   /estimated_length=308
FT                   /gap_type="unknown"
FT   assembly_gap    12249524..12249543
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12255896..12255915
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12257150..12257169
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12261681..12261700
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12263433..12264905
FT                   /estimated_length=1473
FT                   /gap_type="unknown"
FT   assembly_gap    12267726..12267970
FT                   /estimated_length=245
FT                   /gap_type="unknown"
FT   assembly_gap    12291869..12291888
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(12306832..12341790)
FT                   /gene="Wdr1"
FT                   /locus_tag="mCG_3745"
FT                   /note="gene_id=mCG3745.2"
FT   mRNA            complement(join(12306832..12307930,12309543..12309687,
FT                   12309955..12310128,12311033..12311143,12313502..12313589,
FT                   12315202..12315356,12317155..12317244,12320031..12320264,
FT                   12320522..12320602,12320819..12320896,12325692..12325872,
FT                   12326962..12327109,12331395..12331485,12341098..12341219,
FT                   12341534..12341790))
FT                   /gene="Wdr1"
FT                   /locus_tag="mCG_3745"
FT                   /product="WD repeat domain 1, transcript variant mCT2716"
FT                   /note="gene_id=mCG3745.2 transcript_id=mCT2716.2 created on
FT                   24-DEC-2002"
FT   CDS             complement(join(12307824..12307930,12309543..12309687,
FT                   12309955..12310128,12311033..12311143,12313502..12313589,
FT                   12315202..12315356,12317155..12317244,12320031..12320264,
FT                   12320522..12320602,12320819..12320896,12325692..12325872,
FT                   12326962..12327109,12331395..12331485,12341098..12341219,
FT                   12341534..12341549))
FT                   /codon_start=1
FT                   /gene="Wdr1"
FT                   /locus_tag="mCG_3745"
FT                   /product="WD repeat domain 1, isoform CRA_b"
FT                   /note="gene_id=mCG3745.2 transcript_id=mCT2716.2
FT                   protein_id=mCP4154.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q3TJY2"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011045"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="MGI:MGI:1337100"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TJY2"
FT                   /protein_id="EDL37559.1"
FT                   /translation="MPYEIKKVFASLPQVERGVSKILGGDPKGDHFLYTNGKCVILRNI
FT                   DNPAIADIYTEHAHQVVVAKYAPSGFYIASGDISGKLRIWDTTQKEHLLKYEYQPFAGK
FT                   IKDIAWTEDSKRIAVVGEGREKFGAVFLWDTGSSVGEITGHNKVINSVDIKQTRPYRLA
FT                   TGSDDNCAAFFEGPPFKFKFTIGDHSRFVNCVRFSPDGNRFATASADGQIFIYDGKTGE
FT                   KVCALGESKAHDGGIYAISWSPDSTHLLSASGDKTSKIWDVNVNSVVSTFPMGSNVLDQ
FT                   QLGCLWQKDHLLSISLSGYINYLDKNNPSKPLRVIKGHSKSIQCLTVHRNGGKSYIYSG
FT                   SHDGHINYWDSETGENDSFSGKGHTNQVSRMTVNESEQLVSCSMDDTVRYTNLTLRDYS
FT                   GQGVVKLDVQPKCVAVGPGGYTVVVCIGQIVLLKDQKKCFSIDNPGYEPEVVAVHPGGD
FT                   TVAVGGTDGNVRVYSILASTLKDEGKLLEAKGPVTDVAYSHDGAFLAVCDASKVVTVFS
FT                   VADGYSENNVFYGHHAKIVCLAWSPDNEHFASGGMDMMVYVWTLSDPETKVKIQDAHRL
FT                   HHVSSLAWLDEHTLVTTSHDASVKEWTITY"
FT   mRNA            complement(join(<12320206..12320264,12320522..12320602,
FT                   12320819..12320896,12325692..12325826,12341098..12341219,
FT                   12341534..12341620))
FT                   /gene="Wdr1"
FT                   /locus_tag="mCG_3745"
FT                   /product="WD repeat domain 1, transcript variant mCT173436"
FT                   /note="gene_id=mCG3745.2 transcript_id=mCT173436.0 created
FT                   on 24-DEC-2002"
FT   CDS             complement(join(<12320206..12320264,12320522..12320602,
FT                   12320819..12320896,12325692..12325826,12341098..12341219,
FT                   12341534..12341549))
FT                   /codon_start=1
FT                   /gene="Wdr1"
FT                   /locus_tag="mCG_3745"
FT                   /product="WD repeat domain 1, isoform CRA_a"
FT                   /note="gene_id=mCG3745.2 transcript_id=mCT173436.0
FT                   protein_id=mCP96355.0 isoform=CRA_a"
FT                   /protein_id="EDL37558.1"
FT                   /translation="MPYEIKKVFASLPQVERGVSKILGGDPKGDHFLYTNGKCVILRNI
FT                   DITGHNKVINSVDIKQTRPYRLATGSDDNCAAFFEGPPFKFKFTIGDHSRFVNCVRFSP
FT                   DGNRFATASADGQIFIYDGKTGEKVCALGESKAHDGGIYAISWSPDSTHLLSASGDKTS
FT                   "
FT   gene            complement(12354874..12355795)
FT                   /pseudo
FT                   /locus_tag="mCG_1046062"
FT                   /note="gene_id=mCG1046062.1"
FT   mRNA            complement(12354874..12355795)
FT                   /pseudo
FT                   /locus_tag="mCG_1046062"
FT                   /note="gene_id=mCG1046062.1 transcript_id=mCT163766.1
FT                   created on 16-OCT-2002"
FT   assembly_gap    12359900..12360395
FT                   /estimated_length=496
FT                   /gap_type="unknown"
FT   assembly_gap    12377135..12377154
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12378398..12378417
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12379591..12379610
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12385162..12385181
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12392238..12392257
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12395406..12395425
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12410344..12410363
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12413123..12413142
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12414272..12417089
FT                   /estimated_length=2818
FT                   /gap_type="unknown"
FT   assembly_gap    12421028..12421047
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12423172..12423191
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12428266..12428285
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12429381..12430023
FT                   /estimated_length=643
FT                   /gap_type="unknown"
FT   assembly_gap    12448073..12448092
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12449246..12449265
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(12461016..12477277)
FT                   /locus_tag="mCG_141317"
FT                   /note="gene_id=mCG141317.1"
FT   mRNA            complement(join(12461016..12467384,12475005..12475302,
FT                   12477199..12477277))
FT                   /locus_tag="mCG_141317"
FT                   /product="mCG141317"
FT                   /note="gene_id=mCG141317.1 transcript_id=mCT174536.1
FT                   created on 19-FEB-2003"
FT   CDS             complement(12463943..12467191)
FT                   /codon_start=1
FT                   /locus_tag="mCG_141317"
FT                   /product="mCG141317"
FT                   /note="gene_id=mCG141317.1 transcript_id=mCT174536.1
FT                   protein_id=mCP97455.1"
FT                   /db_xref="GOA:J3QPN0"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="InterPro:IPR027775"
FT                   /db_xref="InterPro:IPR028379"
FT                   /db_xref="MGI:MGI:2140750"
FT                   /db_xref="UniProtKB/TrEMBL:J3QPN0"
FT                   /protein_id="EDL37560.1"
FT                   /translation="MQIREMKDIGEQLYTTQVNGGPSSLTMSPKQPNRATRTERQEAQT
FT                   LLYQGSEAEAATMTIATCVQCKSVHKIPTQDLRKGPGQSQDTYVCFKCSLRAVPTQLHF
FT                   VNNNAGAAHVRNETETISSPVNKFKVRNFKPGKYYCDKCRFSTKDPLQYRKHTLQHEEI
FT                   RFICSHCSYISYTKGEFQRHLVKHTGIFPYRCEYCDYGAIRNDYIVKHRRRVHERAGAK
FT                   RPFKTVAKLEPKRTSIPKQSMELSKGPSPRAAFQNKLSDQLSRFSLHANKDKTHNLMLL
FT                   PELKKYQKDVVCIPNKVTLSEPREVSLLGNKNVEVEVLSPSKEPVHPGMPLTVMAPSEL
FT                   VVPTNCLAQLMDVKVVNGAQQLVLKLFPLEENARLETSRGDGGTSECLSTEKGSGGQKK
FT                   MLSPEASRSLAVEGNAGDFVGLDRLHSLVQKQLKNVKWVKSCNFFMPNSGVHSQQESFL
FT                   GSDTIKELQKSHSLCPPRALPSAAIKSHSPASVQNSVPYGPGATVSHFLSKAAVAFADD
FT                   RRGARSNSQQLLPLASLPSKVPFSGEKGLLPIGESDLEARNRISRPETLVSSDRKLEDK
FT                   QMESKAVGNTGQVSSVQNKEYLHINITGEDKPRSQQPGDQPGQPKTSETAGATFEGPII
FT                   SSVFSLSSGSENVPEAIKWNSSTTKIKSIELLRRKIAQLIESCGKPSSLSANSAQRRSI
FT                   GQAPKLTSKATPKAIQEMSVSLTGPGPTPGPSVGPLQKPPNEDSITGSRQLVPQQVCPQ
FT                   FISANDGKMENRVTRKTPVATPVLIPKGAVLRVLNSSEDAHIIEATCDTPVSIPCSEAQ
FT                   LAGTLPFCPMKQTGSGSQPLTCRSGPADMSPGLETSLRPKSRKEDTICSATAKKMVPVY
FT                   STAPGSSDSIRQGRPVSRNLTVSKNKTKQVNSTKKKNKMQANPGRYFKDPPSFFQVARQ
FT                   LRLIAAKPDQLIKCPRRNQPVIVLNHPDVDSPEVTNVMKVINKYKGNVLKVVLSERTRC
FT                   QLGVRRYHMRLTYQNVAETNHMKRQMMLKMKLKKVHKNNYQVVGSMPDDPAQCVFKCWF
FT                   CGRLYEDQEEWMSHGQRHLIEATRDWDVLSSKGK"
FT   assembly_gap    12486417..12486436
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12487696..12487715
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12489484..12489503
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12491078..12491097
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12492703..12493171
FT                   /estimated_length=469
FT                   /gap_type="unknown"
FT   assembly_gap    12496967..12496986
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(12503875..>12672342)
FT                   /gene="Clnk"
FT                   /locus_tag="mCG_122703"
FT                   /note="gene_id=mCG122703.1"
FT   mRNA            complement(join(12503875..12504187,12510648..12510803,
FT                   12512516..12512593,12518475..12518602,12533624..12533664,
FT                   12536899..12536980,12539932..12539950,12542932..12542959,
FT                   12550890..12551003,12552411..12552430,12553262..12553287,
FT                   12564949..12564994,12568645..12568754,12570435..12570576,
FT                   12575150..12575187,12585129..12585157,12595521..12595592,
FT                   12657551..12657603,12672132..>12672223))
FT                   /gene="Clnk"
FT                   /locus_tag="mCG_122703"
FT                   /product="cytokine-dependent hematopoietic cell linker,
FT                   transcript variant mCT179718"
FT                   /note="gene_id=mCG122703.1 transcript_id=mCT179718.0
FT                   created on 07-FEB-2003"
FT   mRNA            complement(join(12503875..12504187,12510648..12510803,
FT                   12512516..12512593,12518475..12518602,12533624..12533664,
FT                   12536899..12536980,12539932..12539950,12542932..12542959,
FT                   12550890..12551003,12552411..12552430,12553262..12553287,
FT                   12564949..12564994,12568645..12568754,12570435..12570576,
FT                   12575150..12575187,12585129..12585157,12595521..12595592,
FT                   12672131..>12672223))
FT                   /gene="Clnk"
FT                   /locus_tag="mCG_122703"
FT                   /product="cytokine-dependent hematopoietic cell linker,
FT                   transcript variant mCT123926"
FT                   /note="gene_id=mCG122703.1 transcript_id=mCT123926.0
FT                   created on 07-FEB-2003"
FT   mRNA            complement(join(12503880..12504187,12510648..12510803,
FT                   12512516..12512593,12518475..12518602,12533624..12533664,
FT                   12536899..12536980,12542917..12542959,12550890..12551003,
FT                   12552411..12552430,12553262..12553287,12564949..12564994,
FT                   12568645..12568754,12570435..12570576,12575150..12575187,
FT                   12585129..12585157,12595521..12595592,12657551..12657603,
FT                   12672132..>12672342))
FT                   /gene="Clnk"
FT                   /locus_tag="mCG_122703"
FT                   /product="cytokine-dependent hematopoietic cell linker,
FT                   transcript variant mCT173397"
FT                   /note="gene_id=mCG122703.1 transcript_id=mCT173397.0
FT                   created on 07-FEB-2003"
FT   CDS             complement(join(12504020..12504187,12510648..12510803,
FT                   12512516..12512593,12518475..12518602,12533624..12533664,
FT                   12536899..12536980,12539932..12539950,12542932..12542959,
FT                   12550890..12551003,12552411..12552430,12553262..12553287,
FT                   12564949..12564994,12568645..12568754,12570435..12570576,
FT                   12575150..12575187,12585129..12585157,12595521..>12595591))
FT                   /codon_start=1
FT                   /gene="Clnk"
FT                   /locus_tag="mCG_122703"
FT                   /product="cytokine-dependent hematopoietic cell linker,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG122703.1 transcript_id=mCT123926.0
FT                   protein_id=mCP64953.1 isoform=CRA_a"
FT                   /protein_id="EDL37561.1"
FT                   /translation="GNKRTTKEGFGDLRFQNVSLLKNRSWPSLSSAKGRCRAVLEPLPD
FT                   HRRNLAGVPGGEKCNSNNDYEDPEFQLLKAWPSMKILPARPIQESEYADTRYFQDTMEA
FT                   PLLLPPKASVSTERQTRDVRMTHLEEVDKPTFKDVRSQRFKGFKYTKINKTPLPPPRPA
FT                   ITLPKKYQPLPPAPPEESSAYFAPKPTFPEVQRGPRQRSAKDFSRVLGAEEESHHQTKP
FT                   ESSCPSSNQNTQKSPPAIASSSYMPGKHSIQARDHTGSMQHCPAQRCQAAASHSPRMLP
FT                   YENTNSEKPDPTKPDEKDVWQNEWYIGEYSRQAVEDVLMKENKDGTFLVRDCSTKSKAE
FT                   PYVLVVFYGNKVYNVKIRFLESNQQFALGTGLRGNEMFDSVEDIIEHYTYFPILLIDGK
FT                   DKAARRKQCYLTQPLPLARLLLTQYSSQALHE"
FT   CDS             complement(join(12504020..12504187,12510648..12510803,
FT                   12512516..12512593,12518475..12518602,12533624..12533664,
FT                   12536899..12536980,12539932..12539950,12542932..12542959,
FT                   12550890..12551003,12552411..12552430,12553262..12553287,
FT                   12564949..12564994,12568645..12568754,12570435..12570576,
FT                   12575150..12575187,12585129..12585157,12595521..>12595591))
FT                   /codon_start=1
FT                   /gene="Clnk"
FT                   /locus_tag="mCG_122703"
FT                   /product="cytokine-dependent hematopoietic cell linker,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG122703.1 transcript_id=mCT179718.0
FT                   protein_id=mCP102640.0 isoform=CRA_a"
FT                   /protein_id="EDL37563.1"
FT                   /translation="GNKRTTKEGFGDLRFQNVSLLKNRSWPSLSSAKGRCRAVLEPLPD
FT                   HRRNLAGVPGGEKCNSNNDYEDPEFQLLKAWPSMKILPARPIQESEYADTRYFQDTMEA
FT                   PLLLPPKASVSTERQTRDVRMTHLEEVDKPTFKDVRSQRFKGFKYTKINKTPLPPPRPA
FT                   ITLPKKYQPLPPAPPEESSAYFAPKPTFPEVQRGPRQRSAKDFSRVLGAEEESHHQTKP
FT                   ESSCPSSNQNTQKSPPAIASSSYMPGKHSIQARDHTGSMQHCPAQRCQAAASHSPRMLP
FT                   YENTNSEKPDPTKPDEKDVWQNEWYIGEYSRQAVEDVLMKENKDGTFLVRDCSTKSKAE
FT                   PYVLVVFYGNKVYNVKIRFLESNQQFALGTGLRGNEMFDSVEDIIEHYTYFPILLIDGK
FT                   DKAARRKQCYLTQPLPLARLLLTQYSSQALHE"
FT   assembly_gap    12507136..12507548
FT                   /estimated_length=413
FT                   /gap_type="unknown"
FT   CDS             complement(join(12512530..12512593,12518475..12518602,
FT                   12533624..12533664,12536899..12536980,12542917..12542959,
FT                   12550890..12551003,12552411..12552430,12553262..12553287,
FT                   12564949..12564994,12568645..12568754,12570435..12570576,
FT                   12575150..12575187,12585129..12585157,12595521..>12595591))
FT                   /codon_start=1
FT                   /gene="Clnk"
FT                   /locus_tag="mCG_122703"
FT                   /product="cytokine-dependent hematopoietic cell linker,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG122703.1 transcript_id=mCT173397.0
FT                   protein_id=mCP96316.0 isoform=CRA_b"
FT                   /protein_id="EDL37562.1"
FT                   /translation="GNKRTTKEGFGDLRFQNVSLLKNRSWPSLSSAKGRCRAVLEPLPD
FT                   HRRNLAGVPGGEKCNSNNDYEDPEFQLLKAWPSMKILPARPIQESEYADTRYFQDTMEA
FT                   PLLLPPKASVSTERQTRDVRMTHLEEVDKPTFKDVRSQRFKGFKYTKINKTPLPPPRPA
FT                   ITLPKKYQPLPPAPPEESSAYFAPKPTFPEVQRGPRQRSAKDFSRVSSYFNLTTRQSQN
FT                   LLAHHQTKTHRRVHLPLPALPTCQESTVYKPETIQVACSTVLLRDAKLQPATALECCPM
FT                   KTQTRRNLTPQSLMRRMSGRMNGTLENTVARQWKMC"
FT   assembly_gap    12530358..12530377
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12532512..12532542
FT                   /estimated_length=31
FT                   /gap_type="unknown"
FT   gene            <12536604..12548481
FT                   /locus_tag="mCG_14725"
FT                   /note="gene_id=mCG14725.1"
FT   mRNA            join(<12536604..12536650,12542376..12542570,
FT                   12544726..12544806,12548361..12548481)
FT                   /locus_tag="mCG_14725"
FT                   /product="mCG14725, transcript variant mCT19622"
FT                   /note="gene_id=mCG14725.1 transcript_id=mCT19622.2 created
FT                   on 18-FEB-2003"
FT   mRNA            join(<12536605..12536650,12542376..12542566,
FT                   12544726..12544806,12548361..12548481)
FT                   /locus_tag="mCG_14725"
FT                   /product="mCG14725, transcript variant mCT180278"
FT                   /note="gene_id=mCG14725.1 transcript_id=mCT180278.0 created
FT                   on 18-FEB-2003"
FT   CDS             join(<12536618..12536650,12542376..12542570,
FT                   12544726..12544806,12548361..12548432)
FT                   /codon_start=1
FT                   /locus_tag="mCG_14725"
FT                   /product="mCG14725, isoform CRA_a"
FT                   /note="gene_id=mCG14725.1 transcript_id=mCT19622.2
FT                   protein_id=mCP4192.2 isoform=CRA_a"
FT                   /protein_id="EDL37564.1"
FT                   /translation="EQLEMTHFFCKAESQLKGADQDDGISWHGPLFCQLGRSDSGFLPR
FT                   LSLLRAMSRPHGIQSALTWKIGIPPELESRQNGSKGIHPDGLLEEEHETEVRICGMQWK
FT                   GFYPDSKCDLKQLVLELFMVGM"
FT   CDS             join(<12536618..12536650,12542376..12542566,
FT                   12544726..12544806,12548361..12548394)
FT                   /codon_start=1
FT                   /locus_tag="mCG_14725"
FT                   /product="mCG14725, isoform CRA_b"
FT                   /note="gene_id=mCG14725.1 transcript_id=mCT180278.0
FT                   protein_id=mCP103200.0 isoform=CRA_b"
FT                   /protein_id="EDL37565.1"
FT                   /translation="EQLEMTHFFCKAESQLKGADQDDGISWHGPLFCQLGRSDSGFLPR
FT                   LSLLRAMSRPHGIQSALTWKIGIPPELESRMAARAFTLTGYWKKSMRQKCESVACNGKD
FT                   FIQIQSVI"
FT   assembly_gap    12548100..12548119
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12552508..12552820
FT                   /estimated_length=313
FT                   /gap_type="unknown"
FT   assembly_gap    12559887..12559906
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12581747..12581840
FT                   /estimated_length=94
FT                   /gap_type="unknown"
FT   assembly_gap    12598561..12598968
FT                   /estimated_length=408
FT                   /gap_type="unknown"
FT   assembly_gap    12600520..12601034
FT                   /estimated_length=515
FT                   /gap_type="unknown"
FT   assembly_gap    12606254..12606273
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12622049..12622302
FT                   /estimated_length=254
FT                   /gap_type="unknown"
FT   assembly_gap    12631230..12631249
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12632388..12632407
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12640211..12640230
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12642336..12642355
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12668151..12669029
FT                   /estimated_length=879
FT                   /gap_type="unknown"
FT   assembly_gap    12683316..12683335
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12686595..12686972
FT                   /estimated_length=378
FT                   /gap_type="unknown"
FT   assembly_gap    12709361..12712825
FT                   /estimated_length=3465
FT                   /gap_type="unknown"
FT   assembly_gap    12714163..12714544
FT                   /estimated_length=382
FT                   /gap_type="unknown"
FT   assembly_gap    12743895..12744060
FT                   /estimated_length=166
FT                   /gap_type="unknown"
FT   assembly_gap    12745368..12745387
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(12767715..>12768558)
FT                   /locus_tag="mCG_1046239"
FT                   /note="gene_id=mCG1046239.1"
FT   mRNA            complement(join(12767715..12768128,12768175..>12768558))
FT                   /locus_tag="mCG_1046239"
FT                   /product="mCG1046239"
FT                   /note="gene_id=mCG1046239.1 transcript_id=mCT163943.1
FT                   created on 15-OCT-2002"
FT   CDS             complement(12767807..>12768073)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1046239"
FT                   /product="mCG1046239"
FT                   /note="gene_id=mCG1046239.1 transcript_id=mCT163943.1
FT                   protein_id=mCP65208.0"
FT                   /protein_id="EDL37566.1"
FT                   /translation="QPLGADNTEEQGSQGAPRITALQACRCKANETVSEPQSCKSLWWL
FT                   LTPAPGVSVCFSASLEPPDRPYNCFSLMRAAFPSKRPDLVISP"
FT   assembly_gap    12768134..12768153
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12777795..12779979
FT                   /estimated_length=2185
FT                   /gap_type="unknown"
FT   assembly_gap    12797395..12797749
FT                   /estimated_length=355
FT                   /gap_type="unknown"
FT   assembly_gap    12799770..12799789
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12800959..12801310
FT                   /estimated_length=352
FT                   /gap_type="unknown"
FT   assembly_gap    12804572..12804591
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12832169..12832188
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12846303..12846322
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12854523..12854542
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12858610..12858839
FT                   /estimated_length=230
FT                   /gap_type="unknown"
FT   assembly_gap    12880877..12880896
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12899961..12900011
FT                   /estimated_length=51
FT                   /gap_type="unknown"
FT   assembly_gap    12905068..12905087
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12914091..12914341
FT                   /estimated_length=251
FT                   /gap_type="unknown"
FT   assembly_gap    12932925..12933025
FT                   /estimated_length=101
FT                   /gap_type="unknown"
FT   assembly_gap    12985974..12989625
FT                   /estimated_length=3652
FT                   /gap_type="unknown"
FT   assembly_gap    13023806..13024059
FT                   /estimated_length=254
FT                   /gap_type="unknown"
FT   assembly_gap    13059571..13059590
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13067294..13067313
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13082599..13082618
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13090653..13091287
FT                   /estimated_length=635
FT                   /gap_type="unknown"
FT   gene            <13101893..13108058
FT                   /locus_tag="mCG_145580"
FT                   /note="gene_id=mCG145580.0"
FT   mRNA            join(<13101893..13101977,13105277..13105408,
FT                   13107731..13108058)
FT                   /locus_tag="mCG_145580"
FT                   /product="mCG145580"
FT                   /note="gene_id=mCG145580.0 transcript_id=mCT185004.0
FT                   created on 05-JUN-2003"
FT   CDS             <13107816..13108034
FT                   /codon_start=1
FT                   /locus_tag="mCG_145580"
FT                   /product="mCG145580"
FT                   /note="gene_id=mCG145580.0 transcript_id=mCT185004.0
FT                   protein_id=mCP105605.0"
FT                   /protein_id="EDL37567.1"
FT                   /translation="EDMWMTAKWMERCWTPFAPGIDRLNHHGICEVSANVFQPNDDSKC
FT                   CQTYGEPGTSDILPRRKSGVTILDIIC"
FT   gene            complement(13132126..13132542)
FT                   /pseudo
FT                   /locus_tag="mCG_1046124"
FT                   /note="gene_id=mCG1046124.1"
FT   mRNA            complement(13132126..13132542)
FT                   /pseudo
FT                   /locus_tag="mCG_1046124"
FT                   /note="gene_id=mCG1046124.1 transcript_id=mCT163828.1
FT                   created on 11-OCT-2002"
FT   assembly_gap    13172593..13172612
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13183659..13183678
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(13195588..13196795)
FT                   /pseudo
FT                   /locus_tag="mCG_14721"
FT                   /note="gene_id=mCG14721.1"
FT   mRNA            complement(13195588..13196795)
FT                   /pseudo
FT                   /locus_tag="mCG_14721"
FT                   /note="gene_id=mCG14721.1 transcript_id=mCT19620.2 created
FT                   on 03-OCT-2002"
FT   assembly_gap    13198589..13199106
FT                   /estimated_length=518
FT                   /gap_type="unknown"
FT   gene            complement(13256912..>13397976)
FT                   /locus_tag="mCG_146111"
FT                   /note="gene_id=mCG146111.0"
FT   mRNA            complement(join(13256912..13257220,13271347..13271478,
FT                   13299094..13299270,13329104..13329210,13397885..>13397976))
FT                   /locus_tag="mCG_146111"
FT                   /product="mCG146111"
FT                   /note="gene_id=mCG146111.0 transcript_id=mCT186214.0
FT                   created on 14-JUL-2003"
FT   assembly_gap    13287132..13287151
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13289766..13290900
FT                   /estimated_length=1135
FT                   /gap_type="unknown"
FT   assembly_gap    13292807..13292888
FT                   /estimated_length=82
FT                   /gap_type="unknown"
FT   assembly_gap    13296232..13296251
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13311691..13311710
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13313048..13313067
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13326268..13326287
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             complement(join(13329105..13329210,13397885..>13397976))
FT                   /codon_start=1
FT                   /locus_tag="mCG_146111"
FT                   /product="mCG146111"
FT                   /note="gene_id=mCG146111.0 transcript_id=mCT186214.0
FT                   protein_id=mCP107476.0"
FT                   /protein_id="EDL37568.1"
FT                   /translation="HRGNRWRGLEQWLRTHILNHKWEAERISSKWNFEHLSDALVINPF
FT                   PPWKRWSLLIYAWTVKFFSS"
FT   assembly_gap    13336107..13336126
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13351474..13353414
FT                   /estimated_length=1941
FT                   /gap_type="unknown"
FT   assembly_gap    13355841..13355860
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13361591..13361739
FT                   /estimated_length=149
FT                   /gap_type="unknown"
FT   assembly_gap    13371091..13373238
FT                   /estimated_length=2148
FT                   /gap_type="unknown"
FT   assembly_gap    13392656..13392675
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13394459..13394478
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(13408243..13439591)
FT                   /locus_tag="mCG_14724"
FT                   /note="gene_id=mCG14724.3"
FT   mRNA            complement(join(13408243..13409790,13439454..13439591))
FT                   /locus_tag="mCG_14724"
FT                   /product="mCG14724, transcript variant mCT180280"
FT                   /note="gene_id=mCG14724.3 transcript_id=mCT180280.0 created
FT                   on 13-FEB-2003"
FT   mRNA            complement(join(13408321..13409790,13438552..13438931))
FT                   /locus_tag="mCG_14724"
FT                   /product="mCG14724, transcript variant mCT19624"
FT                   /note="gene_id=mCG14724.3 transcript_id=mCT19624.2 created
FT                   on 13-FEB-2003"
FT   mRNA            complement(join(13408552..13409790,13438751..13438931))
FT                   /locus_tag="mCG_14724"
FT                   /product="mCG14724, transcript variant mCT180279"
FT                   /note="gene_id=mCG14724.3 transcript_id=mCT180279.0 created
FT                   on 13-FEB-2003"
FT   CDS             complement(13408749..13409684)
FT                   /codon_start=1
FT                   /locus_tag="mCG_14724"
FT                   /product="mCG14724, isoform CRA_a"
FT                   /note="gene_id=mCG14724.3 transcript_id=mCT180279.0
FT                   protein_id=mCP103201.0 isoform=CRA_a"
FT                   /protein_id="EDL37569.1"
FT                   /translation="MTLLLLGAVLLVAQPQLVHSHPAAPGPGLKQQELLRKVIILPEDT
FT                   GEGTASNGSTQQLPQTIIIGVRKGGTRALLEMLSLHPDVAAAENEVHFFDWEEHYSQGL
FT                   GWYLTQMPFSSPHQLTVEKTPAYFTSPKVPERIHSMNPTIRLLLILRDPSERVLSDYTQ
FT                   VLYNHLQKHKPYPPIEDLLMRDGRLNLDYKALNRSLYHAHMLNWLRFFPLGHIHIVDGD
FT                   RLIRDPFPEIQKVERFLKLSPQINASNFYFNKTKGFYCLRDSGKDRCLHESKGRAHPQV
FT                   DPKLLDKLHEYFHEPNKKFFKLVGRTFDWH"
FT   CDS             complement(13408749..13409684)
FT                   /codon_start=1
FT                   /locus_tag="mCG_14724"
FT                   /product="mCG14724, isoform CRA_a"
FT                   /note="gene_id=mCG14724.3 transcript_id=mCT180280.0
FT                   protein_id=mCP103202.0 isoform=CRA_a"
FT                   /protein_id="EDL37570.1"
FT                   /translation="MTLLLLGAVLLVAQPQLVHSHPAAPGPGLKQQELLRKVIILPEDT
FT                   GEGTASNGSTQQLPQTIIIGVRKGGTRALLEMLSLHPDVAAAENEVHFFDWEEHYSQGL
FT                   GWYLTQMPFSSPHQLTVEKTPAYFTSPKVPERIHSMNPTIRLLLILRDPSERVLSDYTQ
FT                   VLYNHLQKHKPYPPIEDLLMRDGRLNLDYKALNRSLYHAHMLNWLRFFPLGHIHIVDGD
FT                   RLIRDPFPEIQKVERFLKLSPQINASNFYFNKTKGFYCLRDSGKDRCLHESKGRAHPQV
FT                   DPKLLDKLHEYFHEPNKKFFKLVGRTFDWH"
FT   CDS             complement(13408749..13409684)
FT                   /codon_start=1
FT                   /locus_tag="mCG_14724"
FT                   /product="mCG14724, isoform CRA_a"
FT                   /note="gene_id=mCG14724.3 transcript_id=mCT19624.2
FT                   protein_id=mCP4191.1 isoform=CRA_a"
FT                   /protein_id="EDL37571.1"
FT                   /translation="MTLLLLGAVLLVAQPQLVHSHPAAPGPGLKQQELLRKVIILPEDT
FT                   GEGTASNGSTQQLPQTIIIGVRKGGTRALLEMLSLHPDVAAAENEVHFFDWEEHYSQGL
FT                   GWYLTQMPFSSPHQLTVEKTPAYFTSPKVPERIHSMNPTIRLLLILRDPSERVLSDYTQ
FT                   VLYNHLQKHKPYPPIEDLLMRDGRLNLDYKALNRSLYHAHMLNWLRFFPLGHIHIVDGD
FT                   RLIRDPFPEIQKVERFLKLSPQINASNFYFNKTKGFYCLRDSGKDRCLHESKGRAHPQV
FT                   DPKLLDKLHEYFHEPNKKFFKLVGRTFDWH"
FT   assembly_gap    13444330..13444542
FT                   /estimated_length=213
FT                   /gap_type="unknown"
FT   assembly_gap    13483129..13483148
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13491781..13491800
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13516123..13519750
FT                   /estimated_length=3628
FT                   /gap_type="unknown"
FT   assembly_gap    13525758..13525777
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13532165..13532184
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13578146..13578165
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13582926..13584123
FT                   /estimated_length=1198
FT                   /gap_type="unknown"
FT   assembly_gap    13586238..13602722
FT                   /estimated_length=16485
FT                   /gap_type="unknown"
FT   assembly_gap    13607588..13607607
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13622018..13622202
FT                   /estimated_length=185
FT                   /gap_type="unknown"
FT   assembly_gap    13628075..13628094
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13650885..13650943
FT                   /estimated_length=59
FT                   /gap_type="unknown"
FT   assembly_gap    13657557..13657576
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13678125..13678558
FT                   /estimated_length=434
FT                   /gap_type="unknown"
FT   assembly_gap    13708898..13709078
FT                   /estimated_length=181
FT                   /gap_type="unknown"
FT   assembly_gap    13713220..13713253
FT                   /estimated_length=34
FT                   /gap_type="unknown"
FT   assembly_gap    13729032..13729051
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13743000..13743153
FT                   /estimated_length=154
FT                   /gap_type="unknown"
FT   assembly_gap    13812662..13814415
FT                   /estimated_length=1754
FT                   /gap_type="unknown"
FT   assembly_gap    13883573..13883843
FT                   /estimated_length=271
FT                   /gap_type="unknown"
FT   assembly_gap    13906572..13906591
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13909409..13909558
FT                   /estimated_length=150
FT                   /gap_type="unknown"
FT   assembly_gap    13910968..13910987
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13912080..13912099
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13913183..13913202
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13918067..13918326
FT                   /estimated_length=260
FT                   /gap_type="unknown"
FT   assembly_gap    13920134..13920153
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13923057..13924595
FT                   /estimated_length=1539
FT                   /gap_type="unknown"
FT   assembly_gap    13926114..13926133
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13928780..13928799
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13930250..13930269
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13932524..13933689
FT                   /estimated_length=1166
FT                   /gap_type="unknown"
FT   assembly_gap    13937958..13938001
FT                   /estimated_length=44
FT                   /gap_type="unknown"
FT   assembly_gap    13945434..13945453
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13948972..13948991
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13957065..13957084
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13970741..13970857
FT                   /estimated_length=117
FT                   /gap_type="unknown"
FT   assembly_gap    13983912..13983931
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13996992..13997011
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13998825..13999182
FT                   /estimated_length=358
FT                   /gap_type="unknown"
FT   assembly_gap    14035697..14035716
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14046131..14046174
FT                   /estimated_length=44
FT                   /gap_type="unknown"
FT   assembly_gap    14075661..14075680
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            14118258..14119536
FT                   /pseudo
FT                   /locus_tag="mCG_5166"
FT                   /note="gene_id=mCG5166.2"
FT   mRNA            14118258..14119536
FT                   /pseudo
FT                   /locus_tag="mCG_5166"
FT                   /note="gene_id=mCG5166.2 transcript_id=mCT4685.2 created on
FT                   26-SEP-2002"
FT   assembly_gap    14119540..14120066
FT                   /estimated_length=527
FT                   /gap_type="unknown"
FT   assembly_gap    14129413..14129583
FT                   /estimated_length=171
FT                   /gap_type="unknown"
FT   assembly_gap    14139358..14139688
FT                   /estimated_length=331
FT                   /gap_type="unknown"
FT   assembly_gap    14197259..14199845
FT                   /estimated_length=2587
FT                   /gap_type="unknown"
FT   assembly_gap    14251734..14253718
FT                   /estimated_length=1985
FT                   /gap_type="unknown"
FT   assembly_gap    14260201..14264278
FT                   /estimated_length=4078
FT                   /gap_type="unknown"
FT   assembly_gap    14266899..14266918
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14329483..14330964
FT                   /estimated_length=1482
FT                   /gap_type="unknown"
FT   assembly_gap    14347166..14347796
FT                   /estimated_length=631
FT                   /gap_type="unknown"
FT   assembly_gap    14367883..14368082
FT                   /estimated_length=200
FT                   /gap_type="unknown"
FT   assembly_gap    14425542..14425561
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14428768..14428787
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14430559..14430578
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14445777..14445796
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14448605..14448624
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14473176..14476072
FT                   /estimated_length=2897
FT                   /gap_type="unknown"
FT   assembly_gap    14477237..14477256
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14573265..14573595
FT                   /estimated_length=331
FT                   /gap_type="unknown"
FT   assembly_gap    14605080..14608082
FT                   /estimated_length=3003
FT                   /gap_type="unknown"
FT   assembly_gap    14652531..14652676
FT                   /estimated_length=146
FT                   /gap_type="unknown"
FT   assembly_gap    14656383..14656555
FT                   /estimated_length=173
FT                   /gap_type="unknown"
FT   assembly_gap    14839702..14839784
FT                   /estimated_length=83
FT                   /gap_type="unknown"
FT   assembly_gap    14864007..14864026
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14866435..14866984
FT                   /estimated_length=550
FT                   /gap_type="unknown"
FT   assembly_gap    14867930..14868257
FT                   /estimated_length=328
FT                   /gap_type="unknown"
FT   assembly_gap    14873897..14874234
FT                   /estimated_length=338
FT                   /gap_type="unknown"
FT   assembly_gap    14926992..14927011
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14930443..14930641
FT                   /estimated_length=199
FT                   /gap_type="unknown"
FT   assembly_gap    14952098..14952117
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14953289..14953308
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14954644..14955859
FT                   /estimated_length=1216
FT                   /gap_type="unknown"
FT   assembly_gap    14959376..14959395
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14968358..14968377
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14985259..14985278
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14988770..14988789
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14993537..14993943
FT                   /estimated_length=407
FT                   /gap_type="unknown"
FT   assembly_gap    14995823..14995842
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15002123..15003953
FT                   /estimated_length=1831
FT                   /gap_type="unknown"
FT   assembly_gap    15073753..15073772
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15075021..15075040
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15076263..15076282
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15111871..15111890
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15120936..15122547
FT                   /estimated_length=1612
FT                   /gap_type="unknown"
FT   assembly_gap    15123421..15124889
FT                   /estimated_length=1469
FT                   /gap_type="unknown"
FT   gene            <15130752..15131661
FT                   /locus_tag="mCG_22728"
FT                   /note="gene_id=mCG22728.2"
FT   mRNA            <15130752..15131661
FT                   /locus_tag="mCG_22728"
FT                   /product="mCG22728"
FT                   /note="gene_id=mCG22728.2 transcript_id=mCT22182.2 created
FT                   on 03-OCT-2002"
FT   CDS             <15131046..15131588
FT                   /codon_start=1
FT                   /locus_tag="mCG_22728"
FT                   /product="mCG22728"
FT                   /note="gene_id=mCG22728.2 transcript_id=mCT22182.2
FT                   protein_id=mCP4150.1"
FT                   /protein_id="EDL37572.1"
FT                   /translation="DQMARMAREAGSFYVPEEPKLAFVIRIRGINGVSPKVRKVLQLLR
FT                   LRQIFNGTFAKLNKASINMLRIVEPYIAWGYPNLKSVNEFIYKRGYGKINKKPIALTDN
FT                   SLIARSLGKFGIICMEDLIHEIYTVGKRFKEANNFLWPFKLSSPRGGMKKKTTHVVEGG
FT                   DTGMREDQINRLIRRMN"
FT   assembly_gap    15134709..15134728
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15136017..15136036
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15161957..15162208
FT                   /estimated_length=252
FT                   /gap_type="unknown"
FT   assembly_gap    15176300..15176319
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15183237..15183256
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15197211..15197230
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(15205529..15206069)
FT                   /pseudo
FT                   /locus_tag="mCG_1046127"
FT                   /note="gene_id=mCG1046127.1"
FT   mRNA            complement(15205529..15206069)
FT                   /pseudo
FT                   /locus_tag="mCG_1046127"
FT                   /note="gene_id=mCG1046127.1 transcript_id=mCT163831.1
FT                   created on 04-OCT-2002"
FT   assembly_gap    15236034..15240948
FT                   /estimated_length=4915
FT                   /gap_type="unknown"
FT   assembly_gap    15255450..15260069
FT                   /estimated_length=4620
FT                   /gap_type="unknown"
FT   assembly_gap    15269897..15270196
FT                   /estimated_length=300
FT                   /gap_type="unknown"
FT   assembly_gap    15277705..15279039
FT                   /estimated_length=1335
FT                   /gap_type="unknown"
FT   assembly_gap    15280910..15280929
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15285560..15288884
FT                   /estimated_length=3325
FT                   /gap_type="unknown"
FT   assembly_gap    15352325..15357738
FT                   /estimated_length=5414
FT                   /gap_type="unknown"
FT   assembly_gap    15362964..15362983
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15370804..15371478
FT                   /estimated_length=675
FT                   /gap_type="unknown"
FT   assembly_gap    15372492..15374937
FT                   /estimated_length=2446
FT                   /gap_type="unknown"
FT   assembly_gap    15377327..15378959
FT                   /estimated_length=1633
FT                   /gap_type="unknown"
FT   assembly_gap    15392589..15392608
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15406577..15406596
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15408840..15408859
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15410447..15410466
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(15410903..15497055)
FT                   /gene="Rab28"
FT                   /locus_tag="mCG_22723"
FT                   /note="gene_id=mCG22723.1"
FT   mRNA            complement(join(15410903..15411405,15419100..15419177,
FT                   15421778..15421881,15476584..15476713,15487253..15487341,
FT                   15492292..15492388,15496759..15496886,15497029..15497055))
FT                   /gene="Rab28"
FT                   /locus_tag="mCG_22723"
FT                   /product="RAB28, member RAS oncogene family, transcript
FT                   variant mCT22177"
FT                   /note="gene_id=mCG22723.1 transcript_id=mCT22177.2 created
FT                   on 13-FEB-2003"
FT   mRNA            complement(join(15410904..15411016,15419100..15419177,
FT                   15421778..15421881,15476584..15476713,15487253..15487341,
FT                   15492292..15492388,15496759..15496911))
FT                   /gene="Rab28"
FT                   /locus_tag="mCG_22723"
FT                   /product="RAB28, member RAS oncogene family, transcript
FT                   variant mCT180283"
FT                   /note="gene_id=mCG22723.1 transcript_id=mCT180283.0 created
FT                   on 13-FEB-2003"
FT   mRNA            complement(join(15410954..15411077,15419100..15419177,
FT                   15421778..15421881,15476584..15476713,15487253..15487341,
FT                   15492292..>15492309))
FT                   /gene="Rab28"
FT                   /locus_tag="mCG_22723"
FT                   /product="RAB28, member RAS oncogene family, transcript
FT                   variant mCT180284"
FT                   /note="gene_id=mCG22723.1 transcript_id=mCT180284.0 created
FT                   on 13-FEB-2003"
FT   CDS             complement(join(15410985..15411077,15419100..15419177,
FT                   15421778..15421881,15476584..15476713,15487253..15487341,
FT                   15492292..>15492307))
FT                   /codon_start=1
FT                   /gene="Rab28"
FT                   /locus_tag="mCG_22723"
FT                   /product="RAB28, member RAS oncogene family, isoform CRA_d"
FT                   /note="gene_id=mCG22723.1 transcript_id=mCT180284.0
FT                   protein_id=mCP103206.0 isoform=CRA_d"
FT                   /protein_id="EDL37576.1"
FT                   /translation="RITLPGNLNVTLQVWDIGGQTIGGKMLDKYIYGAQGILLVYDITN
FT                   YQSFENLEDWYSVVKTVSEESETQPLVALVGNKIDLEHMRTVKADKHLRFCQENGFSSH
FT                   FVSAKTGDSVFLCFQKVAAEILGIKLNKAEIEQSQMALWILINGSADPPHGISPTDCMR
FT                   VLPDES"
FT   CDS             complement(join(15411008..15411016,15419100..15419177,
FT                   15421778..15421881,15476584..15476713,15487253..15487341,
FT                   15492292..15492388,15496759..15496833))
FT                   /codon_start=1
FT                   /gene="Rab28"
FT                   /locus_tag="mCG_22723"
FT                   /product="RAB28, member RAS oncogene family, isoform CRA_c"
FT                   /note="gene_id=mCG22723.1 transcript_id=mCT180283.0
FT                   protein_id=mCP103205.0 isoform=CRA_c"
FT                   /db_xref="GOA:Q9CZQ8"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1917285"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CZQ8"
FT                   /protein_id="EDL37575.1"
FT                   /translation="MSDSEEESQDRQLKIVVLGDGTSGKTSLATCFAQETFGKQYKQTI
FT                   GLDFFLRRITLPGNLNVTLQVWDIGGQTIGGKMLDKYIYGAQGILLVYDITNYQSFENL
FT                   EDWYSVVKTVSEESETQPLVALVGNKIDLEHMRTVKADKHLRFCQENGFSSHFVSAKTG
FT                   DSVFLCFQKVAAEILGIKLNKAEIEQSQTV"
FT   CDS             complement(join(15411400..15411405,15419100..15419177,
FT                   15421778..15421881,15476584..15476713,15487253..15487341,
FT                   15492292..15492388,15496759..15496833))
FT                   /codon_start=1
FT                   /gene="Rab28"
FT                   /locus_tag="mCG_22723"
FT                   /product="RAB28, member RAS oncogene family, isoform CRA_e"
FT                   /note="gene_id=mCG22723.1 transcript_id=mCT22177.2
FT                   protein_id=mCP4172.2 isoform=CRA_e"
FT                   /protein_id="EDL37577.1"
FT                   /translation="MSDSEEESQDRQLKIVVLGDGTSGKTSLATCFAQETFGKQYKQTI
FT                   GLDFFLRRITLPGNLNVTLQVWDIGGQTIGGKMLDKYIYGAQGILLVYDITNYQSFENL
FT                   EDWYSVVKTVSEESETQPLVALVGNKIDLEHMRTVKADKHLRFCQENGFSSHFVSAKTG
FT                   DSVFLCFQKVAAEILGIKLNKAEIEQSQI"
FT   mRNA            complement(join(15419100..15419177,15421778..15421881,
FT                   15433242..15433273,15476584..15476713,15487253..15487341,
FT                   15492292..15492388,15496759..15496926,15496972..15497052))
FT                   /gene="Rab28"
FT                   /locus_tag="mCG_22723"
FT                   /product="RAB28, member RAS oncogene family, transcript
FT                   variant mCT173709"
FT                   /note="gene_id=mCG22723.1 transcript_id=mCT173709.0 created
FT                   on 13-FEB-2003"
FT   assembly_gap    15421623..15421708
FT                   /estimated_length=86
FT                   /gap_type="unknown"
FT   CDS             complement(join(15421855..15421881,15433242..15433273,
FT                   15476584..15476713,15487253..15487341,15492292..15492388,
FT                   15496759..15496833))
FT                   /codon_start=1
FT                   /gene="Rab28"
FT                   /locus_tag="mCG_22723"
FT                   /product="RAB28, member RAS oncogene family, isoform CRA_a"
FT                   /note="gene_id=mCG22723.1 transcript_id=mCT173709.0
FT                   protein_id=mCP96629.0 isoform=CRA_a"
FT                   /protein_id="EDL37573.1"
FT                   /translation="MSDSEEESQDRQLKIVVLGDGTSGKTSLATCFAQETFGKQYKQTI
FT                   GLDFFLRRITLPGNLNVTLQVWDIGGQTIGGKMLDKYIYGAQGILLVYDITNYQSFENL
FT                   EDWYSVVKTVSEESETQPLVALVGNKMPKDVMELELQLTWSICEQ"
FT   assembly_gap    15445642..15448244
FT                   /estimated_length=2603
FT                   /gap_type="unknown"
FT   assembly_gap    15455457..15455476
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15456862..15456881
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            complement(join(<15476591..15476713,15496759..15496885))
FT                   /gene="Rab28"
FT                   /locus_tag="mCG_22723"
FT                   /product="RAB28, member RAS oncogene family, transcript
FT                   variant mCT173710"
FT                   /note="gene_id=mCG22723.1 transcript_id=mCT173710.0 created
FT                   on 13-FEB-2003"
FT   CDS             complement(join(<15476591..15476713,15496759..15496833))
FT                   /codon_start=1
FT                   /gene="Rab28"
FT                   /locus_tag="mCG_22723"
FT                   /product="RAB28, member RAS oncogene family, isoform CRA_b"
FT                   /note="gene_id=mCG22723.1 transcript_id=mCT173710.0
FT                   protein_id=mCP96628.0 isoform=CRA_b"
FT                   /protein_id="EDL37574.1"
FT                   /translation="MSDSEEESQDRQLKIVVLGDGTSGKGILLVYDITNYQSFENLEDW
FT                   YSVVKTVSEESETQPLVALVG"
FT   assembly_gap    15496931..15496953
FT                   /estimated_length=23
FT                   /gap_type="unknown"
FT   assembly_gap    15499876..15500301
FT                   /estimated_length=426
FT                   /gap_type="unknown"
FT   assembly_gap    15502614..15502633
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15503795..15504904
FT                   /estimated_length=1110
FT                   /gap_type="unknown"
FT   gene            15505064..15507267
FT                   /pseudo
FT                   /locus_tag="mCG_1046063"
FT                   /note="gene_id=mCG1046063.1"
FT   mRNA            join(15505064..15505176,15506462..15507267)
FT                   /pseudo
FT                   /locus_tag="mCG_1046063"
FT                   /note="gene_id=mCG1046063.1 transcript_id=mCT163767.1
FT                   created on 16-OCT-2002"
FT   assembly_gap    15506193..15506295
FT                   /estimated_length=103
FT                   /gap_type="unknown"
FT   assembly_gap    15512483..15513225
FT                   /estimated_length=743
FT                   /gap_type="unknown"
FT   assembly_gap    15532484..15532503
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15535665..15535684
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(15551923..15555253)
FT                   /gene="Bapx1"
FT                   /locus_tag="mCG_22729"
FT                   /note="gene_id=mCG22729.2"
FT   mRNA            complement(join(15551923..15552177,15552210..15552939,
FT                   15554241..15555253))
FT                   /gene="Bapx1"
FT                   /locus_tag="mCG_22729"
FT                   /product="bagpipe homeobox gene 1 homolog (Drosophila)"
FT                   /note="gene_id=mCG22729.2 transcript_id=mCT22183.2 created
FT                   on 18-SEP-2002"
FT   CDS             complement(join(15552404..15552939,15554241..15554706))
FT                   /codon_start=1
FT                   /gene="Bapx1"
FT                   /locus_tag="mCG_22729"
FT                   /product="bagpipe homeobox gene 1 homolog (Drosophila)"
FT                   /note="gene_id=mCG22729.2 transcript_id=mCT22183.2
FT                   protein_id=mCP4153.1"
FT                   /db_xref="GOA:P97503"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017970"
FT                   /db_xref="InterPro:IPR020479"
FT                   /db_xref="MGI:MGI:108015"
FT                   /db_xref="UniProtKB/Swiss-Prot:P97503"
FT                   /protein_id="EDL37578.1"
FT                   /translation="MAVRGSGTLTPFSIQAILNKKEERGGLATPEGRPAPGGTEVAVTA
FT                   APAVCCWRIFGETEAGALGGAEDSLLASPARTRTAVGQSAESPGGWDSDSALSEENEGR
FT                   RRCADVPGASGTGRARVTLGLDQPGCELHAAKDLEEEAPVRSDSEMSASVSGDHSPRGE
FT                   DDSVSPGGARVPGLRGAAGSGASGGQAGGVEEEEEPAAPKPRKKRSRAAFSHAQVFELE
FT                   RRFNHQRYLSGPERADLAASLKLTETQVKIWFQNRRYKTKRRQMAADLLASAPAAKKVA
FT                   VKVLVRDDQRQYLPGEVLRPPSLLPLQPSYYYPYYCLPGWALSTCAAAAGTQ"
FT   assembly_gap    15565791..15565916
FT                   /estimated_length=126
FT                   /gap_type="unknown"
FT   assembly_gap    15572795..15573428
FT                   /estimated_length=634
FT                   /gap_type="unknown"
FT   gene            complement(15579311..>15610295)
FT                   /locus_tag="mCG_145575"
FT                   /note="gene_id=mCG145575.0"
FT   mRNA            complement(join(15579311..15579679,15582527..15582667,
FT                   15584957..15585110,15585612..15585693,15585800..15585849,
FT                   15588769..15588814,15590503..15590537,15590621..15590696,
FT                   15591491..15591567,15591893..15591971,15595883..15595962,
FT                   15597420..15597492,15597903..15597973,15599435..15599495,
FT                   15600786..15600829,15603862..15603946,15604871..15604935,
FT                   15606947..>15610295))
FT                   /locus_tag="mCG_145575"
FT                   /product="mCG145575"
FT                   /note="gene_id=mCG145575.0 transcript_id=mCT184999.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(15579562..15579679,15582527..15582667,
FT                   15584957..15585110,15585612..15585693,15585800..15585849,
FT                   15588769..15588814,15590503..15590537,15590621..15590696,
FT                   15591491..15591567,15591893..15591971,15595883..15595962,
FT                   15597420..15597492,15597903..15597973,15599435..15599495,
FT                   15600786..15600829,15603862..15603946,15604871..15604935,
FT                   15606947..>15610295))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145575"
FT                   /product="mCG145575"
FT                   /note="gene_id=mCG145575.0 transcript_id=mCT184999.0
FT                   protein_id=mCP105604.0"
FT                   /protein_id="EDL37579.1"
FT                   /translation="PVPQQRHGKMERGAAGSGRRDKAFIATSTEGTDKGIMLNTVKTGD
FT                   ATTTSSEVGEKGTALPCTSIEADEGFMMGACPKKHPLQVGAEASECTVFAAAEEGKGVV
FT                   TEGFAESEILLTSSKEGESGECAVAESEDRVAGPLAAHTVQAEANVNSITTEEKDDAVT
FT                   SAGSEEKCGGSACTVEGTATFIGEVESDGAVTSAGTEIRAGSLSSEDVDGSQENRIQVG
FT                   PKKETEGTVTCTETKGRNDNFICLVTRVETQEQRVVTGADVVQVNAAKPQEANANQGDG
FT                   SGTDGAEGESAVTSTGITEEDGEASANCTGSEDNREGCAISSETEESAESAMDSTEAKD
FT                   ITNAPLVAAGPCDDEGIVTSTGAKEEDDEDEGVVTSTGRGNEPGHASACTGIEESEGMM
FT                   VCESGEGGAQIGPTIDHVNAEAGAATVNTNDSNVDSMSGAEKEIKDTNICSSAKGIVES
FT                   SVTSALAGNSDRPPVLCGSEGPMASASSHHSDSQLTRKETVEDTTISTGLVKGSDDVLV
FT                   SGEVPECEVGHMSPRKNEECDGLMASTASCDVSNKDSLAGSKSQGNGLMISTSTNACTP
FT                   QISAVIDVRGGHLSTLSTEEIRDGVRVHREGFEAPMPSAVSGENSQLTASRSEEKDECA
FT                   MISTSIGEEFELPISSAVTVTCAERQQPVAAVEESTTGPALVSTEDFEVPMPSAPTEAE
FT                   SPLASTSKEEKDECALISTSIAEECEASVFGVSRNAPSVTDGNAVISTSSVEDCEGSVS
FT                   SAVPQESVCPSVIPVEETGDTAMISTSTSEGREAVMVGTIPTDDDQATTVRGEDLSDAA
FT                   IISTSTAECVLTCTSLSRHEENQQATHNPEGNGGHLATKQSKCELPMPSLVAERNCKCP
FT                   GPFRMGKGVGPLMAVGTRGEHDRLPVCEPSVGQGQPGTALCLGEEESHGMDCPGQDLNA
FT                   KERNTLLSSVQRESKSAEAEAAGDSSTARRTVRKDSERNANSLSETNCLREPEQKPAED
FT                   TSGSTHCLTAVNPGAEADGMLPITHAALEYPDHQEPESNLKTTTKCITGQESQMPSSHT
FT                   GVLSAVCHVAPCASEQEGGLPTKSDHSGTWTSEGSPEKMGHVAGARQSFHREGNLDVTL
FT                   PPEDNGCGVGNEESPPKGIGGLELSTGLTTEISVSSEEDTSHGVVAAPENPCVGRRRGA
FT                   AELQMEALLMRESLNVEKSESRINEEIHFESQNKEEICCGRKGSTEALSGCSVEADPEE
FT                   VEEEEKQISQRNRKPDYSSSEEELDDSPDVLDSRIETAQRQYSETEPHDTKEENSGDVE
FT                   EFSSVTSKTNSSTGLEDRDEFSSSEGTGEKTEPNEDDGSIKSQEDDHPIIIKRRRGRPR
FT                   KYPAETAFKSKEDSKTETDITTVEQSSPSGKLKVSQADESNKEIANLEEKSTSNDDSEE
FT                   KTASMRLRGRKPKRSLTSSDDAESSEPERKRQKSVSETSEDKKDEESDEEEEEEEEEEP
FT                   LGATTRSATRSEAQRKNHSKPSTRATSKLGIPETISPRNRQKLAKEKLSTSEKVSKSPP
FT                   LGRSKAQLSPSVKRKREVSPPGARTRGQQKVDENPLKKAKR"
FT   assembly_gap    15602094..15602113
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<15612770..>15635054)
FT                   /locus_tag="mCG_145571"
FT                   /note="gene_id=mCG145571.0"
FT   mRNA            complement(join(<15612770..15612899,15614708..15614780,
FT                   15617202..15617340,15617848..15617959,15619492..15619658,
FT                   15622184..15622333,15622950..15623564,15624397..15624587,
FT                   15628779..15628903,15634670..>15635054))
FT                   /locus_tag="mCG_145571"
FT                   /product="mCG145571"
FT                   /note="gene_id=mCG145571.0 transcript_id=mCT184995.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(<15612770..15612899,15614708..15614780,
FT                   15617202..15617340,15617848..15617959,15619492..15619658,
FT                   15622184..15622333,15622950..15623564,15624397..15624587,
FT                   15628779..15628903,15634670..>15635023))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145571"
FT                   /product="mCG145571"
FT                   /note="gene_id=mCG145571.0 transcript_id=mCT184995.0
FT                   protein_id=mCP105601.0"
FT                   /protein_id="EDL37580.1"
FT                   /translation="IRWFRNNIPLASLRRRDLCSRLPRSACPPGLAGSPVRDAMATNPQ
FT                   PQPPPPAPPPPPPQPQPPPPPPGPGAGPGASGPGSAGAGAGDPQLVAMIVNHLKSQGLF
FT                   DQFRRDCLADVDTKPAYQNLRQRVDNFVANHLATHTWSPHLNKNQLRNNIRQQVLKSGM
FT                   LESGIDRIISQVVDPKINHTFRPQVEKAVHEFLATLNHKEEAAGSTAPDDEKPESSVIT
FT                   QGAPAPGPSANVASDAMSILETITSLNQEANAARASTEMSNAKVSERTSRKLSSQPSTD
FT                   VSTDKERGSEDATEREKATSDSGGDGLEAALKSEEPSDLPCPVEETKNHMKENNSLLLL
FT                   SKDAQQESTDPKIKSMDKGEKKPDGNEKGERKKEKKEKTEKKIDHSKRNEDTQKVKDER
FT                   QAKDKEVESTKLPSEKSNSRARAAEGTKEDCSLLDSDVDGLTDITVSSVHTSDLSSFEE
FT                   DTEEEVVVSESMEEGEITSEDEEKNKQNKAKVQPGDSSDGKARGVRHAYVHKPYLYSKY
FT                   YSDSDDELTVEQRRQSIAKEKEERLLRRRINREKLEEKRKQKAEKTKSSKVKSQGKSTV
FT                   DLEDSSAKTLEPKAPRIKEVLKERKVLEKKVALSKRRRKDSRNVDENSKKKPQAEEESK
FT                   EALKTTEYCEKEKASSKDLRHTHGKGEPSRPARRLSESLHSADENKTESK"
FT   assembly_gap    15635180..15635464
FT                   /estimated_length=285
FT                   /gap_type="unknown"
FT   assembly_gap    15638439..15638802
FT                   /estimated_length=364
FT                   /gap_type="unknown"
FT   gene            complement(15643960..15645188)
FT                   /pseudo
FT                   /locus_tag="mCG_49626"
FT                   /note="gene_id=mCG49626.2"
FT   mRNA            complement(15643960..15645188)
FT                   /pseudo
FT                   /locus_tag="mCG_49626"
FT                   /note="gene_id=mCG49626.2 transcript_id=mCT49809.2 created
FT                   on 18-OCT-2002"
FT   assembly_gap    15651464..15651650
FT                   /estimated_length=187
FT                   /gap_type="unknown"
FT   assembly_gap    15652971..15654488
FT                   /estimated_length=1518
FT                   /gap_type="unknown"
FT   assembly_gap    15661320..15661339
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15672835..15672967
FT                   /estimated_length=133
FT                   /gap_type="unknown"
FT   assembly_gap    15688322..15688341
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15710067..15710086
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(15724577..15726006)
FT                   /pseudo
FT                   /locus_tag="mCG_1046028"
FT                   /note="gene_id=mCG1046028.1"
FT   mRNA            complement(15724577..15726006)
FT                   /pseudo
FT                   /locus_tag="mCG_1046028"
FT                   /note="gene_id=mCG1046028.1 transcript_id=mCT163732.1
FT                   created on 18-OCT-2002"
FT   assembly_gap    15726593..15726636
FT                   /estimated_length=44
FT                   /gap_type="unknown"
FT   assembly_gap    15750555..15752609
FT                   /estimated_length=2055
FT                   /gap_type="unknown"
FT   assembly_gap    15777959..15777978
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15790044..15790533
FT                   /estimated_length=490
FT                   /gap_type="unknown"
FT   assembly_gap    15791869..15791888
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15807085..15811825
FT                   /estimated_length=4741
FT                   /gap_type="unknown"
FT   assembly_gap    15814628..15814647
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15816163..15819745
FT                   /estimated_length=3583
FT                   /gap_type="unknown"
FT   assembly_gap    15820771..15820836
FT                   /estimated_length=66
FT                   /gap_type="unknown"
FT   assembly_gap    15836973..15837057
FT                   /estimated_length=85
FT                   /gap_type="unknown"
FT   gene            <15843830..15995997
FT                   /locus_tag="mCG_145574"
FT                   /note="gene_id=mCG145574.0"
FT   mRNA            join(<15843830..15843948,15983986..15984194,
FT                   15993810..15995997)
FT                   /locus_tag="mCG_145574"
FT                   /product="mCG145574"
FT                   /note="gene_id=mCG145574.0 transcript_id=mCT184998.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<15843830..15843948,15983986..15984194,
FT                   15993810..15993835)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145574"
FT                   /product="mCG145574"
FT                   /note="gene_id=mCG145574.0 transcript_id=mCT184998.0
FT                   protein_id=mCP105606.0"
FT                   /db_xref="GOA:Q8CBM3"
FT                   /db_xref="MGI:MGI:3648966"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CBM3"
FT                   /protein_id="EDL37581.1"
FT                   /translation="CSALSSFPQRFWRQTLPSGDLQVWSCSPRGFGGERTGLTGEGGQE
FT                   TGVRTCLLTEDEGLKQGLSQNLCSFCSPHSHLCRLVSAESGNQDGSPRCCGKAFLGGAD
FT                   TYPLAACCFHLMV"
FT   assembly_gap    15846443..15846462
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15856433..15858750
FT                   /estimated_length=2318
FT                   /gap_type="unknown"
FT   assembly_gap    15872514..15872533
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15873652..15873671
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15875511..15875530
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15880394..15880413
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15920196..15922514
FT                   /estimated_length=2319
FT                   /gap_type="unknown"
FT   assembly_gap    15928050..15928150
FT                   /estimated_length=101
FT                   /gap_type="unknown"
FT   assembly_gap    15970365..15974523
FT                   /estimated_length=4159
FT                   /gap_type="unknown"
FT   assembly_gap    16000772..16001028
FT                   /estimated_length=257
FT                   /gap_type="unknown"
FT   assembly_gap    16004724..16005828
FT                   /estimated_length=1105
FT                   /gap_type="unknown"
FT   assembly_gap    16010397..16010445
FT                   /estimated_length=49
FT                   /gap_type="unknown"
FT   assembly_gap    16015851..16016067
FT                   /estimated_length=217
FT                   /gap_type="unknown"
FT   assembly_gap    16022997..16023139
FT                   /estimated_length=143
FT                   /gap_type="unknown"
FT   assembly_gap    16030098..16030464
FT                   /estimated_length=367
FT                   /gap_type="unknown"
FT   assembly_gap    16060083..16060102
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16087583..16093532
FT                   /estimated_length=5950
FT                   /gap_type="unknown"
FT   assembly_gap    16115122..16115271
FT                   /estimated_length=150
FT                   /gap_type="unknown"
FT   assembly_gap    16131330..16131349
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16152603..16156542
FT                   /estimated_length=3940
FT                   /gap_type="unknown"
FT   gene            <16179683..16300072
FT                   /locus_tag="mCG_1046128"
FT                   /note="gene_id=mCG1046128.1"
FT   mRNA            join(<16179683..16179749,16207635..16207791,
FT                   16299870..16300072)
FT                   /locus_tag="mCG_1046128"
FT                   /product="mCG1046128"
FT                   /note="gene_id=mCG1046128.1 transcript_id=mCT163832.1
FT                   created on 04-OCT-2002"
FT   CDS             join(<16179685..16179749,16207635..16207770)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1046128"
FT                   /product="mCG1046128"
FT                   /note="gene_id=mCG1046128.1 transcript_id=mCT163832.1
FT                   protein_id=mCP64833.1"
FT                   /protein_id="EDL37582.1"
FT                   /translation="QTRRMKWSLERAGSAGFLSSLVLEDAAASLCRYPYPREITGNLYQ
FT                   RNRWLGPSWSESISGCHVVIL"
FT   assembly_gap    16182559..16182592
FT                   /estimated_length=34
FT                   /gap_type="unknown"
FT   assembly_gap    16185196..16185383
FT                   /estimated_length=188
FT                   /gap_type="unknown"
FT   assembly_gap    16267511..16267832
FT                   /estimated_length=322
FT                   /gap_type="unknown"
FT   assembly_gap    16274715..16274749
FT                   /estimated_length=35
FT                   /gap_type="unknown"
FT   assembly_gap    16288415..16288434
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16312925..16312958
FT                   /estimated_length=34
FT                   /gap_type="unknown"
FT   assembly_gap    16328841..16328860
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16396938..16396957
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16413372..16413391
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16414367..16414421
FT                   /estimated_length=55
FT                   /gap_type="unknown"
FT   assembly_gap    16424463..16424512
FT                   /estimated_length=50
FT                   /gap_type="unknown"
FT   assembly_gap    16436841..16436860
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16488735..16488768
FT                   /estimated_length=34
FT                   /gap_type="unknown"
FT   assembly_gap    16506571..16506590
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16521473..16526247
FT                   /estimated_length=4775
FT                   /gap_type="unknown"
FT   assembly_gap    16539481..16539509
FT                   /estimated_length=29
FT                   /gap_type="unknown"
FT   assembly_gap    16570606..16570721
FT                   /estimated_length=116
FT                   /gap_type="unknown"
FT   assembly_gap    16581268..16581323
FT                   /estimated_length=56
FT                   /gap_type="unknown"
FT   assembly_gap    16593497..16600049
FT                   /estimated_length=6553
FT                   /gap_type="unknown"
FT   assembly_gap    16606586..16609671
FT                   /estimated_length=3086
FT                   /gap_type="unknown"
FT   assembly_gap    16682617..16682728
FT                   /estimated_length=112
FT                   /gap_type="unknown"
FT   assembly_gap    16702445..16702464
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16717205..16717358
FT                   /estimated_length=154
FT                   /gap_type="unknown"
FT   assembly_gap    16719509..16721285
FT                   /estimated_length=1777
FT                   /gap_type="unknown"
FT   assembly_gap    16726140..16726166
FT                   /estimated_length=27
FT                   /gap_type="unknown"
FT   assembly_gap    16728674..16728834
FT                   /estimated_length=161
FT                   /gap_type="unknown"
FT   gene            complement(16737146..16739201)
FT                   /pseudo
FT                   /locus_tag="mCG_122366"
FT                   /note="gene_id=mCG122366.1"
FT   mRNA            complement(16737146..16739201)
FT                   /pseudo
FT                   /locus_tag="mCG_122366"
FT                   /note="gene_id=mCG122366.1 transcript_id=mCT123583.1
FT                   created on 03-OCT-2002"
FT   assembly_gap    16772064..16784371
FT                   /estimated_length=12308
FT                   /gap_type="unknown"
FT   assembly_gap    16786031..16786566
FT                   /estimated_length=536
FT                   /gap_type="unknown"
FT   assembly_gap    16788824..16788881
FT                   /estimated_length=58
FT                   /gap_type="unknown"
FT   gene            complement(16813092..16817412)
FT                   /locus_tag="mCG_148296"
FT                   /note="gene_id=mCG148296.0"
FT   mRNA            complement(join(16813092..16814853,16816877..16817412))
FT                   /locus_tag="mCG_148296"
FT                   /product="mCG148296"
FT                   /note="gene_id=mCG148296.0 transcript_id=mCT188559.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(16814387..16814692)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148296"
FT                   /product="mCG148296"
FT                   /note="gene_id=mCG148296.0 transcript_id=mCT188559.0
FT                   protein_id=mCP109210.0"
FT                   /protein_id="EDL37583.1"
FT                   /translation="MESHQRTTTKWVPPHTFPINLLSPLPLVARLERKLRCLITLNKVG
FT                   LEKSKPTEVTIQDRVSHGLSVWPYMWTSWPKSEKQGWKYQHYWICCSWTCRLRKRP"
FT   assembly_gap    16824035..16824054
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16828538..16828600
FT                   /estimated_length=63
FT                   /gap_type="unknown"
FT   assembly_gap    16839357..16839376
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16842177..16842822
FT                   /estimated_length=646
FT                   /gap_type="unknown"
FT   assembly_gap    16845976..16847591
FT                   /estimated_length=1616
FT                   /gap_type="unknown"
FT   assembly_gap    16851247..16851665
FT                   /estimated_length=419
FT                   /gap_type="unknown"
FT   assembly_gap    16862235..16862316
FT                   /estimated_length=82
FT                   /gap_type="unknown"
FT   assembly_gap    16885131..16885319
FT                   /estimated_length=189
FT                   /gap_type="unknown"
FT   assembly_gap    16897982..16898001
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16899007..16899026
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16900360..16900379
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16901626..16901645
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(16920022..>16995309)
FT                   /locus_tag="mCG_146113"
FT                   /note="gene_id=mCG146113.0"
FT   mRNA            complement(join(16920022..16920115,16922723..16922817,
FT                   16933894..16934003,16955448..16955520,16956746..16956858,
FT                   16958186..16958257,16959209..16959319,16994906..>16995309))
FT                   /locus_tag="mCG_146113"
FT                   /product="mCG146113"
FT                   /note="gene_id=mCG146113.0 transcript_id=mCT186216.0
FT                   created on 14-JUL-2003"
FT   assembly_gap    16941281..16941300
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16971149..16971168
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16975061..16975080
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16993186..16994659
FT                   /estimated_length=1474
FT                   /gap_type="unknown"
FT   gene            <16994840..17050234
FT                   /gene="Cpeb2"
FT                   /locus_tag="mCG_141234"
FT                   /note="gene_id=mCG141234.0"
FT   mRNA            join(<16994840..16995042,16997276..16997542,
FT                   16998281..16998370,17004540..17004630,17021717..17021767,
FT                   17037414..17037584,17038587..17038676,17041594..17041739,
FT                   17041882..17041996,17044448..17044629,17046230..17050234)
FT                   /gene="Cpeb2"
FT                   /locus_tag="mCG_141234"
FT                   /product="cytoplasmic polyadenylation element binding
FT                   protein 2, transcript variant mCT174004"
FT                   /note="gene_id=mCG141234.0 transcript_id=mCT174004.0
FT                   created on 03-OCT-2002"
FT   mRNA            join(<16994841..16995042,16997261..16997542,
FT                   17004540..17004630,17021717..17021767,17028852..17028875,
FT                   17037414..17037584,17038587..17038676,17041621..17041739,
FT                   17041882..17041996,17044448..17044629,17046230..17047533)
FT                   /gene="Cpeb2"
FT                   /locus_tag="mCG_141234"
FT                   /product="cytoplasmic polyadenylation element binding
FT                   protein 2, transcript variant mCT193569"
FT                   /note="gene_id=mCG141234.0 transcript_id=mCT193569.0
FT                   created on 09-MAR-2004"
FT   mRNA            join(<16994841..16995042,16997261..16997542,
FT                   16998281..16998370,17004540..17004630,17021717..17021767,
FT                   17037414..17037584,17038587..17038676,17041621..17041739,
FT                   17041882..17041996,17044448..17044629,17046230..17046701)
FT                   /gene="Cpeb2"
FT                   /locus_tag="mCG_141234"
FT                   /product="cytoplasmic polyadenylation element binding
FT                   protein 2, transcript variant mCT193568"
FT                   /note="gene_id=mCG141234.0 transcript_id=mCT193568.0
FT                   created on 09-MAR-2004"
FT   CDS             join(<16994842..16995042,16997261..16997542,
FT                   16998281..16998370,17004540..17004630,17021717..17021767,
FT                   17037414..17037584,17038587..17038676,17041621..17041739,
FT                   17041882..17041996,17044448..17044629,17046230..17046457)
FT                   /codon_start=1
FT                   /gene="Cpeb2"
FT                   /locus_tag="mCG_141234"
FT                   /product="cytoplasmic polyadenylation element binding
FT                   protein 2, isoform CRA_a"
FT                   /note="gene_id=mCG141234.0 transcript_id=mCT193568.0
FT                   protein_id=mCP114522.0 isoform=CRA_a"
FT                   /protein_id="EDL37585.1"
FT                   /translation="GGGFGGPFSAPTVPAPPAMNLPQQQPPAAAPQQPQSRRSPVSPQL
FT                   QQQHQAAAAAFLQQRNSYNHHQPLLKQSPWSNHQNSGWGTASMSWGAMHGRDHRRSGNM
FT                   GIPGTMNQISPLKKPFSGNVIAPPKFTRSTPSLTPKSWIEDNVFRTDNNSNTLLPLQVR
FT                   SSLQLPAWGSDSLQDSWCTAAGTSRIDQDRSRMYDSLNMHSLENSLIDIMRAEHDPLKG
FT                   RLSYPHPGTDNLLMLNGRSSLFPIDDSLLDDGHSDQVGVLNSPTCYSAHQNGERIERFS
FT                   RKVFVGGLPPDIDEDEITASFRRFGPLVVDWPHKAESKSYFPPKGYAFLLFQEESSVQA
FT                   LIDACIEEDGKLYLCVSSPTIKDKPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVGGVPR
FT                   PLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQH
FT                   GDIDKRVEVKPYVLDDQMCDECQGARCGGKFAPFFCANVTCLQYYCEFCWANIHSRAGR
FT                   EFHKPLVKEGADRPRQIHFRWN"
FT   CDS             join(<16994842..16995042,16997261..16997542,
FT                   17004540..17004630,17021717..17021767,17028852..17028875,
FT                   17037414..17037584,17038587..17038676,17041621..17041739,
FT                   17041882..17041996,17044448..17044629,17046230..17046457)
FT                   /codon_start=1
FT                   /gene="Cpeb2"
FT                   /locus_tag="mCG_141234"
FT                   /product="cytoplasmic polyadenylation element binding
FT                   protein 2, isoform CRA_b"
FT                   /note="gene_id=mCG141234.0 transcript_id=mCT193569.0
FT                   protein_id=mCP114523.0 isoform=CRA_b"
FT                   /protein_id="EDL37586.1"
FT                   /translation="GGGFGGPFSAPTVPAPPAMNLPQQQPPAAAPQQPQSRRSPVSPQL
FT                   QQQHQAAAAAFLQQRNSYNHHQPLLKQSPWSNHQNSGWGTASMSWGAMHGRDHRRSGNM
FT                   GIPGTMNQISPLKKPFSGNVIAPPKFTRSTPSLTPKSWIEDNVFRTDNNSNTLLPLQDR
FT                   SRMYDSLNMHSLENSLIDIMRAEHDPLKGRLSYPHPGTDNLLMLNARSYGRRRGRSSLF
FT                   PIDDSLLDDGHSDQVGVLNSPTCYSAHQNGERIERFSRKVFVGGLPPDIDEDEITASFR
FT                   RFGPLVVDWPHKAESKSYFPPKGYAFLLFQEESSVQALIDACIEEDGKLYLCVSSPTIK
FT                   DKPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAG
FT                   IDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGDIDKRVEVKPYVLDDQMCDEC
FT                   QGARCGGKFAPFFCANVTCLQYYCEFCWANIHSRAGREFHKPLVKEGADRPRQIHFRWN
FT                   "
FT   CDS             join(<16994842..16995042,16997276..16997542,
FT                   16998281..16998370,17004540..17004630,17021717..17021767,
FT                   17037414..17037584,17038587..17038676,17041594..17041739,
FT                   17041882..17041996,17044448..17044629,17046230..17046457)
FT                   /codon_start=1
FT                   /gene="Cpeb2"
FT                   /locus_tag="mCG_141234"
FT                   /product="cytoplasmic polyadenylation element binding
FT                   protein 2, isoform CRA_c"
FT                   /note="gene_id=mCG141234.0 transcript_id=mCT174004.0
FT                   protein_id=mCP96923.0 isoform=CRA_c"
FT                   /protein_id="EDL37587.1"
FT                   /translation="GGGFGGPFSAPTVPAPPAMNLPQQQPPAAAPQQPQSRRSPVSPQL
FT                   QQQHQAAAAAFLQQRNSYNHHQSPWSNHQNSGWGTASMSWGAMHGRDHRRSGNMGIPGT
FT                   MNQISPLKKPFSGNVIAPPKFTRSTPSLTPKSWIEDNVFRTDNNSNTLLPLQVRSSLQL
FT                   PAWGSDSLQDSWCTAAGTSRIDQDRSRMYDSLNMHSLENSLIDIMRAEHDPLKGRLSYP
FT                   HPGTDNLLMLNGRSSLFPIDDSLLDDGHSDQVGVLNSPTCYSAHQNGERIERFSRKVFV
FT                   GGLPPDIDEDEITASFRRFGPLVVDWPHKAESKSYFPPKVLKFFTVIPGYAFLLFQEES
FT                   SVQALIDACIEEDGKLYLCVSSPTIKDKPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVG
FT                   GVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFV
FT                   QLQHGDIDKRVEVKPYVLDDQMCDECQGARCGGKFAPFFCANVTCLQYYCEFCWANIHS
FT                   RAGREFHKPLVKEGADRPRQIHFRWN"
FT   CDS             complement(16994956..>16995306)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146113"
FT                   /product="mCG146113"
FT                   /note="gene_id=mCG146113.0 transcript_id=mCT186216.0
FT                   protein_id=mCP107478.0"
FT                   /protein_id="EDL37584.1"
FT                   /translation="QFLPALTARGCGCRCRLGFISPAQDKLQKGTTPVLVPSVTPGKDP
FT                   ALAAHSPPAFPRVLPRPRVRRQAGAPGAFEGAWRLLFPPRTPYLVVVVRVPLLQEGGCG
FT                   SLVLLLQLRADG"
FT   assembly_gap    17011938..17011957
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17039679..17039698
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17073603..17073622
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17077122..17078011
FT                   /estimated_length=890
FT                   /gap_type="unknown"
FT   assembly_gap    17082728..17082797
FT                   /estimated_length=70
FT                   /gap_type="unknown"
FT   assembly_gap    17084442..17084743
FT                   /estimated_length=302
FT                   /gap_type="unknown"
FT   assembly_gap    17106972..17108425
FT                   /estimated_length=1454
FT                   /gap_type="unknown"
FT   assembly_gap    17109439..17109458
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17110898..17110917
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17112319..17112338
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(17134165..>17136379)
FT                   /locus_tag="mCG_1046256"
FT                   /note="gene_id=mCG1046256.1"
FT   mRNA            complement(join(17134165..17134536,17136031..17136144,
FT                   17136310..>17136379))
FT                   /locus_tag="mCG_1046256"
FT                   /product="mCG1046256"
FT                   /note="gene_id=mCG1046256.1 transcript_id=mCT163960.1
FT                   created on 15-OCT-2002"
FT   CDS             complement(join(17134466..17134536,17136031..>17136124))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1046256"
FT                   /product="mCG1046256"
FT                   /note="gene_id=mCG1046256.1 transcript_id=mCT163960.1
FT                   protein_id=mCP64896.1"
FT                   /protein_id="EDL37588.1"
FT                   /translation="CFLLCVMDVIRICTAPFGVSFGASNTHSPNGGFFYNSRNSIKFIK
FT                   NIIPRWMAF"
FT   assembly_gap    17148898..17151641
FT                   /estimated_length=2744
FT                   /gap_type="unknown"
FT   assembly_gap    17170338..17172165
FT                   /estimated_length=1828
FT                   /gap_type="unknown"
FT   assembly_gap    17186805..17188530
FT                   /estimated_length=1726
FT                   /gap_type="unknown"
FT   assembly_gap    17212801..17212820
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17227356..17227375
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17229128..17229147
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17262050..17262197
FT                   /estimated_length=148
FT                   /gap_type="unknown"
FT   assembly_gap    17288364..17289785
FT                   /estimated_length=1422
FT                   /gap_type="unknown"
FT   gene            complement(<17311355..>17362888)
FT                   /locus_tag="mCG_1046257"
FT                   /note="gene_id=mCG1046257.1"
FT   mRNA            complement(join(<17311355..17311812,17318873..17319337,
FT                   17360307..17360380,17362488..17362560,17362653..17362770,
FT                   17362864..>17362888))
FT                   /locus_tag="mCG_1046257"
FT                   /product="mCG1046257"
FT                   /note="gene_id=mCG1046257.1 transcript_id=mCT163961.1
FT                   created on 15-OCT-2002"
FT   CDS             complement(<17311355..>17311759)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1046257"
FT                   /product="mCG1046257"
FT                   /note="gene_id=mCG1046257.1 transcript_id=mCT163961.1
FT                   protein_id=mCP64903.0"
FT                   /protein_id="EDL37589.1"
FT                   /translation="TPRSIKEAHRECKTTEAKTLLQGGNSLKMSAWMRKRAVYFQHFQE
FT                   RSTAGCLELCTDVDFSVKPLFSGSKKHSLPFPPHLCLASVYFPDLLFKSILLSFKGWQI
FT                   EAAWKGRVSSGAGVSAECLTIGRGFTNKEKR"
FT   gene            17363079..17377824
FT                   /gene="C1qtnf7"
FT                   /locus_tag="mCG_4158"
FT                   /note="gene_id=mCG4158.2"
FT   mRNA            join(17363079..17363139,17370210..17370455,
FT                   17376795..17377824)
FT                   /gene="C1qtnf7"
FT                   /locus_tag="mCG_4158"
FT                   /product="C1q and tumor necrosis factor related protein 7"
FT                   /note="gene_id=mCG4158.2 transcript_id=mCT3294.1 created on
FT                   26-SEP-2002"
FT   CDS             join(17370218..17370455,17376795..17377426)
FT                   /codon_start=1
FT                   /gene="C1qtnf7"
FT                   /locus_tag="mCG_4158"
FT                   /product="C1q and tumor necrosis factor related protein 7"
FT                   /note="gene_id=mCG4158.2 transcript_id=mCT3294.1
FT                   protein_id=mCP4168.1"
FT                   /db_xref="GOA:Q5BKS0"
FT                   /db_xref="InterPro:IPR001073"
FT                   /db_xref="InterPro:IPR008160"
FT                   /db_xref="InterPro:IPR008983"
FT                   /db_xref="MGI:MGI:1925911"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BKS0"
FT                   /protein_id="EDL37590.1"
FT                   /translation="MIVLLYVTSLAICASGQPRANQAKGESYSPRYICSIPGLPGPPGP
FT                   PGANGSPGPHGRIGLPGRDGRDGRKGEKGEKGTAGLKGKTGPLGLAGEKGDQGETGKKG
FT                   PIGPEGEKGEVGPAGPPGPKGDRGDQGDPGLPGVCRCGSIVLKSAFSVGITTSYPEERL
FT                   PIIFNKVLFNEGEHYNPATGKFICAFPGIYYFSYDITLANKHLAIGLVHNGQYRIRTFD
FT                   ANTGNHDVASGSTVIYLQPEDEVWLEIFFNDQNGLFSDPGWADSLFSGFLLYVDTDYLD
FT                   SISEDDEL"
FT   assembly_gap    17373247..17374410
FT                   /estimated_length=1164
FT                   /gap_type="unknown"
FT   assembly_gap    17398542..17398561
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17413410..17413849
FT                   /estimated_length=440
FT                   /gap_type="unknown"
FT   assembly_gap    17416046..17416960
FT                   /estimated_length=915
FT                   /gap_type="unknown"
FT   gene            17423319..17501574
FT                   /gene="5730509K17Rik"
FT                   /locus_tag="mCG_124147"
FT                   /note="gene_id=mCG124147.1"
FT   mRNA            join(17423319..17423498,17426989..17427216,
FT                   17429585..17429645,17432160..17432243,17434617..17434740,
FT                   17442235..17442302,17444018..17444119,17444958..17445152,
FT                   17446176..17446338,17449042..17449178,17449836..17449967,
FT                   17455685..17455894,17457138..17457244,17460558..17460698,
FT                   17463811..17463967,17464421..17464722,17466677..17466854,
FT                   17467363..17467519,17469664..17469811,17471125..17471263,
FT                   17472860..17473063,17475129..17475221,17476374..17476465,
FT                   17479173..17479340,17480961..17481066,17483048..17483157,
FT                   17484360..17484456,17484934..17485032,17490518..17490721,
FT                   17492983..17493072,17494433..17494546,17495921..17496055,
FT                   17496639..17496761,17498101..17498159,17499960..17500080,
FT                   17501271..17501574)
FT                   /gene="5730509K17Rik"
FT                   /locus_tag="mCG_124147"
FT                   /product="RIKEN cDNA 5730509K17"
FT                   /note="gene_id=mCG124147.1 transcript_id=mCT125385.1
FT                   created on 26-SEP-2002"
FT   CDS             join(17429607..17429645,17432160..17432243,
FT                   17434617..17434740,17442235..17442302,17444018..17444119,
FT                   17444958..17445152,17446176..17446338,17449042..17449178,
FT                   17449836..17449967,17455685..17455894,17457138..17457244,
FT                   17460558..17460698,17463811..17463967,17464421..17464722,
FT                   17466677..17466854,17467363..17467519,17469664..17469811,
FT                   17471125..17471263,17472860..17473063,17475129..17475221,
FT                   17476374..17476465,17479173..17479340,17480961..17481066,
FT                   17483048..17483157,17484360..17484456,17484934..17485032,
FT                   17490518..17490721,17492983..17493072,17494433..17494546,
FT                   17495921..17496055,17496639..17496761,17498101..17498159,
FT                   17499960..17500080,17501271..17501459)
FT                   /codon_start=1
FT                   /gene="5730509K17Rik"
FT                   /locus_tag="mCG_124147"
FT                   /product="RIKEN cDNA 5730509K17"
FT                   /note="gene_id=mCG124147.1 transcript_id=mCT125385.1
FT                   protein_id=mCP64835.1"
FT                   /protein_id="EDL37591.1"
FT                   /translation="MNTNDEKMKIISEDFTGDGVDTEAGRRKKNSKVRRQQRKKKPPAS
FT                   PPEEMVSDKFQDGGQQEVVEEEPETNLLSLTARRGPRTSRTGFAEFSMRERMREKLQAA
FT                   RPSTEVQDTQKEDDTKSYSRIKFRDSVRKIKSKPQLPPGFPSAEEAYNFFTFNFDPEPE
FT                   ESEEKSPVKGGERAHHEDQEGEEGTQAQERAKKTVSDTVTVEEEELLNGKDAEDFLLGL
FT                   DPTAHDFVAVRAAEYKSARIQLQKEKEILFTPSRLTVPTYKKLPENIQPRFLEDEGLYI
FT                   GARPEVARTNENIMENRLLIQEPGSKWFGDDGRILALPSPIKPFPSRPSLTTREQSPKA
FT                   GLETLYKKAEKYVHSRQHMIGSGDPPGNFQLDIDISGLIFTHHPCFSREHVLASKLAQL
FT                   YDQYLARQQRNKTKFLTDKLQALRKAVQTSLNPEKPHQSLDTTQKTINEYKSEIRQTRK
FT                   LRDAEQEKDRTLLKTIIKVWKEMKSLREFQRFTNTPLKLVLRKEKVDPKLDEDAYEAEI
FT                   QAEIHELLEEHMEEYATKMEEYRTSHQQWKAWRKAQCHAAESQSRRLETRSPSTQQRAK
FT                   KKKKKQTTEEHLEEEEAEESFPEEEVTKPIPPEPTDPAVIEQQVRERAAHSRRRPGEPT
FT                   LIPELSLAGNVTPNDQCPRVEVSRREDVRRRSVYLKVVFNSKEVSRTVSRPLGADFRVH
FT                   FGQIFNLQIFNWPESLMLQVYETIGHSGTTLLAEVFLPIPETTLVTGRAPIEEVEFSSN
FT                   QHVTLDHEGVGSGVPFSFEADGSNQLTLMTSGKVSHSVAWAVGENGIPLIPPLSQQNIG
FT                   FRSALRRADAISSIGTSGLTDMKKLAKWAAESKLDPNDPNHAPLMQLISVATSGESYVP
FT                   DFFRLEQLQQEFNFVSEEELNRSKRFRLLHLRSQEVPEFRNYKQIPAYDREIMEKVFQD
FT                   YEKRLRDRNVIETKDHLDMHRATVAKYLQQVREAVVNRFLTAKHHFLLTDLVVEEEVPN
FT                   ISILGLSLFKLAEQKRPLRPRRKGRKKVTAQNLSDGDIKLLVNIIRAYDIPVRKPVVSK
FT                   FQQPSRSSRTFSEKQTASPSTHSPLHNADYPLGQVLVRPFVEVSFQRTICHTTTAEGPN
FT                   PSWNEELELPFRAPNGDYSTASLQSVKDDVYINIFDEVLYDILEDDRERGSGIHTRIER
FT                   HWLGCVKIPFSTIYFQARFDTQEDEKLLQATEKFQAECALKFPQRQCLTTVTDMTGKTV
FT                   FITRYLKPLNPPQELLHVYPNNPQATAELVARYVSLIPFLPDSVSFAGVCDLWSTSDQF
FT                   LDLLAGDEEEHAVLLCNYFLFLGKKAWLVMGSAIPEGPTAYVLTWEKNYYLIWNPCSGH
FT                   CYGQFDAFCPLKSVGCLIGPDNIWFNIQHHDSPLRINFDVTKPKLWKSFFSRSLPYPGL
FT                   SSVQPEELIYQHTDKAVAAELQDRWNRYCTSTLRHFLPLLERSQGEDIEDDHRAELLKQ
FT                   LGDYRFSGFPLHMPYSEVKPLVEAVYSTGVHNIDLPNVEFALAVYIHPYPKNVLSVWIY
FT                   VASLVRNR"
FT   assembly_gap    17433000..17433019
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17454669..17455216
FT                   /estimated_length=548
FT                   /gap_type="unknown"
FT   assembly_gap    17482693..17482734
FT                   /estimated_length=42
FT                   /gap_type="unknown"
FT   assembly_gap    17492262..17492364
FT                   /estimated_length=103
FT                   /gap_type="unknown"
FT   gene            complement(17505221..>17542642)
FT                   /gene="Fbxl5"
FT                   /locus_tag="mCG_4162"
FT                   /note="gene_id=mCG4162.1"
FT   mRNA            complement(join(17505221..17505980,17511467..17511615,
FT                   17518823..17519520,17521308..17521456,17523418..17523543,
FT                   17525910..17526092,17528665..17528851,17531338..17531433,
FT                   17534045..17534260,17542566..17542642))
FT                   /gene="Fbxl5"
FT                   /locus_tag="mCG_4162"
FT                   /product="F-box and leucine-rich repeat protein 5,
FT                   transcript variant mCT3293"
FT                   /note="gene_id=mCG4162.1 transcript_id=mCT3293.1 created on
FT                   09-APR-2003"
FT   mRNA            complement(join(17505223..17505980,17511467..17511615,
FT                   17518823..17519545,17520344..17520426,17521308..17521456,
FT                   17523418..17523543,17525910..17526092,17528665..17528851,
FT                   17531338..17531433,17534045..17534260,17542566..>17542642))
FT                   /gene="Fbxl5"
FT                   /locus_tag="mCG_4162"
FT                   /product="F-box and leucine-rich repeat protein 5,
FT                   transcript variant mCT193555"
FT                   /note="gene_id=mCG4162.1 transcript_id=mCT193555.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(17505904..17505980,17511467..17511615,
FT                   17518823..17519545,17520344..17520426,17521308..17521456,
FT                   17523418..17523543,17525910..17526092,17528665..17528851,
FT                   17531338..17531433,17534045..17534260,17542566..>17542640))
FT                   /codon_start=1
FT                   /gene="Fbxl5"
FT                   /locus_tag="mCG_4162"
FT                   /product="F-box and leucine-rich repeat protein 5, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG4162.1 transcript_id=mCT193555.0
FT                   protein_id=mCP114548.0 isoform=CRA_a"
FT                   /protein_id="EDL37592.1"
FT                   /translation="FPDEVDVFTAPHWRMKQLVGRYCDKLSKTNFSNNNDFRALLQSLY
FT                   ATFKEFKMHEQIENEYIIGLLQQRSQTIYNVHSDNKLSEMLSLFEKGLKNVKNEYEQLN
FT                   YAKQLKERLEAFTRDFLPHMKEEEEVFQPMLMEYFTYEELKDIKKKVIAQHCSQKDTAE
FT                   LLRGLSLWNQAEERQKVLKYSVDEKADTEAEVSEHSTGITHLPPEVMLSIFSYLNPQEL
FT                   CRCSQVSTKWSQLAKTGSLWKHLYPVHWARGDWYSGPATELDTEPDEEWVRNRKDESRA
FT                   FQEWDEDADIDESEESAEESVAISIAQMEKRVLHGLIHNVLPYVGTSVKTLVLAYSSAV
FT                   SSKMVRQILELCPNLEHLDLTQTDISDSAFDSWSWLGCCQSLRHLDLSGCEKITDMALE
FT                   KISRALGVLTSHQSGFLKSAGKAASTPWTSKDITMPSTTQYACLHNLTDKGIGEEIDNE
FT                   HSWTEPVSSESLTSPYVWMLDAEDLADIEDAVEWRHRNVESLCVMETASNFGCSSSGCY
FT                   SKDIVGLRTSVCWQQHCASPAFAYCGHSFCCTGTALRTMTTLPATSAMCRKALRTTLPR
FT                   GKDLIYFGSEKSDQETGRVLLFLSLSGCYQITDHGLRALTLGGGLPYLEHLNLSGCLTV
FT                   TGAGLQDLVSACPSLNDEYFYYCDNINGPHADTASGCQNLQCGFRACCRSGE"
FT   CDS             complement(join(17505904..17505980,17511467..17511615,
FT                   17518823..17519520,17521308..17521456,17523418..17523543,
FT                   17525910..17526092,17528665..17528851,17531338..17531433,
FT                   17534045..17534260,17542566..17542598))
FT                   /codon_start=1
FT                   /gene="Fbxl5"
FT                   /locus_tag="mCG_4162"
FT                   /product="F-box and leucine-rich repeat protein 5, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG4162.1 transcript_id=mCT3293.1
FT                   protein_id=mCP4208.2 isoform=CRA_b"
FT                   /protein_id="EDL37593.1"
FT                   /translation="MKQLVGRYCDKLSKTNFSNNNDFRALLQSLYATFKEFKMHEQIEN
FT                   EYIIGLLQQRSQTIYNVHSDNKLSEMLSLFEKGLKNVKNEYEQLNYAKQLKERLEAFTR
FT                   DFLPHMKEEEEVFQPMLMEYFTYEELKDIKKKVIAQHCSQKDTAELLRGLSLWNQAEER
FT                   QKVLKYSVDEKADTEAEVSEHSTGITHLPPEVMLSIFSYLNPQELCRCSQVSTKWSQLA
FT                   KTGSLWKHLYPVHWARGDWYSGPATELDTEPDEEWVRNRKDESRAFQEWDEDADIDESE
FT                   ESAEESVAISIAQMEKRVLHGLIHNVLPYVGTSVKTLVLAYSSAVSSKMSLRHLDLSGC
FT                   EKITDMALEKISRALGVLTSHQSGFLKSAGKAASTPWTSKDITMPSTTQYACLHNLTDK
FT                   GIGEEIDNEHSWTEPVSSESLTSPYVWMLDAEDLADIEDAVEWRHRNVESLCVMETASN
FT                   FGCSSSGCYSKDIVGLRTSVCWQQHCASPAFAYCGHSFCCTGTALRTMTTLPATSAMCR
FT                   KALRTTLPRGKDLIYFGSEKSDQETGRVLLFLSLSGCYQITDHGLRALTLGGGLPYLEH
FT                   LNLSGCLTVTGAGLQDLVSACPSLNDEYFYYCDNINGPHADTASGCQNLQCGFRACCRS
FT                   GE"
FT   gene            complement(17513514..17514872)
FT                   /locus_tag="mCG_148303"
FT                   /note="gene_id=mCG148303.0"
FT   mRNA            complement(17513514..17514872)
FT                   /locus_tag="mCG_148303"
FT                   /product="mCG148303"
FT                   /note="gene_id=mCG148303.0 transcript_id=mCT188566.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(17513709..17514062)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148303"
FT                   /product="mCG148303"
FT                   /note="gene_id=mCG148303.0 transcript_id=mCT188566.0
FT                   protein_id=mCP109217.0"
FT                   /protein_id="EDL37594.1"
FT                   /translation="MREIFLEYIFLLYVIIPQSFIDWVILPLAKDSILTFDIPLLFLTL
FT                   IIALKRRVCVCVCVCVCVCVYVCVCMYTHTHSGILAHTYIHTYTHTYALAVNSCFLLFY
FT                   GTVLLMSFCIFSL"
FT   assembly_gap    17542643..17543193
FT                   /estimated_length=551
FT                   /gap_type="unknown"
FT   assembly_gap    17552238..17552257
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17555094..17555155
FT                   /estimated_length=62
FT                   /gap_type="unknown"
FT   assembly_gap    17561174..17561241
FT                   /estimated_length=68
FT                   /gap_type="unknown"
FT   assembly_gap    17567303..17567328
FT                   /estimated_length=26
FT                   /gap_type="unknown"
FT   assembly_gap    17572937..17572956
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            17579660..17604033
FT                   /gene="Bst1"
FT                   /locus_tag="mCG_4156"
FT                   /note="gene_id=mCG4156.1"
FT   mRNA            join(17579660..17579845,17581209..17581335,
FT                   17582341..17582476,17582998..17583080,17586059..17586135,
FT                   17586995..17587087,17598193..17598279,17601163..17601222,
FT                   17602719..17604033)
FT                   /gene="Bst1"
FT                   /locus_tag="mCG_4156"
FT                   /product="bone marrow stromal cell antigen 1"
FT                   /note="gene_id=mCG4156.1 transcript_id=mCT3303.1 created on
FT                   18-SEP-2002"
FT   CDS             join(17579679..17579845,17581209..17581335,
FT                   17582341..17582476,17582998..17583080,17586059..17586135,
FT                   17586995..17587087,17598193..17598279,17601163..17601222,
FT                   17602719..17602824)
FT                   /codon_start=1
FT                   /gene="Bst1"
FT                   /locus_tag="mCG_4156"
FT                   /product="bone marrow stromal cell antigen 1"
FT                   /note="gene_id=mCG4156.1 transcript_id=mCT3303.1
FT                   protein_id=mCP4151.2"
FT                   /protein_id="EDL37595.1"
FT                   /translation="MAVQGGLLSLWLWLWLSLLTVLLGARARWRGEGTTPHLQSIFLGR
FT                   CAEYTTLLSLGNKNCTAIWEAFKGVLDKDPCSVLPSDYDLFINLSRHPIPRDKSLFWEN
FT                   NHLLVMSYGENTRRLVALCDVLYGKVGDFLSWCRQENASGLDYQSCPTSEDCENNAVDS
FT                   YWKSASMQYSRDSSGVINVMLNGSEPKGAYPTRGFFADFEIPYLQKDKVTRIEIWVMHD
FT                   VGGPNVESCGEGSVKILEDRLEALGFQHSCINDYRPVKFLMCVDHSTHPDCIMNSASAS
FT                   MRRESASLHAIGDASLLISLLVALASSSQA"
FT   assembly_gap    17580694..17580713
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17607827..17607846
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17613149..17613168
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17616690..17617097
FT                   /estimated_length=408
FT                   /gap_type="unknown"
FT   assembly_gap    17622332..17622541
FT                   /estimated_length=210
FT                   /gap_type="unknown"
FT   assembly_gap    17627672..17627691
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            17629638..17673166
FT                   /gene="Cd38"
FT                   /locus_tag="mCG_4157"
FT                   /note="gene_id=mCG4157.2"
FT   mRNA            join(17629638..17629912,17661125..17661254,
FT                   17662213..17662348,17664387..17664472,17666956..17667029,
FT                   17668310..17668402,17668720..17668806,17671077..17673166)
FT                   /gene="Cd38"
FT                   /locus_tag="mCG_4157"
FT                   /product="CD38 antigen"
FT                   /note="gene_id=mCG4157.2 transcript_id=mCT3298.2 created on
FT                   18-SEP-2002"
FT   CDS             join(17629668..17629912,17661125..17661254,
FT                   17662213..17662348,17664387..17664472,17666956..17667029,
FT                   17668310..17668402,17668720..17668806,17671077..17671140)
FT                   /codon_start=1
FT                   /gene="Cd38"
FT                   /locus_tag="mCG_4157"
FT                   /product="CD38 antigen"
FT                   /note="gene_id=mCG4157.2 transcript_id=mCT3298.2
FT                   protein_id=mCP4160.2"
FT                   /protein_id="EDL37596.1"
FT                   /translation="MANYEFSQVSGDRPGCRLSRKAQIGLGVGLLVLIALVVGIVVILL
FT                   RPRSLLVWTGEPTTKHFSDIFLGRCLIYTQILRPEMRDQNCQEILSTFKGAFVSKNPCN
FT                   ITREDYAPLVKLVTQTIPCNKTLFWSKSKHLAHQYTWIQGKMFTLEDTLLGYIADDLRW
FT                   CGDPSTSDMNYVSCPHWSENCPNNPITMFWKVISQKFAEDACGVVQVMLNGSLREPFYK
FT                   NSTFGSVEVFSLDPNKVHKLQAWVMHDIEGASSNACSSSSLNELKMIVQKRNMIFACVD
FT                   NYRPARFLQCVKNPEHPSCRLNT"
FT   gene            complement(17670014..>17670682)
FT                   /locus_tag="mCG_146116"
FT                   /note="gene_id=mCG146116.0"
FT   mRNA            complement(join(17670014..17670237,17670323..17670393,
FT                   17670590..>17670682))
FT                   /locus_tag="mCG_146116"
FT                   /product="mCG146116"
FT                   /note="gene_id=mCG146116.0 transcript_id=mCT186219.0
FT                   created on 14-JUL-2003"
FT   CDS             complement(17670018..>17670221)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146116"
FT                   /product="mCG146116"
FT                   /note="gene_id=mCG146116.0 transcript_id=mCT186219.0
FT                   protein_id=mCP107481.0"
FT                   /protein_id="EDL37597.1"
FT                   /translation="SVFTVSTKRASGWSLPPYRSATPTATTCRLAVPELSRGHLKLKLQ
FT                   FGGNGPLPLLHNPVSGNSKIEP"
FT   gene            17673947..17674835
FT                   /locus_tag="mCG_1046030"
FT                   /note="gene_id=mCG1046030.1"
FT   mRNA            17673947..17674835
FT                   /locus_tag="mCG_1046030"
FT                   /product="mCG1046030"
FT                   /note="gene_id=mCG1046030.1 transcript_id=mCT163734.1
FT                   created on 18-OCT-2002"
FT   CDS             17673969..17674502
FT                   /codon_start=1
FT                   /locus_tag="mCG_1046030"
FT                   /product="mCG1046030"
FT                   /note="gene_id=mCG1046030.1 transcript_id=mCT163734.1
FT                   protein_id=mCP65025.0"
FT                   /db_xref="GOA:Q4G0C5"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="MGI:MGI:3645078"
FT                   /db_xref="UniProtKB/TrEMBL:Q4G0C5"
FT                   /protein_id="EDL37598.1"
FT                   /translation="MAVANSSPVNPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQ
FT                   FCTGEFRKDGVPIGYKGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENFKLRH
FT                   SAPGLLSMANSGPSTNGCQFFITCSKCDWLDGKHVVFGKIIDGLLVMRKIENVPTGPNN
FT                   KPKLPVVISQCGEM"
FT   gene            17677549..17679022
FT                   /pseudo
FT                   /locus_tag="mCG_1046130"
FT                   /note="gene_id=mCG1046130.1"
FT   mRNA            17677549..17679022
FT                   /pseudo
FT                   /locus_tag="mCG_1046130"
FT                   /note="gene_id=mCG1046130.1 transcript_id=mCT163834.1
FT                   created on 11-OCT-2002"
FT   gene            complement(17683303..17683937)
FT                   /pseudo
FT                   /locus_tag="mCG_1046065"
FT                   /note="gene_id=mCG1046065.1"
FT   mRNA            complement(17683303..17683937)
FT                   /pseudo
FT                   /locus_tag="mCG_1046065"
FT                   /note="gene_id=mCG1046065.1 transcript_id=mCT163769.1
FT                   created on 16-OCT-2002"
FT   assembly_gap    17703243..17703273
FT                   /estimated_length=31
FT                   /gap_type="unknown"
FT   gene            complement(17704527..17705306)
FT                   /pseudo
FT                   /locus_tag="mCG_124142"
FT                   /note="gene_id=mCG124142.1"
FT   mRNA            complement(17704527..17705306)
FT                   /pseudo
FT                   /locus_tag="mCG_124142"
FT                   /note="gene_id=mCG124142.1 transcript_id=mCT125380.1
FT                   created on 03-OCT-2002"
FT   assembly_gap    17713847..17713866
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17718559..17718642
FT                   /estimated_length=84
FT                   /gap_type="unknown"
FT   assembly_gap    17729654..17729777
FT                   /estimated_length=124
FT                   /gap_type="unknown"
FT   gene            complement(17739089..17742001)
FT                   /gene="Fgfbp1"
FT                   /locus_tag="mCG_14740"
FT                   /note="gene_id=mCG14740.2"
FT   mRNA            complement(join(17739089..17740194,17741939..17742001))
FT                   /gene="Fgfbp1"
FT                   /locus_tag="mCG_14740"
FT                   /product="fibroblast growth factor binding protein 1"
FT                   /note="gene_id=mCG14740.2 transcript_id=mCT19752.2 created
FT                   on 28-SEP-2004"
FT   CDS             complement(17739419..17740174)
FT                   /codon_start=1
FT                   /gene="Fgfbp1"
FT                   /locus_tag="mCG_14740"
FT                   /product="fibroblast growth factor binding protein 1"
FT                   /note="gene_id=mCG14740.2 transcript_id=mCT19752.2
FT                   protein_id=mCP4188.1"
FT                   /protein_id="EDL37599.1"
FT                   /translation="MRLHSLILLSFLLLATQAFSEKVRKRAKNAPHSTAEEGVEGSAPS
FT                   LGKAQNKQRSRTSKSLTHGKFVTKDQATCRWAVTEEEQGISLKVQCTQADQEFSCVFAG
FT                   DPTDCLKHDKDQIYWKQVARTLRKQKNICRNAKSVLKTRVCRKRFPESNLKLVNPNARG
FT                   NTKPRKEKAEVSAREHNKVQEAVSTEPNRVKEDITLNPAATQTMAIRDPECLEDPDVLN
FT                   QRKTALEFCGESWSSICTFFLNMLQATSC"
FT   assembly_gap    17748211..17748254
FT                   /estimated_length=44
FT                   /gap_type="unknown"
FT   gene            complement(17753863..17861845)
FT                   /gene="Prom1"
FT                   /locus_tag="mCG_124143"
FT                   /note="gene_id=mCG124143.1"
FT   mRNA            complement(join(17753863..17754738,17755317..17755356,
FT                   17760977..17761045,17761470..17761493,17761986..17762101,
FT                   17765086..17765178,17766365..17766433,17767223..17767303,
FT                   17771395..17771448,17773076..17773168,17774296..17774367,
FT                   17774958..17775104,17776766..17776850,17778493..17778596,
FT                   17781008..17781131,17786883..17787035,17789810..17789969,
FT                   17793144..17793207,17794547..17794621,17797625..17797842,
FT                   17804542..17804631,17805745..17805808,17807727..17807847,
FT                   17816079..17816284,17818863..17818889,17823375..17823433,
FT                   17854619..17854992,17861775..17861845))
FT                   /gene="Prom1"
FT                   /locus_tag="mCG_124143"
FT                   /product="prominin 1, transcript variant mCT173401"
FT                   /note="gene_id=mCG124143.1 transcript_id=mCT173401.0
FT                   created on 20-SEP-2002"
FT   mRNA            complement(join(17753864..17754738,17755317..17755356,
FT                   17760977..17761045,17761470..17761493,17761986..17762101,
FT                   17765086..17765178,17766365..17766433,17767223..17767303,
FT                   17771395..17771448,17773076..17773168,17774296..17774367,
FT                   17774958..17775104,17776766..17776850,17778493..17778596,
FT                   17781008..17781131,17786883..17787035,17789810..17789969,
FT                   17793144..17793207,17794547..17794621,17797625..17797842,
FT                   17804542..17804631,17805745..17805808,17807727..17807847,
FT                   17816079..17816284,17823375..17823433,17854619..17854992,
FT                   17861775..17861808))
FT                   /gene="Prom1"
FT                   /locus_tag="mCG_124143"
FT                   /product="prominin 1, transcript variant mCT125381"
FT                   /note="gene_id=mCG124143.1 transcript_id=mCT125381.1
FT                   created on 20-SEP-2002"
FT   mRNA            complement(join(17754546..17754738,17755317..17755356,
FT                   17761986..17762101,17765086..17765178,17766365..17766433,
FT                   17767223..17767303,17771395..17771448,17773076..17773168,
FT                   17774296..17774367,17774958..17775104,17776766..17776850,
FT                   17778493..17778596,17781008..17781131,17786883..17787035,
FT                   17789810..17789969,17793144..17793207,17794547..17794621,
FT                   17797625..17797842,17804542..17804631,17805745..17805808,
FT                   17807727..17807847,17816079..17816284,17823375..17823433,
FT                   17854619..17854992,17858898..>17859449))
FT                   /gene="Prom1"
FT                   /locus_tag="mCG_124143"
FT                   /product="prominin 1, transcript variant mCT193570"
FT                   /note="gene_id=mCG124143.1 transcript_id=mCT193570.0
FT                   created on 09-MAR-2004"
FT   CDS             complement(join(17755341..17755356,17761986..17762101,
FT                   17765086..17765178,17766365..17766433,17767223..17767303,
FT                   17771395..17771448,17773076..17773168,17774296..17774367,
FT                   17774958..17775104,17776766..17776850,17778493..17778596,
FT                   17781008..17781131,17786883..17787035,17789810..17789969,
FT                   17793144..17793207,17794547..17794621,17797625..17797842,
FT                   17804542..17804631,17805745..17805808,17807727..17807847,
FT                   17816079..17816284,17823375..17823433,17854619..>17854856))
FT                   /codon_start=1
FT                   /gene="Prom1"
FT                   /locus_tag="mCG_124143"
FT                   /product="prominin 1, isoform CRA_b"
FT                   /note="gene_id=mCG124143.1 transcript_id=mCT193570.0
FT                   protein_id=mCP114514.0 isoform=CRA_b"
FT                   /protein_id="EDL37601.1"
FT                   /translation="EIRPTTMALVFSALLLLGLCGKISSEGQPAFHNTPGAMNYELPTT
FT                   KYETQDTFNAGIVGPLYKMVHIFLNVVQPNDFPLDLIKKLIQNKNFDISVDSKEIALYE
FT                   IGVLICAILGLLFIILMPLVGCFFCMCRCCNKCGGEMHQRQKQNAPCRRKCLGLSLLVI
FT                   CLLMSLGIIYGFVANQQTRTRIKGTQKLAKSNFRDFQTLLTETPKQIDYVVEQYTNTKN
FT                   KAFSDLDGIGSVLGGRIKDQLKPKVTPVLEEIKAMATAIKQTKDALQNMSSSLKSLQDA
FT                   ATQLNTNLSSVRNSIENSLSSSDCTSDPASKICDSIRPSLSSLGSSLNSSQLPSVDREL
FT                   NTVTEVDKTDLESLVKRGYTTIDEIPNTIQNQTVDVIKDVKNTLDSISSNIKDMSQSIP
FT                   IEDMLLQVSHYLNNSNRYLNQELPKLEEYDSYWWLGGLIVCFLLTLIVTFFFLGLLCGV
FT                   FGYDKHATPTRRGCVSNTGGIFLMAGVGFGFLFCWILMILVVLTFVVGANVEKLLCEPY
FT                   ENKKLLQVLDTPYLLKEQWQFYLSGMLFNNPDINMTFEQVYRDCKRGRGIYAAFQLENV
FT                   VNVSDHFNIDQISENINTELENLNVNIDSIELLDNTGRKSLEDFAHSGIDTIDYSTYLK
FT                   ETEKSPTEVNLLTFASTLEAKANQLPEGKLKQAFLLDVQNIRAIHQHLLPPVQQSLNTL
FT                   RQSVWTLQQTSNKLPEKVKKILASLDSVQHFLTNNVSLIVIGETKKFGKTILGYFEHYL
FT                   HWVFYAITEKMTSCKPMATAMDSAVNGILCGYVADPLNLFWFGIGKATVLLLPAVIIAI
FT                   KLAKYYRRMDSEDVYDDPSRY"
FT   CDS             complement(join(17755341..17755356,17760977..17761045,
FT                   17761470..17761493,17761986..17762101,17765086..17765178,
FT                   17766365..17766433,17767223..17767303,17771395..17771448,
FT                   17773076..17773168,17774296..17774367,17774958..17775104,
FT                   17776766..17776850,17778493..17778596,17781008..17781131,
FT                   17786883..17787035,17789810..17789969,17793144..17793207,
FT                   17794547..17794621,17797625..17797842,17804542..17804631,
FT                   17805745..17805808,17807727..17807847,17816079..17816284,
FT                   17823375..17823433,17854619..17854838))
FT                   /codon_start=1
FT                   /gene="Prom1"
FT                   /locus_tag="mCG_124143"
FT                   /product="prominin 1, isoform CRA_g"
FT                   /note="gene_id=mCG124143.1 transcript_id=mCT125381.1
FT                   protein_id=mCP65233.1 isoform=CRA_g"
FT                   /db_xref="GOA:G3X9J8"
FT                   /db_xref="InterPro:IPR008795"
FT                   /db_xref="MGI:MGI:1100886"
FT                   /db_xref="UniProtKB/TrEMBL:G3X9J8"
FT                   /protein_id="EDL37606.1"
FT                   /translation="MALVFSALLLLGLCGKISSEGQPAFHNTPGAMNYELPTTKYETQD
FT                   TFNAGIVGPLYKMVHIFLNVVQPNDFPLDLIKKLIQNKNFDISVDSKEIALYEIGVLIC
FT                   AILGLLFIILMPLVGCFFCMCRCCNKCGGEMHQRQKQNAPCRRKCLGLSLLVICLLMSL
FT                   GIIYGFVANQQTRTRIKGTQKLAKSNFRDFQTLLTETPKQIDYVVEQYTNTKNKAFSDL
FT                   DGIGSVLGGRIKDQLKPKVTPVLEEIKAMATAIKQTKDALQNMSSSLKSLQDAATQLNT
FT                   NLSSVRNSIENSLSSSDCTSDPASKICDSIRPSLSSLGSSLNSSQLPSVDRELNTVTEV
FT                   DKTDLESLVKRGYTTIDEIPNTIQNQTVDVIKDVKNTLDSISSNIKDMSQSIPIEDMLL
FT                   QVSHYLNNSNRYLNQELPKLEEYDSYWWLGGLIVCFLLTLIVTFFFLGLLCGVFGYDKH
FT                   ATPTRRGCVSNTGGIFLMAGVGFGFLFCWILMILVVLTFVVGANVEKLLCEPYENKKLL
FT                   QVLDTPYLLKEQWQFYLSGMLFNNPDINMTFEQVYRDCKRGRGIYAAFQLENVVNVSDH
FT                   FNIDQISENINTELENLNVNIDSIELLDNTGRKSLEDFAHSGIDTIDYSTYLKETEKSP
FT                   TEVNLLTFASTLEAKANQLPEGKLKQAFLLDVQNIRAIHQHLLPPVQQSLNTLRQSVWT
FT                   LQQTSNKLPEKVKKILASLDSVQHFLTNNVSLIVIGETKKFGKTILGYFEHYLHWVFYA
FT                   ITEKMTSCKPMATAMDSAVNGILCGYVADPLNLFWFGIGKATVLLLPAVIIAIKLAKYY
FT                   RRMDSEDVYDDVETVPMKNLEIGSNGYHKDHLYGVHNPVMTSPSRY"
FT   CDS             complement(join(17755341..17755356,17760977..17761045,
FT                   17761470..17761493,17761986..17762101,17765086..17765178,
FT                   17766365..17766433,17767223..17767303,17771395..17771448,
FT                   17773076..17773168,17774296..17774367,17774958..17775104,
FT                   17776766..17776850,17778493..17778596,17781008..17781131,
FT                   17786883..17787035,17789810..17789969,17793144..17793207,
FT                   17794547..17794621,17797625..17797842,17804542..17804631,
FT                   17805745..17805808,17807727..17807847,17816079..17816284,
FT                   17818863..17818889,17823375..17823433,17854619..17854838))
FT                   /codon_start=1
FT                   /gene="Prom1"
FT                   /locus_tag="mCG_124143"
FT                   /product="prominin 1, isoform CRA_a"
FT                   /note="gene_id=mCG124143.1 transcript_id=mCT173401.0
FT                   protein_id=mCP96320.0 isoform=CRA_a"
FT                   /db_xref="GOA:G5E8G5"
FT                   /db_xref="InterPro:IPR008795"
FT                   /db_xref="MGI:MGI:1100886"
FT                   /db_xref="UniProtKB/TrEMBL:G5E8G5"
FT                   /protein_id="EDL37600.1"
FT                   /translation="MALVFSALLLLGLCGKISSEGQPAFHNTPGAMNYELPTTKYETQD
FT                   TFNAGIVGPLYKMVHIFLNVVQPNDFPLDLIKKLIQNKNFDISVDSKEPEIIVLALKIA
FT                   LYEIGVLICAILGLLFIILMPLVGCFFCMCRCCNKCGGEMHQRQKQNAPCRRKCLGLSL
FT                   LVICLLMSLGIIYGFVANQQTRTRIKGTQKLAKSNFRDFQTLLTETPKQIDYVVEQYTN
FT                   TKNKAFSDLDGIGSVLGGRIKDQLKPKVTPVLEEIKAMATAIKQTKDALQNMSSSLKSL
FT                   QDAATQLNTNLSSVRNSIENSLSSSDCTSDPASKICDSIRPSLSSLGSSLNSSQLPSVD
FT                   RELNTVTEVDKTDLESLVKRGYTTIDEIPNTIQNQTVDVIKDVKNTLDSISSNIKDMSQ
FT                   SIPIEDMLLQVSHYLNNSNRYLNQELPKLEEYDSYWWLGGLIVCFLLTLIVTFFFLGLL
FT                   CGVFGYDKHATPTRRGCVSNTGGIFLMAGVGFGFLFCWILMILVVLTFVVGANVEKLLC
FT                   EPYENKKLLQVLDTPYLLKEQWQFYLSGMLFNNPDINMTFEQVYRDCKRGRGIYAAFQL
FT                   ENVVNVSDHFNIDQISENINTELENLNVNIDSIELLDNTGRKSLEDFAHSGIDTIDYST
FT                   YLKETEKSPTEVNLLTFASTLEAKANQLPEGKLKQAFLLDVQNIRAIHQHLLPPVQQSL
FT                   NTLRQSVWTLQQTSNKLPEKVKKILASLDSVQHFLTNNVSLIVIGETKKFGKTILGYFE
FT                   HYLHWVFYAITEKMTSCKPMATAMDSAVNGILCGYVADPLNLFWFGIGKATVLLLPAVI
FT                   IAIKLAKYYRRMDSEDVYDDVETVPMKNLEIGSNGYHKDHLYGVHNPVMTSPSRY"
FT   assembly_gap    17760581..17760600
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            complement(join(17761481..17761748,17761986..17762101,
FT                   17765086..17765178,17766365..17766433,17767223..17767303,
FT                   17771395..17771448,17773076..17773168,17774296..17774367,
FT                   17774958..17775104,17776766..17776850,17778493..17778596,
FT                   17781008..17781131,17786883..17787035,17789810..17789969,
FT                   17793144..17793207,17794547..17794621,17797625..17797842,
FT                   17804542..17804631,17805745..17805808,17807727..17807847,
FT                   17816079..17816284,17823375..17823433,17854619..17854992,
FT                   17858898..>17859416))
FT                   /gene="Prom1"
FT                   /locus_tag="mCG_124143"
FT                   /product="prominin 1, transcript variant mCT193571"
FT                   /note="gene_id=mCG124143.1 transcript_id=mCT193571.0
FT                   created on 09-MAR-2004"
FT   mRNA            complement(join(17761643..17761748,17761986..17762101,
FT                   17765086..17765178,17766365..17766433,17767223..17767303,
FT                   17771395..17771448,17773076..17773168,17774296..17774367,
FT                   17774958..17775104,17776766..17776850,17778493..17778596,
FT                   17781008..17781131,17786883..17787035,17789810..17789969,
FT                   17793144..17793207,17797625..17797842,17804542..17804631,
FT                   17805745..17805808,17807727..17807847,17816079..17816269,
FT                   17823375..17823433,17854619..>17854937))
FT                   /gene="Prom1"
FT                   /locus_tag="mCG_124143"
FT                   /product="prominin 1, transcript variant mCT193572"
FT                   /note="gene_id=mCG124143.1 transcript_id=mCT193572.0
FT                   created on 09-MAR-2004"
FT   mRNA            complement(join(17761643..17761748,17761986..17762101,
FT                   17765086..17765178,17766365..17766433,17767223..17767303,
FT                   17771395..17771448,17773076..17773168,17774296..17774367,
FT                   17774958..17775104,17776766..17776850,17778493..17778596,
FT                   17781008..17781131,17786883..17787035,17789810..17789969,
FT                   17793144..17793207,17797625..17797842,17804542..17804631,
FT                   17805745..17805808,17807727..17807847,17816079..17816284,
FT                   17823375..17823433,17854619..>17854937))
FT                   /gene="Prom1"
FT                   /locus_tag="mCG_124143"
FT                   /product="prominin 1, transcript variant mCT193574"
FT                   /note="gene_id=mCG124143.1 transcript_id=mCT193574.0
FT                   created on 09-MAR-2004"
FT   mRNA            complement(join(17761643..17762101,17765086..17765178,
FT                   17766365..17766433,17767223..17767303,17771395..17771448,
FT                   17773076..17773168,17774296..17774367,17774958..17775104,
FT                   17776766..17776850,17778493..17778596,17781008..17781131,
FT                   17786883..17787035,17789810..17789969,17793144..17793207,
FT                   17794547..17794621,17797625..17797842,17804542..17804631,
FT                   17805745..17805808,17807727..17807847,17816079..17816284,
FT                   17823375..17823433,17854619..>17854937))
FT                   /gene="Prom1"
FT                   /locus_tag="mCG_124143"
FT                   /product="prominin 1, transcript variant mCT193573"
FT                   /note="gene_id=mCG124143.1 transcript_id=mCT193573.0
FT                   created on 09-MAR-2004"
FT   CDS             complement(join(17761712..17761748,17761986..17762101,
FT                   17765086..17765178,17766365..17766433,17767223..17767303,
FT                   17771395..17771448,17773076..17773168,17774296..17774367,
FT                   17774958..17775104,17776766..17776850,17778493..17778596,
FT                   17781008..17781131,17786883..17787035,17789810..17789969,
FT                   17793144..17793207,17797625..17797842,17804542..17804631,
FT                   17805745..17805808,17807727..17807847,17816079..17816269,
FT                   17823375..17823433,17854619..>17854856))
FT                   /codon_start=1
FT                   /gene="Prom1"
FT                   /locus_tag="mCG_124143"
FT                   /product="prominin 1, isoform CRA_d"
FT                   /note="gene_id=mCG124143.1 transcript_id=mCT193572.0
FT                   protein_id=mCP114516.0 isoform=CRA_d"
FT                   /protein_id="EDL37603.1"
FT                   /translation="EIRPTTMALVFSALLLLGLCGKISSEGQPAFHNTPGAMNYELPTT
FT                   KYETQDTFNAGIVGPLYKMVHIFLNVVQPNDFPLDLIKKLIQNKNFDISVDSKEIGVLI
FT                   CAILGLLFIILMPLVGCFFCMCRCCNKCGGEMHQRQKQNAPCRRKCLGLSLLVICLLMS
FT                   LGIIYGFVANQQTRTRIKGTQKLAKSNFRDFQTLLTETPKQIDYVVEQYTNTKNKAFSD
FT                   LDGIGSVLGGRIKDQLKPKVTPVLEEIKAMATAIKQTKDALQNMSSSLKSLQDAATQLN
FT                   TNLSSVRNSIENSLSSSDCTSDPASKICDSIRPSLSSLGSSLNSSQGYTTIDEIPNTIQ
FT                   NQTVDVIKDVKNTLDSISSNIKDMSQSIPIEDMLLQVSHYLNNSNRYLNQELPKLEEYD
FT                   SYWWLGGLIVCFLLTLIVTFFFLGLLCGVFGYDKHATPTRRGCVSNTGGIFLMAGVGFG
FT                   FLFCWILMILVVLTFVVGANVEKLLCEPYENKKLLQVLDTPYLLKEQWQFYLSGMLFNN
FT                   PDINMTFEQVYRDCKRGRGIYAAFQLENVVNVSDHFNIDQISENINTELENLNVNIDSI
FT                   ELLDNTGRKSLEDFAHSGIDTIDYSTYLKETEKSPTEVNLLTFASTLEAKANQLPEGKL
FT                   KQAFLLDVQNIRAIHQHLLPPVQQSLNTLRQSVWTLQQTSNKLPEKVKKILASLDSVQH
FT                   FLTNNVSLIVIGETKKFGKTILGYFEHYLHWVFYAITEKMTSCKPMATAMDSAVNGILC
FT                   GYVADPLNLFWFGIGKATVLLLPAVIIAIKLAKYYRRMDSEDVYDDSSVSGMWHFTL"
FT   CDS             complement(join(17761712..17761748,17761986..17762101,
FT                   17765086..17765178,17766365..17766433,17767223..17767303,
FT                   17771395..17771448,17773076..17773168,17774296..17774367,
FT                   17774958..17775104,17776766..17776850,17778493..17778596,
FT                   17781008..17781131,17786883..17787035,17789810..17789969,
FT                   17793144..17793207,17797625..17797842,17804542..17804631,
FT                   17805745..17805808,17807727..17807847,17816079..17816284,
FT                   17823375..17823433,17854619..>17854856))
FT                   /codon_start=1
FT                   /gene="Prom1"
FT                   /locus_tag="mCG_124143"
FT                   /product="prominin 1, isoform CRA_f"
FT                   /note="gene_id=mCG124143.1 transcript_id=mCT193574.0
FT                   protein_id=mCP114518.0 isoform=CRA_f"
FT                   /protein_id="EDL37605.1"
FT                   /translation="EIRPTTMALVFSALLLLGLCGKISSEGQPAFHNTPGAMNYELPTT
FT                   KYETQDTFNAGIVGPLYKMVHIFLNVVQPNDFPLDLIKKLIQNKNFDISVDSKEIALYE
FT                   IGVLICAILGLLFIILMPLVGCFFCMCRCCNKCGGEMHQRQKQNAPCRRKCLGLSLLVI
FT                   CLLMSLGIIYGFVANQQTRTRIKGTQKLAKSNFRDFQTLLTETPKQIDYVVEQYTNTKN
FT                   KAFSDLDGIGSVLGGRIKDQLKPKVTPVLEEIKAMATAIKQTKDALQNMSSSLKSLQDA
FT                   ATQLNTNLSSVRNSIENSLSSSDCTSDPASKICDSIRPSLSSLGSSLNSSQGYTTIDEI
FT                   PNTIQNQTVDVIKDVKNTLDSISSNIKDMSQSIPIEDMLLQVSHYLNNSNRYLNQELPK
FT                   LEEYDSYWWLGGLIVCFLLTLIVTFFFLGLLCGVFGYDKHATPTRRGCVSNTGGIFLMA
FT                   GVGFGFLFCWILMILVVLTFVVGANVEKLLCEPYENKKLLQVLDTPYLLKEQWQFYLSG
FT                   MLFNNPDINMTFEQVYRDCKRGRGIYAAFQLENVVNVSDHFNIDQISENINTELENLNV
FT                   NIDSIELLDNTGRKSLEDFAHSGIDTIDYSTYLKETEKSPTEVNLLTFASTLEAKANQL
FT                   PEGKLKQAFLLDVQNIRAIHQHLLPPVQQSLNTLRQSVWTLQQTSNKLPEKVKKILASL
FT                   DSVQHFLTNNVSLIVIGETKKFGKTILGYFEHYLHWVFYAITEKMTSCKPMATAMDSAV
FT                   NGILCGYVADPLNLFWFGIGKATVLLLPAVIIAIKLAKYYRRMDSEDVYDDSSVSGMWH
FT                   FTL"
FT   CDS             complement(join(17761712..17761748,17761986..17762101,
FT                   17765086..17765178,17766365..17766433,17767223..17767303,
FT                   17771395..17771448,17773076..17773168,17774296..17774367,
FT                   17774958..17775104,17776766..17776850,17778493..17778596,
FT                   17781008..17781131,17786883..17787035,17789810..17789969,
FT                   17793144..17793207,17794547..17794621,17797625..17797842,
FT                   17804542..17804631,17805745..17805808,17807727..17807847,
FT                   17816079..17816284,17823375..17823433,17854619..>17854856))
FT                   /codon_start=1
FT                   /gene="Prom1"
FT                   /locus_tag="mCG_124143"
FT                   /product="prominin 1, isoform CRA_c"
FT                   /note="gene_id=mCG124143.1 transcript_id=mCT193571.0
FT                   protein_id=mCP114515.0 isoform=CRA_c"
FT                   /protein_id="EDL37602.1"
FT                   /translation="EIRPTTMALVFSALLLLGLCGKISSEGQPAFHNTPGAMNYELPTT
FT                   KYETQDTFNAGIVGPLYKMVHIFLNVVQPNDFPLDLIKKLIQNKNFDISVDSKEIALYE
FT                   IGVLICAILGLLFIILMPLVGCFFCMCRCCNKCGGEMHQRQKQNAPCRRKCLGLSLLVI
FT                   CLLMSLGIIYGFVANQQTRTRIKGTQKLAKSNFRDFQTLLTETPKQIDYVVEQYTNTKN
FT                   KAFSDLDGIGSVLGGRIKDQLKPKVTPVLEEIKAMATAIKQTKDALQNMSSSLKSLQDA
FT                   ATQLNTNLSSVRNSIENSLSSSDCTSDPASKICDSIRPSLSSLGSSLNSSQLPSVDREL
FT                   NTVTEVDKTDLESLVKRGYTTIDEIPNTIQNQTVDVIKDVKNTLDSISSNIKDMSQSIP
FT                   IEDMLLQVSHYLNNSNRYLNQELPKLEEYDSYWWLGGLIVCFLLTLIVTFFFLGLLCGV
FT                   FGYDKHATPTRRGCVSNTGGIFLMAGVGFGFLFCWILMILVVLTFVVGANVEKLLCEPY
FT                   ENKKLLQVLDTPYLLKEQWQFYLSGMLFNNPDINMTFEQVYRDCKRGRGIYAAFQLENV
FT                   VNVSDHFNIDQISENINTELENLNVNIDSIELLDNTGRKSLEDFAHSGIDTIDYSTYLK
FT                   ETEKSPTEVNLLTFASTLEAKANQLPEGKLKQAFLLDVQNIRAIHQHLLPPVQQSLNTL
FT                   RQSVWTLQQTSNKLPEKVKKILASLDSVQHFLTNNVSLIVIGETKKFGKTILGYFEHYL
FT                   HWVFYAITEKMTSCKPMATAMDSAVNGILCGYVADPLNLFWFGIGKATVLLLPAVIIAI
FT                   KLAKYYRRMDSEDVYDDSSVSGMWHFTL"
FT   CDS             complement(join(17761982..17762101,17765086..17765178,
FT                   17766365..17766433,17767223..17767303,17771395..17771448,
FT                   17773076..17773168,17774296..17774367,17774958..17775104,
FT                   17776766..17776850,17778493..17778596,17781008..17781131,
FT                   17786883..17787035,17789810..17789969,17793144..17793207,
FT                   17794547..17794621,17797625..17797842,17804542..17804631,
FT                   17805745..17805808,17807727..17807847,17816079..17816284,
FT                   17823375..17823433,17854619..>17854856))
FT                   /codon_start=1
FT                   /gene="Prom1"
FT                   /locus_tag="mCG_124143"
FT                   /product="prominin 1, isoform CRA_e"
FT                   /note="gene_id=mCG124143.1 transcript_id=mCT193573.0
FT                   protein_id=mCP114517.0 isoform=CRA_e"
FT                   /protein_id="EDL37604.1"
FT                   /translation="EIRPTTMALVFSALLLLGLCGKISSEGQPAFHNTPGAMNYELPTT
FT                   KYETQDTFNAGIVGPLYKMVHIFLNVVQPNDFPLDLIKKLIQNKNFDISVDSKEIALYE
FT                   IGVLICAILGLLFIILMPLVGCFFCMCRCCNKCGGEMHQRQKQNAPCRRKCLGLSLLVI
FT                   CLLMSLGIIYGFVANQQTRTRIKGTQKLAKSNFRDFQTLLTETPKQIDYVVEQYTNTKN
FT                   KAFSDLDGIGSVLGGRIKDQLKPKVTPVLEEIKAMATAIKQTKDALQNMSSSLKSLQDA
FT                   ATQLNTNLSSVRNSIENSLSSSDCTSDPASKICDSIRPSLSSLGSSLNSSQLPSVDREL
FT                   NTVTEVDKTDLESLVKRGYTTIDEIPNTIQNQTVDVIKDVKNTLDSISSNIKDMSQSIP
FT                   IEDMLLQVSHYLNNSNRYLNQELPKLEEYDSYWWLGGLIVCFLLTLIVTFFFLGLLCGV
FT                   FGYDKHATPTRRGCVSNTGGIFLMAGVGFGFLFCWILMILVVLTFVVGANVEKLLCEPY
FT                   ENKKLLQVLDTPYLLKEQWQFYLSGMLFNNPDINMTFEQVYRDCKRGRGIYAAFQLENV
FT                   VNVSDHFNIDQISENINTELENLNVNIDSIELLDNTGRKSLEDFAHSGIDTIDYSTYLK
FT                   ETEKSPTEVNLLTFASTLEAKANQLPEGKLKQAFLLDVQNIRAIHQHLLPPVQQSLNTL
FT                   RQSVWTLQQTSNKLPEKVKKILASLDSVQHFLTNNVSLIVIGETKKFGKTILGYFEHYL
FT                   HWVFYAITEKMTSCKPMATAMDSAVNGILCGYVADPLNLFWFGIGKATVLLLPAVIIAI
FT                   KLAKYYRRMDSEDVYDE"
FT   assembly_gap    17803721..17803740
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17815363..17815986
FT                   /estimated_length=624
FT                   /gap_type="unknown"
FT   assembly_gap    17849119..17849178
FT                   /estimated_length=60
FT                   /gap_type="unknown"
FT   assembly_gap    17853524..17853756
FT                   /estimated_length=233
FT                   /gap_type="unknown"
FT   gene            complement(17859879..>17862086)
FT                   /locus_tag="mCG_146110"
FT                   /note="gene_id=mCG146110.0"
FT   mRNA            complement(join(17859879..17860121,17860218..17860457,
FT                   17860563..17860704,17862061..>17862086))
FT                   /locus_tag="mCG_146110"
FT                   /product="mCG146110"
FT                   /note="gene_id=mCG146110.0 transcript_id=mCT186213.0
FT                   created on 14-JUL-2003"
FT   CDS             complement(join(17860038..17860121,17860218..>17860337))
FT                   /codon_start=1
FT                   /locus_tag="mCG_146110"
FT                   /product="mCG146110"
FT                   /note="gene_id=mCG146110.0 transcript_id=mCT186213.0
FT                   protein_id=mCP107475.0"
FT                   /protein_id="EDL37607.1"
FT                   /translation="PVNPMQKPTSQSEATVTVTGLVSGSRDLVPFETVFLLFSKFSEVN
FT                   RSKDGLTTLGAGEKAQLLGALD"
FT   assembly_gap    17861415..17861448
FT                   /estimated_length=34
FT                   /gap_type="unknown"
FT   assembly_gap    17863360..17863379
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17877263..17877282
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17891098..17891117
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(17926214..>17977601)
FT                   /gene="4932414K18Rik"
FT                   /locus_tag="mCG_124149"
FT                   /note="gene_id=mCG124149.0"
FT   mRNA            complement(join(17926214..17928233,17929912..17930072,
FT                   17933739..17933815,17935622..17935690,17935996..17936055,
FT                   17937273..17937382,17939660..17939740,17943106..17943175,
FT                   17943393..17943490,17944141..17944348,17945274..17945408,
FT                   17969119..17969249,17977428..>17977601))
FT                   /gene="4932414K18Rik"
FT                   /locus_tag="mCG_124149"
FT                   /product="RIKEN cDNA 4932414K18, transcript variant
FT                   mCT125387"
FT                   /note="gene_id=mCG124149.0 transcript_id=mCT125387.1
FT                   created on 03-OCT-2002"
FT   CDS             complement(join(17928004..17928233,17929912..17930072,
FT                   17933739..17933815,17935622..17935690,17935996..17936055,
FT                   17937273..17937382,17939660..17939740,17943106..17943175,
FT                   17943393..17943490,17944141..17944348,17945274..17945408,
FT                   17969119..17969249,17977428..>17977599))
FT                   /codon_start=1
FT                   /gene="4932414K18Rik"
FT                   /locus_tag="mCG_124149"
FT                   /product="RIKEN cDNA 4932414K18, isoform CRA_b"
FT                   /note="gene_id=mCG124149.0 transcript_id=mCT125387.1
FT                   protein_id=mCP64878.1 isoform=CRA_b"
FT                   /protein_id="EDL37609.1"
FT                   /translation="AAAPGEGGGGGADGPERTGRGEAEQPGGGGHGPAPQHTETLGFYE
FT                   SDRRREKRRGRAELSLLRFLSAELTRGYFLEHNEAKYTERRERVYTCMRIPRELEKVCD
FT                   ILKGVILVICYFMMHYVDYSMMYHLIRGQSVIKLYIIYNMLEVADRLFSSFGQDILDAL
FT                   YWTATEPKERKRAHIGVIPHFFMAVLYVCILLGLEGTPATRAALFAHPCTEWVLHAILI
FT                   MVQATTLNVAFNSHNKSLLTIMMSNNFVEIKGSVFKKFEKNNLFQMSNSDIKERFTNYV
FT                   LLLIVCLRNMEQFSWNPDHLWVLFPDVCMVIASEIAVDIVKHAFITKFNDITADVYSEY
FT                   RASLAFDLVSSRQKNAYTDYSDSVARRMGFIPLPLAVLLIRVVTSSIKVQGILSYACVI
FT                   LFYFGLISLKILNSIVLLGKSCQYVKEAKMEEKLFNPPPASTPGKPSSKSQSKGKPSQG
FT                   LSTEENLSASVTSQPGHQKENVIPLLVTSNSDQFLTTPDGDEKDITQENSELKHRSSKK
FT                   DLLEIDRFTICGNRID"
FT   mRNA            complement(join(17944273..17944348,17945274..17945436,
FT                   17950327..17950392,17955224..17955342,17969119..>17969227))
FT                   /gene="4932414K18Rik"
FT                   /locus_tag="mCG_124149"
FT                   /product="RIKEN cDNA 4932414K18, transcript variant
FT                   mCT174526"
FT                   /note="gene_id=mCG124149.0 transcript_id=mCT174526.0
FT                   created on 03-OCT-2002"
FT   CDS             complement(join(17945401..17945436,17950327..17950392,
FT                   17955224..17955342,17969119..>17969185))
FT                   /codon_start=1
FT                   /gene="4932414K18Rik"
FT                   /locus_tag="mCG_124149"
FT                   /product="RIKEN cDNA 4932414K18, isoform CRA_a"
FT                   /note="gene_id=mCG124149.0 transcript_id=mCT174526.0
FT                   protein_id=mCP97445.0 isoform=CRA_a"
FT                   /protein_id="EDL37608.1"
FT                   /translation="SQVYRAKRKGVHLYANTKRIGKAHVLWNIFVPRCLSVCVHPASFK
FT                   SLSGAIQAPHSALLWLKTEGRSTFTSFIGWSVVAQGLLVGPTSASARTGV"
FT   gene            <17970698..17975017
FT                   /locus_tag="mCG_144988"
FT                   /note="gene_id=mCG144988.0"
FT   mRNA            join(<17970698..17970755,17971662..17971747,
FT                   17974475..17975017)
FT                   /locus_tag="mCG_144988"
FT                   /product="mCG144988"
FT                   /note="gene_id=mCG144988.0 transcript_id=mCT184412.0
FT                   created on 05-JUN-2003"
FT   CDS             <17974581..17974730
FT                   /codon_start=1
FT                   /locus_tag="mCG_144988"
FT                   /product="mCG144988"
FT                   /note="gene_id=mCG144988.0 transcript_id=mCT184412.0
FT                   protein_id=mCP105597.0"
FT                   /protein_id="EDL37610.1"
FT                   /translation="SRAKWIKQAVYEVQQQNQVKKTEFRILSPTWTCSSLTARAIHGYA
FT                   ESFT"
FT   assembly_gap    17977603..17977766
FT                   /estimated_length=164
FT                   /gap_type="unknown"
FT   assembly_gap    18009866..18010580
FT                   /estimated_length=715
FT                   /gap_type="unknown"
FT   assembly_gap    18012284..18012618
FT                   /estimated_length=335
FT                   /gap_type="unknown"
FT   assembly_gap    18027596..18028569
FT                   /estimated_length=974
FT                   /gap_type="unknown"
FT   assembly_gap    18031813..18031967
FT                   /estimated_length=155
FT                   /gap_type="unknown"
FT   assembly_gap    18032941..18033223
FT                   /estimated_length=283
FT                   /gap_type="unknown"
FT   assembly_gap    18065009..18065028
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18096781..18097548
FT                   /estimated_length=768
FT                   /gap_type="unknown"
FT   assembly_gap    18119471..18119490
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18123999..18124018
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18142120..18142139
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(18160672..18162177)
FT                   /pseudo
FT                   /locus_tag="mCG_123612"
FT                   /note="gene_id=mCG123612.1"
FT   mRNA            complement(18160672..18162177)
FT                   /pseudo
FT                   /locus_tag="mCG_123612"
FT                   /note="gene_id=mCG123612.1 transcript_id=mCT124845.1
FT                   created on 03-OCT-2002"
FT   gene            complement(<18168226..>18183000)
FT                   /locus_tag="mCG_144987"
FT                   /note="gene_id=mCG144987.0"
FT   mRNA            complement(join(<18168226..18168473,18169030..18169114,
FT                   18182121..18182464,18182758..>18183000))
FT                   /locus_tag="mCG_144987"
FT                   /product="mCG144987"
FT                   /note="gene_id=mCG144987.0 transcript_id=mCT184411.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(<18168226..>18168379)
FT                   /codon_start=1
FT                   /locus_tag="mCG_144987"
FT                   /product="mCG144987"
FT                   /note="gene_id=mCG144987.0 transcript_id=mCT184411.0
FT                   protein_id=mCP105596.0"
FT                   /protein_id="EDL37611.1"
FT                   /translation="RFSYSNAKICCLIPRLTCIPNVHTLLYSYSNLYLYFINVFSLFII
FT                   KFTPEA"
FT   assembly_gap    18178815..18178834
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18199273..18199292
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18203110..18207341
FT                   /estimated_length=4232
FT                   /gap_type="unknown"
FT   assembly_gap    18214811..18215113
FT                   /estimated_length=303
FT                   /gap_type="unknown"
FT   assembly_gap    18224699..18224718
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(18226584..18565380)
FT                   /gene="Ldb2"
FT                   /locus_tag="mCG_14734"
FT                   /note="gene_id=mCG14734.2"
FT   mRNA            complement(join(18226584..18227403,18233062..18233213,
FT                   18234195..18234318,18293491..18293574,18295868..18295990,
FT                   18302513..18302685,18429730..18429832,18565123..18565380))
FT                   /gene="Ldb2"
FT                   /locus_tag="mCG_14734"
FT                   /product="LIM domain binding 2"
FT                   /note="gene_id=mCG14734.2 transcript_id=mCT19746.1 created
FT                   on 20-SEP-2002"
FT   CDS             complement(join(18227173..18227403,18233062..18233213,
FT                   18234195..18234318,18293491..18293574,18295868..18295990,
FT                   18302513..18302685,18429730..18429832,18565123..18565254))
FT                   /codon_start=1
FT                   /gene="Ldb2"
FT                   /locus_tag="mCG_14734"
FT                   /product="LIM domain binding 2"
FT                   /note="gene_id=mCG14734.2 transcript_id=mCT19746.1
FT                   protein_id=mCP4190.1"
FT                   /protein_id="EDL37612.1"
FT                   /translation="MSSTPHDPFYSSPFGPFYRRHTPYMVQPEYRIYEMNKRLQSRTED
FT                   SDNLWWDAFATEFFEDDATLTLSFCLEDGPKRYTIGRTLIPRYFSTVFEGGVTDLYYIL
FT                   KHSKESYHNSSITVDCDQCAMVTQHGKPMFTKVCTEGRLILEFTFDDLMRIKTWHFTIR
FT                   QYRELVPRSILAMHAQDPQVLDQLSKNITRMGLTNFTLNYLRLCVILEPMQELMSRHKT
FT                   YNLSPRDCLKTCLFQKWQRMVAPPAEPTRQPTTKRRKRKNSTSSTSNSSAGNTTNSAGS
FT                   KKKTPAASLSLATQVPDVMVVGEPTLMGGEFGDEDERLITRLENTQYDAANGMDDEEDF
FT                   NNSPALGNNSPWNSKPPATQETKSENAPPQASQ"
FT   assembly_gap    18242920..18248930
FT                   /estimated_length=6011
FT                   /gap_type="unknown"
FT   assembly_gap    18272122..18272308
FT                   /estimated_length=187
FT                   /gap_type="unknown"
FT   assembly_gap    18292610..18292677
FT                   /estimated_length=68
FT                   /gap_type="unknown"
FT   assembly_gap    18322667..18322872
FT                   /estimated_length=206
FT                   /gap_type="unknown"
FT   assembly_gap    18327463..18327523
FT                   /estimated_length=61
FT                   /gap_type="unknown"
FT   assembly_gap    18353328..18353347
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18360273..18360292
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <18402180..18422548
FT                   /locus_tag="mCG_145578"
FT                   /note="gene_id=mCG145578.0"
FT   mRNA            join(<18402180..18402258,18412375..18412463,
FT                   18419451..18419583,18420821..18422548)
FT                   /locus_tag="mCG_145578"
FT                   /product="mCG145578"
FT                   /note="gene_id=mCG145578.0 transcript_id=mCT185002.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<18402180..18402258,18412375..18412463,
FT                   18419451..18419573)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145578"
FT                   /product="mCG145578"
FT                   /note="gene_id=mCG145578.0 transcript_id=mCT185002.0
FT                   protein_id=mCP105609.0"
FT                   /protein_id="EDL37613.1"
FT                   /translation="SLNNTEDPLLRGLPLAFQTGSLQKAICIVEMALWVKDSPSSKVTR
FT                   GGAIIIHVSTRRLFPMKKRPENTSSQVTDDQKLVFQNNSNKMYIWRCEFHF"
FT   assembly_gap    18412719..18414328
FT                   /estimated_length=1610
FT                   /gap_type="unknown"
FT   assembly_gap    18434659..18434678
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18441600..18445401
FT                   /estimated_length=3802
FT                   /gap_type="unknown"
FT   assembly_gap    18449630..18449649
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18461787..18461806
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(18466849..18472747)
FT                   /locus_tag="mCG_148298"
FT                   /note="gene_id=mCG148298.0"
FT   mRNA            complement(join(18466849..18467194,18471877..18472747))
FT                   /locus_tag="mCG_148298"
FT                   /product="mCG148298"
FT                   /note="gene_id=mCG148298.0 transcript_id=mCT188561.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(join(18467155..18467194,18471877..18472112))
FT                   /codon_start=1
FT                   /locus_tag="mCG_148298"
FT                   /product="mCG148298"
FT                   /note="gene_id=mCG148298.0 transcript_id=mCT188561.0
FT                   protein_id=mCP109212.0"
FT                   /protein_id="EDL37614.1"
FT                   /translation="MVSFTSSFIYSDNIELDYILYHIFCLELGMNTQGSQSKAVLALPS
FT                   LHAVKCGLQQLSRLVTRGKDYVTQSSRAFWEPSGCAVFQPCSVRSQ"
FT   assembly_gap    18491258..18491414
FT                   /estimated_length=157
FT                   /gap_type="unknown"
FT   assembly_gap    18528668..18528687
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18536069..18536088
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18549148..18549167
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18561340..18561359
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18565597..18565616
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18601390..18601409
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18612353..18612487
FT                   /estimated_length=135
FT                   /gap_type="unknown"
FT   assembly_gap    18680473..18692638
FT                   /estimated_length=12166
FT                   /gap_type="unknown"
FT   assembly_gap    18694350..18695095
FT                   /estimated_length=746
FT                   /gap_type="unknown"
FT   assembly_gap    18697192..18697505
FT                   /estimated_length=314
FT                   /gap_type="unknown"
FT   assembly_gap    18721706..18721857
FT                   /estimated_length=152
FT                   /gap_type="unknown"
FT   gene            18727106..18739723
FT                   /locus_tag="mCG_65884"
FT                   /note="gene_id=mCG65884.1"
FT   mRNA            join(18727106..18727217,18727442..18727495,
FT                   18727697..18728041,18728688..18728857,18732466..18732501,
FT                   18732977..18733176,18733538..18733666,18734403..18734526,
FT                   18737976..18738080,18738736..18739723)
FT                   /locus_tag="mCG_65884"
FT                   /product="mCG65884"
FT                   /note="gene_id=mCG65884.1 transcript_id=mCT66067.1 created
FT                   on 01-OCT-2002"
FT   CDS             join(18727490..18727495,18727697..18728041,
FT                   18728688..18728765)
FT                   /codon_start=1
FT                   /locus_tag="mCG_65884"
FT                   /product="mCG65884"
FT                   /note="gene_id=mCG65884.1 transcript_id=mCT66067.1
FT                   protein_id=mCP27190.2"
FT                   /protein_id="EDL37615.1"
FT                   /translation="MMGRCTVIWCLDLLLAEDEGPKQDLSQKLCCFGQEGGGLSGAEDG
FT                   AASEALWLSPGPEKAGLCIPHRHPCSLPSAESRRQGGSRQGLRQKLLGPGGPLCSHQEG
FT                   GQLSGAEEWRCPVKLVYELSQMLGPSKGAEKAETEDSS"
FT   assembly_gap    18752890..18752909
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18798722..18798741
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18799967..18799986
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18801065..18801084
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18809184..18809203
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18811109..18811128
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18823932..18832699
FT                   /estimated_length=8768
FT                   /gap_type="unknown"
FT   assembly_gap    18836051..18836070
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18859033..18859077
FT                   /estimated_length=45
FT                   /gap_type="unknown"
FT   assembly_gap    18867728..18867747
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18874248..18874842
FT                   /estimated_length=595
FT                   /gap_type="unknown"
FT   gene            complement(18878346..18943443)
FT                   /locus_tag="mCG_1046133"
FT                   /note="gene_id=mCG1046133.0"
FT   mRNA            complement(join(18878346..18878555,18879369..18879479,
FT                   18922659..18922826,18931063..18931220,18937116..18937352,
FT                   18943295..18943443))
FT                   /locus_tag="mCG_1046133"
FT                   /product="mCG1046133"
FT                   /note="gene_id=mCG1046133.0 transcript_id=mCT163837.0
FT                   created on 01-OCT-2002"
FT   assembly_gap    18897268..18897287
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18910947..18911048
FT                   /estimated_length=102
FT                   /gap_type="unknown"
FT   CDS             complement(join(18931111..18931220,18937116..18937314))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1046133"
FT                   /product="mCG1046133"
FT                   /note="gene_id=mCG1046133.0 transcript_id=mCT163837.0
FT                   protein_id=mCP65182.1"
FT                   /protein_id="EDL37616.1"
FT                   /translation="MGAGSMWQRKLLTFWKPGNKEWDRKGWDPKCRFMNMLHGHAHSDL
FT                   FPMMLLVEAEGSEIQSSSQRHTNGGTCIDSWLLKMMRVVTFLPGPCCWGRPLCGLLL"
FT   assembly_gap    18956164..18957478
FT                   /estimated_length=1315
FT                   /gap_type="unknown"
FT   assembly_gap    18987449..18987489
FT                   /estimated_length=41
FT                   /gap_type="unknown"
FT   assembly_gap    19012489..19015357
FT                   /estimated_length=2869
FT                   /gap_type="unknown"
FT   assembly_gap    19033122..19033228
FT                   /estimated_length=107
FT                   /gap_type="unknown"
FT   assembly_gap    19034759..19034895
FT                   /estimated_length=137
FT                   /gap_type="unknown"
FT   assembly_gap    19040516..19040825
FT                   /estimated_length=310
FT                   /gap_type="unknown"
FT   assembly_gap    19046021..19046562
FT                   /estimated_length=542
FT                   /gap_type="unknown"
FT   assembly_gap    19048709..19048879
FT                   /estimated_length=171
FT                   /gap_type="unknown"
FT   assembly_gap    19060052..19060140
FT                   /estimated_length=89
FT                   /gap_type="unknown"
FT   assembly_gap    19070635..19070786
FT                   /estimated_length=152
FT                   /gap_type="unknown"
FT   assembly_gap    19077669..19078010
FT                   /estimated_length=342
FT                   /gap_type="unknown"
FT   assembly_gap    19087981..19088000
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19127985..19128148
FT                   /estimated_length=164
FT                   /gap_type="unknown"
FT   assembly_gap    19163162..19163181
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19170578..19170750
FT                   /estimated_length=173
FT                   /gap_type="unknown"
FT   assembly_gap    19181716..19181826
FT                   /estimated_length=111
FT                   /gap_type="unknown"
FT   gene            complement(19191229..19207419)
FT                   /gene="Qdpr"
FT                   /locus_tag="mCG_21480"
FT                   /note="gene_id=mCG21480.1"
FT   mRNA            complement(join(19191229..19191857,19195021..19195104,
FT                   19196463..19196571,19200622..19200762,19201843..19201939,
FT                   19204772..19204864,19207203..19207419))
FT                   /gene="Qdpr"
FT                   /locus_tag="mCG_21480"
FT                   /product="quininoid dihydropteridine reductase, transcript
FT                   variant mCT22133"
FT                   /note="gene_id=mCG21480.1 transcript_id=mCT22133.1 created
FT                   on 18-FEB-2003"
FT   mRNA            complement(join(19191229..19191857,19196463..19196571,
FT                   19200622..19200762,19201843..19201939,19204772..19204864,
FT                   19207203..19207370))
FT                   /gene="Qdpr"
FT                   /locus_tag="mCG_21480"
FT                   /product="quininoid dihydropteridine reductase, transcript
FT                   variant mCT173708"
FT                   /note="gene_id=mCG21480.1 transcript_id=mCT173708.0 created
FT                   on 18-FEB-2003"
FT   mRNA            complement(join(19191621..19191857,19195021..19195104,
FT                   19196463..19196571,19200622..19200762,19201843..19201939,
FT                   19204772..19204864,19207286..>19207367))
FT                   /gene="Qdpr"
FT                   /locus_tag="mCG_21480"
FT                   /product="quininoid dihydropteridine reductase, transcript
FT                   variant mCT193579"
FT                   /note="gene_id=mCG21480.1 transcript_id=mCT193579.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(19191701..19191857,19195021..19195104,
FT                   19196463..19196571,19200622..19200762,19201843..19201939,
FT                   19204772..19204864,19207078..>19207161))
FT                   /gene="Qdpr"
FT                   /locus_tag="mCG_21480"
FT                   /product="quininoid dihydropteridine reductase, transcript
FT                   variant mCT180255"
FT                   /note="gene_id=mCG21480.1 transcript_id=mCT180255.0 created
FT                   on 18-FEB-2003"
FT   CDS             complement(join(19191752..19191857,19195021..19195104,
FT                   19196463..19196571,19200622..19200762,19201843..19201939,
FT                   19204772..19204864,19207286..>19207366))
FT                   /codon_start=1
FT                   /gene="Qdpr"
FT                   /locus_tag="mCG_21480"
FT                   /product="quininoid dihydropteridine reductase, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG21480.1 transcript_id=mCT193579.0
FT                   protein_id=mCP114535.0 isoform=CRA_c"
FT                   /protein_id="EDL37619.1"
FT                   /translation="GSCEPRSAFGLAVQYRASLSGAGWRLQWVASIDVVENEEASASVV
FT                   VKMTDSFTEQADQVTADVGKLLGDQKVDAILCVAGGWAGGNAKSKSLFKNCDMMWKQSM
FT                   WTSTISSHLATKHLKEGGLLTLAGAKAALDGTPGMIGYGMAKGAVHQLCQSLAGKNSGM
FT                   PPGAAAIAVLPVTLDTPMNRKSMPEADFSSWTPLEFLVETFHDWITGNKRPNSGSLIQV
FT                   VTTDGKTELTPAYF"
FT   CDS             complement(join(19191752..19191857,19196463..19196571,
FT                   19200622..19200762,19201843..19201939,19204772..19204864,
FT                   19207203..19207298))
FT                   /codon_start=1
FT                   /gene="Qdpr"
FT                   /locus_tag="mCG_21480"
FT                   /product="quininoid dihydropteridine reductase, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG21480.1 transcript_id=mCT173708.0
FT                   protein_id=mCP96627.0 isoform=CRA_a"
FT                   /db_xref="GOA:A0A0G2JGJ1"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="MGI:MGI:97836"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0G2JGJ1"
FT                   /protein_id="EDL37617.1"
FT                   /translation="MAASGEARRVLVYGGRGALGSRCVQAFRARNWWVASIDVVENEEA
FT                   SASVVVKMTDSFTEQADQVTADVGKLLGDQKVDAILCVAGGWAGGNAKSKSLFKNCDMM
FT                   WKQSMWTSTISSHLATKHLKEGGLLTLAGAKAALDGTPGMIGYGMAKGAVHQLCQSLAG
FT                   KNSGMPPGAAAIAVLPTFHDWITGNKRPNSGSLIQVVTTDGKTELTPAYF"
FT   CDS             complement(join(19191752..19191857,19195021..19195104,
FT                   19196463..19196571,19200622..19200762,19201843..19201939,
FT                   19204772..19204864,19207203..19207298))
FT                   /codon_start=1
FT                   /gene="Qdpr"
FT                   /locus_tag="mCG_21480"
FT                   /product="quininoid dihydropteridine reductase, isoform
FT                   CRA_d"
FT                   /note="gene_id=mCG21480.1 transcript_id=mCT22133.1
FT                   protein_id=mCP4164.2 isoform=CRA_d"
FT                   /protein_id="EDL37620.1"
FT                   /translation="MAASGEARRVLVYGGRGALGSRCVQAFRARNWWVASIDVVENEEA
FT                   SASVVVKMTDSFTEQADQVTADVGKLLGDQKVDAILCVAGGWAGGNAKSKSLFKNCDMM
FT                   WKQSMWTSTISSHLATKHLKEGGLLTLAGAKAALDGTPGMIGYGMAKGAVHQLCQSLAG
FT                   KNSGMPPGAAAIAVLPVTLDTPMNRKSMPEADFSSWTPLEFLVETFHDWITGNKRPNSG
FT                   SLIQVVTTDGKTELTPAYF"
FT   CDS             complement(join(19191752..19191857,19195021..19195104,
FT                   19196463..19196571,19200622..19200762,19201843..19201939,
FT                   19204772..19204864,19207078..>19207161))
FT                   /codon_start=1
FT                   /gene="Qdpr"
FT                   /locus_tag="mCG_21480"
FT                   /product="quininoid dihydropteridine reductase, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG21480.1 transcript_id=mCT180255.0
FT                   protein_id=mCP103177.0 isoform=CRA_b"
FT                   /protein_id="