
ID   CH466524; SV 1; linear; genomic DNA; CON; MUS; 61163717 BP.
AC   CH466524;
PR   Project:PRJNA11785;
DT   04-AUG-2005 (Rel. 84, Created)
DT   10-JUN-2007 (Rel. 92, Last updated, Version 7)
DE   Mus musculus 232000009833416 genomic scaffold, whole genome shotgun
DE   sequence.
KW   .
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
RN   [1]
RP   1-61163717
RX   DOI; 10.1126/science.1069193.
RX   PUBMED; 12040188.
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Miklos G.L., Wides R.,
RA   Halpern A., Li P.W., Sutton G.G., Nadeau J., Salzberg S.L., Holt R.A.,
RA   Kodira C.D., Lu F., Chen L., Deng Z., Evangelista C.C., Gan W.,
RA   Heiman T.J., Li J., Li Z., Merkulov G.V., Milshina N.V., Naik A.K., Qi R.,
RA   Shue B.C., Wang A., Wang J., Wang X., Yan X., Ye J., Yooseph S., Zhao Q.,
RA   Zheng L., Zhu S.C., Biddick K., Bolanos R., Delcher A.L., Dew I.M.,
RA   Fasulo D., Flanigan M.J., Huson D.H., Kravitz S.A., Miller J.R.,
RA   Mobarry C.M., Reinert K., Remington K.A., Zhang Q., Zheng X.H.,
RA   Nusskern D.R., Lai Z., Lei Y., Zhong W., Yao A., Guan P., Ji R.R., Gu Z.,
RA   Wang Z.Y., Zhong F., Xiao C., Chiang C.C., Yandell M., Wortman J.R.,
RA   Amanatides P.G., Hladun S.L., Pratts E.C., Johnson J.E., Dodson K.L.,
RA   Woodford K.J., Evans C.A., Gropman B., Rusch D.B., Venter E., Wang M.,
RA   Smith T.J., Houck J.T., Tompkins D.E., Haynes C., Jacob D., Chin S.H.,
RA   Allen D.R., Dahlke C.E., Sanders R., Li K., Liu X., Levitsky A.A.,
RA   Majoros W.H., Chen Q., Xia A.C., Lopez J.R., Donnelly M.T., Newman M.H.,
RA   Glodek A., Kraft C.L., Nodell M., Ali F., An H.J., Baldwin-Pitts D.,
RA   Beeson K.Y., Cai S., Carnes M., Carver A., Caulk P.M., Center A.,
RA   Chen Y.H., Cheng M.L., Coyne M.D., Crowder M., Danaher S., Davenport L.B.,
RA   Desilets R., Dietz S.M., Doup L., Dullaghan P., Ferriera S., Fosler C.R.,
RA   Gire H.C., Gluecksmann A., Gocayne J.D., Gray J., Hart B., Haynes J.,
RA   Hoover J., Howland T., Ibegwam C., Jalali M., Johns D., Kline L., Ma D.S.,
RA   MacCawley S., Magoon A., Mann F., May D., McIntosh T.C., Mehta S., Moy L.,
RA   Moy M.C., Murphy B.J., Murphy S.D., Nelson K.A., Nuri Z., Parker K.A.,
RA   Prudhomme A.C., Puri V.N., Qureshi H., Raley J.C., Reardon M.S.,
RA   Regier M.A., Rogers Y.H., Romblad D.L., Schutz J., Scott J.L., Scott R.,
RA   Sitter C.D., Smallwood M., Sprague A.C., Stewart E., Strong R.V., Suh E.,
RA   Sylvester K., Thomas R., Tint N.N., Tsonis C., Wang G., Wang G.,
RA   Williams M.S., Williams S.M., Windsor S.M., Wolfe K., Wu M.M., Zaveri J.,
RA   Chaturvedi K., Gabrielian A.E., Ke Z., Sun J., Subramanian G., Venter J.C.,
RA   Pfannkoch C.M., Barnstead M., Stephenson L.D.;
RT   "A comparison of whole-genome shotgun-derived mouse chromosome 16 and the
RT   human genome";
RL   Science, e1252229 296(5573):1661-1671(2002).
RN   [2]
RP   1-61163717
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (05-JUL-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
DR   MD5; 261a943bcabf22138051af11b4399b9a.
DR   ENA; AAHY01000000; SET.
DR   ENA; AAHY00000000; SET.
DR   ENA-CON; CM000213.
DR   BioSample; SAMN03004379.
DR   Ensembl-Gn; ENSMUSG00000000560; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000001260; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000001566; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000004642; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000005103; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000005107; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000005220; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000006641; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000013622; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000013629; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000014932; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000015806; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000023452; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025746; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025747; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029086; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029088; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029093; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029097; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029103; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029104; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029108; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029127; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029128; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029130; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029131; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029138; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029145; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029146; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029162; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029167; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029169; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029176; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029177; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029178; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029191; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029192; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029196; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029201; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029203; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029204; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029205; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029211; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029212; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029213; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029219; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029228; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029236; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029246; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029247; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029248; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029253; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029255; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029260; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029272; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000033036; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000035811; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000035836; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000036435; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000036553; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000036596; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000036693; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000037355; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000037373; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038552; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038676; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039095; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039106; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039156; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039191; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039358; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039474; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000043430; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000044681; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000044716; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000044827; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000045302; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000046572; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000047215; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000048450; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000049691; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000051246; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000051498; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000051674; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000052783; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000053856; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000054252; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000054520; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000054630; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000054892; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000054920; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000057425; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000059434; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000060288; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000060636; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000061184; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000061535; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000061906; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000062960; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000064037; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000067285; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000067367; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000070704; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000075703; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000089992; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000097271; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000107283; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022751; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029367; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029369; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029373; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029376; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029379; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029380; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029394; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029401; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029403; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029405; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029406; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029407; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029409; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029411; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029412; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029415; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029416; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029423; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029424; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029427; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029436; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029443; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029448; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029449; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029452; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029466; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029469; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029470; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029475; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029476; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029479; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029480; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029483; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029486; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029487; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029489; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029491; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029497; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029504; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029508; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029511; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029512; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029513; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029514; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029517; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029518; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029520; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029522; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029528; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029531; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029542; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029543; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029550; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029554; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029557; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029558; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029559; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029567; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029568; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029569; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029572; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029574; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029576; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029578; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029581; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029584; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029585; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029597; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029605; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029606; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029608; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029609; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029610; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029611; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029616; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029620; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029626; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029634; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029639; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029644; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029645; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029649; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029650; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029653; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029663; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029666; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029667; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029675; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029676; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029677; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029678; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029679; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029680; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029688; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0022716; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029333; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029335; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029339; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029342; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029345; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029346; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029360; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029367; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029369; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029371; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029372; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029373; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029375; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029377; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029378; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029381; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029382; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029389; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029390; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029393; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029402; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029410; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029415; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029416; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029419; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029433; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029436; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029437; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029442; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029443; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029446; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029447; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029450; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029453; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029454; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029456; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029458; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029463; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029470; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029474; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029477; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029478; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029479; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029480; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029483; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029484; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029486; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029488; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029495; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029499; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029510; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029511; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029518; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029522; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029525; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029526; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029527; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029535; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029536; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029540; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029542; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029544; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029546; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029549; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029552; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029553; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029565; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029573; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029574; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029576; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029577; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029578; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029579; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029584; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029594; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029602; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029607; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029612; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029613; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029617; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029618; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029621; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029631; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029634; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029635; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029643; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029644; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029645; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029646; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029648; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029655; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0022689; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029284; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029286; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029290; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029293; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029296; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029297; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029311; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029318; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029320; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029322; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029323; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029324; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029326; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029328; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029331; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029332; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029339; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029340; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029343; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029352; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029359; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029364; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029365; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029368; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029382; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029385; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029386; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029391; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029392; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029395; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029396; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029399; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029402; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029403; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029405; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029407; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029413; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029420; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029424; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029427; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029428; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029429; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029430; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029433; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029434; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029436; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029438; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029444; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029447; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029458; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029459; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029466; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029470; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029473; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029474; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029475; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029483; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029484; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029485; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029488; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029490; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029492; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029494; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029497; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029500; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029501; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029513; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029521; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029522; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029524; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029525; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029526; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029527; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029532; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029536; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029542; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029550; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029555; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029560; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029561; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029565; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029566; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029569; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029579; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029582; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029583; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029591; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029592; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029593; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029594; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029601; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022718; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029344; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029346; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029350; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029353; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029356; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029357; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029371; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029378; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029380; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029382; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029383; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029384; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029386; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029388; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029389; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029392; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029393; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029400; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029401; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029404; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029413; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029420; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029425; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029426; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029429; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029443; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029446; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029447; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029452; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029453; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029456; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029457; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029460; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029463; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029464; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029466; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029468; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029474; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029481; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029485; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029488; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029489; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029490; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029491; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029494; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029495; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029497; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029499; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029505; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029519; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029520; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029527; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029531; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029534; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029535; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029536; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029544; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029545; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029546; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029549; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029551; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029553; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029555; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029558; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029561; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029562; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029574; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029582; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029583; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029585; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029586; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029587; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029588; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029592; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029596; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029603; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029611; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029616; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029621; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029622; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029626; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029627; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029630; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029640; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029643; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029644; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029652; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029653; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029654; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029655; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029656; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029664; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0022483; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029065; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029067; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029071; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029074; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029077; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029078; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029092; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029099; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029101; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029103; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029104; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029105; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029107; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029109; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029110; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029113; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029114; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029121; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029122; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029125; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029134; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029142; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029147; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029148; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029151; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029165; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029168; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029169; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029174; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029175; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029178; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029179; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029182; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029185; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029186; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029188; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029190; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029197; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029204; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029208; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029211; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029212; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029213; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029214; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029217; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029218; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029220; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029222; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029228; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029231; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029242; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029243; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029250; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029257; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029258; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029259; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029267; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029272; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029274; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029278; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029281; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029284; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029285; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029297; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029305; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029306; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029308; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029309; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029310; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029311; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029317; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029321; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029326; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029334; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029339; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029344; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029345; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029349; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029350; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029353; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029363; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029366; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029367; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029375; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029376; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029377; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029378; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029379; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029380; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029387; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0023167; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029797; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029799; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029803; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029806; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029809; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029810; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029824; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029831; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029833; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029835; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029836; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029837; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029839; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029841; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029842; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029845; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029846; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029853; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029854; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029857; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029866; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029874; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029879; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029880; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029883; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029897; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029900; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029901; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029906; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029907; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029911; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029914; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029917; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029918; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029920; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029922; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029928; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029935; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029939; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029942; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029943; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029944; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029945; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029948; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029949; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029951; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029953; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029959; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029962; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029973; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029974; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029981; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029988; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029989; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029990; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029998; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030000; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030003; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030005; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030007; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030009; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030012; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030015; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030016; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030028; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030036; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030037; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030039; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030040; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030041; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030042; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030047; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030057; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030065; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030070; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030075; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030076; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030080; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030081; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030084; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030094; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030097; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030098; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030106; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030107; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030108; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030109; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030110; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030111; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030119; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0022011; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028476; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028478; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028482; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028485; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028488; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028489; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028503; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028510; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028512; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028513; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028514; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028515; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028517; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028519; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028520; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028523; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028524; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028531; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028532; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028535; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028544; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028551; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028556; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028557; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028560; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028574; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028577; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028578; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028583; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028584; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028587; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028588; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028591; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028594; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028595; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028597; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028599; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028605; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028612; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028616; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028619; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028620; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028621; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028622; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028625; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028626; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028628; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028630; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028636; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028639; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028650; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028651; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028658; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028665; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028666; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028667; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028675; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028676; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028677; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028682; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028685; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028686; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028689; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028692; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028693; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028705; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028713; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028714; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028716; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028717; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028718; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028719; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028726; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028734; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028742; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028747; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028752; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028753; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028757; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028758; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028761; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028771; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028774; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028775; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028783; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028784; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028785; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028786; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028789; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028797; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0022453; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029033; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029035; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029039; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029042; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029045; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029046; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029060; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029067; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029069; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029071; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029072; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029073; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029075; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029077; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029078; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029081; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029082; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029089; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029090; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029093; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029102; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029110; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029115; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029116; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029119; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029133; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029136; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029137; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029142; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029143; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029146; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029147; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029150; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029153; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029154; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029156; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029158; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029164; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029171; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029175; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029178; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029179; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029180; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029181; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029184; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029185; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029187; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029191; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029197; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029200; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029211; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029212; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029219; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029223; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029226; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029227; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029228; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029236; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029237; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029241; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029243; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029246; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029247; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029250; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029253; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029254; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029266; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029274; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029275; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029277; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029278; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029279; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029280; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029285; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029291; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029295; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029303; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029308; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029313; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029314; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029318; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029319; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029322; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029332; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029335; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029336; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029344; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029345; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029346; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029347; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029348; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029356; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0022586; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029182; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029184; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029188; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029191; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029194; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029195; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029209; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029216; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029218; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029220; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029221; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029222; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029224; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029226; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029227; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029230; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029231; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029238; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029239; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029242; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029251; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029258; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029263; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029264; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029267; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029281; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029284; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029285; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029290; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029291; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029294; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029295; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029298; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029301; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029302; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029304; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029306; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029311; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029318; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029322; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029325; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029326; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029327; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029328; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029331; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029332; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029334; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029336; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029342; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029357; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029358; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029365; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029369; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029372; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029373; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029374; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029382; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029383; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029384; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029387; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029389; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029392; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029393; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029396; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029399; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029400; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029412; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029420; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029421; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029423; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029424; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029425; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029426; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029432; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029440; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029448; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029453; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029458; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029459; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029463; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029464; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029467; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029477; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029480; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029481; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029489; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029490; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029491; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029493; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029495; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029501; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0022561; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029140; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029142; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029146; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029149; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029152; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029153; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029167; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029174; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029176; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029178; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029179; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029180; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029182; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029184; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029185; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029188; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029189; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029196; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029197; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029200; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029209; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029217; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029222; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029223; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029226; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029240; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029243; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029244; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029249; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029250; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029253; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029254; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029257; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029260; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029261; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029263; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029265; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029270; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029277; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029281; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029284; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029285; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029286; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029287; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029290; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029291; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029293; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029297; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029303; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029306; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029317; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029318; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029325; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029329; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029332; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029333; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029334; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029342; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029343; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029347; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029349; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029351; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029353; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029356; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029359; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029360; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029372; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029380; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029381; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029383; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029384; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029385; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029386; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029392; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029401; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029409; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029414; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029419; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029420; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029424; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029425; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029428; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029438; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029441; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029442; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029450; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029451; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029452; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029453; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029461; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0022653; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0023046; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029267; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029269; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029273; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029276; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029279; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029280; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029294; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029301; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029303; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029305; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029306; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029307; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029309; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029311; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029312; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029315; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029316; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029323; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029324; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029327; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029336; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029343; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029348; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029349; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029352; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029366; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029369; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029370; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029375; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029376; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029379; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029380; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029383; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029386; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029387; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029389; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029391; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029397; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029404; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029408; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029411; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029412; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029413; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029414; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029417; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029418; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029420; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029422; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029428; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029431; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029442; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029443; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029450; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029457; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029458; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029459; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029467; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029469; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029472; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029474; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029476; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029478; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029481; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029484; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029485; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029497; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029505; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029506; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029508; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029509; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029510; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029511; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029516; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029526; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029534; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029540; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029545; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029546; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029550; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029551; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029554; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029564; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029567; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029568; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029576; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029577; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029578; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029579; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029580; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029581; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029589; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022580; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029169; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029171; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029175; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029178; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029181; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029182; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029196; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029203; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029205; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029207; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029208; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029209; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029211; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029213; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029214; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029217; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029218; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029225; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029226; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029229; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029238; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029247; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029252; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029253; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029256; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029270; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029273; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029274; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029279; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029280; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029283; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029284; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029287; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029290; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029291; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029293; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029295; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029300; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029307; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029311; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029314; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029315; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029316; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029317; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029320; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029321; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029323; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029325; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029331; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029334; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029345; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029346; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029353; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029357; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029360; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029361; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029362; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029370; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029371; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029375; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029377; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029381; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029384; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029387; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029388; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029400; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029409; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029411; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029412; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029413; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029414; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029418; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029422; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029428; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029436; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029442; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029448; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029452; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029453; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029456; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029466; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029469; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029470; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029478; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029479; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029480; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029481; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029483; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029490; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0023179; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029831; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029833; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029837; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029840; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029843; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029844; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029858; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029865; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029867; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029869; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029870; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029871; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029873; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029875; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029876; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029879; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029880; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029887; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029888; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029891; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029900; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029907; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029912; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029913; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029916; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029930; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029933; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029934; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029939; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029940; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029943; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029944; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029947; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029950; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029951; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029953; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029955; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029961; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029968; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029972; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029975; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029976; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029977; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029978; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029981; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029982; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029984; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029986; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029992; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029995; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030006; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030007; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030014; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030018; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030021; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030022; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030023; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030031; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030032; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030036; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030038; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030042; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030045; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030048; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030049; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030061; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030069; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030070; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030072; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030073; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030074; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030075; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030081; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030090; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030098; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030103; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030108; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030109; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030113; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030114; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030117; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030127; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030130; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030131; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030139; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030140; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030141; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030142; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030143; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030144; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030152; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021752; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028200; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028202; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028206; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028209; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028212; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028213; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028227; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028234; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028236; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028238; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028239; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028240; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028242; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028244; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028245; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028248; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028249; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028256; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028260; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028269; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028276; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028281; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028282; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028285; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028299; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028302; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028303; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028308; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028309; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028312; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028313; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028316; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028319; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028320; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028322; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028324; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028329; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028336; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028340; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028343; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028344; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028345; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028346; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028349; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028350; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028352; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028354; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028360; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028363; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028374; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028375; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028382; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028389; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028390; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028391; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028399; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028400; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028406; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028408; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028409; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028410; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028413; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028416; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028417; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028429; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028437; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028438; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028440; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028441; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028442; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028443; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028448; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028457; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028465; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028470; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028475; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028476; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028481; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028484; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028495; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028498; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028499; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028508; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028509; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028516; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0022055; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028556; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028558; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028562; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028565; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028568; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028569; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028583; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028590; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028592; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028594; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028595; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028596; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028598; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028600; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028601; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028604; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028605; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028612; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028613; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028616; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028625; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028632; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028637; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028638; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028641; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028655; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028658; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028659; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028664; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028665; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028668; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028669; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028672; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028675; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028676; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028678; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028680; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028686; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028693; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028697; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028700; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028701; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028702; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028703; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028706; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028707; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028709; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028711; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028717; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028720; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028731; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028732; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028739; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028746; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028747; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028748; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028756; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028757; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028762; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028764; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028766; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028769; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028772; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028773; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028785; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028793; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028794; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028796; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028797; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028798; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028799; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028803; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028806; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028814; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028822; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028827; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028832; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028833; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028837; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028838; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028841; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028852; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028855; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028856; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028864; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028865; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028866; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028867; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028876; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000001112; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000005234; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000005238; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000005352; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000012734; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000013693; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000013766; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000013773; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000026845; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000026846; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030980; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030986; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031020; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031061; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031072; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031073; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031097; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031103; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031106; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031108; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031119; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031121; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031122; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031127; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031146; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031160; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031161; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031170; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031181; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031183; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031186; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031201; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000036177; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000036227; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000037370; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000038676; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000039744; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000041266; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000041364; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000041646; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000043475; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000043964; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000050709; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000052224; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000053876; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000056458; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000057258; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000057551; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000057885; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000059349; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000060820; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000061895; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000062315; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000063116; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000066544; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000067150; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000067638; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000067790; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000068110; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000070203; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000072311; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000072818; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000074113; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000074840; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000075858; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000076949; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000077693; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000078804; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000080036; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000080431; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000087181; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000087332; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000087441; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000087820; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000087864; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000094649; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000094783; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000101191; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000101354; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106318; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106321; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113372; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113516; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114603; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114668; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115075; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115076; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115078; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115079; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000117525; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000117536; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000117661; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000117880; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000120094; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000120912; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000121872; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000122204; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000124036; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000126267; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000130417; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000132404; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000132734; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000133316; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000134521; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000134846; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000140076; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000141601; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000142407; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000143436; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000145858; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000146401; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000151104; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000154975; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000160383; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000165512; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000165536; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000166409; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000166769; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000166924; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000167460; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000168707; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000169212; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000169534; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000172435; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000179555; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000179943; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000181102; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000196462; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000197284; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000197315; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000197946; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000199321; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000199617; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000199705; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000200730; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000201166; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000201182; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000201184; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000201275; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000201511; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000201533; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000201571; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000201621; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000201912; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000202138; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000202205; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000202241; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000202520; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000202543; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000202556; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000202567; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000202816; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000202913; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000204965; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0044169; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0070567; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0070569; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0070582; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0070603; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0070611; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0070621; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0070685; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0070738; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0070745; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0070757; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0070764; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0070772; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0070791; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0070797; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0070799; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0070824; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0070836; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0070894; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0070901; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0070915; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0070982; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0071016; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0071047; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0071048; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0071067; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0071164; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0071208; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0071211; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0071250; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0071255; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0071263; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0071265; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0071283; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0071312; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0071317; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0071319; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0071322; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0071360; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0071403; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0071430; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0071448; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0071449; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0071461; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0071472; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0071482; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0071487; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0071492; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0071499; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0071526; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0071559; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0071640; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0071644; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0071674; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0071700; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0071723; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0071727; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0071734; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0071767; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0071776; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0071779; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0071786; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0071800; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0071810; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0071824; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0071838; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0071869; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0071873; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0071972; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0072011; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0072015; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0072023; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0072028; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0072030; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0072035; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0072063; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0072086; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0072124; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0072170; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0072201; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0072223; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0072224; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0072266; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0072269; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0072287; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0072356; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0072368; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0072371; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0072395; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0072397; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0072398; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0072399; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0072403; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0072404; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0072416; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0044143; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0070645; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0070647; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0070660; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0070681; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0070689; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0070700; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0070763; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0070817; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0070824; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0070836; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0070843; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0070851; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0070870; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0070876; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0070878; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0070903; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0070915; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0070973; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0070980; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0070994; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0071065; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0071100; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0071131; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0071132; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0071151; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0071250; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0071294; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0071297; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0071337; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0071342; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0071350; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0071352; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0071370; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0071399; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0071404; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0071406; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0071408; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0071437; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0071480; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0071507; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0071525; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0071526; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0071538; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0071549; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0071559; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0071564; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0071569; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0071576; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0071605; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0071639; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0071727; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0071731; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0071760; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0071786; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0071809; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0071813; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0071820; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0071855; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0071864; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0071875; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0071889; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0071899; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0071913; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0071927; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0071956; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0071960; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0072056; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0072095; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0072099; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0072107; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0072112; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0072114; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0072119; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0072147; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0072208; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0072253; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0072284; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0072306; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0072307; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0072349; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0072352; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0072370; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0072439; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0072451; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0072454; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0072478; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0072480; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0072481; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0072482; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0072488; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0072500; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0044115; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0070557; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0070560; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0070573; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0070594; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0070602; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0070613; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0070677; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0070729; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0070736; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0070748; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0070755; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0070763; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0070782; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0070788; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0070802; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0070814; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0070874; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0070881; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0070895; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0070966; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0071006; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0071037; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0071038; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0071057; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0071157; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0071201; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0071204; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0071243; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0071248; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0071256; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0071258; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0071276; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0071305; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0071310; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0071312; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0071315; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0071353; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0071396; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0071423; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0071441; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0071442; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0071454; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0071465; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0071475; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0071480; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0071485; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0071492; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0071520; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0071553; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0071637; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0071641; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0071670; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0071696; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0071719; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0071723; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0071730; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0071763; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0071772; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0071775; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0071783; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0071797; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0071807; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0071821; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0071835; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0071866; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0071870; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0071970; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0072009; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0072013; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0072021; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0072026; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0072028; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0072033; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0072059; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0072082; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0072122; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0072168; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0072200; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0072222; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0072223; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0072266; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0072269; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0072287; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0072357; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0072369; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0072372; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0072396; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0072398; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0072399; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0072403; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0072414; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0044119; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0070568; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0070571; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0070584; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0070605; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0070613; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0070625; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0070690; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0070742; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0070749; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0070761; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0070768; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0070776; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0070795; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0070801; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0070803; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0070828; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0070840; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0070898; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0070905; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0070919; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0070990; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0071028; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0071058; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0071059; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0071079; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0071178; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0071222; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0071225; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0071264; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0071269; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0071277; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0071279; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0071297; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0071326; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0071331; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0071333; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0071336; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0071374; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0071417; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0071444; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0071462; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0071463; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0071475; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0071486; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0071496; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0071501; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0071506; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0071513; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0071541; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0071657; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0071662; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0071691; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0071717; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0071737; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0071741; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0071748; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0071781; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0071790; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0071793; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0071801; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0071815; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0071825; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0071839; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0071853; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0071884; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0071888; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0071987; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0072026; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0072030; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0072038; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0072043; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0072045; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0072050; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0072075; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0072098; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0072139; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0072185; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0072216; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0072235; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0072236; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0072279; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0072282; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0072300; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0072369; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0072381; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0072384; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0072408; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0072410; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0072411; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0072412; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0072416; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0072428; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0043861; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0070215; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0070218; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0070231; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0070252; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0070260; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0070272; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0070336; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0070388; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0070395; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0070407; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0070414; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0070422; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0070441; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0070447; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0070449; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0070474; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0070486; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0070544; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0070551; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0070565; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0070636; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0070673; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0070704; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0070705; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0070724; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0070822; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0070866; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0070869; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0070908; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0070913; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0070921; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0070923; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0070941; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0070970; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0070975; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0070977; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0070980; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0071019; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0071062; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0071089; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0071107; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0071108; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0071120; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0071131; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0071141; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0071146; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0071151; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0071158; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0071185; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0071218; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0071303; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0071307; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0071336; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0071381; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0071385; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0071392; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0071425; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0071444; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0071458; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0071481; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0071495; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0071524; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0071528; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0071627; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0071666; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0071670; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0071678; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0071683; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0071685; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0071690; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0071719; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0071742; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0071782; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0071827; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0071859; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0071880; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0071881; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0071923; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0071926; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0071944; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0072012; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0072023; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0072026; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0072050; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0072052; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0072053; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0072054; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0072058; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0072059; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0072070; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0044604; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0071046; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0071049; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0071062; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0071083; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0071091; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0071101; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0071165; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0071218; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0071225; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0071237; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0071244; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0071252; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0071271; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0071277; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0071279; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0071304; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0071316; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0071375; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0071382; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0071399; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0071469; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0071512; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0071543; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0071544; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0071563; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0071660; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0071704; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0071707; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0071745; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0071750; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0071759; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0071777; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0071804; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0071809; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0071811; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0071814; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0071852; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0071895; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0071922; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0071940; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0071941; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0071953; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0071964; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0071974; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0071979; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0071984; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0071991; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0072018; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0072051; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0072136; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0072140; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0072169; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0072214; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0072217; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0072224; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0072257; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0072267; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0072274; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0072288; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0072298; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0072312; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0072326; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0072357; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0072361; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0072458; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0072495; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0072499; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0072507; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0072512; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0072514; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0072519; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0072546; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0072604; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0072650; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0072681; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0072700; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0072701; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0072743; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0072746; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0072764; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0072832; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0072844; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0072847; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0072870; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0072872; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0072873; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0072874; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0072878; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0072879; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0072891; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0043976; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0070749; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0070752; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0070766; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0070787; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0070795; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0070805; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0070871; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0070923; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0070930; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0070941; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0070948; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0070956; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0070975; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0070981; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0070983; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0071008; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0071020; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0071078; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0071085; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0071100; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0071172; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0071205; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0071236; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0071237; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0071256; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0071352; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0071396; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0071400; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0071439; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0071444; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0071453; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0071456; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0071475; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0071505; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0071511; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0071513; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0071515; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0071551; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0071597; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0071624; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0071643; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0071644; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0071656; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0071667; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0071677; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0071682; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0071689; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0071696; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0071724; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0071757; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0071841; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0071845; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0071875; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0071921; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0071925; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0071932; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0071965; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0071974; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0071976; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0071997; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0072019; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0072025; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0072040; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0072067; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0072071; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0072169; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0072210; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0072214; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0072222; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0072227; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0072229; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0072236; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0072266; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0072325; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0072373; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0072406; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0072428; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0072429; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0072472; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0072475; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0072494; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0072556; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0072569; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0072572; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0072596; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0072597; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0072598; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0072599; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0072605; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0072617; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0043772; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0070155; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0070158; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0070171; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0070192; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0070200; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0070211; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0070276; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0070328; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0070335; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0070347; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0070354; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0070362; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0070381; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0070387; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0070389; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0070414; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0070426; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0070484; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0070491; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0070505; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0070575; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0070611; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0070642; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0070643; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0070661; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0070760; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0070804; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0070807; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0070848; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0070853; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0070861; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0070863; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0070881; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0070910; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0070915; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0070917; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0070920; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0070958; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0071001; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0071028; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0071046; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0071047; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0071059; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0071070; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0071080; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0071085; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0071090; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0071099; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0071127; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0071160; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0071248; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0071252; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0071281; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0071307; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0071329; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0071333; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0071340; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0071373; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0071382; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0071393; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0071407; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0071426; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0071432; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0071446; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0071477; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0071481; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0071580; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0071619; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0071623; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0071631; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0071636; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0071638; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0071643; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0071670; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0071697; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0071731; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0071777; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0071809; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0071830; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0071831; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0071873; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0071876; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0071894; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0071963; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0071975; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0071978; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0072002; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0072004; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0072005; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0072006; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0072010; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0072021; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0043928; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0070292; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0070295; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0070308; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0070329; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0070337; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0070349; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0070413; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0070465; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0070472; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0070484; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0070491; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0070499; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0070518; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0070524; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0070526; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0070551; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0070563; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0070621; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0070628; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0070642; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0070713; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0070750; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0070781; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0070782; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0070802; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0070901; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0070945; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0070948; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0070989; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0070994; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0071002; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0071004; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0071022; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0071051; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0071056; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0071058; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0071061; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0071096; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0071139; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0071166; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0071184; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0071185; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0071197; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0071208; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0071218; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0071223; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0071228; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0071235; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0071263; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0071386; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0071390; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0071419; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0071445; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0071468; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0071471; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0071478; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0071511; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0071520; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0071523; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0071531; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0071545; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0071564; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0071572; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0071586; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0071617; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0071621; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0071720; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0071758; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0071760; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0071768; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0071773; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0071775; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0071780; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0071808; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0071870; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0071916; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0071948; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0071969; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0071970; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0072012; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0072015; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0072033; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0072101; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0072113; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0072116; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0072140; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0072142; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0072143; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0072148; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0072150; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0072159; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0043884; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0070205; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0070207; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0070220; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0070241; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0070249; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0070261; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0070325; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0070377; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0070384; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0070396; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0070403; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0070411; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0070430; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0070436; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0070438; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0070463; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0070475; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0070533; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0070540; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0070552; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0070623; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0070661; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0070691; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0070692; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0070712; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0070810; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0070854; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0070857; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0070898; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0070903; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0070910; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0070912; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0070930; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0070958; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0070963; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0070965; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0070968; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0071005; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0071046; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0071073; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0071091; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0071092; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0071104; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0071115; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0071125; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0071130; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0071135; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0071144; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0071172; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0071205; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0071288; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0071292; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0071321; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0071347; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0071369; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0071372; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0071379; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0071412; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0071421; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0071432; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0071446; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0071456; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0071470; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0071484; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0071515; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0071519; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0071616; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0071655; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0071659; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0071667; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0071672; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0071674; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0071679; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0071707; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0071772; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0071818; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0071849; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0071871; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0071872; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0071913; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0071916; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0071934; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0072003; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0072015; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0072018; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0072041; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0072043; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0072044; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0072045; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0072059; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0044003; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0045357; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0070368; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0070370; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0070383; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0070404; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0070412; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0070422; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0070486; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0070539; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0070546; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0070558; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0070565; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0070573; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0070592; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0070598; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0070600; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0070625; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0070637; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0070695; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0070702; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0070715; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0070786; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0070821; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0070851; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0070852; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0070868; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0070965; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0071009; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0071012; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0071051; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0071056; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0071064; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0071066; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0071084; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0071113; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0071118; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0071120; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0071123; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0071160; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0071204; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0071231; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0071249; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0071250; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0071262; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0071273; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0071283; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0071288; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0071293; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0071300; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0071327; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0071360; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0071443; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0071448; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0071478; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0071523; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0071526; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0071533; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0071566; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0071576; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0071586; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0071600; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0071610; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0071623; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0071637; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0071667; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0071671; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0071769; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0071806; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0071810; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0071818; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0071823; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0071825; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0071830; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0071857; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0071921; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0071967; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0071999; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0072020; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0072021; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0072063; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0072066; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0072084; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0072152; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0072165; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0072168; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0072192; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0072194; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0072195; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0072196; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0072200; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0072201; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0072213; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0043865; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0070230; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0070233; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0070246; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0070267; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0070275; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0070287; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0070348; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0070400; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0070407; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0070419; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0070426; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0070434; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0070453; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0070459; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0070461; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0070486; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0070498; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0070556; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0070563; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0070577; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0070648; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0070691; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0070722; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0070723; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0070743; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0070841; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0070885; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0070888; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0070929; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0070934; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0070942; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0070944; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0070962; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0070991; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0070996; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0070998; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0071001; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0071037; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0071080; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0071107; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0071125; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0071126; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0071138; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0071149; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0071159; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0071164; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0071169; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0071176; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0071203; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0071236; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0071311; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0071315; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0071344; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0071370; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0071392; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0071396; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0071402; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0071435; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0071444; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0071454; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0071468; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0071495; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0071509; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0071543; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0071547; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0071644; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0071686; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0071693; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0071698; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0071700; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0071705; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0071730; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0071754; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0071793; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0071839; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0071871; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0071895; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0071937; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0071940; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0071958; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0072022; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0072035; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0072038; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0072062; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0072064; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0072065; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0072066; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0072071; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0072082; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0044658; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0071249; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0071251; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0071264; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0071285; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0071293; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0071303; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0071366; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0071419; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0071426; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0071438; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0071445; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0071453; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0071472; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0071478; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0071480; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0071505; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0071517; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0071575; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0071582; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0071596; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0071666; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0071704; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0071736; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0071737; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0071754; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0071852; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0071896; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0071899; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0071939; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0071944; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0071952; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0071954; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0071972; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0072001; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0072006; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0072008; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0072011; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0072050; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0072093; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0072120; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0072138; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0072139; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0072151; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0072162; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0072172; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0072177; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0072182; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0072189; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0072216; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0072249; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0072332; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0072336; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0072365; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0072391; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0072414; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0072417; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0072424; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0072457; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0072466; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0072477; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0072491; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0072515; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0072529; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0072558; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0072562; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0072659; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0072698; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0072702; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0072710; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0072715; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0072717; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0072722; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0072749; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0072814; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0072860; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0072891; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0072910; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0072911; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0072953; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0072956; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0072974; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0073043; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0073055; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0073058; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0073082; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0073084; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0073085; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0073086; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0073090; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0073092; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0073105; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0043558; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0070221; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0070223; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0070237; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0070256; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0070264; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0070273; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0070340; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0070394; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0070401; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0070413; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0070420; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0070428; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0070447; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0070453; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0070455; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0070480; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0070492; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0070550; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0070573; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0070642; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0070676; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0070707; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0070708; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0070726; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0070823; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0070867; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0070871; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0070909; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0070913; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0070923; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0070926; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0070945; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0070975; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0070981; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0070983; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0070985; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0071021; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0071067; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0071094; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0071113; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0071114; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0071126; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0071137; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0071147; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0071152; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0071157; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0071164; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0071193; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0071226; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0071311; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0071315; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0071345; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0071391; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0071395; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0071402; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0071435; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0071444; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0071468; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0071478; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0071490; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0071495; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0071509; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0071538; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0071542; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0071640; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0071681; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0071685; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0071693; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0071698; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0071700; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0071706; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0071732; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0071796; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0071843; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0071876; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0071899; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0071900; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0071944; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0071962; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0072032; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0072044; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0072047; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0072072; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0072073; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0072084; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0043243; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0069373; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0069376; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0069389; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0069410; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0069418; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0069428; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0069490; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0069542; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0069549; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0069561; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0069568; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0069576; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0069595; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0069601; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0069603; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0069628; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0069640; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0069698; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0069705; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0069722; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0069793; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0069827; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0069858; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0069859; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0069878; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0069976; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0070020; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0070023; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0070063; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0070068; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0070076; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0070078; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0070096; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0070125; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0070130; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0070132; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0070134; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0070172; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0070215; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0070242; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0070260; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0070261; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0070273; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0070284; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0070294; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0070299; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0070304; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0070312; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0070339; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0070372; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0070455; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0070459; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0070489; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0070532; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0070536; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0070543; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0070575; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0070584; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0070605; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0070615; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0070631; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0070645; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0070676; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0070680; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0070777; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0070816; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0070820; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0070828; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0070833; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0070835; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0070840; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0070858; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0070868; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0070928; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0070974; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0071005; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0071026; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0071027; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0071070; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0071073; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0071091; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0071160; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0071171; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0071174; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0071198; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0071200; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0071201; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0071202; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0071218; mus_musculus_wsbeij.
DR   PubMed; 12040188.
CC   This is the July 2001 combined whole genome shotgun assembly of Mus
CC   musculus. It contains 27 million Celera reads on four Mus musculus
CC   strains (129X1/SvJ, 129S1/SvImJ, DBA/2J and A/J), 13 million reads
CC   on C57BL/6J from the NCBI Trace Archive, 0.4 million BAC end
CC   sequences from TIGR, and unfinished and finished BACs pulled from
CC   NCBI (Nature 2002. 420:520-562). The assembly process relied on
CC   Celera's paired reads and BAC end reads for long range order and
CC   orientation. Its scaffolds were mapped to chromosomes using STS
CC   maps. For more detailed information about whole genome sequencing
CC   and Celera's assembly process, please refer to Venter, J.C. et al.
CC   Science 2001. 291:1304-1351.
CC   This version of genes, transcripts, and proteins was
CC   computationally created in November 2001 from the whole-genome
CC   mapping of transcript and protein sequences on the Celera mouse
CC   genome assembly by Celera Chromosome Team and Content Systems.  The
CC   data sets used by this annotation process were collected in 2001
CC   and include RefSeq (NM_ from mouse and human) sequences, GenBank
CC   mRNA and dbEST sequences, mammalian SwissProt sequences,  and NRAA
CC   sequences (all mouse unless noted otherwise).  The initial gene set
CC   was manually curated between 2002 and 2003. Subsequently, automated
CC   annotation updates were performed.  The CDS of each transcript was
CC   manually or computationally defined by either the longest
CC   ATG-to-Stop or the longest open reading frame. All CDSs
CC   corresponding to the longest open reading frames with no starting
CC   ATG were flagged as partial.
FH   Key             Location/Qualifiers
FT   source          1..61163717
FT                   /organism="Mus musculus"
FT                   /chromosome="5"
FT                   /strain="mixed"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   gene            <1289..3427
FT                   /locus_tag="mCG_113006"
FT                   /note="gene_id=mCG113006.0"
FT   mRNA            join(<1289..1434,2070..2253,2994..3427)
FT                   /locus_tag="mCG_113006"
FT                   /product="mCG113006"
FT                   /note="gene_id=mCG113006.0 transcript_id=mCT114083.0
FT                   created on 01-OCT-2002"
FT   CDS             join(<1289..1434,2070..2253,2994..3170)
FT                   /codon_start=1
FT                   /locus_tag="mCG_113006"
FT                   /product="mCG113006"
FT                   /note="gene_id=mCG113006.0 transcript_id=mCT114083.0
FT                   protein_id=mCP64658.0"
FT                   /protein_id="EDL37212.1"
FT                   CPSWE"
FT   assembly_gap    3447..3466
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4519..7891
FT                   /estimated_length=3373
FT                   /gap_type="unknown"
FT   assembly_gap    109174..109193
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    115070..115089
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    116519..116538
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    120728..120747
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    138794..141632
FT                   /estimated_length=2839
FT                   /gap_type="unknown"
FT   gene            145920..151577
FT                   /locus_tag="mCG_113008"
FT                   /note="gene_id=mCG113008.0"
FT   mRNA            join(145920..146135,147123..147282,148553..148684,
FT                   149320..149503,150247..151577)
FT                   /locus_tag="mCG_113008"
FT                   /product="mCG113008, transcript variant mCT114085"
FT                   /note="gene_id=mCG113008.0 transcript_id=mCT114085.0
FT                   created on 01-OCT-2002"
FT   CDS             join(145997..146135,147123..147282,148553..148684,
FT                   149320..149503,150247..150423)
FT                   /codon_start=1
FT                   /locus_tag="mCG_113008"
FT                   /product="mCG113008, isoform CRA_a"
FT                   /note="gene_id=mCG113008.0 transcript_id=mCT114085.0
FT                   protein_id=mCP64674.1 isoform=CRA_a"
FT                   /protein_id="EDL37213.1"
FT   mRNA            join(<148553..148684,150247..151577)
FT                   /locus_tag="mCG_113008"
FT                   /product="mCG113008, transcript variant mCT174525"
FT                   /note="gene_id=mCG113008.0 transcript_id=mCT174525.0
FT                   created on 01-OCT-2002"
FT   CDS             join(<148554..148684,150247..150448)
FT                   /codon_start=1
FT                   /locus_tag="mCG_113008"
FT                   /product="mCG113008, isoform CRA_b"
FT                   /note="gene_id=mCG113008.0 transcript_id=mCT174525.0
FT                   protein_id=mCP97444.0 isoform=CRA_b"
FT                   /protein_id="EDL37214.1"
FT                   YRGSHG"
FT   assembly_gap    166355..166554
FT                   /estimated_length=200
FT                   /gap_type="unknown"
FT   assembly_gap    186777..186796
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    193335..193421
FT                   /estimated_length=87
FT                   /gap_type="unknown"
FT   assembly_gap    195679..195880
FT                   /estimated_length=202
FT                   /gap_type="unknown"
FT   assembly_gap    206680..206744
FT                   /estimated_length=65
FT                   /gap_type="unknown"
FT   assembly_gap    220502..221922
FT                   /estimated_length=1421
FT                   /gap_type="unknown"
FT   gene            241921..243715
FT                   /pseudo
FT                   /locus_tag="mCG_12038"
FT                   /note="gene_id=mCG12038.1"
FT   mRNA            241921..243715
FT                   /pseudo
FT                   /locus_tag="mCG_12038"
FT                   /note="gene_id=mCG12038.1 transcript_id=mCT12420.1 created
FT                   on 01-OCT-2002"
FT   assembly_gap    253941..253960
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    267227..267246
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    272304..273895
FT                   /estimated_length=1592
FT                   /gap_type="unknown"
FT   assembly_gap    317327..319871
FT                   /estimated_length=2545
FT                   /gap_type="unknown"
FT   gene            complement(339298..>372358)
FT                   /locus_tag="mCG_1046109"
FT                   /note="gene_id=mCG1046109.2"
FT   mRNA            complement(join(339298..339592,358762..359132,
FT                   362333..362468,369628..369702,372285..>372358))
FT                   /locus_tag="mCG_1046109"
FT                   /product="mCG1046109, transcript variant mCT180213"
FT                   /note="gene_id=mCG1046109.2 transcript_id=mCT180213.0
FT                   created on 18-FEB-2003"
FT   mRNA            complement(join(339300..339592,358762..358910,
FT                   369424..369702,372285..>372324))
FT                   /locus_tag="mCG_1046109"
FT                   /product="mCG1046109, transcript variant mCT174531"
FT                   /note="gene_id=mCG1046109.2 transcript_id=mCT174531.0
FT                   created on 18-FEB-2003"
FT   CDS             complement(join(339472..339592,358762..358910,
FT                   369424..>369528))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1046109"
FT                   /product="mCG1046109, isoform CRA_a"
FT                   /note="gene_id=mCG1046109.2 transcript_id=mCT174531.0
FT                   protein_id=mCP97450.0 isoform=CRA_a"
FT                   /protein_id="EDL37215.1"
FT   CDS             complement(join(339472..339592,358762..>358916))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1046109"
FT                   /product="mCG1046109, isoform CRA_b"
FT                   /note="gene_id=mCG1046109.2 transcript_id=mCT180213.0
FT                   protein_id=mCP103135.0 isoform=CRA_b"
FT                   /protein_id="EDL37216.1"
FT   assembly_gap    345766..345916
FT                   /estimated_length=151
FT                   /gap_type="unknown"
FT   assembly_gap    349289..349308
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            complement(join(353970..354370,358762..359132,
FT                   372285..>372334))
FT                   /locus_tag="mCG_1046109"
FT                   /product="mCG1046109, transcript variant mCT163813"
FT                   /note="gene_id=mCG1046109.2 transcript_id=mCT163813.0
FT                   created on 18-FEB-2003"
FT   CDS             complement(354084..>354341)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1046109"
FT                   /product="mCG1046109, isoform CRA_c"
FT                   /note="gene_id=mCG1046109.2 transcript_id=mCT163813.0
FT                   protein_id=mCP65111.0 isoform=CRA_c"
FT                   /protein_id="EDL37217.1"
FT   assembly_gap    381835..382973
FT                   /estimated_length=1139
FT                   /gap_type="unknown"
FT   assembly_gap    429277..429296
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    446886..446905
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    448029..448048
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    487683..487848
FT                   /estimated_length=166
FT                   /gap_type="unknown"
FT   assembly_gap    556435..556770
FT                   /estimated_length=336
FT                   /gap_type="unknown"
FT   assembly_gap    608973..608992
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    610434..610453
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    623424..623460
FT                   /estimated_length=37
FT                   /gap_type="unknown"
FT   assembly_gap    631235..631254
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    634479..634538
FT                   /estimated_length=60
FT                   /gap_type="unknown"
FT   assembly_gap    667871..667890
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(708921..709340)
FT                   /pseudo
FT                   /locus_tag="mCG_61063"
FT                   /note="gene_id=mCG61063.2"
FT   mRNA            complement(708921..709340)
FT                   /pseudo
FT                   /locus_tag="mCG_61063"
FT                   /note="gene_id=mCG61063.2 transcript_id=mCT61246.2 created
FT                   on 14-OCT-2002"
FT   assembly_gap    723145..723164
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    727866..727980
FT                   /estimated_length=115
FT                   /gap_type="unknown"
FT   assembly_gap    762530..762549
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    876236..876255
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(886973..888600)
FT                   /pseudo
FT                   /locus_tag="mCG_1046046"
FT                   /note="gene_id=mCG1046046.1"
FT   mRNA            complement(join(886973..887343,888265..888600))
FT                   /pseudo
FT                   /locus_tag="mCG_1046046"
FT                   /note="gene_id=mCG1046046.1 transcript_id=mCT163750.1
FT                   created on 14-OCT-2002"
FT   assembly_gap    895385..895404
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    929044..929444
FT                   /estimated_length=401
FT                   /gap_type="unknown"
FT   gene            930717..930945
FT                   /pseudo
FT                   /locus_tag="mCG_141313"
FT                   /note="gene_id=mCG141313.0"
FT   mRNA            930717..930945
FT                   /pseudo
FT                   /locus_tag="mCG_141313"
FT                   /note="gene_id=mCG141313.0 transcript_id=mCT174532.0
FT                   created on 14-OCT-2002"
FT   assembly_gap    933368..933387
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    984163..984182
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    993131..993198
FT                   /estimated_length=68
FT                   /gap_type="unknown"
FT   assembly_gap    1012239..1012258
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1015657..1015676
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1071961..1071999
FT                   /estimated_length=39
FT                   /gap_type="unknown"
FT   assembly_gap    1104882..1104992
FT                   /estimated_length=111
FT                   /gap_type="unknown"
FT   assembly_gap    1106778..1110492
FT                   /estimated_length=3715
FT                   /gap_type="unknown"
FT   assembly_gap    1120206..1120225
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <1141429..1604623
FT                   /gene="Dpp6"
FT                   /locus_tag="mCG_113122"
FT                   /note="gene_id=mCG113122.2"
FT   mRNA            join(<1141429..1141706,1256417..1256531,1272598..1272696,
FT                   1324213..1324307,1346059..1346133,1414871..1414923,
FT                   1434988..1435069,1476210..1476330,1508829..1508983,
FT                   1511959..1512056,1529842..1529965,1531365..1531403,
FT                   1539258..1539365,1541101..1541192,1542386..1542433,
FT                   1544061..1544179,1574495..1574542,1587067..1587165,
FT                   1590225..1590294,1592024..1592218,1596114..1596168,
FT                   1598713..1598824,1600341..1600399,1601040..1601112,
FT                   1601209..1601282,1603276..1604152)
FT                   /gene="Dpp6"
FT                   /locus_tag="mCG_113122"
FT                   /product="dipeptidylpeptidase 6, transcript variant
FT                   mCT193625"
FT                   /note="gene_id=mCG113122.2 transcript_id=mCT193625.0
FT                   created on 09-MAR-2004"
FT   mRNA            join(<1141430..1141706,1256417..1256531,1272598..1272696,
FT                   1324213..1324307,1346059..1346133,1414871..1414923,
FT                   1434988..1435069,1476210..1476330,1508829..1508983,
FT                   1511959..1512056,1529842..1529965,1539258..1539365,
FT                   1541101..1541192,1542386..1542433,1544061..1544179,
FT                   1574495..1574542,1587067..1587165,1590225..1590294,
FT                   1592024..1592218,1596114..1596168,1598713..1598824,
FT                   1600341..1600399,1601040..1601112,1601209..1601282,
FT                   1603276..1604623)
FT                   /gene="Dpp6"
FT                   /locus_tag="mCG_113122"
FT                   /product="dipeptidylpeptidase 6, transcript variant
FT                   mCT114200"
FT                   /note="gene_id=mCG113122.2 transcript_id=mCT114200.1
FT                   created on 01-OCT-2002"
FT   CDS             join(<1141533..1141706,1256417..1256531,1272598..1272696,
FT                   1324213..1324307,1346059..1346133,1414871..1414923,
FT                   1434988..1435069,1476210..1476330,1508829..1508983,
FT                   1511959..1512056,1529842..1529965,1531365..1531403,
FT                   1539258..1539365,1541101..1541192,1542386..1542433,
FT                   1544061..1544179,1574495..1574542,1587067..1587165,
FT                   1590225..1590294,1592024..1592218,1596114..1596168,
FT                   1598713..1598824,1600341..1600399,1601040..1601112,
FT                   1601209..1601282,1603276..1603422)
FT                   /codon_start=1
FT                   /gene="Dpp6"
FT                   /locus_tag="mCG_113122"
FT                   /product="dipeptidylpeptidase 6, isoform CRA_a"
FT                   /note="gene_id=mCG113122.2 transcript_id=mCT193625.0
FT                   protein_id=mCP114557.0 isoform=CRA_a"
FT                   /protein_id="EDL37218.1"
FT   assembly_gap    1176045..1182338
FT                   /estimated_length=6294
FT                   /gap_type="unknown"
FT   assembly_gap    1185456..1185475
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1216510..1216906
FT                   /estimated_length=397
FT                   /gap_type="unknown"
FT   assembly_gap    1238223..1238242
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(<1256417..1256531,1272598..1272696,1324213..1324307,
FT                   1346059..1346133,1414871..1414923,1434988..1435069,
FT                   1476210..1476330,1508829..1508983,1511959..1512056,
FT                   1529842..1529965,1539258..1539365,1541101..1541192,
FT                   1542386..1542433,1544061..1544179,1574495..1574542,
FT                   1587067..1587165,1590225..1590294,1592024..1592218,
FT                   1596114..1596168,1598713..1598824,1600341..1600399,
FT                   1601040..1601112,1601209..1601282,1603276..1603422)
FT                   /codon_start=1
FT                   /gene="Dpp6"
FT                   /locus_tag="mCG_113122"
FT                   /product="dipeptidylpeptidase 6, isoform CRA_b"
FT                   /note="gene_id=mCG113122.2 transcript_id=mCT114200.1
FT                   protein_id=mCP65324.1 isoform=CRA_b"
FT                   /protein_id="EDL37219.1"
FT                   RVQDKLPTATAKEEEEED"
FT   mRNA            join(<1256498..1256531,1272598..1272696,1324213..1324307,
FT                   1346059..1346133,1434988..>1435072)
FT                   /gene="Dpp6"
FT                   /locus_tag="mCG_113122"
FT                   /product="dipeptidylpeptidase 6, transcript variant
FT                   mCT173992"
FT                   /note="gene_id=mCG113122.2 transcript_id=mCT173992.0
FT                   created on 01-OCT-2002"
FT   CDS             join(<1256498..1256531,1272598..1272696,1324213..1324307,
FT                   1346059..1346133,1434988..>1435072)
FT                   /codon_start=1
FT                   /gene="Dpp6"
FT                   /locus_tag="mCG_113122"
FT                   /product="dipeptidylpeptidase 6, isoform CRA_c"
FT                   /note="gene_id=mCG113122.2 transcript_id=mCT173992.0
FT                   protein_id=mCP96911.0 isoform=CRA_c"
FT                   /protein_id="EDL37220.1"
FT   assembly_gap    1274222..1274557
FT                   /estimated_length=336
FT                   /gap_type="unknown"
FT   assembly_gap    1300356..1300376
FT                   /estimated_length=21
FT                   /gap_type="unknown"
FT   assembly_gap    1301091..1301190
FT                   /estimated_length=100
FT                   /gap_type="unknown"
FT   assembly_gap    1341227..1341246
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1342720..1342739
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1344352..1344371
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1346488..1346507
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1348639..1348658
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1372633..1378590)
FT                   /locus_tag="mCG_56332"
FT                   /note="gene_id=mCG56332.2"
FT   mRNA            complement(join(1372633..1373960,1374705..1374888,
FT                   1375524..1375667,1376902..1377061,1378057..1378590))
FT                   /locus_tag="mCG_56332"
FT                   /product="mCG56332"
FT                   /note="gene_id=mCG56332.2 transcript_id=mCT56515.2 created
FT                   on 01-OCT-2002"
FT   CDS             complement(join(1373784..1373960,1374705..1374888,
FT                   1375524..1375667,1376902..1377061,1378057..1378153))
FT                   /codon_start=1
FT                   /locus_tag="mCG_56332"
FT                   /product="mCG56332"
FT                   /note="gene_id=mCG56332.2 transcript_id=mCT56515.2
FT                   protein_id=mCP24528.2"
FT                   /protein_id="EDL37221.1"
FT   assembly_gap    1407209..1407402
FT                   /estimated_length=194
FT                   /gap_type="unknown"
FT   assembly_gap    1419518..1420144
FT                   /estimated_length=627
FT                   /gap_type="unknown"
FT   assembly_gap    1439754..1439773
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1440611..1440630
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1442240..1442575
FT                   /estimated_length=336
FT                   /gap_type="unknown"
FT   assembly_gap    1457679..1457734
FT                   /estimated_length=56
FT                   /gap_type="unknown"
FT   assembly_gap    1461023..1461109
FT                   /estimated_length=87
FT                   /gap_type="unknown"
FT   assembly_gap    1498763..1498872
FT                   /estimated_length=110
FT                   /gap_type="unknown"
FT   assembly_gap    1524226..1524678
FT                   /estimated_length=453
FT                   /gap_type="unknown"
FT   assembly_gap    1576153..1576172
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1576960..1577053
FT                   /estimated_length=94
FT                   /gap_type="unknown"
FT   assembly_gap    1593350..1593369
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1605091..1605110
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1609979..1609998
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1620546..1671369)
FT                   /gene="Paxip1"
FT                   /locus_tag="mCG_7319"
FT                   /note="gene_id=mCG7319.1"
FT   mRNA            complement(join(1620546..1620999,1622611..1622673,
FT                   1622755..1622830,1622919..1623053,1627845..1627945,
FT                   1629985..1630153,1631517..1631619,1633258..1633328,
FT                   1635726..1635769,1637238..1637422,1638177..1638298,
FT                   1638780..1638917,1640384..1640479,1643945..1644039,
FT                   1644398..1645097,1651823..1652443,1655385..1655498,
FT                   1661241..1661304,1663549..1663592,1668462..1668596,
FT                   1671018..1671369))
FT                   /gene="Paxip1"
FT                   /locus_tag="mCG_7319"
FT                   /product="PAX interacting (with transcription-activation
FT                   domain) protein 1, transcript variant mCT6358"
FT                   /note="gene_id=mCG7319.1 transcript_id=mCT6358.1 created on
FT                   24-DEC-2002"
FT   CDS             complement(join(1620986..1620999,1622611..1622673,
FT                   1622755..1622830,1622919..1623053,1627845..1627945,
FT                   1629985..1630153,1631517..1631619,1633258..1633328,
FT                   1635726..1635769,1637238..1637422,1638177..1638298,
FT                   1638780..1638917,1640384..1640479,1643945..1644039,
FT                   1644398..1645097,1651823..1652443,1655385..1655498,
FT                   1661241..1661304,1663549..1663592,1668462..1668596,
FT                   1671018..1671098))
FT                   /codon_start=1
FT                   /gene="Paxip1"
FT                   /locus_tag="mCG_7319"
FT                   /product="PAX interacting (with transcription-activation
FT                   domain) protein 1, isoform CRA_a"
FT                   /note="gene_id=mCG7319.1 transcript_id=mCT6358.1
FT                   protein_id=mCP1606.2 isoform=CRA_a"
FT                   /protein_id="EDL37222.1"
FT                   DYESYKFN"
FT   assembly_gap    1623857..1623876
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1629940..1629959
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1631251..1631270
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1649740..1649759
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            complement(join(1652310..1652443,1655385..1655498,
FT                   1660085..1660145,1663549..1663592,1668462..1668596,
FT                   1671018..1671369))
FT                   /gene="Paxip1"
FT                   /locus_tag="mCG_7319"
FT                   /product="PAX interacting (with transcription-activation
FT                   domain) protein 1, transcript variant mCT173439"
FT                   /note="gene_id=mCG7319.1 transcript_id=mCT173439.0 created
FT                   on 24-DEC-2002"
FT   CDS             complement(join(1660112..1660145,1663549..1663592,
FT                   1668462..1668596,1671018..1671098))
FT                   /codon_start=1
FT                   /gene="Paxip1"
FT                   /locus_tag="mCG_7319"
FT                   /product="PAX interacting (with transcription-activation
FT                   domain) protein 1, isoform CRA_b"
FT                   /note="gene_id=mCG7319.1 transcript_id=mCT173439.0
FT                   protein_id=mCP96358.0 isoform=CRA_b"
FT                   /protein_id="EDL37223.1"
FT   assembly_gap    1675185..1675264
FT                   /estimated_length=80
FT                   /gap_type="unknown"
FT   assembly_gap    1681443..1687209
FT                   /estimated_length=5767
FT                   /gap_type="unknown"
FT   gene            1696849..1697771
FT                   /pseudo
FT                   /locus_tag="mCG_51587"
FT                   /note="gene_id=mCG51587.2"
FT   mRNA            1696849..1697771
FT                   /pseudo
FT                   /locus_tag="mCG_51587"
FT                   /note="gene_id=mCG51587.2 transcript_id=mCT51770.2 created
FT                   on 14-OCT-2002"
FT   assembly_gap    1698580..1698926
FT                   /estimated_length=347
FT                   /gap_type="unknown"
FT   gene            1701025..1701942
FT                   /pseudo
FT                   /locus_tag="mCG_1046048"
FT                   /note="gene_id=mCG1046048.1"
FT   mRNA            1701025..1701942
FT                   /pseudo
FT                   /locus_tag="mCG_1046048"
FT                   /note="gene_id=mCG1046048.1 transcript_id=mCT163752.1
FT                   created on 14-OCT-2002"
FT   gene            1721866..1731464
FT                   /gene="Htr5a"
FT                   /locus_tag="mCG_7318"
FT                   /note="gene_id=mCG7318.1"
FT   mRNA            join(1721866..1723108,1731029..1731464)
FT                   /gene="Htr5a"
FT                   /locus_tag="mCG_7318"
FT                   /product="5-hydroxytryptamine (serotonin) receptor 5A"
FT                   /note="gene_id=mCG7318.1 transcript_id=mCT6360.0 created on
FT                   23-SEP-2002"
FT   CDS             join(1722368..1723108,1731029..1731361)
FT                   /codon_start=1
FT                   /gene="Htr5a"
FT                   /locus_tag="mCG_7318"
FT                   /product="5-hydroxytryptamine (serotonin) receptor 5A"
FT                   /note="gene_id=mCG7318.1 transcript_id=mCT6360.0
FT                   protein_id=mCP1605.1"
FT                   /db_xref="GOA:P30966"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR001397"
FT                   /db_xref="InterPro:IPR002231"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:96283"
FT                   /db_xref="UniProtKB/Swiss-Prot:P30966"
FT                   /protein_id="EDL37224.1"
FT                   FNRSYSSAFKVFFSKQQ"
FT   assembly_gap    1726565..1726584
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1738590..1738858
FT                   /estimated_length=269
FT                   /gap_type="unknown"
FT   assembly_gap    1741277..1742242
FT                   /estimated_length=966
FT                   /gap_type="unknown"
FT   assembly_gap    1743885..1743904
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1745525..1745544
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1746214..1747149)
FT                   /pseudo
FT                   /locus_tag="mCG_113121"
FT                   /note="gene_id=mCG113121.0"
FT   mRNA            complement(1746214..1747149)
FT                   /pseudo
FT                   /locus_tag="mCG_113121"
FT                   /note="gene_id=mCG113121.0 transcript_id=mCT114199.0
FT                   created on 01-OCT-2002"
FT   gene            1747149..1747857
FT                   /pseudo
FT                   /locus_tag="mCG_1046020"
FT                   /note="gene_id=mCG1046020.1"
FT   mRNA            1747149..1747857
FT                   /pseudo
FT                   /locus_tag="mCG_1046020"
FT                   /note="gene_id=mCG1046020.1 transcript_id=mCT163724.1
FT                   created on 18-OCT-2002"
FT   assembly_gap    1748667..1748686
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1749237..1749256
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1750581..1750600
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1751644..1751663
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1752977..1755815
FT                   /estimated_length=2839
FT                   /gap_type="unknown"
FT   assembly_gap    1759691..1759710
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1767515..1767534
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1769687..1769706
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1771896..1771915
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1772977..1772996
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1774188..1775488
FT                   /estimated_length=1301
FT                   /gap_type="unknown"
FT   assembly_gap    1779932..1780161
FT                   /estimated_length=230
FT                   /gap_type="unknown"
FT   assembly_gap    1781329..1781348
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1782505..1782524
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1783814..1783833
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1795283..1795572
FT                   /estimated_length=290
FT                   /gap_type="unknown"
FT   assembly_gap    1798770..1799291
FT                   /estimated_length=522
FT                   /gap_type="unknown"
FT   assembly_gap    1800575..1800594
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1802160..1802179
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1806574..1807612
FT                   /estimated_length=1039
FT                   /gap_type="unknown"
FT   assembly_gap    1826385..1826404
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            1858105..1860529
FT                   /pseudo
FT                   /locus_tag="mCG_1046049"
FT                   /note="gene_id=mCG1046049.1"
FT   mRNA            1858105..1860529
FT                   /pseudo
FT                   /locus_tag="mCG_1046049"
FT                   /note="gene_id=mCG1046049.1 transcript_id=mCT163753.1
FT                   created on 14-OCT-2002"
FT   assembly_gap    1871059..1871078
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1877739..1877758
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1881235..1882909)
FT                   /pseudo
FT                   /locus_tag="mCG_49883"
FT                   /note="gene_id=mCG49883.2"
FT   mRNA            complement(1881235..1882909)
FT                   /pseudo
FT                   /locus_tag="mCG_49883"
FT                   /note="gene_id=mCG49883.2 transcript_id=mCT50066.2 created
FT                   on 01-OCT-2002"
FT   assembly_gap    1911765..1912575
FT                   /estimated_length=811
FT                   /gap_type="unknown"
FT   assembly_gap    1931157..1931176
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1935362..1936870)
FT                   /locus_tag="mCG_148309"
FT                   /note="gene_id=mCG148309.0"
FT   mRNA            complement(join(1935362..1936526,1936673..1936870))
FT                   /locus_tag="mCG_148309"
FT                   /product="mCG148309"
FT                   /note="gene_id=mCG148309.0 transcript_id=mCT188572.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(1936185..1936307)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148309"
FT                   /product="mCG148309"
FT                   /note="gene_id=mCG148309.0 transcript_id=mCT188572.0
FT                   protein_id=mCP109223.0"
FT                   /protein_id="EDL37225.1"
FT   assembly_gap    1939761..1939780
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            1952782..1960081
FT                   /gene="Insig1"
FT                   /locus_tag="mCG_7565"
FT                   /note="gene_id=mCG7565.2"
FT   mRNA            join(1952782..1953214,1954966..1955090,1955901..1956067,
FT                   1956481..1956580,1958210..1960081)
FT                   /gene="Insig1"
FT                   /locus_tag="mCG_7565"
FT                   /product="insulin induced gene 1"
FT                   /note="gene_id=mCG7565.2 transcript_id=mCT6465.2 created on
FT                   24-SEP-2002"
FT   CDS             join(1952857..1953214,1954966..1955090,1955901..1956067,
FT                   1956481..1956580,1958210..1958239)
FT                   /codon_start=1
FT                   /gene="Insig1"
FT                   /locus_tag="mCG_7565"
FT                   /product="insulin induced gene 1"
FT                   /note="gene_id=mCG7565.2 transcript_id=mCT6465.2
FT                   protein_id=mCP3948.1"
FT                   /protein_id="EDL37226.1"
FT   assembly_gap    1965752..1965771
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1971765..1971784
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1996154..1996173
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1999468..1999963
FT                   /estimated_length=496
FT                   /gap_type="unknown"
FT   assembly_gap    2042432..2042451
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            2045852..2051511
FT                   /gene="En2"
FT                   /locus_tag="mCG_7563"
FT                   /note="gene_id=mCG7563.1"
FT   mRNA            join(2045852..2046556,2049461..2051511)
FT                   /gene="En2"
FT                   /locus_tag="mCG_7563"
FT                   /product="engrailed 2"
FT                   /note="gene_id=mCG7563.1 transcript_id=mCT6463.1 created on
FT                   16-SEP-2002"
FT   CDS             join(2045899..2046556,2049461..2049777)
FT                   /codon_start=1
FT                   /gene="En2"
FT                   /locus_tag="mCG_7563"
FT                   /product="engrailed 2"
FT                   /note="gene_id=mCG7563.1 transcript_id=mCT6463.1
FT                   protein_id=mCP3913.1"
FT                   /db_xref="GOA:Q3TZM2"
FT                   /db_xref="InterPro:IPR000747"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017970"
FT                   /db_xref="InterPro:IPR019549"
FT                   /db_xref="InterPro:IPR019737"
FT                   /db_xref="InterPro:IPR020479"
FT                   /db_xref="MGI:MGI:95390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TZM2"
FT                   /protein_id="EDL37227.1"
FT   assembly_gap    2057408..2057492
FT                   /estimated_length=85
FT                   /gap_type="unknown"
FT   assembly_gap    2072563..2072582
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(2080178..2125269)
FT                   /gene="9630008K15Rik"
FT                   /locus_tag="mCG_56335"
FT                   /note="gene_id=mCG56335.2"
FT   mRNA            complement(join(2080178..2082779,2086630..2086726,
FT                   2088440..2088643,2125156..2125269))
FT                   /gene="9630008K15Rik"
FT                   /locus_tag="mCG_56335"
FT                   /product="RIKEN cDNA 9630008K15"
FT                   /note="gene_id=mCG56335.2 transcript_id=mCT56518.2 created
FT                   on 14-OCT-2002"
FT   CDS             complement(join(2082742..2082779,2086630..2086726,
FT                   2088440..2088643,2125156..2125254))
FT                   /codon_start=1
FT                   /gene="9630008K15Rik"
FT                   /locus_tag="mCG_56335"
FT                   /product="RIKEN cDNA 9630008K15"
FT                   /note="gene_id=mCG56335.2 transcript_id=mCT56518.2
FT                   protein_id=mCP26978.2"
FT                   /db_xref="InterPro:IPR021852"
FT                   /db_xref="MGI:MGI:2442451"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1C7CYV1"
FT                   /protein_id="EDL37228.1"
FT   assembly_gap    2086968..2086987
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2096432..2096451
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2098847..2098866
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2106942..2106961
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2125328..2125483
FT                   /estimated_length=156
FT                   /gap_type="unknown"
FT   assembly_gap    2136605..2136652
FT                   /estimated_length=48
FT                   /gap_type="unknown"
FT   gene            2197203..2295653
FT                   /locus_tag="mCG_141193"
FT                   /note="gene_id=mCG141193.0"
FT   mRNA            join(2197203..2197420,2211136..2211214,2215848..2215896,
FT                   2217000..2217076,2219022..2219334,2222421..2222540,
FT                   2232452..2232623,2238243..2238451,2242001..2242147,
FT                   2270127..2270207,2271274..2271423,2274392..2275042,
FT                   2288628..2288834,2290944..2291132,2293661..2293749,
FT                   2293942..2295653)
FT                   /locus_tag="mCG_141193"
FT                   /product="mCG141193, transcript variant mCT173724"
FT                   /note="gene_id=mCG141193.0 transcript_id=mCT173724.0
FT                   created on 24-SEP-2002"
FT   CDS             join(2197378..2197420,2211136..2211214,2215848..2215896,
FT                   2217000..2217076,2219022..2219334,2222421..2222540,
FT                   2232452..2232623,2238243..2238451,2242001..2242147,
FT                   2270127..2270207,2271274..2271423,2274392..2275042,
FT                   2288628..2288834,2290944..2291132,2293661..2293749,
FT                   2293942..2293990)
FT                   /codon_start=1
FT                   /locus_tag="mCG_141193"
FT                   /product="mCG141193, isoform CRA_a"
FT                   /note="gene_id=mCG141193.0 transcript_id=mCT173724.0
FT                   protein_id=mCP96644.0 isoform=CRA_a"
FT                   /protein_id="EDL37229.1"
FT                   IVE"
FT   mRNA            join(<2219096..2219334,2232452..2232623,2238243..2238451,
FT                   2241842..>2241991)
FT                   /locus_tag="mCG_141193"
FT                   /product="mCG141193, transcript variant mCT173725"
FT                   /note="gene_id=mCG141193.0 transcript_id=mCT173725.0
FT                   created on 24-SEP-2002"
FT   CDS             join(<2219098..2219334,2232452..2232623,2238243..2238451,
FT                   2241842..>2241991)
FT                   /codon_start=1
FT                   /locus_tag="mCG_141193"
FT                   /product="mCG141193, isoform CRA_b"
FT                   /note="gene_id=mCG141193.0 transcript_id=mCT173725.0
FT                   protein_id=mCP96643.0 isoform=CRA_b"
FT                   /protein_id="EDL37230.1"
FT   assembly_gap    2224306..2224366
FT                   /estimated_length=61
FT                   /gap_type="unknown"
FT   assembly_gap    2240434..2240453
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2260821..2260840
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2265153..2265172
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2318046..2318065
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2319202..2319221
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(2330206..2339606)
FT                   /gene="Shh"
FT                   /locus_tag="mCG_7564"
FT                   /note="gene_id=mCG7564.2"
FT   mRNA            complement(join(2330206..2330957,2333676..2333937,
FT                   2338815..2339606))
FT                   /gene="Shh"
FT                   /locus_tag="mCG_7564"
FT                   /product="sonic hedgehog"
FT                   /note="gene_id=mCG7564.2 transcript_id=mCT6464.2 created on
FT                   01-OCT-2002"
FT   CDS             complement(join(2330209..2330957,2333676..2333937,
FT                   2338815..2339117))
FT                   /codon_start=1
FT                   /gene="Shh"
FT                   /locus_tag="mCG_7564"
FT                   /product="sonic hedgehog"
FT                   /note="gene_id=mCG7564.2 transcript_id=mCT6464.2
FT                   protein_id=mCP3918.2"
FT                   /protein_id="EDL37231.1"
FT   gene            <2339338..2573756
FT                   /locus_tag="mCG_146320"
FT                   /note="gene_id=mCG146320.0"
FT   mRNA            join(<2339338..2339702,2434849..2434985,2523374..2523654,
FT                   2526926..2528514,2565481..2565568,2565669..2565740,
FT                   2573363..2573756)
FT                   /locus_tag="mCG_146320"
FT                   /product="mCG146320"
FT                   /note="gene_id=mCG146320.0 transcript_id=mCT186423.0
FT                   created on 14-JUL-2003"
FT   assembly_gap    2352005..2352024
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2356645..2364476
FT                   /estimated_length=7832
FT                   /gap_type="unknown"
FT   assembly_gap    2379408..2379685
FT                   /estimated_length=278
FT                   /gap_type="unknown"
FT   assembly_gap    2380824..2383740
FT                   /estimated_length=2917
FT                   /gap_type="unknown"
FT   assembly_gap    2403064..2403259
FT                   /estimated_length=196
FT                   /gap_type="unknown"
FT   gene            2409604..2410877
FT                   /pseudo
FT                   /locus_tag="mCG_119764"
FT                   /note="gene_id=mCG119764.1"
FT   mRNA            2409604..2410877
FT                   /pseudo
FT                   /locus_tag="mCG_119764"
FT                   /note="gene_id=mCG119764.1 transcript_id=mCT120941.1
FT                   created on 01-OCT-2002"
FT   assembly_gap    2411858..2414029
FT                   /estimated_length=2172
FT                   /gap_type="unknown"
FT   assembly_gap    2423748..2423820
FT                   /estimated_length=73
FT                   /gap_type="unknown"
FT   assembly_gap    2425736..2426474
FT                   /estimated_length=739
FT                   /gap_type="unknown"
FT   assembly_gap    2441997..2442383
FT                   /estimated_length=387
FT                   /gap_type="unknown"
FT   CDS             <2527105..2527428
FT                   /codon_start=1
FT                   /locus_tag="mCG_146320"
FT                   /product="mCG146320"
FT                   /note="gene_id=mCG146320.0 transcript_id=mCT186423.0
FT                   protein_id=mCP107488.0"
FT                   /protein_id="EDL37232.1"
FT                   HPM"
FT   assembly_gap    2528937..2529097
FT                   /estimated_length=161
FT                   /gap_type="unknown"
FT   assembly_gap    2584030..2584049
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2584928..2585071
FT                   /estimated_length=144
FT                   /gap_type="unknown"
FT   assembly_gap    2598545..2598616
FT                   /estimated_length=72
FT                   /gap_type="unknown"
FT   assembly_gap    2628282..2629379
FT                   /estimated_length=1098
FT                   /gap_type="unknown"
FT   assembly_gap    2635543..2635562
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2671735..2671907
FT                   /estimated_length=173
FT                   /gap_type="unknown"
FT   assembly_gap    2686012..2686599
FT                   /estimated_length=588
FT                   /gap_type="unknown"
FT   assembly_gap    2695695..2695714
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2730959..2733258
FT                   /estimated_length=2300
FT                   /gap_type="unknown"
FT   assembly_gap    2781549..2782308
FT                   /estimated_length=760
FT                   /gap_type="unknown"
FT   assembly_gap    2858356..2858375
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2861136..2861877
FT                   /estimated_length=742
FT                   /gap_type="unknown"
FT   assembly_gap    2869314..2869586
FT                   /estimated_length=273
FT                   /gap_type="unknown"
FT   assembly_gap    2878495..2878582
FT                   /estimated_length=88
FT                   /gap_type="unknown"
FT   assembly_gap    2909515..2914783
FT                   /estimated_length=5269
FT                   /gap_type="unknown"
FT   assembly_gap    2920375..2920702
FT                   /estimated_length=328
FT                   /gap_type="unknown"
FT   assembly_gap    2921825..2922112
FT                   /estimated_length=288
FT                   /gap_type="unknown"
FT   assembly_gap    3017709..3017728
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3030571..3030590
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            3043778..3073203
FT                   /gene="Rnf32"
FT                   /locus_tag="mCG_7344"
FT                   /note="gene_id=mCG7344.2"
FT   mRNA            join(3043778..3043897,3044365..3044430,3045711..3045805,
FT                   3046359..3046623,3053454..3053486,3054481..3054589,
FT                   3071802..3071969,3072728..3073166)
FT                   /gene="Rnf32"
FT                   /locus_tag="mCG_7344"
FT                   /product="ring finger protein 32, transcript variant
FT                   mCT173438"
FT                   /note="gene_id=mCG7344.2 transcript_id=mCT173438.0 created
FT                   on 18-FEB-2003"
FT   mRNA            join(3043782..3043897,3044365..3044430,3045711..3045805,
FT                   3046359..3046623,3050840..3050982,3053454..3053486,
FT                   3053959..3054083,3054481..3054589,3071802..3071969,
FT                   3072728..3073203)
FT                   /gene="Rnf32"
FT                   /locus_tag="mCG_7344"
FT                   /product="ring finger protein 32, transcript variant
FT                   mCT6327"
FT                   /note="gene_id=mCG7344.2 transcript_id=mCT6327.2 created on
FT                   18-FEB-2003"
FT   mRNA            join(3043822..3043869,3044365..3044430,3045711..3045805,
FT                   3046359..3046623,3050840..3050982,3053454..3053486,
FT                   3053959..3054083,3054481..3054589,3071802..3071969,
FT                   3072728..3073124)
FT                   /gene="Rnf32"
FT                   /locus_tag="mCG_7344"
FT                   /product="ring finger protein 32, transcript variant
FT                   mCT180246"
FT                   /note="gene_id=mCG7344.2 transcript_id=mCT180246.0 created
FT                   on 18-FEB-2003"
FT   CDS             join(3045791..3045805,3046359..3046623,3050840..3050982,
FT                   3053454..3053486,3053959..3054083,3054481..3054589,
FT                   3071802..3071969,3072728..3072976)
FT                   /codon_start=1
FT                   /gene="Rnf32"
FT                   /locus_tag="mCG_7344"
FT                   /product="ring finger protein 32, isoform CRA_b"
FT                   /note="gene_id=mCG7344.2 transcript_id=mCT180246.0
FT                   protein_id=mCP103168.0 isoform=CRA_b"
FT                   /protein_id="EDL37234.1"
FT   CDS             join(3045791..3045805,3046359..3046623,3050840..3050982,
FT                   3053454..3053486,3053959..3054083,3054481..3054589,
FT                   3071802..3071969,3072728..3072976)
FT                   /codon_start=1
FT                   /gene="Rnf32"
FT                   /locus_tag="mCG_7344"
FT                   /product="ring finger protein 32, isoform CRA_b"
FT                   /note="gene_id=mCG7344.2 transcript_id=mCT6327.2
FT                   protein_id=mCP3961.1 isoform=CRA_b"
FT                   /protein_id="EDL37235.1"
FT   CDS             join(3045791..3045805,3046359..3046623,3053454..3053485)
FT                   /codon_start=1
FT                   /gene="Rnf32"
FT                   /locus_tag="mCG_7344"
FT                   /product="ring finger protein 32, isoform CRA_a"
FT                   /note="gene_id=mCG7344.2 transcript_id=mCT173438.0
FT                   protein_id=mCP96357.0 isoform=CRA_a"
FT                   /db_xref="MGI:MGI:1861747"
FT                   /db_xref="UniProtKB/TrEMBL:E0CZC4"
FT                   /protein_id="EDL37233.1"
FT   gene            3065339..3066966
FT                   /pseudo
FT                   /locus_tag="mCG_7346"
FT                   /note="gene_id=mCG7346.2"
FT   mRNA            3065339..3066966
FT                   /pseudo
FT                   /locus_tag="mCG_7346"
FT                   /note="gene_id=mCG7346.2 transcript_id=mCT6337.2 created on
FT                   01-OCT-2002"
FT   gene            complement(3077489..3077877)
FT                   /gene="1110048D14Rik"
FT                   /locus_tag="mCG_148289"
FT                   /note="gene_id=mCG148289.0"
FT   mRNA            complement(3077489..3077877)
FT                   /gene="1110048D14Rik"
FT                   /locus_tag="mCG_148289"
FT                   /product="RIKEN cDNA 1110048D14"
FT                   /note="gene_id=mCG148289.0 transcript_id=mCT188552.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(3077543..3077734)
FT                   /codon_start=1
FT                   /gene="1110048D14Rik"
FT                   /locus_tag="mCG_148289"
FT                   /product="RIKEN cDNA 1110048D14"
FT                   /note="gene_id=mCG148289.0 transcript_id=mCT188552.0
FT                   protein_id=mCP109203.0"
FT                   /db_xref="GOA:Q8BMZ2"
FT                   /db_xref="MGI:MGI:1861746"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BMZ2"
FT                   /protein_id="EDL37236.1"
FT                   LVNFCYILFSSFLLVLFL"
FT   gene            complement(3079015..>3225458)
FT                   /gene="Lmbr1"
FT                   /locus_tag="mCG_7345"
FT                   /note="gene_id=mCG7345.2"
FT   mRNA            complement(join(3079015..3080833,3082663..3082824,
FT                   3100429..3100495,3101928..3102018,3102232..3102305,
FT                   3105744..3105821,3106365..3106441,3111081..3111161,
FT                   3135119..3135191,3139001..3139065,3139880..3139948,
FT                   3140551..3140677,3171384..3171487,3194333..3194472,
FT                   3208176..3208215,3211011..3211083,3225344..>3225457))
FT                   /gene="Lmbr1"
FT                   /locus_tag="mCG_7345"
FT                   /product="limb region 1, transcript variant mCT6325"
FT                   /note="gene_id=mCG7345.2 transcript_id=mCT6325.2 created on
FT                   01-OCT-2002"
FT   mRNA            complement(join(3079804..3080833,3082663..3082824,
FT                   3100429..3100495,3101928..3102018,3102232..3102305,
FT                   3105744..3105821,3106365..3106441,3111081..3111161,
FT                   3135119..3135191,3139001..3139065,3139880..3139948,
FT                   3140551..3140677,3171384..3171487,3194333..3194472,
FT                   3208176..3208215,3211011..3211083,3212049..3212943,
FT                   3225265..>3225440))
FT                   /gene="Lmbr1"
FT                   /locus_tag="mCG_7345"
FT                   /product="limb region 1, transcript variant mCT193633"
FT                   /note="gene_id=mCG7345.2 transcript_id=mCT193633.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(3080066..3080833,3082663..3082824,
FT                   3100429..3100495,3101928..3102018,3102232..3102305,
FT                   3105744..3105821,3106365..3106441,3111081..3111161,
FT                   3135119..3135191,3139001..3139065,3139880..3139948,
FT                   3140551..3140677,3171384..3171406,3194333..3194472,
FT                   3208176..3208215,3211011..3211083,3225265..>3225368))
FT                   /gene="Lmbr1"
FT                   /locus_tag="mCG_7345"
FT                   /product="limb region 1, transcript variant mCT193634"
FT                   /note="gene_id=mCG7345.2 transcript_id=mCT193634.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(3080748..3080833,3082663..3082824,
FT                   3100429..3100495,3101928..3102018,3102232..3102305,
FT                   3105744..3105821,3106365..3106441,3111081..3111161,
FT                   3135119..3135191,3139001..3139065,3139880..3139948,
FT                   3140551..3140677,3171384..3171406,3194333..3194472,
FT                   3208176..3208215,3211011..3211083,3225265..>3225366))
FT                   /codon_start=1
FT                   /gene="Lmbr1"
FT                   /locus_tag="mCG_7345"
FT                   /product="limb region 1, isoform CRA_c"
FT                   /note="gene_id=mCG7345.2 transcript_id=mCT193634.0
FT                   protein_id=mCP114606.0 isoform=CRA_c"
FT                   /protein_id="EDL37239.1"
FT                   RDSETTKPSANGHQKAL"
FT   CDS             complement(join(3080748..3080833,3082663..3082824,
FT                   3100429..3100495,3101928..3102018,3102232..3102305,
FT                   3105744..3105821,3106365..3106441,3111081..3111161,
FT                   3135119..3135191,3139001..3139065,3139880..3139948,
FT                   3140551..3140677,3171384..3171487,3194333..3194472,
FT                   3208176..3208215,3211011..>3211083))
FT                   /codon_start=1
FT                   /gene="Lmbr1"
FT                   /locus_tag="mCG_7345"
FT                   /product="limb region 1, isoform CRA_b"
FT                   /note="gene_id=mCG7345.2 transcript_id=mCT193633.0
FT                   protein_id=mCP114605.0 isoform=CRA_b"
FT                   /protein_id="EDL37238.1"
FT                   PSANGHQKAL"
FT   CDS             complement(join(3080748..3080833,3082663..3082824,
FT                   3100429..3100495,3101928..3102018,3102232..3102305,
FT                   3105744..3105821,3106365..3106441,3111081..3111161,
FT                   3135119..3135191,3139001..3139065,3139880..3139948,
FT                   3140551..3140677,3171384..3171487,3194333..3194472,
FT                   3208176..3208215,3211011..>3211083))
FT                   /codon_start=1
FT                   /gene="Lmbr1"
FT                   /locus_tag="mCG_7345"
FT                   /product="limb region 1, isoform CRA_b"
FT                   /note="gene_id=mCG7345.2 transcript_id=mCT6325.2
FT                   protein_id=mCP4000.2 isoform=CRA_b"
FT                   /protein_id="EDL37240.1"
FT                   PSANGHQKAL"
FT   assembly_gap    3114297..3114316
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            complement(join(3135115..3135191,3139001..3139065,
FT                   3139880..3139948,3140551..3140708,3194333..3194472,
FT                   3208176..3208215,3211011..3211083,3225265..>3225458))
FT                   /gene="Lmbr1"
FT                   /locus_tag="mCG_7345"
FT                   /product="limb region 1, transcript variant mCT174006"
FT                   /note="gene_id=mCG7345.2 transcript_id=mCT174006.0 created
FT                   on 01-OCT-2002"
FT   CDS             complement(join(3140620..3140708,3194333..3194472,
FT                   3208176..3208215,3211011..3211083,3225265..>3225438))
FT                   /codon_start=1
FT                   /gene="Lmbr1"
FT                   /locus_tag="mCG_7345"
FT                   /product="limb region 1, isoform CRA_a"
FT                   /note="gene_id=mCG7345.2 transcript_id=mCT174006.0
FT                   protein_id=mCP96925.0 isoform=CRA_a"
FT                   /protein_id="EDL37237.1"
FT                   LCCCFLRC"
FT   assembly_gap    3154276..3154320
FT                   /estimated_length=45
FT                   /gap_type="unknown"
FT   assembly_gap    3187025..3187044
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3199069..3199564
FT                   /estimated_length=496
FT                   /gap_type="unknown"
FT   gene            <3225836..3237627
FT                   /locus_tag="mCG_1046201"
FT                   /note="gene_id=mCG1046201.0"
FT   mRNA            join(<3225836..3227349,3235904..3237627)
FT                   /locus_tag="mCG_1046201"
FT                   /product="mCG1046201"
FT                   /note="gene_id=mCG1046201.0 transcript_id=mCT163905.0
FT                   created on 30-SEP-2002"
FT   CDS             <3236287..3236571
FT                   /codon_start=1
FT                   /locus_tag="mCG_1046201"
FT                   /product="mCG1046201"
FT                   /note="gene_id=mCG1046201.0 transcript_id=mCT163905.0
FT                   protein_id=mCP65044.0"
FT                   /protein_id="EDL37241.1"
FT   gene            complement(3267414..3271388)
FT                   /locus_tag="mCG_66329"
FT                   /note="gene_id=mCG66329.2"
FT   mRNA            complement(join(3267414..3267558,3268727..3268984,
FT                   3269650..3269761,3271112..3271388))
FT                   /locus_tag="mCG_66329"
FT                   /product="mCG66329"
FT                   /note="gene_id=mCG66329.2 transcript_id=mCT66512.2 created
FT                   on 14-OCT-2002"
FT   CDS             complement(join(3267417..3267558,3268727..3268984,
FT                   3269650..3269761,3271112..3271385))
FT                   /codon_start=1
FT                   /locus_tag="mCG_66329"
FT                   /product="mCG66329"
FT                   /note="gene_id=mCG66329.2 transcript_id=mCT66512.2
FT                   protein_id=mCP26985.1"
FT                   /protein_id="EDL37242.1"
FT   gene            3281856..3300598
FT                   /locus_tag="mCG_122632"
FT                   /note="gene_id=mCG122632.1"
FT   mRNA            join(3281856..3282777,3283064..3283191,3284731..3284926,
FT                   3286960..3287283,3288464..3288574,3289627..3289794,
FT                   3290483..3290604,3293371..3293503,3296714..3296823,
FT                   3298159..3300598)
FT                   /locus_tag="mCG_122632"
FT                   /product="mCG122632"
FT                   /note="gene_id=mCG122632.1 transcript_id=mCT123854.1
FT                   created on 01-OCT-2002"
FT   CDS             join(3281881..3282777,3283064..3283191,3284731..3284926,
FT                   3286960..3287283,3288464..3288574,3289627..3289794,
FT                   3290483..3290604,3293371..3293503,3296714..3296823,
FT                   3298159..3298333)
FT                   /codon_start=1
FT                   /locus_tag="mCG_122632"
FT                   /product="mCG122632"
FT                   /note="gene_id=mCG122632.1 transcript_id=mCT123854.1
FT                   protein_id=mCP64743.1"
FT                   /protein_id="EDL37243.1"
FT   gene            complement(3320391..3325600)
FT                   /gene="Hlxb9"
FT                   /locus_tag="mCG_7342"
FT                   /note="gene_id=mCG7342.1"
FT   mRNA            complement(join(3320391..3321361,3321886..3322046,
FT                   3324715..3325600))
FT                   /gene="Hlxb9"
FT                   /locus_tag="mCG_7342"
FT                   /product="homeobox gene HB9"
FT                   /note="gene_id=mCG7342.1 transcript_id=mCT6326.1 created on
FT                   16-SEP-2002"
FT   CDS             complement(join(3320999..3321361,3321886..3322046,
FT                   3324715..3325405))
FT                   /codon_start=1
FT                   /gene="Hlxb9"
FT                   /locus_tag="mCG_7342"
FT                   /product="homeobox gene HB9"
FT                   /note="gene_id=mCG7342.1 transcript_id=mCT6326.1
FT                   protein_id=mCP3942.1"
FT                   /db_xref="GOA:A2RSX2"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017970"
FT                   /db_xref="InterPro:IPR020479"
FT                   /db_xref="MGI:MGI:109160"
FT                   /db_xref="UniProtKB/TrEMBL:A2RSX2"
FT                   /protein_id="EDL37244.1"
FT                   QPLPQ"
FT   gene            3385023..3385789
FT                   /locus_tag="mCG_11640"
FT                   /note="gene_id=mCG11640.1"
FT   mRNA            3385023..3385789
FT                   /locus_tag="mCG_11640"
FT                   /product="mCG11640"
FT                   /note="gene_id=mCG11640.1 transcript_id=mCT12255.1 created
FT                   on 24-SEP-2002"
FT   CDS             3385237..3385590
FT                   /codon_start=1
FT                   /locus_tag="mCG_11640"
FT                   /product="mCG11640"
FT                   /note="gene_id=mCG11640.1 transcript_id=mCT12255.1
FT                   protein_id=mCP3889.1"
FT                   /protein_id="EDL37245.1"
FT                   ESMKTLELGQCIE"
FT   gene            <3416323..3523154
FT                   /gene="Ube3c"
FT                   /locus_tag="mCG_11645"
FT                   /note="gene_id=mCG11645.3"
FT   mRNA            join(<3416323..3416662,3434357..3434410,3436970..3437044,
FT                   3437892..3438038,3444151..3444266,3445941..3446098,
FT                   3447723..3447876,3448214..3448434,3449278..3449429,
FT                   3453979..3454166,3461986..3462072,3466306..3466463,
FT                   3466633..3466865,3478270..3478374,3479828..3479915,
FT                   3482709..3482806,3484716..3484848,3493488..3493735,
FT                   3505287..3505499,3510540..3510728,3510853..3510919,
FT                   3514991..3515121,3521476..3523154)
FT                   /gene="Ube3c"
FT                   /locus_tag="mCG_11645"
FT                   /product="ubiquitin protein ligase E3C, transcript variant
FT                   mCT193576"
FT                   /note="gene_id=mCG11645.3 transcript_id=mCT193576.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(3416327..3416662,3434357..3434410,3436970..3437044,
FT                   3437892..3438038,3444151..3444266,3445941..3446098,
FT                   3447723..3447876,3448214..3448434,3449278..3449429,
FT                   3453979..3454166,3461986..3462072,3466306..3466463,
FT                   3466639..3466865,3478270..3478374,3479828..3479915,
FT                   3482709..3482806,3484716..3484848,3493488..3493735,
FT                   3505287..3505499,3510540..3510728,3510853..3510919,
FT                   3514991..3515121,3521476..3523154)
FT                   /gene="Ube3c"
FT                   /locus_tag="mCG_11645"
FT                   /product="ubiquitin protein ligase E3C, transcript variant
FT                   mCT12260"
FT                   /note="gene_id=mCG11645.3 transcript_id=mCT12260.2 created
FT                   on 01-OCT-2002"
FT   CDS             join(<3416588..3416662,3434357..3434410,3436970..3437044,
FT                   3437892..3438038,3444151..3444266,3445941..3446098,
FT                   3447723..3447876,3448214..3448434,3449278..3449429,
FT                   3453979..3454166,3461986..3462072,3466306..3466463,
FT                   3466633..3466865,3478270..3478374,3479828..3479915,
FT                   3482709..3482806,3484716..3484848,3493488..3493735,
FT                   3505287..3505499,3510540..3510728,3510853..3510919,
FT                   3514991..3515121,3521476..3521646)
FT                   /codon_start=1
FT                   /gene="Ube3c"
FT                   /locus_tag="mCG_11645"
FT                   /product="ubiquitin protein ligase E3C, isoform CRA_a"
FT                   /note="gene_id=mCG11645.3 transcript_id=mCT193576.0
FT                   protein_id=mCP114513.0 isoform=CRA_a"
FT                   /protein_id="EDL37246.1"
FT   CDS             join(3416597..3416662,3434357..3434410,3436970..3437044,
FT                   3437892..3438038,3444151..3444266,3445941..3446098,
FT                   3447723..3447876,3448214..3448434,3449278..3449429,
FT                   3453979..3454166,3461986..3462072,3466306..3466463,
FT                   3466639..3466865,3478270..3478374,3479828..3479915,
FT                   3482709..3482806,3484716..3484848,3493488..3493735,
FT                   3505287..3505499,3510540..3510728,3510853..3510919,
FT                   3514991..3515121,3521476..3521646)
FT                   /codon_start=1
FT                   /gene="Ube3c"
FT                   /locus_tag="mCG_11645"
FT                   /product="ubiquitin protein ligase E3C, isoform CRA_b"
FT                   /note="gene_id=mCG11645.3 transcript_id=mCT12260.2
FT                   protein_id=mCP3892.2 isoform=CRA_b"
FT                   /protein_id="EDL37247.1"
FT   assembly_gap    3524880..3524899
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(3567069..3567600)
FT                   /pseudo
FT                   /locus_tag="mCG_49601"
FT                   /note="gene_id=mCG49601.1"
FT   mRNA            complement(3567069..3567600)
FT                   /pseudo
FT                   /locus_tag="mCG_49601"
FT                   /note="gene_id=mCG49601.1 transcript_id=mCT49784.1 created
FT                   on 18-OCT-2002"
FT   gene            complement(3583157..3614818)
FT                   /locus_tag="mCG_148304"
FT                   /note="gene_id=mCG148304.1"
FT   mRNA            complement(join(3583157..3583841,3614326..3614818))
FT                   /locus_tag="mCG_148304"
FT                   /product="mCG148304"
FT                   /note="gene_id=mCG148304.1 transcript_id=mCT188567.1
FT                   created on 19-MAR-2004"
FT   gene            3583766..3634245
FT                   /locus_tag="mCG_11633"
FT                   /note="gene_id=mCG11633.2"
FT   mRNA            join(3583766..3583905,3596135..3596225,3598728..3598837,
FT                   3600187..3600249,3601332..3601442,3612186..3612317,
FT                   3613293..3613434,3614112..3614182,3628917..3629237,
FT                   3632818..3634245)
FT                   /locus_tag="mCG_11633"
FT                   /product="mCG11633, transcript variant mCT173394"
FT                   /note="gene_id=mCG11633.2 transcript_id=mCT173394.1 created
FT                   on 19-MAR-2004"
FT   mRNA            join(3583766..3583905,3596135..3596225,3598728..3598837,
FT                   3600187..3600249,3601332..3601442,3612186..3612317,
FT                   3613293..3613434,3614112..3614182,3628917..3629474)
FT                   /locus_tag="mCG_11633"
FT                   /product="mCG11633, transcript variant mCT180106"
FT                   /note="gene_id=mCG11633.2 transcript_id=mCT180106.1 created
FT                   on 19-MAR-2004"
FT   mRNA            join(3583766..3583905,3596135..3596225,3598728..3598837,
FT                   3600187..3600249,3601332..3601442,3612186..3612317,
FT                   3613293..3613434,3614112..3614875)
FT                   /locus_tag="mCG_11633"
FT                   /product="mCG11633, transcript variant mCT12247"
FT                   /note="gene_id=mCG11633.2 transcript_id=mCT12247.3 created
FT                   on 19-MAR-2004"
FT   mRNA            join(3583766..3583905,3596135..3596225,3598728..3598837,
FT                   3600187..3600249,3601332..3601442,3604024..3604128,
FT                   3605338..3605758)
FT                   /locus_tag="mCG_11633"
FT                   /product="mCG11633, transcript variant mCT12248"
FT                   /note="gene_id=mCG11633.2 transcript_id=mCT12248.2 created
FT                   on 19-MAR-2004"
FT   CDS             join(3596161..3596225,3598728..3598837,3600187..3600249,
FT                   3601332..3601442,3612186..3612317,3613293..3613434,
FT                   3614112..3614182,3628917..3629237,3632818..3632900)
FT                   /codon_start=1
FT                   /locus_tag="mCG_11633"
FT                   /product="mCG11633, isoform CRA_f"
FT                   /note="gene_id=mCG11633.2 transcript_id=mCT173394.1
FT                   protein_id=mCP96313.1 isoform=CRA_f"
FT                   /protein_id="EDL37254.1"
FT   CDS             join(3596161..3596225,3598728..3598837,3600187..3600249,
FT                   3601332..3601442,3612186..3612317,3613293..3613434,
FT                   3614112..3614182,3628917..3629341)
FT                   /codon_start=1
FT                   /locus_tag="mCG_11633"
FT                   /product="mCG11633, isoform CRA_b"
FT                   /note="gene_id=mCG11633.2 transcript_id=mCT180106.1
FT                   protein_id=mCP103030.1 isoform=CRA_b"
FT                   /protein_id="EDL37250.1"
FT   CDS             join(3596161..3596225,3598728..3598837,3600187..3600249,
FT                   3601332..3601442,3612186..3612317,3613293..3613434,
FT                   3614112..3614217)
FT                   /codon_start=1
FT                   /locus_tag="mCG_11633"
FT                   /product="mCG11633, isoform CRA_a"
FT                   /note="gene_id=mCG11633.2 transcript_id=mCT12247.3
FT                   protein_id=mCP4025.3 isoform=CRA_a"
FT                   /protein_id="EDL37249.1"
FT   CDS             join(3596161..3596225,3598728..3598837,3600187..3600249,
FT                   3601332..3601442,3604024..3604128,3605338..3605669)
FT                   /codon_start=1
FT                   /locus_tag="mCG_11633"
FT                   /product="mCG11633, isoform CRA_e"
FT                   /note="gene_id=mCG11633.2 transcript_id=mCT12248.2
FT                   protein_id=mCP3977.2 isoform=CRA_e"
FT                   /db_xref="GOA:G3X8S5"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="MGI:MGI:1344381"
FT                   /db_xref="UniProtKB/TrEMBL:G3X8S5"
FT                   /protein_id="EDL37253.1"
FT   mRNA            join(3598512..3598837,3600187..3600249,3601332..3601442,
FT                   3612186..3612317,3613293..3613434,3614112..3614182,
FT                   3628917..3629237,3632818..3634245)
FT                   /locus_tag="mCG_11633"
FT                   /product="mCG11633, transcript variant mCT180107"
FT                   /note="gene_id=mCG11633.2 transcript_id=mCT180107.1 created
FT                   on 19-MAR-2004"
FT   mRNA            join(<3602222..3602381,3604024..3604128,3605338..3605758)
FT                   /locus_tag="mCG_11633"
FT                   /product="mCG11633, transcript variant mCT180108"
FT                   /note="gene_id=mCG11633.2 transcript_id=mCT180108.1 created
FT                   on 19-MAR-2004"
FT   CDS             join(<3602357..3602381,3604024..3604128,3605338..3605669)
FT                   /codon_start=1
FT                   /locus_tag="mCG_11633"
FT                   /product="mCG11633, isoform CRA_d"
FT                   /note="gene_id=mCG11633.2 transcript_id=mCT180108.1
FT                   protein_id=mCP103029.1 isoform=CRA_d"
FT                   /protein_id="EDL37252.1"
FT   CDS             join(3613367..3613434,3614112..3614182,3628917..3629237,
FT                   3632818..3632900)
FT                   /codon_start=1
FT                   /locus_tag="mCG_11633"
FT                   /product="mCG11633, isoform CRA_c"
FT                   /note="gene_id=mCG11633.2 transcript_id=mCT180107.1
FT                   protein_id=mCP103028.1 isoform=CRA_c"
FT                   /protein_id="EDL37251.1"
FT                   QKQKEDLKKKKSTKGNH"
FT   CDS             complement(3614520..3614612)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148304"
FT                   /product="mCG148304"
FT                   /note="gene_id=mCG148304.1 transcript_id=mCT188567.1
FT                   protein_id=mCP109218.1"
FT                   /protein_id="EDL37248.1"
FT                   /translation="MLSPQQADTTHSQFTTMGSRSMLVLQTVSS"
FT   gene            3635670..3637172
FT                   /locus_tag="mCG_148308"
FT                   /note="gene_id=mCG148308.0"
FT   mRNA            join(3635670..3636860,3637104..3637172)
FT                   /locus_tag="mCG_148308"
FT                   /product="mCG148308"
FT                   /note="gene_id=mCG148308.0 transcript_id=mCT188571.0
FT                   created on 13-JAN-2004"
FT   CDS             3635718..3635858
FT                   /codon_start=1
FT                   /locus_tag="mCG_148308"
FT                   /product="mCG148308"
FT                   /note="gene_id=mCG148308.0 transcript_id=mCT188571.0
FT                   protein_id=mCP109222.0"
FT                   /protein_id="EDL37255.1"
FT                   W"
FT   assembly_gap    3639372..3639635
FT                   /estimated_length=264
FT                   /gap_type="unknown"
FT   gene            complement(3641913..3642967)
FT                   /pseudo
FT                   /locus_tag="mCG_11639"
FT                   /note="gene_id=mCG11639.1"
FT   mRNA            complement(3641913..3642967)
FT                   /pseudo
FT                   /locus_tag="mCG_11639"
FT                   /note="gene_id=mCG11639.1 transcript_id=mCT12254.1 created
FT                   on 01-OCT-2002"
FT   assembly_gap    3649180..3649393
FT                   /estimated_length=214
FT                   /gap_type="unknown"
FT   assembly_gap    3653122..3653141
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(3654525..3656232)
FT                   /pseudo
FT                   /locus_tag="mCG_51660"
FT                   /note="gene_id=mCG51660.2"
FT   mRNA            complement(3654525..3656232)
FT                   /pseudo
FT                   /locus_tag="mCG_51660"
FT                   /note="gene_id=mCG51660.2 transcript_id=mCT51843.2 created
FT                   on 18-OCT-2002"
FT   gene            complement(3679048..3681469)
FT                   /pseudo
FT                   /locus_tag="mCG_52324"
FT                   /note="gene_id=mCG52324.2"
FT   mRNA            complement(3679048..3681469)
FT                   /pseudo
FT                   /locus_tag="mCG_52324"
FT                   /note="gene_id=mCG52324.2 transcript_id=mCT52507.2 created
FT                   on 14-OCT-2002"
FT   assembly_gap    3683866..3683933
FT                   /estimated_length=68
FT                   /gap_type="unknown"
FT   assembly_gap    3687105..3687124
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3721599..3721618
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3729419..3729438
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3734175..3734500
FT                   /estimated_length=326
FT                   /gap_type="unknown"
FT   assembly_gap    3751047..3751066
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3783728..3783911
FT                   /estimated_length=184
FT                   /gap_type="unknown"
FT   assembly_gap    3789512..3789755
FT                   /estimated_length=244
FT                   /gap_type="unknown"
FT   assembly_gap    3792727..3792746
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3835653..3836027
FT                   /estimated_length=375
FT                   /gap_type="unknown"
FT   gene            complement(3844545..>3857202)
FT                   /locus_tag="mCG_1046205"
FT                   /note="gene_id=mCG1046205.0"
FT   mRNA            complement(join(3844545..3844778,3852879..3852968,
FT                   3857171..>3857202))
FT                   /locus_tag="mCG_1046205"
FT                   /product="mCG1046205"
FT                   /note="gene_id=mCG1046205.0 transcript_id=mCT163909.0
FT                   created on 14-OCT-2002"
FT   CDS             complement(3844558..>3844761)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1046205"
FT                   /product="mCG1046205"
FT                   /note="gene_id=mCG1046205.0 transcript_id=mCT163909.0
FT                   protein_id=mCP65090.0"
FT                   /protein_id="EDL37256.1"
FT   gene            <3861546..3868382
FT                   /gene="Il6"
FT                   /locus_tag="mCG_11634"
FT                   /note="gene_id=mCG11634.2"
FT   mRNA            join(<3861546..3861614,3861780..3861964,3863223..3863336,
FT                   3866404..3868382)
FT                   /gene="Il6"
FT                   /locus_tag="mCG_11634"
FT                   /product="interleukin 6, transcript variant mCT193535"
FT                   /note="gene_id=mCG11634.2 transcript_id=mCT193535.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(3861565..3861614,3861780..3861964,3863223..3863336,
FT                   3866404..3866553,3867782..3868369)
FT                   /gene="Il6"
FT                   /locus_tag="mCG_11634"
FT                   /product="interleukin 6, transcript variant mCT12249"
FT                   /note="gene_id=mCG11634.2 transcript_id=mCT12249.1 created
FT                   on 16-SEP-2002"
FT   CDS             join(<3861578..3861614,3861780..3861964,3863223..3863336,
FT                   3866404..3866712)
FT                   /codon_start=1
FT                   /gene="Il6"
FT                   /locus_tag="mCG_11634"
FT                   /product="interleukin 6, isoform CRA_a"
FT                   /note="gene_id=mCG11634.2 transcript_id=mCT193535.0
FT                   protein_id=mCP114512.0 isoform=CRA_a"
FT                   /protein_id="EDL37257.1"
FT   CDS             join(3861596..3861614,3861780..3861964,3863223..3863336,
FT                   3866404..3866553,3867782..3867949)
FT                   /codon_start=1
FT                   /gene="Il6"
FT                   /locus_tag="mCG_11634"
FT                   /product="interleukin 6, isoform CRA_b"
FT                   /note="gene_id=mCG11634.2 transcript_id=mCT12249.1
FT                   protein_id=mCP3999.2 isoform=CRA_b"
FT                   /db_xref="GOA:A2RTD1"
FT                   /db_xref="InterPro:IPR003574"
FT                   /db_xref="InterPro:IPR009079"
FT                   /db_xref="InterPro:IPR030473"
FT                   /db_xref="InterPro:IPR030474"
FT                   /db_xref="MGI:MGI:96559"
FT                   /db_xref="UniProtKB/TrEMBL:A2RTD1"
FT                   /protein_id="EDL37258.1"
FT   assembly_gap    3869937..3869956
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            3887921..3889075
FT                   /pseudo
FT                   /locus_tag="mCG_1046024"
FT                   /note="gene_id=mCG1046024.1"
FT   mRNA            3887921..3889075
FT                   /pseudo
FT                   /locus_tag="mCG_1046024"
FT                   /note="gene_id=mCG1046024.1 transcript_id=mCT163728.1
FT                   created on 18-OCT-2002"
FT   assembly_gap    3890217..3890236
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3900278..3900297
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3901128..3904255
FT                   /estimated_length=3128
FT                   /gap_type="unknown"
FT   gene            complement(3904549..3922351)
FT                   /gene="Tyms"
FT                   /locus_tag="mCG_11630"
FT                   /note="gene_id=mCG11630.1"
FT   mRNA            complement(join(3904549..3904685,3909675..3909862,
FT                   3910697..3910768,3911965..3912140,3912814..3912915,
FT                   3917168..3917342,3920345..3920418,3922072..3922351))
FT                   /gene="Tyms"
FT                   /locus_tag="mCG_11630"
FT                   /product="thymidylate synthase, transcript variant
FT                   mCT12244"
FT                   /note="gene_id=mCG11630.1 transcript_id=mCT12244.2 created
FT                   on 24-SEP-2002"
FT   assembly_gap    3906254..3906273
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            complement(join(3907556..3909862,3910697..3910768,
FT                   3911965..3912140,3912814..3912915,3917168..3917342,
FT                   3920345..3920418,3922072..>3922293))
FT                   /gene="Tyms"
FT                   /locus_tag="mCG_11630"
FT                   /product="thymidylate synthase, transcript variant
FT                   mCT193533"
FT                   /note="gene_id=mCG11630.1 transcript_id=mCT193533.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(3909725..3909862,3910697..3910768,
FT                   3911965..3912140,3912814..3912915,3917168..3917342,
FT                   3920345..3920418,3922072..>3922291))
FT                   /codon_start=1
FT                   /gene="Tyms"
FT                   /locus_tag="mCG_11630"
FT                   /product="thymidylate synthase, isoform CRA_a"
FT                   /note="gene_id=mCG11630.1 transcript_id=mCT193533.0
FT                   protein_id=mCP114511.0 isoform=CRA_a"
FT                   /protein_id="EDL37259.1"
FT   CDS             complement(join(3909725..3909862,3910697..3910768,
FT                   3911965..3912140,3912814..3912915,3917168..3917342,
FT                   3920345..3920418,3922072..3922258))
FT                   /codon_start=1
FT                   /gene="Tyms"
FT                   /locus_tag="mCG_11630"
FT                   /product="thymidylate synthase, isoform CRA_b"
FT                   /note="gene_id=mCG11630.1 transcript_id=mCT12244.2
FT                   protein_id=mCP3932.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q544L2"
FT                   /db_xref="InterPro:IPR000398"
FT                   /db_xref="InterPro:IPR020940"
FT                   /db_xref="InterPro:IPR023451"
FT                   /db_xref="InterPro:IPR036926"
FT                   /db_xref="MGI:MGI:98878"
FT                   /db_xref="UniProtKB/TrEMBL:Q544L2"
FT                   /protein_id="EDL37260.1"
FT   assembly_gap    3914426..3914607
FT                   /estimated_length=182
FT                   /gap_type="unknown"
FT   gene            complement(3944738..3946393)
FT                   /pseudo
FT                   /locus_tag="mCG_11638"
FT                   /note="gene_id=mCG11638.2"
FT   mRNA            complement(3944738..3946393)
FT                   /pseudo
FT                   /locus_tag="mCG_11638"
FT                   /note="gene_id=mCG11638.2 transcript_id=mCT12253.2 created
FT                   on 01-OCT-2002"
FT   assembly_gap    3953516..3953794
FT                   /estimated_length=279
FT                   /gap_type="unknown"
FT   gene            3954035..3967818
FT                   /locus_tag="mCG_11643"
FT                   /note="gene_id=mCG11643.2"
FT   mRNA            join(3954035..3954225,3957074..3957214,3962120..3962250,
FT                   3962762..3963445,3963641..3963823,3964723..3964892,
FT                   3965097..3966103,3966653..3967818)
FT                   /locus_tag="mCG_11643"
FT                   /product="mCG11643"
FT                   /note="gene_id=mCG11643.2 transcript_id=mCT12258.2 created
FT                   on 02-OCT-2002"
FT   CDS             join(3954114..3954225,3957074..3957214,3962120..3962250,
FT                   3962762..3963445,3963641..3963823,3964723..3964892,
FT                   3965097..3966103,3966653..3966933)
FT                   /codon_start=1
FT                   /locus_tag="mCG_11643"
FT                   /product="mCG11643"
FT                   /note="gene_id=mCG11643.2 transcript_id=mCT12258.2
FT                   protein_id=mCP4028.2"
FT                   /protein_id="EDL37261.1"
FT   assembly_gap    3962068..3962087
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(3968261..4003950)
FT                   /gene="Hadha"
FT                   /locus_tag="mCG_11632"
FT                   /note="gene_id=mCG11632.2"
FT   mRNA            complement(join(3968261..3968796,3968881..3969026,
FT                   3969524..3969638,3970174..3970369,3970986..3971054,
FT                   3971457..3971597,3972444..3972530,3975401..3975572,
FT                   3977636..3977770,3978657..3978766,3981079..3981135,
FT                   3982897..3983015,3983818..3983940,3989790..3989892,
FT                   3991560..3991679,3993000..3993138,3994076..3994209,
FT                   3996183..3996253,3996817..3996858,4003719..4003950))
FT                   /gene="Hadha"
FT                   /locus_tag="mCG_11632"
FT                   /product="hydroxyacyl-Coenzyme A
FT                   dehydrogenase/3-ketoacyl-Coenzyme A thiolase/enoyl-Coenzyme
FT                   A hydratase (trifunctional protein), alpha subunit,
FT                   transcript variant mCT12246"
FT                   /note="gene_id=mCG11632.2 transcript_id=mCT12246.2 created
FT                   on 02-OCT-2002"
FT   mRNA            complement(join(3968261..3968796,3968881..3969026,
FT                   3972492..3972530,3975401..3975420,3982948..3983015,
FT                   3983818..3983940,3989790..3989885,3991556..>3991591))
FT                   /gene="Hadha"
FT                   /locus_tag="mCG_11632"
FT                   /product="hydroxyacyl-Coenzyme A
FT                   dehydrogenase/3-ketoacyl-Coenzyme A thiolase/enoyl-Coenzyme
FT                   A hydratase (trifunctional protein), alpha subunit,
FT                   transcript variant mCT173994"
FT                   /note="gene_id=mCG11632.2 transcript_id=mCT173994.0 created
FT                   on 02-OCT-2002"
FT   CDS             complement(join(3968651..3968796,3968881..3969026,
FT                   3969524..3969638,3970174..3970369,3970986..3971054,
FT                   3971457..3971597,3972444..3972530,3975401..3975572,
FT                   3977636..3977770,3978657..3978766,3981079..3981135,
FT                   3982897..3983015,3983818..3983940,3989790..3989892,
FT                   3991560..3991679,3993000..3993138,3994076..3994209,
FT                   3996183..3996253,3996817..3996858,4003719..4003785))
FT                   /codon_start=1
FT                   /gene="Hadha"
FT                   /locus_tag="mCG_11632"
FT                   /product="hydroxyacyl-Coenzyme A
FT                   dehydrogenase/3-ketoacyl-Coenzyme A thiolase/enoyl-Coenzyme
FT                   A hydratase (trifunctional protein), alpha subunit, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG11632.2 transcript_id=mCT12246.2
FT                   protein_id=mCP3959.2 isoform=CRA_a"
FT                   /protein_id="EDL37262.1"
FT                   ANNSSKKFYQ"
FT   CDS             complement(join(3975415..3975420,3982948..3983015,
FT                   3983818..3983940,3989790..3989885,3991556..>3991589))
FT                   /codon_start=1
FT                   /gene="Hadha"
FT                   /locus_tag="mCG_11632"
FT                   /product="hydroxyacyl-Coenzyme A
FT                   dehydrogenase/3-ketoacyl-Coenzyme A thiolase/enoyl-Coenzyme
FT                   A hydratase (trifunctional protein), alpha subunit, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG11632.2 transcript_id=mCT173994.0
FT                   protein_id=mCP96913.0 isoform=CRA_b"
FT                   /protein_id="EDL37263.1"
FT                   EEKC"
FT   assembly_gap    3988509..3988528
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            4004060..4033426
FT                   /locus_tag="mCG_11629"
FT                   /note="gene_id=mCG11629.2"
FT   mRNA            join(4004060..4004223,4012506..4012580,4012863..4012907,
FT                   4015502..4015601,4017361..4017405,4018333..4018432,
FT                   4021463..4021550,4022647..4022834,4023628..4023808,
FT                   4025725..4025846,4027477..4027556,4027634..4027681,
FT                   4028389..4028476,4029152..4029226,4029758..4029922,
FT                   4032890..4033426)
FT                   /locus_tag="mCG_11629"
FT                   /product="mCG11629, transcript variant mCT12243"
FT                   /note="gene_id=mCG11629.2 transcript_id=mCT12243.2 created
FT                   on 13-FEB-2003"
FT   mRNA            join(<4004125..4004219,4012506..4012580,4012863..4012907,
FT                   4015502..4015601,4017361..4017405,4018333..4018432,
FT                   4021463..4021550,4022647..4022834,4023628..4023808,
FT                   4025725..4025846,4027477..4027556,4027634..4027681,
FT                   4028389..4028476,4029152..4029226,4029758..4029922,
FT                   4032890..4033327)
FT                   /locus_tag="mCG_11629"
FT                   /product="mCG11629, transcript variant mCT193632"
FT                   /note="gene_id=mCG11629.2 transcript_id=mCT193632.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(4004126..4004176,4012506..4012580,4012863..4012907,
FT                   4015502..4015601,4017361..4017405,4018333..4018432,
FT                   4021463..4021550,4022647..4022834,4023628..4023808,
FT                   4025725..4025846,4027477..4027556,4027634..4027681,
FT                   4028389..4028476,4029152..4029226,4029758..4029922,
FT                   4032890..4033421)
FT                   /locus_tag="mCG_11629"
FT                   /product="mCG11629, transcript variant mCT180104"
FT                   /note="gene_id=mCG11629.2 transcript_id=mCT180104.0 created
FT                   on 13-FEB-2003"
FT   CDS             join(<4004126..4004219,4012506..4012580,4012863..4012907,
FT                   4015502..4015601,4017361..4017405,4018333..4018432,
FT                   4021463..4021550,4022647..4022834,4023628..4023808,
FT                   4025725..4025846,4027477..4027556,4027634..4027681,
FT                   4028389..4028476,4029152..4029226,4029758..4029922,
FT                   4032890..4032925)
FT                   /codon_start=1
FT                   /locus_tag="mCG_11629"
FT                   /product="mCG11629, isoform CRA_d"
FT                   /note="gene_id=mCG11629.2 transcript_id=mCT193632.0
FT                   protein_id=mCP114558.0 isoform=CRA_d"
FT                   /protein_id="EDL37268.1"
FT   mRNA            join(4004156..4004219,4012506..4012580,4012863..4012907,
FT                   4015502..4015601,4017361..4017405,4018333..4018366,
FT                   4029875..4029922,4032890..4033011)
FT                   /locus_tag="mCG_11629"
FT                   /product="mCG11629, transcript variant mCT180105"
FT                   /note="gene_id=mCG11629.2 transcript_id=mCT180105.0 created
FT                   on 13-FEB-2003"
FT   mRNA            join(<4012503..4012580,4012863..4012907,4015502..4015601,
FT                   4022690..4022834,4023626..>4023694)
FT                   /locus_tag="mCG_11629"
FT                   /product="mCG11629, transcript variant mCT173680"
FT                   /note="gene_id=mCG11629.2 transcript_id=mCT173680.0 created
FT                   on 13-FEB-2003"
FT   CDS             join(<4012505..4012580,4012863..4012907,4015502..4015601,
FT                   4022690..4022834,4023626..>4023694)
FT                   /codon_start=1
FT                   /locus_tag="mCG_11629"
FT                   /product="mCG11629, isoform CRA_e"
FT                   /note="gene_id=mCG11629.2 transcript_id=mCT173680.0
FT                   protein_id=mCP96599.0 isoform=CRA_e"
FT                   /protein_id="EDL37269.1"
FT   CDS             join(4012514..4012580,4012863..4012907,4015502..4015601,
FT                   4017361..4017405,4018333..4018432,4021463..4021550,
FT                   4022647..4022834,4023628..4023808,4025725..4025846,
FT                   4027477..4027556,4027634..4027681,4028389..4028476,
FT                   4029152..4029226,4029758..4029922,4032890..4032925)
FT                   /codon_start=1
FT                   /locus_tag="mCG_11629"
FT                   /product="mCG11629, isoform CRA_a"
FT                   /note="gene_id=mCG11629.2 transcript_id=mCT12243.2
FT                   protein_id=mCP3938.2 isoform=CRA_a"
FT                   /protein_id="EDL37264.1"
FT                   CAAGGQGHAMIVEAYPK"
FT   CDS             join(4012514..4012580,4012863..4012907,4015502..4015601,
FT                   4017361..4017405,4018333..4018432,4021463..4021550,
FT                   4022647..4022834,4023628..4023808,4025725..4025846,
FT                   4027477..4027556,4027634..4027681,4028389..4028476,
FT                   4029152..4029226,4029758..4029922,4032890..4032925)
FT                   /codon_start=1
FT                   /locus_tag="mCG_11629"
FT                   /product="mCG11629, isoform CRA_a"
FT                   /note="gene_id=mCG11629.2 transcript_id=mCT180104.0
FT                   protein_id=mCP103026.0 isoform=CRA_a"
FT                   /protein_id="EDL37266.1"
FT                   CAAGGQGHAMIVEAYPK"
FT   CDS             join(4012514..4012580,4012863..4012907,4015502..4015601,
FT                   4017361..4017405,4018333..4018366,4029875..4029922,
FT                   4032890..4032925)
FT                   /codon_start=1
FT                   /locus_tag="mCG_11629"
FT                   /product="mCG11629, isoform CRA_c"
FT                   /note="gene_id=mCG11629.2 transcript_id=mCT180105.0
FT                   protein_id=mCP103027.0 isoform=CRA_c"
FT                   /protein_id="EDL37267.1"
FT   mRNA            join(<4025741..4025846,4027477..4027556,4027634..4027681,
FT                   4028389..4028476,4029152..4029192,4032890..4033426)
FT                   /locus_tag="mCG_11629"
FT                   /product="mCG11629, transcript variant mCT173679"
FT                   /note="gene_id=mCG11629.2 transcript_id=mCT173679.0 created
FT                   on 13-FEB-2003"
FT   CDS             join(<4025742..4025846,4027477..4027556,4027634..4027681,
FT                   4028389..4028476,4029152..4029192,4032890..4032902)
FT                   /codon_start=1
FT                   /locus_tag="mCG_11629"
FT                   /product="mCG11629, isoform CRA_b"
FT                   /note="gene_id=mCG11629.2 transcript_id=mCT173679.0
FT                   protein_id=mCP96598.0 isoform=CRA_b"
FT                   /protein_id="EDL37265.1"
FT   gene            complement(4042272..4053484)
FT                   /gene="Gpr113"
FT                   /locus_tag="mCG_52323"
FT                   /note="gene_id=mCG52323.3"
FT   mRNA            complement(join(4042272..4042398,4043884..4043939,
FT                   4044338..4044400,4045080..4046456,4047204..4047383,
FT                   4047858..4048054,4048239..4048382,4049281..4049487,
FT                   4051080..4051298,4051798..4051974,4052328..4052468,
FT                   4053236..4053484))
FT                   /gene="Gpr113"
FT                   /locus_tag="mCG_52323"
FT                   /product="G protein-coupled receptor 113"
FT                   /note="gene_id=mCG52323.3 transcript_id=mCT52506.3 created
FT                   on 18-APR-2003"
FT   CDS             complement(join(4042374..4042398,4043884..4043939,
FT                   4044338..4044400,4045080..4046456,4047204..4047383,
FT                   4047858..4048054,4048239..4048382,4049281..4049487,
FT                   4051080..4051298,4051798..4051852))
FT                   /codon_start=1
FT                   /gene="Gpr113"
FT                   /locus_tag="mCG_52323"
FT                   /product="G protein-coupled receptor 113"
FT                   /note="gene_id=mCG52323.3 transcript_id=mCT52506.3
FT                   protein_id=mCP26973.3"
FT                   /protein_id="EDL37270.1"
FT   assembly_gap    4052711..4052787
FT                   /estimated_length=77
FT                   /gap_type="unknown"
FT   assembly_gap    4056082..4056101
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4057632..4057941
FT                   /estimated_length=310
FT                   /gap_type="unknown"
FT   gene            complement(4070467..4070829)
FT                   /pseudo
FT                   /locus_tag="mCG_11636"
FT                   /note="gene_id=mCG11636.1"
FT   mRNA            complement(4070467..4070829)
FT                   /pseudo
FT                   /locus_tag="mCG_11636"
FT                   /note="gene_id=mCG11636.1 transcript_id=mCT12251.1 created
FT                   on 02-OCT-2002"
FT   assembly_gap    4076758..4077005
FT                   /estimated_length=248
FT                   /gap_type="unknown"
FT   gene            4082303..4122765
FT                   /gene="D5Wsu178e"
FT                   /locus_tag="mCG_11644"
FT                   /note="gene_id=mCG11644.2"
FT   mRNA            join(4082303..4082468,4097116..4097184,4102363..4102437,
FT                   4105731..4105993,4107365..4107408)
FT                   /gene="D5Wsu178e"
FT                   /locus_tag="mCG_11644"
FT                   /product="DNA segment, Chr 5, Wayne State University 178,
FT                   expressed, transcript variant mCT173681"
FT                   /note="gene_id=mCG11644.2 transcript_id=mCT173681.0 created
FT                   on 18-FEB-2003"
FT   mRNA            join(4082318..4082468,4097116..4097184,4098065..4098173,
FT                   4102363..4102437,4105731..4105993,4107365..4107473,
FT                   4113406..4113454,4114610..4114790,4115673..4115858,
FT                   4117236..4122765)
FT                   /gene="D5Wsu178e"
FT                   /locus_tag="mCG_11644"
FT                   /product="DNA segment, Chr 5, Wayne State University 178,
FT                   expressed, transcript variant mCT12259"
FT                   /note="gene_id=mCG11644.2 transcript_id=mCT12259.2 created
FT                   on 18-FEB-2003"
FT   mRNA            join(4082324..4082468,4097116..4097184,4098065..4098173,
FT                   4105731..4105993,4107365..4107414,4113406..4113454,
FT                   4114610..4114790,4115673..4115858,4117236..4119308)
FT                   /gene="D5Wsu178e"
FT                   /locus_tag="mCG_11644"
FT                   /product="DNA segment, Chr 5, Wayne State University 178,
FT                   expressed, transcript variant mCT180247"
FT                   /note="gene_id=mCG11644.2 transcript_id=mCT180247.0 created
FT                   on 18-FEB-2003"
FT   CDS             join(4082412..4082468,4097116..4097184,4098065..4098173,
FT                   4102363..4102437,4105731..4105993,4107365..4107473,
FT                   4113406..4113454,4114610..4114790,4115673..4115858,
FT                   4117236..4117301)
FT                   /codon_start=1
FT                   /gene="D5Wsu178e"
FT                   /locus_tag="mCG_11644"
FT                   /product="DNA segment, Chr 5, Wayne State University 178,
FT                   expressed, isoform CRA_a"
FT                   /note="gene_id=mCG11644.2 transcript_id=mCT12259.2
FT                   protein_id=mCP3893.2 isoform=CRA_a"
FT                   /protein_id="EDL37271.1"
FT   CDS             join(4082412..4082468,4097116..4097184,4098065..4098173,
FT                   4105731..4105993,4107365..4107414,4113406..4113454)
FT                   /codon_start=1
FT                   /gene="D5Wsu178e"
FT                   /locus_tag="mCG_11644"
FT                   /product="DNA segment, Chr 5, Wayne State University 178,
FT                   expressed, isoform CRA_c"
FT                   /note="gene_id=mCG11644.2 transcript_id=mCT180247.0
FT                   protein_id=mCP103169.0 isoform=CRA_c"
FT                   /db_xref="GOA:Q8CET7"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR014472"
FT                   /db_xref="MGI:MGI:107898"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CET7"
FT                   /protein_id="EDL37273.1"
FT   CDS             join(4082412..4082468,4097116..4097184,4102363..4102437)
FT                   /codon_start=1
FT                   /gene="D5Wsu178e"
FT                   /locus_tag="mCG_11644"
FT                   /product="DNA segment, Chr 5, Wayne State University 178,
FT                   expressed, isoform CRA_b"
FT                   /note="gene_id=mCG11644.2 transcript_id=mCT173681.0
FT                   protein_id=mCP96600.0 isoform=CRA_b"
FT                   /db_xref="InterPro:IPR014472"
FT                   /db_xref="MGI:MGI:107898"
FT                   /db_xref="UniProtKB/TrEMBL:D6RE20"
FT                   /protein_id="EDL37272.1"
FT   assembly_gap    4112042..4112061
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4131169..4131343
FT                   /estimated_length=175
FT                   /gap_type="unknown"
FT   gene            4131784..4174051
FT                   /locus_tag="mCG_11631"
FT                   /note="gene_id=mCG11631.1"
FT   mRNA            join(4131784..4131997,4149581..4149724,4152511..4152637,
FT                   4154186..4154323,4155793..4155879,4157531..4157653,
FT                   4162328..4162467,4162801..4162935,4163713..4163846,
FT                   4165812..4165924,4166917..4167006,4167350..4167436,
FT                   4170343..4170624,4171266..4171438,4171728..4171830,
FT                   4173838..4174051)
FT                   /locus_tag="mCG_11631"
FT                   /product="mCG11631"
FT                   /note="gene_id=mCG11631.1 transcript_id=mCT12245.1 created
FT                   on 02-OCT-2002"
FT   CDS             join(4131843..4131997,4149581..4149724,4152511..4152637,
FT                   4154186..4154323,4155793..4155879,4157531..4157653,
FT                   4162328..4162467,4162801..4162935,4163713..4163846,
FT                   4165812..4165924,4166917..4167006,4167350..4167436,
FT                   4170343..4170624,4171266..4171438,4171728..4171830,
FT                   4173838..4173894)
FT                   /codon_start=1
FT                   /locus_tag="mCG_11631"
FT                   /product="mCG11631"
FT                   /note="gene_id=mCG11631.1 transcript_id=mCT12245.1
FT                   protein_id=mCP3962.2"
FT                   /protein_id="EDL37274.1"
FT                   K"
FT   assembly_gap    4140170..4146608
FT                   /estimated_length=6439
FT                   /gap_type="unknown"
FT   assembly_gap    4148444..4148677
FT                   /estimated_length=234
FT                   /gap_type="unknown"
FT   assembly_gap    4151877..4151973
FT                   /estimated_length=97
FT                   /gap_type="unknown"
FT   assembly_gap    4153354..4153460
FT                   /estimated_length=107
FT                   /gap_type="unknown"
FT   assembly_gap    4161387..4162048
FT                   /estimated_length=662
FT                   /gap_type="unknown"
FT   assembly_gap    4163357..4163705
FT                   /estimated_length=349
FT                   /gap_type="unknown"
FT   gene            complement(4174414..4271383)
FT                   /gene="Otof"
FT                   /locus_tag="mCG_11635"
FT                   /note="gene_id=mCG11635.1"
FT   mRNA            complement(join(4174414..4175108,4177623..4177825,
FT                   4178247..4178347,4178448..4178626,4179077..4179318,
FT                   4179440..4179538,4181171..4181259,4181555..4181697,
FT                   4182422..4182582,4183179..4183349,4183452..4183579,
FT                   4183855..4183992,4184191..4184325,4184422..4184558,
FT                   4186573..4186639,4187024..4187155,4187445..4187474,
FT                   4188069..4188199,4188490..4188652,4188778..4188939,
FT                   4189434..4189553,4189705..4189866,4190311..4190445,
FT                   4190769..4190893,4190997..4191186,4191487..4191639,
FT                   4191901..4192017,4192137..4192227,4192329..4192429,
FT                   4192867..4192987,4193079..4193259,4193720..4193828,
FT                   4194240..4194463,4196200..4196406,4196602..4196768,
FT                   4197735..4197894,4202086..4202170,4202607..4202669,
FT                   4207162..4207293,4214518..4214572,4215086..4215212,
FT                   4216534..4216607,4228696..4228874,4230271..4230370,
FT                   4236866..4236954,4250668..4250726,4271201..4271383))
FT                   /gene="Otof"
FT                   /locus_tag="mCG_11635"
FT                   /product="otoferlin, transcript variant mCT12250"
FT                   /note="gene_id=mCG11635.1 transcript_id=mCT12250.1 created
FT                   on 16-SEP-2002"
FT   mRNA            complement(join(4174414..4175108,4178247..4178347,
FT                   4178448..4178626,4179077..4179318,4179440..4179538,
FT                   4181171..4181259,4181555..4181697,4182422..4182582,
FT                   4183179..4183349,4183452..4183579,4183855..4183992,
FT                   4184191..4184325,4184422..4184558,4186573..4186639,
FT                   4187024..4187155,4187445..4187474,4188069..4188139,
FT                   4188490..4188652,4188778..4188939,4189434..4189553,
FT                   4189705..4189866,4190311..4190445,4190769..4190893,
FT                   4190997..4191186,4191487..4191639,4191901..4192017,
FT                   4192137..4192227,4192329..4192429,4192867..4192987,
FT                   4193079..4193259,4193720..4193828,4194240..4194463,
FT                   4196200..4196406,4196602..4196768,4197735..4197894,
FT                   4202086..4202170,4202607..4202669,4207162..4207293,
FT                   4214518..4214572,4215086..4215212,4216534..4216607,
FT                   4223842..4223886,4228696..4228874,4230271..4230370,
FT                   4236866..4236954,4250668..4250726,4271201..4271383))
FT                   /gene="Otof"
FT                   /locus_tag="mCG_11635"
FT                   /product="otoferlin, transcript variant mCT173395"
FT                   /note="gene_id=mCG11635.1 transcript_id=mCT173395.0 created
FT                   on 16-SEP-2002"
FT   CDS             complement(join(4174607..4175108,4178247..4178347,
FT                   4178448..4178626,4179077..4179318,4179440..4179538,
FT                   4181171..4181259,4181555..4181697,4182422..4182582,
FT                   4183179..4183349,4183452..4183579,4183855..4183992,
FT                   4184191..4184325,4184422..4184558,4186573..4186639,
FT                   4187024..4187155,4187445..4187474,4188069..4188139,
FT                   4188490..4188652,4188778..4188939,4189434..4189553,
FT                   4189705..4189866,4190311..4190445,4190769..4190893,
FT                   4190997..4191186,4191487..4191639,4191901..4192017,
FT                   4192137..4192227,4192329..4192429,4192867..4192987,
FT                   4193079..4193259,4193720..4193828,4194240..4194463,
FT                   4196200..4196406,4196602..4196768,4197735..4197894,
FT                   4202086..4202170,4202607..4202669,4207162..4207293,
FT                   4214518..4214572,4215086..4215212,4216534..4216607,
FT                   4223842..4223886,4228696..4228874,4230271..4230370,
FT                   4236866..4236954,4250668..4250726,4271201..4271279))
FT                   /codon_start=1
FT                   /gene="Otof"
FT                   /locus_tag="mCG_11635"
FT                   /product="otoferlin, isoform CRA_a"
FT                   /note="gene_id=mCG11635.1 transcript_id=mCT173395.0
FT                   protein_id=mCP96314.0 isoform=CRA_a"
FT                   /protein_id="EDL37275.1"
FT   assembly_gap    4175109..4176062
FT                   /estimated_length=954
FT                   /gap_type="unknown"
FT   CDS             complement(join(4177645..4177825,4178247..4178347,
FT                   4178448..4178626,4179077..4179318,4179440..4179538,
FT                   4181171..4181259,4181555..4181697,4182422..4182582,
FT                   4183179..4183349,4183452..4183579,4183855..4183992,
FT                   4184191..4184325,4184422..4184558,4186573..4186639,
FT                   4187024..4187155,4187445..4187474,4188069..4188199,
FT                   4188490..4188652,4188778..4188939,4189434..4189553,
FT                   4189705..4189866,4190311..4190445,4190769..4190893,
FT                   4190997..4191186,4191487..4191639,4191901..4192017,
FT                   4192137..4192227,4192329..4192429,4192867..4192987,
FT                   4193079..4193259,4193720..4193828,4194240..4194463,
FT                   4196200..4196406,4196602..4196768,4197735..4197894,
FT                   4202086..4202170,4202607..4202669,4207162..4207293,
FT                   4214518..4214572,4215086..4215212,4216534..4216607,
FT                   4228696..4228874,4230271..4230370,4236866..4236954,
FT                   4250668..4250726,4271201..4271279))
FT                   /codon_start=1
FT                   /gene="Otof"
FT                   /locus_tag="mCG_11635"
FT                   /product="otoferlin, isoform CRA_b"
FT                   /note="gene_id=mCG11635.1 transcript_id=mCT12250.1
FT                   protein_id=mCP3992.2 isoform=CRA_b"
FT                   /protein_id="EDL37276.1"
FT                   KILGA"
FT   assembly_gap    4180662..4180863
FT                   /estimated_length=202
FT                   /gap_type="unknown"
FT   assembly_gap    4185418..4185782
FT                   /estimated_length=365
FT                   /gap_type="unknown"
FT   assembly_gap    4187493..4187579
FT                   /estimated_length=87
FT                   /gap_type="unknown"
FT   assembly_gap    4196467..4196601
FT                   /estimated_length=135
FT                   /gap_type="unknown"
FT   assembly_gap    4210570..4210589
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4211816..4211835
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4226553..4226678
FT                   /estimated_length=126
FT                   /gap_type="unknown"
FT   assembly_gap    4231774..4231874
FT                   /estimated_length=101
FT                   /gap_type="unknown"
FT   assembly_gap    4256180..4256199
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            4275525..4293569
FT                   /gene="1700001C02Rik"
FT                   /locus_tag="mCG_11646"
FT                   /note="gene_id=mCG11646.1"
FT   mRNA            join(4275525..4275666,4289867..4290137,4291558..4291670,
FT                   4293350..4293569)
FT                   /gene="1700001C02Rik"
FT                   /locus_tag="mCG_11646"
FT                   /product="RIKEN cDNA 1700001C02"
FT                   /note="gene_id=mCG11646.1 transcript_id=mCT12261.1 created
FT                   on 24-SEP-2002"
FT   CDS             join(4275593..4275666,4289867..4290137,4291558..4291670,
FT                   4293350..4293494)
FT                   /codon_start=1
FT                   /gene="1700001C02Rik"
FT                   /locus_tag="mCG_11646"
FT                   /product="RIKEN cDNA 1700001C02"
FT                   /note="gene_id=mCG11646.1 transcript_id=mCT12261.1
FT                   protein_id=mCP3911.1"
FT                   /protein_id="EDL37277.1"
FT   gene            complement(4295066..>4355652)
FT                   /locus_tag="mCG_11642"
FT                   /note="gene_id=mCG11642.1"
FT   mRNA            complement(join(4295066..4295250,4296928..4297016,
FT                   4297967..4298076,4307487..4307628,4344022..4344118,
FT                   4354482..4354516,4355542..>4355652))
FT                   /locus_tag="mCG_11642"
FT                   /product="mCG11642"
FT                   /note="gene_id=mCG11642.1 transcript_id=mCT12257.2 created
FT                   on 25-SEP-2002"
FT   CDS             complement(join(4295220..4295250,4296928..4297016,
FT                   4297967..4298076,4307487..4307628,4344022..4344118,
FT                   4354482..4354516,4355542..>4355643))
FT                   /codon_start=1
FT                   /locus_tag="mCG_11642"
FT                   /product="mCG11642"
FT                   /note="gene_id=mCG11642.1 transcript_id=mCT12257.2
FT                   protein_id=mCP3891.1"
FT                   /protein_id="EDL37278.1"
FT   assembly_gap    4305258..4305458
FT                   /estimated_length=201
FT                   /gap_type="unknown"
FT   gene            4338957..4353646
FT                   /locus_tag="mCG_148294"
FT                   /note="gene_id=mCG148294.0"
FT   mRNA            join(4338957..4339186,4350746..4353646)
FT                   /locus_tag="mCG_148294"
FT                   /product="mCG148294"
FT                   /note="gene_id=mCG148294.0 transcript_id=mCT188557.0
FT                   created on 13-JAN-2004"
FT   assembly_gap    4340513..4341817
FT                   /estimated_length=1305
FT                   /gap_type="unknown"
FT   assembly_gap    4348749..4348768
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             4351273..4351515
FT                   /codon_start=1
FT                   /locus_tag="mCG_148294"
FT                   /product="mCG148294"
FT                   /note="gene_id=mCG148294.0 transcript_id=mCT188557.0
FT                   protein_id=mCP109208.0"
FT                   /protein_id="EDL37279.1"
FT   gene            complement(4387101..>4398132)
FT                   /locus_tag="mCG_146317"
FT                   /note="gene_id=mCG146317.0"
FT   mRNA            complement(join(4387101..4388198,4389266..4389368,
FT                   4392499..4392575,4398027..>4398132))
FT                   /locus_tag="mCG_146317"
FT                   /product="mCG146317"
FT                   /note="gene_id=mCG146317.0 transcript_id=mCT186420.0
FT                   created on 14-JUL-2003"
FT   CDS             complement(4387460..>4387888)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146317"
FT                   /product="mCG146317"
FT                   /note="gene_id=mCG146317.0 transcript_id=mCT186420.0
FT                   protein_id=mCP107483.0"
FT                   /protein_id="EDL37280.1"
FT   assembly_gap    4389851..4389870
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4397520..4397539
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            4397742..4433229
FT                   /gene="Kcnk3"
FT                   /locus_tag="mCG_23503"
FT                   /note="gene_id=mCG23503.2"
FT   mRNA            join(4397742..4398255,4431636..4433229)
FT                   /gene="Kcnk3"
FT                   /locus_tag="mCG_23503"
FT                   /product="potassium channel, subfamily K, member 3"
FT                   /note="gene_id=mCG23503.2 transcript_id=mCT23412.2 created
FT                   on 02-OCT-2002"
FT   CDS             join(4397973..4398255,4431636..4432582)
FT                   /codon_start=1
FT                   /gene="Kcnk3"
FT                   /locus_tag="mCG_23503"
FT                   /product="potassium channel, subfamily K, member 3"
FT                   /note="gene_id=mCG23503.2 transcript_id=mCT23412.2
FT                   protein_id=mCP3968.2"
FT                   /protein_id="EDL37281.1"
FT                   RGLMKRRSSV"
FT   assembly_gap    4410619..4410723
FT                   /estimated_length=105
FT                   /gap_type="unknown"
FT   assembly_gap    4426268..4426287
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4441769..4441788
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4452939..4453034
FT                   /estimated_length=96
FT                   /gap_type="unknown"
FT   gene            4457734..4469521
FT                   /gene="4930471M23Rik"
FT                   /locus_tag="mCG_23502"
FT                   /note="gene_id=mCG23502.1"
FT   mRNA            join(4457734..4457890,4464540..4464612,4465287..4465458,
FT                   4465680..4465892,4466539..4466649,4467169..4469521)
FT                   /gene="4930471M23Rik"
FT                   /locus_tag="mCG_23502"
FT                   /product="RIKEN cDNA 4930471M23"
FT                   /note="gene_id=mCG23502.1 transcript_id=mCT23411.1 created
FT                   on 25-SEP-2002"
FT   CDS             join(4457814..4457890,4464540..4464612,4465287..4465458,
FT                   4465680..4465892,4466539..4466649,4467169..4467641)
FT                   /codon_start=1
FT                   /gene="4930471M23Rik"
FT                   /locus_tag="mCG_23502"
FT                   /product="RIKEN cDNA 4930471M23"
FT                   /note="gene_id=mCG23502.1 transcript_id=mCT23411.1
FT                   protein_id=mCP3965.1"
FT                   /protein_id="EDL37282.1"
FT   assembly_gap    4470281..4470300
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4474195..4474389
FT                   /estimated_length=195
FT                   /gap_type="unknown"
FT   gene            4476940..4484871
FT                   /gene="Cenpa"
FT                   /locus_tag="mCG_23505"
FT                   /note="gene_id=mCG23505.2"
FT   mRNA            join(4476940..4477158,4482509..4482615,4483027..4483104,
FT                   4483338..4483488,4484083..4484871)
FT                   /gene="Cenpa"
FT                   /locus_tag="mCG_23505"
FT                   /product="centromere protein A, transcript variant
FT                   mCT23414"
FT                   /note="gene_id=mCG23505.2 transcript_id=mCT23414.2 created
FT                   on 18-FEB-2003"
FT   mRNA            join(4476940..4477158,4479044..4479097,4479737..4479873,
FT                   4482509..4482615,4483027..4483104,4483338..4483488,
FT                   4484083..4484304)
FT                   /gene="Cenpa"
FT                   /locus_tag="mCG_23505"
FT                   /product="centromere protein A, transcript variant
FT                   mCT173428"
FT                   /note="gene_id=mCG23505.2 transcript_id=mCT173428.0 created
FT                   on 18-FEB-2003"
FT   mRNA            join(4476940..4477158,4479737..4479873,4482509..4482615,
FT                   4483027..4483104,4483338..4483488,4484083..4484258)
FT                   /gene="Cenpa"
FT                   /locus_tag="mCG_23505"
FT                   /product="centromere protein A, transcript variant
FT                   mCT173430"
FT                   /note="gene_id=mCG23505.2 transcript_id=mCT173430.0 created
FT                   on 18-FEB-2003"
FT   mRNA            join(4476940..4477158,4482509..4482615,4483027..4483104,
FT                   4484083..>4484153)
FT                   /gene="Cenpa"
FT                   /locus_tag="mCG_23505"
FT                   /product="centromere protein A, transcript variant
FT                   mCT173429"
FT                   /note="gene_id=mCG23505.2 transcript_id=mCT173429.0 created
FT                   on 18-FEB-2003"
FT   mRNA            join(<4477019..4477158,4479044..4479097,4479783..4479873,
FT                   4482509..4482615,4483027..4483104,4483338..4483488,
FT                   4484083..4484453)
FT                   /gene="Cenpa"
FT                   /locus_tag="mCG_23505"
FT                   /product="centromere protein A, transcript variant
FT                   mCT193542"
FT                   /note="gene_id=mCG23505.2 transcript_id=mCT193542.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(4477043..4477158,4482509..4482615,4483027..4483104,
FT                   4483312..4483488,4484083..4484425)
FT                   /gene="Cenpa"
FT                   /locus_tag="mCG_23505"
FT                   /product="centromere protein A, transcript variant
FT                   mCT180245"
FT                   /note="gene_id=mCG23505.2 transcript_id=mCT180245.0 created
FT                   on 18-FEB-2003"
FT   CDS             join(4477074..4477158,4482509..4482615,4483027..4483104,
FT                   4484083..>4484153)
FT                   /codon_start=1
FT                   /gene="Cenpa"
FT                   /locus_tag="mCG_23505"
FT                   /product="centromere protein A, isoform CRA_b"
FT                   /note="gene_id=mCG23505.2 transcript_id=mCT173429.0
FT                   protein_id=mCP96348.0 isoform=CRA_b"
FT                   /protein_id="EDL37284.1"
FT                   SEELAGFCC"
FT   CDS             join(4477074..4477158,4482509..4482615,4483027..4483104,
FT                   4483338..4483472)
FT                   /codon_start=1
FT                   /gene="Cenpa"
FT                   /locus_tag="mCG_23505"
FT                   /product="centromere protein A, isoform CRA_e"
FT                   /note="gene_id=mCG23505.2 transcript_id=mCT23414.2
FT                   protein_id=mCP3954.2 isoform=CRA_e"
FT                   /protein_id="EDL37287.1"
FT   CDS             join(4477074..4477158,4482509..4482615,4483027..4483104,
FT                   4483312..4483434)
FT                   /codon_start=1
FT                   /gene="Cenpa"
FT                   /locus_tag="mCG_23505"
FT                   /product="centromere protein A, isoform CRA_f"
FT                   /note="gene_id=mCG23505.2 transcript_id=mCT180245.0
FT                   protein_id=mCP103167.0 isoform=CRA_f"
FT                   /db_xref="GOA:A0A0G2JEV2"
FT                   /db_xref="InterPro:IPR000164"
FT                   /db_xref="InterPro:IPR007125"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="MGI:MGI:88375"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0G2JEV2"
FT                   /protein_id="EDL37288.1"
FT   CDS             join(4477074..4477158,4479737..4479780)
FT                   /codon_start=1
FT                   /gene="Cenpa"
FT                   /locus_tag="mCG_23505"
FT                   /product="centromere protein A, isoform CRA_c"
FT                   /note="gene_id=mCG23505.2 transcript_id=mCT173430.0
FT                   protein_id=mCP96349.0 isoform=CRA_c"
FT                   /db_xref="GOA:D6RCV6"
FT                   /db_xref="MGI:MGI:88375"
FT                   /db_xref="UniProtKB/TrEMBL:D6RCV6"
FT                   /protein_id="EDL37285.1"
FT   CDS             join(4477074..4477158,4479044..4479078)
FT                   /codon_start=1
FT                   /gene="Cenpa"
FT                   /locus_tag="mCG_23505"
FT                   /product="centromere protein A, isoform CRA_a"
FT                   /note="gene_id=mCG23505.2 transcript_id=mCT173428.0
FT                   protein_id=mCP96347.0 isoform=CRA_a"
FT                   /db_xref="GOA:D6RJ71"
FT                   /db_xref="MGI:MGI:88375"
FT                   /db_xref="UniProtKB/TrEMBL:D6RJ71"
FT                   /protein_id="EDL37283.1"
FT   CDS             join(<4479095..4479097,4479783..4479873,4482509..4482615,
FT                   4483027..4483104,4483338..4483472)
FT                   /codon_start=1
FT                   /gene="Cenpa"
FT                   /locus_tag="mCG_23505"
FT                   /product="centromere protein A, isoform CRA_d"
FT                   /note="gene_id=mCG23505.2 transcript_id=mCT193542.0
FT                   protein_id=mCP114546.0 isoform=CRA_d"
FT                   /protein_id="EDL37286.1"
FT   gene            4497634..4498061
FT                   /pseudo
FT                   /locus_tag="mCG_1046209"
FT                   /note="gene_id=mCG1046209.1"
FT   mRNA            4497634..4498061
FT                   /pseudo
FT                   /locus_tag="mCG_1046209"
FT                   /note="gene_id=mCG1046209.1 transcript_id=mCT163913.1
FT                   created on 14-OCT-2002"
FT   assembly_gap    4504610..4504712
FT                   /estimated_length=103
FT                   /gap_type="unknown"
FT   gene            4521739..4609845
FT                   /gene="Dpysl5"
FT                   /locus_tag="mCG_23504"
FT                   /note="gene_id=mCG23504.2"
FT   mRNA            join(4521739..4522177,4555531..4555795,4587663..4587821,
FT                   4588318..4588501,4589211..4589279,4591822..4591866,
FT                   4593538..4593613,4594654..4594810,4599042..4599183,
FT                   4601975..4602117,4602603..4602810,4604410..4604578,
FT                   4606713..4609445)
FT                   /gene="Dpysl5"
FT                   /locus_tag="mCG_23504"
FT                   /product="dihydropyrimidinase-like 5, transcript variant
FT                   mCT23413"
FT                   /note="gene_id=mCG23504.2 transcript_id=mCT23413.1 created
FT                   on 07-FEB-2003"
FT   mRNA            join(4521739..4522177,4555531..4555795,4587663..4587821,
FT                   4588318..4588497,4589211..4589279,4591822..4591866,
FT                   4593538..4593613,4594654..4594810,4599042..4599183,
FT                   4601975..4602117,4602603..4602810,4604410..4604578,
FT                   4606713..4609445)
FT                   /gene="Dpysl5"
FT                   /locus_tag="mCG_23504"
FT                   /product="dihydropyrimidinase-like 5, transcript variant
FT                   mCT179720"
FT                   /note="gene_id=mCG23504.2 transcript_id=mCT179720.0 created
FT                   on 07-FEB-2003"
FT   mRNA            join(4522027..4522177,4555531..4555795,4587663..4587821,
FT                   4589211..4589324,4593538..4593613,4594654..4594810,
FT                   4599042..4599187,4602496..4602810,4606713..4608804)
FT                   /gene="Dpysl5"
FT                   /locus_tag="mCG_23504"
FT                   /product="dihydropyrimidinase-like 5, transcript variant
FT                   mCT173427"
FT                   /note="gene_id=mCG23504.2 transcript_id=mCT173427.0 created
FT                   on 07-FEB-2003"
FT   mRNA            join(4522027..4522177,4555531..4555795,4587663..4587821,
FT                   4589119..4589324,4593538..4593613,4594654..4594810,
FT                   4602561..4602810,4604410..4604578,4606713..4608803)
FT                   /gene="Dpysl5"
FT                   /locus_tag="mCG_23504"
FT                   /product="dihydropyrimidinase-like 5, transcript variant
FT                   mCT173426"
FT                   /note="gene_id=mCG23504.2 transcript_id=mCT173426.0 created
FT                   on 07-FEB-2003"
FT   mRNA            join(<4522070..4522344,4555531..4555795,4587663..4587821,
FT                   4588318..4588497,4589211..4589279,4591822..4591866,
FT                   4593538..4593613,4594654..4594810,4599042..4599183,
FT                   4601975..4602117,4602603..4602810,4604410..4604578,
FT                   4606713..4609845)
FT                   /gene="Dpysl5"
FT                   /locus_tag="mCG_23504"
FT                   /product="dihydropyrimidinase-like 5, transcript variant
FT                   mCT193539"
FT                   /note="gene_id=mCG23504.2 transcript_id=mCT193539.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<4522292..4522344,4555531..4555795,4587663..4587821,
FT                   4588318..4588497,4589211..4589279,4591822..4591866,
FT                   4593538..4593613,4594654..4594810,4599042..4599183,
FT                   4601975..4602117,4602603..4602810,4604410..4604578,
FT                   4606713..4606798)
FT                   /codon_start=1
FT                   /gene="Dpysl5"
FT                   /locus_tag="mCG_23504"
FT                   /product="dihydropyrimidinase-like 5, isoform CRA_c"
FT                   /note="gene_id=mCG23504.2 transcript_id=mCT193539.0
FT                   protein_id=mCP114545.0 isoform=CRA_c"
FT                   /protein_id="EDL37291.1"
FT                   GRSSGIW"
FT   assembly_gap    4542383..4542425
FT                   /estimated_length=43
FT                   /gap_type="unknown"
FT   assembly_gap    4546275..4546416
FT                   /estimated_length=142
FT                   /gap_type="unknown"
FT   CDS             join(4555535..4555795,4587663..4587821,4588318..4588497,
FT                   4589211..4589279,4591822..4591866,4593538..4593613,
FT                   4594654..4594810,4599042..4599183,4601975..4602117,
FT                   4602603..4602810,4604410..4604578,4606713..4606798)
FT                   /codon_start=1
FT                   /gene="Dpysl5"
FT                   /locus_tag="mCG_23504"
FT                   /product="dihydropyrimidinase-like 5, isoform CRA_b"
FT                   /note="gene_id=mCG23504.2 transcript_id=mCT179720.0
FT                   protein_id=mCP102642.0 isoform=CRA_b"
FT                   /protein_id="EDL37290.1"
FT   CDS             join(4555535..4555795,4587663..4587821,4589211..4589324,
FT                   4593538..4593613,4594654..4594810,4599042..4599187,
FT                   4602496..4602560)
FT                   /codon_start=1
FT                   /gene="Dpysl5"
FT                   /locus_tag="mCG_23504"
FT                   /product="dihydropyrimidinase-like 5, isoform CRA_a"
FT                   /note="gene_id=mCG23504.2 transcript_id=mCT173427.0
FT                   protein_id=mCP96345.0 isoform=CRA_a"
FT                   /protein_id="EDL37289.1"
FT   CDS             join(4555535..4555795,4587663..4587821,4588318..4588501,
FT                   4589211..4589218)
FT                   /codon_start=1
FT                   /gene="Dpysl5"
FT                   /locus_tag="mCG_23504"
FT                   /product="dihydropyrimidinase-like 5, isoform CRA_d"
FT                   /note="gene_id=mCG23504.2 transcript_id=mCT23413.1
FT                   protein_id=mCP3985.2 isoform=CRA_d"
FT                   /protein_id="EDL37292.1"
FT   CDS             join(4555535..4555795,4587663..4587821,4589119..4589130)
FT                   /codon_start=1
FT                   /gene="Dpysl5"
FT                   /locus_tag="mCG_23504"
FT                   /product="dihydropyrimidinase-like 5, isoform CRA_e"
FT                   /note="gene_id=mCG23504.2 transcript_id=mCT173426.0
FT                   protein_id=mCP96346.0 isoform=CRA_e"
FT                   /protein_id="EDL37293.1"
FT   assembly_gap    4586754..4586908
FT                   /estimated_length=155
FT                   /gap_type="unknown"
FT   assembly_gap    4599744..4600001
FT                   /estimated_length=258
FT                   /gap_type="unknown"
FT   assembly_gap    4603400..4603419
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <4625231..4676788
FT                   /gene="Mapre3"
FT                   /locus_tag="mCG_145577"
FT                   /note="gene_id=mCG145577.1"
FT   mRNA            join(<4625231..4625375,4672490..4672617,4673181..4674088,
FT                   4675257..4675411,4675498..4675650,4675811..4676740)
FT                   /gene="Mapre3"
FT                   /locus_tag="mCG_145577"
FT                   /product="microtubule-associated protein, RP/EB family,
FT                   member 3, transcript variant mCT185001"
FT                   /note="gene_id=mCG145577.1 transcript_id=mCT185001.0
FT                   created on 05-JUN-2003"
FT   mRNA            join(<4625233..4625375,4672490..4672617,4673181..4673326,
FT                   4673887..4674088,4675257..4675411,4675498..4675650,
FT                   4675811..4676788)
FT                   /gene="Mapre3"
FT                   /locus_tag="mCG_145577"
FT                   /product="microtubule-associated protein, RP/EB family,
FT                   member 3, transcript variant mCT193635"
FT                   /note="gene_id=mCG145577.1 transcript_id=mCT193635.0
FT                   created on 09-MAR-2004"
FT   CDS             join(<4625272..4625375,4672490..4672617,4673181..4673326,
FT                   4673887..4674088,4675257..4675411,4675498..4675650,
FT                   4675811..4675879)
FT                   /codon_start=1
FT                   /gene="Mapre3"
FT                   /locus_tag="mCG_145577"
FT                   /product="microtubule-associated protein, RP/EB family,
FT                   member 3, isoform CRA_b"
FT                   /note="gene_id=mCG145577.1 transcript_id=mCT193635.0
FT                   protein_id=mCP114614.0 isoform=CRA_b"
FT                   /protein_id="EDL37295.1"
FT   assembly_gap    4642018..4642037
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4646668..4647197
FT                   /estimated_length=530
FT                   /gap_type="unknown"
FT   CDS             join(<4673797..4674088,4675257..4675411,4675498..4675650,
FT                   4675811..4675879)
FT                   /codon_start=1
FT                   /gene="Mapre3"
FT                   /locus_tag="mCG_145577"
FT                   /product="microtubule-associated protein, RP/EB family,
FT                   member 3, isoform CRA_a"
FT                   /note="gene_id=mCG145577.1 transcript_id=mCT185001.0
FT                   protein_id=mCP105608.0 isoform=CRA_a"
FT                   /protein_id="EDL37294.1"
FT                   "
FT   gene            4680017..4689047
FT                   /gene="1110039B18Rik"
FT                   /locus_tag="mCG_23493"
FT                   /note="gene_id=mCG23493.2"
FT   mRNA            join(4680017..4680501,4681272..4681471,4682103..4682253,
FT                   4682404..4682538,4682755..4682837,4683184..4683289,
FT                   4683370..4683451,4683726..4683827,4684178..4684319,
FT                   4684639..4684730,4684996..4685044,4685220..4685333,
FT                   4685534..4685651,4686473..4686569,4686730..4686898,
FT                   4687046..4687191,4687347..4688144)
FT                   /gene="1110039B18Rik"
FT                   /locus_tag="mCG_23493"
FT                   /product="RIKEN cDNA 1110039B18, transcript variant
FT                   mCT23403"
FT                   /note="gene_id=mCG23493.2 transcript_id=mCT23403.1 created
FT                   on 25-SEP-2002"
FT   mRNA            join(<4680313..4680501,4681272..4681471,4682103..4682253,
FT                   4682404..4682538,4682755..4682837,4683184..4683289,
FT                   4683370..4683827,4684178..4684319,4684639..4684730,
FT                   4684996..4685044,4685220..4685333,4685534..4685651,
FT                   4686473..4686569,4686730..4686898,4687046..4687191,
FT                   4687347..4689047)
FT                   /gene="1110039B18Rik"
FT                   /locus_tag="mCG_23493"
FT                   /product="RIKEN cDNA 1110039B18, transcript variant
FT                   mCT193620"
FT                   /note="gene_id=mCG23493.2 transcript_id=mCT193620.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(<4680322..4680420,4683749..4683827,4684178..4684319,
FT                   4684639..4684730,4684996..4685044,4685220..4685333,
FT                   4685534..4685651,4686473..4686569,4686730..4686898,
FT                   4687046..4687191,4687347..4688145)
FT                   /gene="1110039B18Rik"
FT                   /locus_tag="mCG_23493"
FT                   /product="RIKEN cDNA 1110039B18, transcript variant
FT                   mCT193621"
FT                   /note="gene_id=mCG23493.2 transcript_id=mCT193621.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<4680324..4680420,4683749..4683827,4684178..4684319,
FT                   4684639..4684730,4684996..4685044,4685220..4685333,
FT                   4685534..4685651,4686473..4686569,4686730..4686898,
FT                   4687046..4687191,4687347..4687473)
FT                   /codon_start=1
FT                   /gene="1110039B18Rik"
FT                   /locus_tag="mCG_23493"
FT                   /product="RIKEN cDNA 1110039B18, isoform CRA_b"
FT                   /note="gene_id=mCG23493.2 transcript_id=mCT193621.0
FT                   protein_id=mCP114591.0 isoform=CRA_b"
FT                   /protein_id="EDL37297.1"
FT                   DWALTMISQQ"
FT   CDS             join(4680351..4680501,4681272..4681471,4682103..4682253,
FT                   4682404..4682538,4682755..4682837,4683184..4683289,
FT                   4683370..4683451,4683726..4683827,4684178..4684319,
FT                   4684639..4684730,4684996..4685044,4685220..4685333,
FT                   4685534..4685651,4686473..4686569,4686730..4686898,
FT                   4687046..4687191,4687347..4687473)
FT                   /codon_start=1
FT                   /gene="1110039B18Rik"
FT                   /locus_tag="mCG_23493"
FT                   /product="RIKEN cDNA 1110039B18, isoform CRA_c"
FT                   /note="gene_id=mCG23493.2 transcript_id=mCT23403.1
FT                   protein_id=mCP4002.1 isoform=CRA_c"
FT                   /protein_id="EDL37298.1"
FT   CDS             join(<4683670..4683827,4684178..4684319,4684639..4684730,
FT                   4684996..4685044,4685220..4685333,4685534..4685651,
FT                   4686473..4686569,4686730..4686898,4687046..4687191,
FT                   4687347..4687473)
FT                   /codon_start=1
FT                   /gene="1110039B18Rik"
FT                   /locus_tag="mCG_23493"
FT                   /product="RIKEN cDNA 1110039B18, isoform CRA_a"
FT                   /note="gene_id=mCG23493.2 transcript_id=mCT193620.0
FT                   protein_id=mCP114590.0 isoform=CRA_a"
FT                   /protein_id="EDL37296.1"
FT                   ISQQ"
FT   assembly_gap    4692862..4692881
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            4699815..4717899
FT                   /gene="9430057O19Rik"
FT                   /locus_tag="mCG_23501"
FT                   /note="gene_id=mCG23501.3"
FT   mRNA            join(4699815..4699994,4701045..4701305,4701524..4701695,
FT                   4701985..4702148,4702738..4702915,4703363..4703541,
FT                   4703930..4704386,4704826..4704995,4705300..4705435,
FT                   4705922..4706124,4706691..4706905,4713987..4714142,
FT                   4715637..4715749,4716043..4716089,4716570..4716695,
FT                   4717050..4717898)
FT                   /gene="9430057O19Rik"
FT                   /locus_tag="mCG_23501"
FT                   /product="RIKEN cDNA 9430057O19, transcript variant
FT                   mCT23408"
FT                   /note="gene_id=mCG23501.3 transcript_id=mCT23408.2 created
FT                   on 25-SEP-2002"
FT   mRNA            join(<4699879..4700006,4701045..4701305,4701524..4701695,
FT                   4702083..4702148,4702738..4702915,4703363..4703541,
FT                   4703930..4704386,4704826..4705435,4705922..4706124,
FT                   4706691..4706905,4713987..4714142,4715637..4715749,
FT                   4716043..4716089,4716565..4716695,4717050..4717601)
FT                   /gene="9430057O19Rik"
FT                   /locus_tag="mCG_23501"
FT                   /product="RIKEN cDNA 9430057O19, transcript variant
FT                   mCT193536"
FT                   /note="gene_id=mCG23501.3 transcript_id=mCT193536.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(<4699926..4700006,4701045..4701305,4701524..4701695,
FT                   4701985..4702148,4702738..4702915,4703363..4703541,
FT                   4703930..4704386,4704826..4704995,4705300..4705435,
FT                   4705922..4706124,4706691..4706905,4713987..4714142,
FT                   4715637..4715749,4715952..4716089,4716565..4716695,
FT                   4717050..4717593)
FT                   /gene="9430057O19Rik"
FT                   /locus_tag="mCG_23501"
FT                   /product="RIKEN cDNA 9430057O19, transcript variant
FT                   mCT193537"
FT                   /note="gene_id=mCG23501.3 transcript_id=mCT193537.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<4699972..4700006,4701045..4701305,4701524..4701695,
FT                   4701985..4702148,4702738..4702915,4703363..4703541,
FT                   4703930..4704386,4704826..4704995,4705300..4705435,
FT                   4705922..4706124,4706691..4706905,4713987..4714142,
FT                   4715637..4715749,4715952..4716020)
FT                   /codon_start=1
FT                   /gene="9430057O19Rik"
FT                   /locus_tag="mCG_23501"
FT                   /product="RIKEN cDNA 9430057O19, isoform CRA_b"
FT                   /note="gene_id=mCG23501.3 transcript_id=mCT193537.0
FT                   protein_id=mCP114543.0 isoform=CRA_b"
FT                   /protein_id="EDL37300.1"
FT   CDS             join(4701091..4701305,4701524..4701695,4701985..4702148,
FT                   4702738..4702915,4703363..4703541,4703930..4704386,
FT                   4704826..4704995,4705300..4705435,4705922..4706124,
FT                   4706691..4706905,4713987..4714142,4715637..4715749,
FT                   4716043..4716089,4716570..4716695,4717050..4717221)
FT                   /codon_start=1
FT                   /gene="9430057O19Rik"
FT                   /locus_tag="mCG_23501"
FT                   /product="RIKEN cDNA 9430057O19, isoform CRA_d"
FT                   /note="gene_id=mCG23501.3 transcript_id=mCT23408.2
FT                   protein_id=mCP3902.2 isoform=CRA_d"
FT                   /protein_id="EDL37302.1"
FT   CDS             join(<4701595..4701695,4702083..4702148,4702738..4702915,
FT                   4703363..4703541,4703930..4704386,4704826..4705299)
FT                   /codon_start=1
FT                   /gene="9430057O19Rik"
FT                   /locus_tag="mCG_23501"
FT                   /product="RIKEN cDNA 9430057O19, isoform CRA_a"
FT                   /note="gene_id=mCG23501.3 transcript_id=mCT193536.0
FT                   protein_id=mCP114542.0 isoform=CRA_a"
FT                   /protein_id="EDL37299.1"
FT   mRNA            join(<4701615..4701695,4701985..4702148,4702738..4702915,
FT                   4703363..4703541,4703930..4704386,4704826..4704995,
FT                   4705300..4705435,4705922..4706124,4706691..4706905,
FT                   4713987..4714142,4715637..4715749,4716043..4716089,
FT                   4716565..4716695,4717050..4717899)
FT                   /gene="9430057O19Rik"
FT                   /locus_tag="mCG_23501"
FT                   /product="RIKEN cDNA 9430057O19, transcript variant
FT                   mCT193538"
FT                   /note="gene_id=mCG23501.3 transcript_id=mCT193538.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<4701615..4701695,4701985..4702148,4702738..4702915,
FT                   4703363..4703541,4703930..4704386,4704826..4704995,
FT                   4705300..4705435,4705922..4706124,4706691..4706905,
FT                   4713987..4714142,4715637..4715749,4716043..4716089,
FT                   4716565..4716613)
FT                   /codon_start=1
FT                   /gene="9430057O19Rik"
FT                   /locus_tag="mCG_23501"
FT                   /product="RIKEN cDNA 9430057O19, isoform CRA_c"
FT                   /note="gene_id=mCG23501.3 transcript_id=mCT193538.0
FT                   protein_id=mCP114544.0 isoform=CRA_c"
FT                   /protein_id="EDL37301.1"
FT   assembly_gap    4711125..4711144
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(4716818..4718724)
FT                   /gene="2310016E02Rik"
FT                   /locus_tag="mCG_23494"
FT                   /note="gene_id=mCG23494.1"
FT   mRNA            complement(join(4716818..4717700,4718333..4718470,
FT                   4718599..4718724))
FT                   /gene="2310016E02Rik"
FT                   /locus_tag="mCG_23494"
FT                   /product="RIKEN cDNA 2310016E02, transcript variant
FT                   mCT23404"
FT                   /note="gene_id=mCG23494.1 transcript_id=mCT23404.1 created
FT                   on 25-SEP-2002"
FT   mRNA            complement(join(4716841..4717700,4718333..4718651))
FT                   /gene="2310016E02Rik"
FT                   /locus_tag="mCG_23494"
FT                   /product="RIKEN cDNA 2310016E02, transcript variant
FT                   mCT173721"
FT                   /note="gene_id=mCG23494.1 transcript_id=mCT173721.0 created
FT                   on 25-SEP-2002"
FT   CDS             complement(4718356..4718469)
FT                   /codon_start=1
FT                   /gene="2310016E02Rik"
FT                   /locus_tag="mCG_23494"
FT                   /product="RIKEN cDNA 2310016E02, isoform CRA_a"
FT                   /note="gene_id=mCG23494.1 transcript_id=mCT173721.0
FT                   protein_id=mCP96640.0 isoform=CRA_a"
FT                   /protein_id="EDL37303.1"
FT   CDS             complement(4718356..4718469)
FT                   /codon_start=1
FT                   /gene="2310016E02Rik"
FT                   /locus_tag="mCG_23494"
FT                   /product="RIKEN cDNA 2310016E02, isoform CRA_a"
FT                   /note="gene_id=mCG23494.1 transcript_id=mCT23404.1
FT                   protein_id=mCP3914.2 isoform=CRA_a"
FT                   /protein_id="EDL37304.1"
FT   assembly_gap    4722410..4722429
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4724328..4724406
FT                   /estimated_length=79
FT                   /gap_type="unknown"
FT   gene            4724511..4732363
FT                   /gene="Emilin1"
FT                   /locus_tag="mCG_23500"
FT                   /note="gene_id=mCG23500.1"
FT   mRNA            join(4724511..4725123,4726063..4726188,4726598..4726818,
FT                   4728027..4729952,4730349..4730465,4731024..4731041,
FT                   4731173..4731310,4731708..4732363)
FT                   /gene="Emilin1"
FT                   /locus_tag="mCG_23500"
FT                   /product="elastin microfibril interfacer 1, transcript
FT                   variant mCT23410"
FT                   /note="gene_id=mCG23500.1 transcript_id=mCT23410.1 created
FT                   on 16-SEP-2002"
FT   CDS             join(4724954..4725123,4726063..4726188,4726598..4726818,
FT                   4728027..4729952,4730349..4730465,4731024..4731041,
FT                   4731173..4731310,4731708..4732045)
FT                   /codon_start=1
FT                   /gene="Emilin1"
FT                   /locus_tag="mCG_23500"
FT                   /product="elastin microfibril interfacer 1, isoform CRA_b"
FT                   /note="gene_id=mCG23500.1 transcript_id=mCT23410.1
FT                   protein_id=mCP4009.2 isoform=CRA_b"
FT                   /protein_id="EDL37306.1"
FT   mRNA            join(<4729330..4729952,4731173..4731310,4731708..4732349)
FT                   /gene="Emilin1"
FT                   /locus_tag="mCG_23500"
FT                   /product="elastin microfibril interfacer 1, transcript
FT                   variant mCT173425"
FT                   /note="gene_id=mCG23500.1 transcript_id=mCT173425.0 created
FT                   on 16-SEP-2002"
FT   CDS             join(<4729331..4729952,4731173..4731310,4731708..4732045)
FT                   /codon_start=1
FT                   /gene="Emilin1"
FT                   /locus_tag="mCG_23500"
FT                   /product="elastin microfibril interfacer 1, isoform CRA_a"
FT                   /note="gene_id=mCG23500.1 transcript_id=mCT173425.0
FT                   protein_id=mCP96344.0 isoform=CRA_a"
FT                   /protein_id="EDL37305.1"
FT   gene            4732633..4742341
FT                   /gene="Khk"
FT                   /locus_tag="mCG_23498"
FT                   /note="gene_id=mCG23498.2"
FT   mRNA            join(4732633..4733100,4735832..4735948,4737781..4737915,
FT                   4739536..4739608,4740614..>4740761)
FT                   /gene="Khk"
FT                   /locus_tag="mCG_23498"
FT                   /product="ketohexokinase, transcript variant mCT181686"
FT                   /note="gene_id=mCG23498.2 transcript_id=mCT181686.0 created
FT                   on 03-APR-2003"
FT   mRNA            join(4732691..4733100,4735832..4735948,4738115..4738249,
FT                   4739536..4739608,4740614..4740760,4741642..4741730,
FT                   4741810..4741967,4742056..4742341)
FT                   /gene="Khk"
FT                   /locus_tag="mCG_23498"
FT                   /product="ketohexokinase, transcript variant mCT23407"
FT                   /note="gene_id=mCG23498.2 transcript_id=mCT23407.1 created
FT                   on 03-APR-2003"
FT   mRNA            join(4732713..4733100,4735832..4735948,4737781..4737915,
FT                   4738115..4738249,4739536..4739608,4740614..>4740638)
FT                   /gene="Khk"
FT                   /locus_tag="mCG_23498"
FT                   /product="ketohexokinase, transcript variant mCT181685"
FT                   /note="gene_id=mCG23498.2 transcript_id=mCT181685.0 created
FT                   on 03-APR-2003"
FT   mRNA            join(4732724..4733100,4735832..4735948,4738115..4738249,
FT                   4739536..4739608,4740614..4740760,4741642..4741719,
FT                   4741802..>4741899)
FT                   /gene="Khk"
FT                   /locus_tag="mCG_23498"
FT                   /product="ketohexokinase, transcript variant mCT181688"
FT                   /note="gene_id=mCG23498.2 transcript_id=mCT181688.0 created
FT                   on 03-APR-2003"
FT   mRNA            join(4732735..4733100,4735832..4735948,4739536..4739608,
FT                   4740614..4740760,4741642..4741730,4741810..4741967,
FT                   4742056..4742341)
FT                   /gene="Khk"
FT                   /locus_tag="mCG_23498"
FT                   /product="ketohexokinase, transcript variant mCT181687"
FT                   /note="gene_id=mCG23498.2 transcript_id=mCT181687.0 created
FT                   on 03-APR-2003"
FT   CDS             join(4733009..4733100,4735832..4735948,4738115..4738249,
FT                   4739536..4739608,4740614..4740760,4741642..4741730,
FT                   4741810..4741967,4742056..4742141)
FT                   /codon_start=1
FT                   /gene="Khk"
FT                   /locus_tag="mCG_23498"
FT                   /product="ketohexokinase, isoform CRA_d"
FT                   /note="gene_id=mCG23498.2 transcript_id=mCT23407.1
FT                   protein_id=mCP3947.0 isoform=CRA_d"
FT                   /db_xref="GOA:A0A0J9YU79"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR034093"
FT                   /db_xref="MGI:MGI:1096353"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0J9YU79"
FT                   /protein_id="EDL37310.1"
FT                   CQVAGKKCGLQGFDGIV"
FT   CDS             join(4733009..4733100,4735832..4735948,4739536..4739608,
FT                   4740614..4740760,4741642..4741730,4741810..4741967,
FT                   4742056..4742141)
FT                   /codon_start=1
FT                   /gene="Khk"
FT                   /locus_tag="mCG_23498"
FT                   /product="ketohexokinase, isoform CRA_e"
FT                   /note="gene_id=mCG23498.2 transcript_id=mCT181687.0
FT                   protein_id=mCP104607.0 isoform=CRA_e"
FT                   /db_xref="GOA:A0A0J9YUK6"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR034093"
FT                   /db_xref="MGI:MGI:1096353"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0J9YUK6"
FT                   /protein_id="EDL37311.1"
FT   CDS             join(4733009..4733100,4735832..4735948,4738115..4738249,
FT                   4739536..4739608,4740614..4740760,4741642..4741719,
FT                   4741802..>4741899)
FT                   /codon_start=1
FT                   /gene="Khk"
FT                   /locus_tag="mCG_23498"
FT                   /product="ketohexokinase, isoform CRA_c"
FT                   /note="gene_id=mCG23498.2 transcript_id=mCT181688.0
FT                   protein_id=mCP104610.0 isoform=CRA_c"
FT                   /protein_id="EDL37309.1"
FT   CDS             join(4733009..4733100,4735832..4735948,4737781..4737915,
FT                   4739536..4739608,4740614..>4740761)
FT                   /codon_start=1
FT                   /gene="Khk"
FT                   /locus_tag="mCG_23498"
FT                   /product="ketohexokinase, isoform CRA_b"
FT                   /note="gene_id=mCG23498.2 transcript_id=mCT181686.0
FT                   protein_id=mCP104609.0 isoform=CRA_b"
FT                   /protein_id="EDL37308.1"
FT   CDS             join(4733009..4733100,4735832..4735948,4737781..4737915,
FT                   4738115..4738249,4739536..4739608,4740614..>4740638)
FT                   /codon_start=1
FT                   /gene="Khk"
FT                   /locus_tag="mCG_23498"
FT                   /product="ketohexokinase, isoform CRA_a"
FT                   /note="gene_id=mCG23498.2 transcript_id=mCT181685.0
FT                   protein_id=mCP104608.0 isoform=CRA_a"
FT                   /protein_id="EDL37307.1"
FT   gene            complement(4744239..4756578)
FT                   /locus_tag="mCG_23492"
FT                   /note="gene_id=mCG23492.1"
FT   mRNA            complement(join(4744239..4745088,4745260..4745381,
FT                   4745456..4745526,4745620..4745685,4746955..4747057,
FT                   4756387..4756578))
FT                   /locus_tag="mCG_23492"
FT                   /product="mCG23492, transcript variant mCT23402"
FT                   /note="gene_id=mCG23492.1 transcript_id=mCT23402.2 created
FT                   on 18-FEB-2003"
FT   mRNA            complement(join(4744243..4745088,4745260..4745381,
FT                   4745456..4745526,4745620..4745685,4746955..4747057,
FT                   4756450..4756500))
FT                   /locus_tag="mCG_23492"
FT                   /product="mCG23492, transcript variant mCT180313"
FT                   /note="gene_id=mCG23492.1 transcript_id=mCT180313.0 created
FT                   on 18-FEB-2003"
FT   CDS             complement(join(4744588..4745088,4745260..4745381,
FT                   4745456..4745526,4745620..4745685,4746955..4747040))
FT                   /codon_start=1
FT                   /locus_tag="mCG_23492"
FT                   /product="mCG23492, isoform CRA_a"
FT                   /note="gene_id=mCG23492.1 transcript_id=mCT180313.0
FT                   protein_id=mCP103235.0 isoform=CRA_a"
FT                   /protein_id="EDL37312.1"
FT                   "
FT   CDS             complement(join(4744588..4745088,4745260..4745381,
FT                   4745456..4745526,4745620..4745685,4746955..4747040))
FT                   /codon_start=1
FT                   /locus_tag="mCG_23492"
FT                   /product="mCG23492, isoform CRA_a"
FT                   /note="gene_id=mCG23492.1 transcript_id=mCT23402.2
FT                   protein_id=mCP3982.2 isoform=CRA_a"
FT                   /protein_id="EDL37313.1"
FT                   "
FT   gene            4761164..4766187
FT                   /gene="Abhd1"
FT                   /locus_tag="mCG_23497"
FT                   /note="gene_id=mCG23497.1"
FT   mRNA            join(4761164..4761340,4763981..4764141,4764441..4764623,
FT                   4764765..4764810,4764977..4765089,4765189..4765363,
FT                   4765503..4765551,4765632..4765797,4765914..4766187)
FT                   /gene="Abhd1"
FT                   /locus_tag="mCG_23497"
FT                   /product="abhydrolase domain containing 1, transcript
FT                   variant mCT23406"
FT                   /note="gene_id=mCG23497.1 transcript_id=mCT23406.1 created
FT                   on 16-SEP-2002"
FT   mRNA            join(4761184..4761340,4764441..4764623,4764765..4764810,
FT                   4764977..4765089,4765189..4765363,4765503..4765551,
FT                   4765632..4765798)
FT                   /gene="Abhd1"
FT                   /locus_tag="mCG_23497"
FT                   /product="abhydrolase domain containing 1, transcript
FT                   variant mCT173424"
FT                   /note="gene_id=mCG23497.1 transcript_id=mCT173424.0 created
FT                   on 16-SEP-2002"
FT   CDS             join(4761203..4761340,4763981..4764141,4764441..4764623,
FT                   4764765..4764810,4764977..4765089,4765189..4765279)
FT                   /codon_start=1
FT                   /gene="Abhd1"
FT                   /locus_tag="mCG_23497"
FT                   /product="abhydrolase domain containing 1, isoform CRA_b"
FT                   /note="gene_id=mCG23497.1 transcript_id=mCT23406.1
FT                   protein_id=mCP3923.2 isoform=CRA_b"
FT                   /protein_id="EDL37315.1"
FT   CDS             join(4761203..4761340,4764441..4764443)
FT                   /codon_start=1
FT                   /gene="Abhd1"
FT                   /locus_tag="mCG_23497"
FT                   /product="abhydrolase domain containing 1, isoform CRA_a"
FT                   /note="gene_id=mCG23497.1 transcript_id=mCT173424.0
FT                   protein_id=mCP96343.0 isoform=CRA_a"
FT                   /protein_id="EDL37314.1"
FT                   Q"
FT   gene            complement(4766141..4770973)
FT                   /gene="Preb"
FT                   /locus_tag="mCG_23495"
FT                   /note="gene_id=mCG23495.2"
FT   mRNA            complement(join(4766141..4766835,4767360..4767432,
FT                   4768580..4768753,4768925..4769049,4769163..4769243,
FT                   4769408..4769628,4769915..4770104,4770663..4770973))
FT                   /gene="Preb"
FT                   /locus_tag="mCG_23495"
FT                   /product="prolactin regulatory element binding, transcript
FT                   variant mCT180314"
FT                   /note="gene_id=mCG23495.2 transcript_id=mCT180314.0 created
FT                   on 18-FEB-2003"
FT   mRNA            complement(join(4766148..4766835,4767028..4767187,
FT                   4767360..4767432,4768580..4768753,4768925..4769049,
FT                   4769163..4769243,4769408..4769628,4769915..4770104,
FT                   4770663..4770932))
FT                   /gene="Preb"
FT                   /locus_tag="mCG_23495"
FT                   /product="prolactin regulatory element binding, transcript
FT                   variant mCT23405"
FT                   /note="gene_id=mCG23495.2 transcript_id=mCT23405.1 created
FT                   on 18-FEB-2003"
FT   CDS             complement(join(4766741..4766835,4767028..4767187,
FT                   4767360..4767432,4768580..4768753,4768925..4769049,
FT                   4769163..4769243,4769408..4769628,4769915..4770104,
FT                   4770663..4770797))
FT                   /codon_start=1
FT                   /gene="Preb"
FT                   /locus_tag="mCG_23495"
FT                   /product="prolactin regulatory element binding, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG23495.2 transcript_id=mCT23405.1
FT                   protein_id=mCP3904.1 isoform=CRA_c"
FT                   /db_xref="GOA:Q3UAP1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="MGI:MGI:1355326"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UAP1"
FT                   /protein_id="EDL37318.1"
FT                   GLIIVTILLLQTAFPGFL"
FT   mRNA            complement(join(<4766781..4766835,4768580..4768753,
FT                   4768925..4769049,4769163..>4769243))
FT                   /gene="Preb"
FT                   /locus_tag="mCG_23495"
FT                   /product="prolactin regulatory element binding, transcript
FT                   variant mCT173423"
FT                   /note="gene_id=mCG23495.2 transcript_id=mCT173423.0 created
FT                   on 18-FEB-2003"
FT   CDS             complement(join(<4766781..4766835,4768580..4768753,
FT                   4768925..4769049,4769163..>4769243))
FT                   /codon_start=1
FT                   /gene="Preb"
FT                   /locus_tag="mCG_23495"
FT                   /product="prolactin regulatory element binding, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG23495.2 transcript_id=mCT173423.0
FT                   protein_id=mCP96342.0 isoform=CRA_a"
FT                   /protein_id="EDL37316.1"
FT   CDS             complement(join(4766782..4766835,4767360..4767432,
FT                   4768580..4768753,4768925..4769049,4769163..4769243,
FT                   4769408..4769628,4769915..4770104,4770663..4770797))
FT                   /codon_start=1
FT                   /gene="Preb"
FT                   /locus_tag="mCG_23495"
FT                   /product="prolactin regulatory element binding, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG23495.2 transcript_id=mCT180314.0
FT                   protein_id=mCP103236.0 isoform=CRA_b"
FT                   /db_xref="GOA:D3Z3S1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="MGI:MGI:1355326"
FT                   /db_xref="UniProtKB/TrEMBL:D3Z3S1"
FT                   /protein_id="EDL37317.1"
FT                   CSCCVSALLL"
FT   assembly_gap    4778305..4778448
FT                   /estimated_length=144
FT                   /gap_type="unknown"
FT   gene            4779350..4787692
FT                   /gene="Tcf23"
FT                   /locus_tag="mCG_63988"
FT                   /note="gene_id=mCG63988.2"
FT   mRNA            join(4779350..4779671,4780749..4780991,4784156..4787692)
FT                   /gene="Tcf23"
FT                   /locus_tag="mCG_63988"
FT                   /product="transcription factor 23"
FT                   /note="gene_id=mCG63988.2 transcript_id=mCT64171.2 created
FT                   on 16-SEP-2002"
FT   CDS             join(4779453..4779671,4780749..4780991,4784156..4784323)
FT                   /codon_start=1
FT                   /gene="Tcf23"
FT                   /locus_tag="mCG_63988"
FT                   /product="transcription factor 23"
FT                   /note="gene_id=mCG63988.2 transcript_id=mCT64171.2
FT                   protein_id=mCP27017.2"
FT                   /protein_id="EDL37319.1"
FT   assembly_gap    4796474..4803376
FT                   /estimated_length=6903
FT                   /gap_type="unknown"
FT   assembly_gap    4817808..4817827
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4826523..4826857
FT                   /estimated_length=335
FT                   /gap_type="unknown"
FT   gene            complement(4839283..4852256)
FT                   /locus_tag="mCG_23491"
FT                   /note="gene_id=mCG23491.2"
FT   mRNA            complement(join(4839283..4840204,4840354..4840469,
FT                   4840660..4840763,4840965..4841143,4841265..4841351,
FT                   4842273..4842340,4842635..4842747,4843085..4843173,
FT                   4843693..4843822,4843989..4844129,4844475..4844629,
FT                   4844875..4844942,4845469..4845520,4845910..4845975,
FT                   4846281..4846763,4847844..4847922,4851039..4851201,
FT                   4852082..4852256))
FT                   /locus_tag="mCG_23491"
FT                   /product="mCG23491, transcript variant mCT23400"
FT                   /note="gene_id=mCG23491.2 transcript_id=mCT23400.2 created
FT                   on 02-OCT-2002"
FT   mRNA            complement(join(4839287..4840204,4840354..4840469,
FT                   4840660..4840763,4840965..4841143,4841265..4841351,
FT                   4842273..4842340,4842635..4842747,4843085..4843173,
FT                   4843693..4843822,4843989..4844129,4844475..4844629,
FT                   4844875..4844942,4845469..4845520,4845910..4845975,
FT                   4846281..4846790,4847844..4847922,4850960..4851129,
FT                   4852082..>4852254))
FT                   /locus_tag="mCG_23491"
FT                   /product="mCG23491, transcript variant mCT193617"
FT                   /note="gene_id=mCG23491.2 transcript_id=mCT193617.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(4839287..4840204,4840354..4840469,
FT                   4840660..4840763,4840965..4841143,4841265..4841351,
FT                   4842273..4842340,4842635..4842747,4843085..4843173,
FT                   4843693..4843822,4843989..4844129,4844475..4844629,
FT                   4844875..4844942,4845469..4845520,4845910..4845975,
FT                   4846281..4846790,4847844..4847922,4850960..4851129,
FT                   4851502..>4851580))
FT                   /locus_tag="mCG_23491"
FT                   /product="mCG23491, transcript variant mCT193616"
FT                   /note="gene_id=mCG23491.2 transcript_id=mCT193616.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(4840058..4840204,4840354..4840469,
FT                   4840660..4840763,4840965..4841143,4841265..4841351,
FT                   4842273..4842340,4842635..4842747,4843085..4843173,
FT                   4843693..4843822,4843989..4844129,4844475..4844629,
FT                   4844875..4844942,4845469..4845520,4845910..4845975,
FT                   4846281..>4846763))
FT                   /codon_start=1
FT                   /locus_tag="mCG_23491"
FT                   /product="mCG23491, isoform CRA_a"
FT                   /note="gene_id=mCG23491.2 transcript_id=mCT193616.0
FT                   protein_id=mCP114588.0 isoform=CRA_a"
FT                   /protein_id="EDL37320.1"
FT   CDS             complement(join(4840058..4840204,4840354..4840469,
FT                   4840660..4840763,4840965..4841143,4841265..4841351,
FT                   4842273..4842340,4842635..4842747,4843085..4843173,
FT                   4843693..4843822,4843989..4844129,4844475..4844629,
FT                   4844875..4844942,4845469..4845520,4845910..4845975,
FT                   4846281..>4846763))
FT                   /codon_start=1
FT                   /locus_tag="mCG_23491"
FT                   /product="mCG23491, isoform CRA_a"
FT                   /note="gene_id=mCG23491.2 transcript_id=mCT193617.0
FT                   protein_id=mCP114589.0 isoform=CRA_a"
FT                   /protein_id="EDL37321.1"
FT   CDS             complement(join(4840058..4840204,4840354..4840469,
FT                   4840660..4840763,4840965..4841143,4841265..4841351,
FT                   4842273..4842340,4842635..4842747,4843085..4843173,
FT                   4843693..4843822,4843989..4844129,4844475..4844629,
FT                   4844875..4844942,4845469..4845520,4845910..4845975,
FT                   4846281..4846670))
FT                   /codon_start=1
FT                   /locus_tag="mCG_23491"
FT                   /product="mCG23491, isoform CRA_b"
FT                   /note="gene_id=mCG23491.2 transcript_id=mCT23400.2
FT                   protein_id=mCP3971.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q5U4D8"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR018212"
FT                   /db_xref="MGI:MGI:2660847"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5U4D8"
FT                   /protein_id="EDL37322.1"
FT   assembly_gap    4841825..4841945
FT                   /estimated_length=121
FT                   /gap_type="unknown"
FT   gene            4851550..4857944
FT                   /gene="0610007C21Rik"
FT                   /locus_tag="mCG_23484"
FT                   /note="gene_id=mCG23484.1"
FT   mRNA            join(4851550..4852086,4852790..4852908,4855525..4855596,
FT                   4856091..4856212,4857283..4857380,4857585..4857944)
FT                   /gene="0610007C21Rik"
FT                   /locus_tag="mCG_23484"
FT                   /product="RIKEN cDNA 0610007C21, transcript variant
FT                   mCT23339"
FT                   /note="gene_id=mCG23484.1 transcript_id=mCT23339.1 created
FT                   on 13-FEB-2003"
FT   mRNA            join(4851565..4852086,4852790..4852908,4855525..4855596,
FT                   4855790..4855861,4856091..4856212,4857283..4857380,
FT                   4857585..4857944)
FT                   /gene="0610007C21Rik"
FT                   /locus_tag="mCG_23484"
FT                   /product="RIKEN cDNA 0610007C21, transcript variant
FT                   mCT173714"
FT                   /note="gene_id=mCG23484.1 transcript_id=mCT173714.0 created
FT                   on 13-FEB-2003"
FT   mRNA            join(4851969..4852086,4852790..4852908,4855525..4855596,
FT                   4855790..4855861,4856091..4856212,4857283..4857380,
FT                   4857637..>4857666)
FT                   /gene="0610007C21Rik"
FT                   /locus_tag="mCG_23484"
FT                   /product="RIKEN cDNA 0610007C21, transcript variant
FT                   mCT180256"
FT                   /note="gene_id=mCG23484.1 transcript_id=mCT180256.0 created
FT                   on 13-FEB-2003"
FT   mRNA            join(4851985..4852086,4852790..4852811,4855525..4855596,
FT                   4855790..4855861,4856091..4856212,4857283..4857380,
FT                   4857585..4857827)
FT                   /gene="0610007C21Rik"
FT                   /locus_tag="mCG_23484"
FT                   /product="RIKEN cDNA 0610007C21, transcript variant
FT                   mCT180257"
FT                   /note="gene_id=mCG23484.1 transcript_id=mCT180257.0 created
FT                   on 13-FEB-2003"
FT   CDS             join(4852003..4852086,4852790..4852908,4855525..4855596,
FT                   4855790..4855861,4856091..4856212,4857283..4857380,
FT                   4857585..4857689)
FT                   /codon_start=1
FT                   /gene="0610007C21Rik"
FT                   /locus_tag="mCG_23484"
FT                   /product="RIKEN cDNA 0610007C21, isoform CRA_a"
FT                   /note="gene_id=mCG23484.1 transcript_id=mCT173714.0
FT                   protein_id=mCP96633.0 isoform=CRA_a"
FT                   /db_xref="GOA:A8C1S6"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR013032"
FT                   /db_xref="MGI:MGI:1918918"
FT                   /db_xref="UniProtKB/TrEMBL:A8C1S6"
FT                   /protein_id="EDL37323.1"
FT                   S"
FT   CDS             join(4852003..4852086,4852790..4852908,4855525..4855596,
FT                   4856091..4856212,4857283..4857380,4857585..4857689)
FT                   /codon_start=1
FT                   /gene="0610007C21Rik"
FT                   /locus_tag="mCG_23484"
FT                   /product="RIKEN cDNA 0610007C21, isoform CRA_d"
FT                   /note="gene_id=mCG23484.1 transcript_id=mCT23339.1
FT                   protein_id=mCP3898.2 isoform=CRA_d"
FT                   /protein_id="EDL37326.1"
FT   CDS             join(4852003..4852086,4852790..4852908,4855525..4855596,
FT                   4855790..4855861,4856091..4856212,4857283..4857380,
FT                   4857637..>4857666)
FT                   /codon_start=1
FT                   /gene="0610007C21Rik"
FT                   /locus_tag="mCG_23484"
FT                   /product="RIKEN cDNA 0610007C21, isoform CRA_b"
FT                   /note="gene_id=mCG23484.1 transcript_id=mCT180256.0
FT                   protein_id=mCP103179.0 isoform=CRA_b"
FT                   /protein_id="EDL37324.1"
FT   CDS             join(4852003..4852086,4852790..4852811,4855525..4855529)
FT                   /codon_start=1
FT                   /gene="0610007C21Rik"
FT                   /locus_tag="mCG_23484"
FT                   /product="RIKEN cDNA 0610007C21, isoform CRA_c"
FT                   /note="gene_id=mCG23484.1 transcript_id=mCT180257.0
FT                   protein_id=mCP103178.0 isoform=CRA_c"
FT                   /protein_id="EDL37325.1"
FT   gene            4858040..4883226
FT                   /gene="Cad"
FT                   /locus_tag="mCG_23490"
FT                   /note="gene_id=mCG23490.2"
FT   mRNA            join(4858040..4858358,4858565..4858707,4861395..4861524,
FT                   4862003..4862145,4862307..4862448,4862759..4862930,
FT                   4863105..4863290,4863425..4863537,4863807..4863952,
FT                   4864154..4864285,4864443..4864676,4864783..4865004,
FT                   4865104..4865292,4865527..4865651,4865788..4865918,
FT                   4870129..4870241,4870422..4870666,4870841..4871087,
FT                   4871547..4871645,4871804..4872028,4872115..4872297,
FT                   4872456..4872674,4872960..4873127,4873736..4873918,
FT                   4874009..4874113,4876610..4876849,4877047..4877128,
FT                   4877302..4877468,4877563..4877727,4877887..4878018,
FT                   4878236..4878437,4878743..4878933,4879015..4879155,
FT                   4879339..4879464,4879834..4879930,4880554..4880598,
FT                   4880700..4880869,4880963..4881037,4881420..4881632,
FT                   4881840..4881965,4882098..4882253,4882342..4882443,
FT                   4882636..4882730,4882840..4883226)
FT                   /gene="Cad"
FT                   /locus_tag="mCG_23490"
FT                   /product="carbamoyl-phosphate synthetase 2, aspartate
FT                   transcarbamylase, and dihydroorotase, transcript variant
FT                   mCT173719"
FT                   /note="gene_id=mCG23490.2 transcript_id=mCT173719.0 created
FT                   on 25-SEP-2002"
FT   mRNA            join(4858040..4858358,4858565..4858704,4861395..4861524,
FT                   4862003..4862191,4862329..4862448,4862759..4862930,
FT                   4863105..4863290,4863425..4863537,4863807..4863952,
FT                   4864154..4864285,4864443..4864676,4864783..4865004,
FT                   4865104..4865292,4865527..4865651,4865788..4865918,
FT                   4870129..4870241,4870422..4870666,4870841..4871087,
FT                   4871547..4871645,4871804..4872028,4872115..4872297,
FT                   4872456..4872674,4872960..4873127,4873736..4873918,
FT                   4874009..4874179,4876672..4876864,4877256..4877468,
FT                   4877563..4877727,4877887..4878018,4878236..4878437,
FT                   4878743..4878940,4879040..4879253,4880931..4881115,
FT                   4881349..4881632,4881840..4881965,4882098..4882253,
FT                   4882342..4882443,4882636..4882730,4882840..4883226)
FT                   /gene="Cad"
FT                   /locus_tag="mCG_23490"
FT                   /product="carbamoyl-phosphate synthetase 2, aspartate
FT                   transcarbamylase, and dihydroorotase, transcript variant
FT                   mCT173717"
FT                   /note="gene_id=mCG23490.2 transcript_id=mCT173717.0 created
FT                   on 25-SEP-2002"
FT   mRNA            join(4858040..4858358,4858565..4858704,4861395..4861524,
FT                   4862003..4862177,4862279..4862448,4862759..4862930,
FT                   4863105..4863290,4863425..4863537,4863807..4863952,
FT                   4864154..4864285,4864443..4864676,4864783..4865004,
FT                   4865104..4865292,4865527..4865651,4865788..4865918,
FT                   4870129..4870241,4870422..4870666,4870841..4871087,
FT                   4871547..4871645,4871804..4872028,4872115..4872297,
FT                   4872456..4872674,4872960..4873127,4873736..4873918,
FT                   4874009..4874117,4876685..4876877,4877069..4877128,
FT                   4877302..4877468,4877563..4877727,4877887..4878018,
FT                   4878236..4878437,4878743..4878933,4879015..4879159,
FT                   4880458..4880598,4880700..4880869,4880963..4881037,
FT                   4881420..4881632,4881840..4881965,4882098..4882253,
FT                   4882348..4882443,4882636..4882730,4882840..4883226)
FT                   /gene="Cad"
FT                   /locus_tag="mCG_23490"
FT                   /product="carbamoyl-phosphate synthetase 2, aspartate
FT                   transcarbamylase, and dihydroorotase, transcript variant
FT                   mCT173718"
FT                   /note="gene_id=mCG23490.2 transcript_id=mCT173718.0 created
FT                   on 25-SEP-2002"
FT   mRNA            join(4858040..4858358,4858565..4858704,4861395..4861524,
FT                   4862003..4862145,4862307..4862448,4862759..4862930,
FT                   4863105..4863290,4863425..4863537,4863807..4863952,
FT                   4864154..4864285,4864443..4864676,4864783..4865004,
FT                   4865104..4865292,4865527..4865651,4865788..4865918,
FT                   4870129..4870241,4870422..4870666,4870841..4871087,
FT                   4871547..4871645,4871804..4872028,4872115..4872297,
FT                   4872456..4872674,4872960..4873127,4873736..4873918,
FT                   4874009..4874113,4876610..4876849,4877047..4877128,
FT                   4877302..4877468,4877563..4877727,4877887..4878018,
FT                   4878236..4878437,4878743..4878933,4879015..4879155,
FT                   4879339..4879440,4879834..4879930,4880554..4880598,
FT                   4880700..4880869,4880963..4881037,4881420..4881632,
FT                   4881840..4881965,4882098..4882253,4882342..4882443,
FT                   4882636..4882730,4882840..4883226)
FT                   /gene="Cad"
FT                   /locus_tag="mCG_23490"
FT                   /product="carbamoyl-phosphate synthetase 2, aspartate
FT                   transcarbamylase, and dihydroorotase, transcript variant
FT                   mCT23399"
FT                   /note="gene_id=mCG23490.2 transcript_id=mCT23399.2 created
FT                   on 25-SEP-2002"
FT   mRNA            join(4858040..4858358,4858565..4858704,4862003..4862145,
FT                   4862307..4862448,4862759..4862930,4863105..4863290,
FT                   4863686..4863952,4864154..4864285,4864443..4864676,
FT                   4864783..4865004,4865104..4865292,4865527..4865651,
FT                   4865788..4865918,4870129..4870241,4870422..4870666,
FT                   4870841..4871087,4871547..4871669,4871825..4872028,
FT                   4872115..4872297,4872456..4872674,4872960..4873127,
FT                   4873736..4873918,4874009..4874113,4876610..4876849,
FT                   4877047..4877128,4877302..4877468,4877563..4877727,
FT                   4877887..4878018,4878236..4878437,4878743..4878933,
FT                   4879015..4879155,4879834..4879930,4880673..4880869,
FT                   4880963..4881037,4881420..4881626,4881809..4881965,
FT                   4882098..4882253,4882342..4882443,4882636..4882730,
FT                   4882840..4883226)
FT                   /gene="Cad"
FT                   /locus_tag="mCG_23490"
FT                   /product="carbamoyl-phosphate synthetase 2, aspartate
FT                   transcarbamylase, and dihydroorotase, transcript variant
FT                   mCT173720"
FT                   /note="gene_id=mCG23490.2 transcript_id=mCT173720.0 created
FT                   on 25-SEP-2002"
FT   CDS             join(4858277..4858358,4858565..4858707,4861395..4861524,
FT                   4862003..4862145,4862307..4862448,4862759..4862930,
FT                   4863105..4863290,4863425..4863537,4863807..4863952,
FT                   4864154..4864285,4864443..4864676,4864783..4865004,
FT                   4865104..4865292,4865527..4865651,4865788..4865918,
FT                   4870129..4870241,4870422..4870666,4870841..4871087,
FT                   4871547..4871645,4871804..4872028,4872115..4872297,
FT                   4872456..4872674,4872960..4873127,4873736..4873918,
FT                   4874009..4874113,4876610..4876849,4877047..4877128,
FT                   4877302..4877468,4877563..4877727,4877887..4878018,
FT                   4878236..4878437,4878743..4878933,4879015..4879155,
FT                   4879339..4879464,4879834..4879930,4880554..4880598,
FT                   4880700..4880869,4880963..4881037,4881420..4881632,
FT                   4881840..4881965,4882098..4882253,4882342..4882443,
FT                   4882636..4882730,4882840..4882942)
FT                   /codon_start=1
FT                   /gene="Cad"
FT                   /locus_tag="mCG_23490"
FT                   /product="carbamoyl-phosphate synthetase 2, aspartate
FT                   transcarbamylase, and dihydroorotase, isoform CRA_d"
FT                   /note="gene_id=mCG23490.2 transcript_id=mCT173719.0
FT                   protein_id=mCP96639.0 isoform=CRA_d"
FT                   /protein_id="EDL37330.1"
FT                   TVLGRF"
FT   CDS             join(4858277..4858358,4858565..4858704,4861395..4861524,
FT                   4862003..4862145,4862307..4862448,4862759..4862930,
FT                   4863105..4863290,4863425..4863537,4863807..4863952,
FT                   4864154..4864285,4864443..4864676,4864783..4865004,
FT                   4865104..4865292,4865527..4865651,4865788..4865918,
FT                   4870129..4870241,4870422..4870666,4870841..4871087,
FT                   4871547..4871645,4871804..4872028,4872115..4872297,
FT                   4872456..4872674,4872960..4873127,4873736..4873918,
FT                   4874009..4874113,4876610..4876849,4877047..4877128,
FT                   4877302..4877468,4877563..4877727,4877887..4878018,
FT                   4878236..4878437,4878743..4878933,4879015..4879155,
FT                   4879339..4879440,4879834..4879930,4880554..4880598,
FT                   4880700..4880869,4880963..4881037,4881420..4881632,
FT                   4881840..4881965,4882098..4882253,4882342..4882443,
FT                   4882636..4882730,4882840..4882942)
FT                   /codon_start=1
FT                   /gene="Cad"
FT                   /locus_tag="mCG_23490"
FT                   /product="carbamoyl-phosphate synthetase 2, aspartate
FT                   transcarbamylase, and dihydroorotase, isoform CRA_c"
FT                   /note="gene_id=mCG23490.2 transcript_id=mCT23399.2
FT                   protein_id=mCP4018.2 isoform=CRA_c"
FT                   /db_xref="GOA:B2RQC6"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="InterPro:IPR035686"
FT                   /db_xref="InterPro:IPR036480"
FT                   /db_xref="InterPro:IPR036897"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="MGI:MGI:1916969"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2RQC6"
FT                   /protein_id="EDL37329.1"
FT   CDS             join(4858277..4858358,4858565..4858704,4861395..4861524,
FT                   4862003..4862191,4862329..4862448,4862759..4862930,
FT                   4863105..4863290,4863425..4863537,4863807..4863952,
FT                   4864154..4864285,4864443..4864676,4864783..4865004,
FT                   4865104..4865292,4865527..4865651,4865788..4865918,
FT                   4870129..4870241,4870422..4870666,4870841..4871087,
FT                   4871547..4871645,4871804..4872028,4872115..4872297,
FT                   4872456..4872674,4872960..4873127,4873736..4873918,
FT                   4874009..4874179,4876672..4876692)
FT                   /codon_start=1
FT                   /gene="Cad"
FT                   /locus_tag="mCG_23490"
FT                   /product="carbamoyl-phosphate synthetase 2, aspartate
FT                   transcarbamylase, and dihydroorotase, isoform CRA_a"
FT                   /note="gene_id=mCG23490.2 transcript_id=mCT173717.0
FT                   protein_id=mCP96636.0 isoform=CRA_a"
FT                   /protein_id="EDL37327.1"
FT   CDS             join(4858277..4858358,4858565..4858704,4861395..4861524,
FT                   4862003..4862177,4862279..4862448,4862759..4862930,
FT                   4863105..4863290,4863425..4863537,4863807..4863952,
FT                   4864154..4864285,4864443..4864676,4864783..4865004,
FT                   4865104..4865292,4865527..4865651,4865788..4865918,
FT                   4870129..4870241,4870422..4870666,4870841..4871087,
FT                   4871547..4871645,4871804..4872028,4872115..4872297,
FT                   4872456..4872674,4872960..4873127,4873736..4873918,
FT                   4874009..4874117,4876685..4876692)
FT                   /codon_start=1
FT                   /gene="Cad"
FT                   /locus_tag="mCG_23490"
FT                   /product="carbamoyl-phosphate synthetase 2, aspartate
FT                   transcarbamylase, and dihydroorotase, isoform CRA_b"
FT                   /note="gene_id=mCG23490.2 transcript_id=mCT173718.0
FT                   protein_id=mCP96637.0 isoform=CRA_b"
FT                   /protein_id="EDL37328.1"
FT   CDS             join(4858277..4858358,4858565..4858704,4862003..4862023)
FT                   /codon_start=1
FT                   /gene="Cad"
FT                   /locus_tag="mCG_23490"
FT                   /product="carbamoyl-phosphate synthetase 2, aspartate
FT                   transcarbamylase, and dihydroorotase, isoform CRA_e"
FT                   /note="gene_id=mCG23490.2 transcript_id=mCT173720.0
FT                   protein_id=mCP96638.0 isoform=CRA_e"
FT                   /protein_id="EDL37331.1"
FT   assembly_gap    4875640..4875659
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4884079..4884098
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4886734..4888059
FT                   /estimated_length=1326
FT                   /gap_type="unknown"
FT   assembly_gap    4889887..4889906
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4891986..4892005
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4893665..4893684
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4895510..4895529
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(4895858..>4904207)
FT                   /gene="Slc30a3"
FT                   /locus_tag="mCG_23488"
FT                   /note="gene_id=mCG23488.1"
FT   mRNA            complement(join(4895858..4896670,4897699..4897841,
FT                   4898055..4898160,4898358..4898556,4899067..4899220,
FT                   4899302..4899448,4899804..4899985,4903011..4903246))
FT                   /gene="Slc30a3"
FT                   /locus_tag="mCG_23488"
FT                   /product="solute carrier family 30 (zinc transporter),
FT                   member 3, transcript variant mCT23397"
FT                   /note="gene_id=mCG23488.1 transcript_id=mCT23397.1 created
FT                   on 16-SEP-2002"
FT   mRNA            complement(join(4895858..4896670,4897707..4897841,
FT                   4898055..4898160,4898358..4898556,4899067..4899220,
FT                   4899302..4899448,4899804..4899985,4903011..>4903233))
FT                   /gene="Slc30a3"
FT                   /locus_tag="mCG_23488"
FT                   /product="solute carrier family 30 (zinc transporter),
FT                   member 3, transcript variant mCT193589"
FT                   /note="gene_id=mCG23488.1 transcript_id=mCT193589.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(4896522..4896670,4897707..4897841,
FT                   4898055..4898160,4898358..4898556,4899067..4899220,
FT                   4899302..4899448,4899804..4899985,4903011..>4903231))
FT                   /codon_start=1
FT                   /gene="Slc30a3"
FT                   /locus_tag="mCG_23488"
FT                   /product="solute carrier family 30 (zinc transporter),
FT                   member 3, isoform CRA_b"
FT                   /note="gene_id=mCG23488.1 transcript_id=mCT193589.0
FT                   protein_id=mCP114587.0 isoform=CRA_b"
FT                   /protein_id="EDL37333.1"
FT   CDS             complement(join(4897699..4897841,4898055..4898160,
FT                   4898358..4898556,4899067..4899220,4899302..4899448,
FT                   4899804..4899985,4903011..4903105))
FT                   /codon_start=1
FT                   /gene="Slc30a3"
FT                   /locus_tag="mCG_23488"
FT                   /product="solute carrier family 30 (zinc transporter),
FT                   member 3, isoform CRA_c"
FT                   /note="gene_id=mCG23488.1 transcript_id=mCT23397.1
FT                   protein_id=mCP3967.1 isoform=CRA_c"
FT                   /protein_id="EDL37334.1"
FT                   E"
FT   mRNA            complement(join(<4899070..4899220,4899302..4899448,
FT                   4899804..4899985,4904127..>4904207))
FT                   /gene="Slc30a3"
FT                   /locus_tag="mCG_23488"
FT                   /product="solute carrier family 30 (zinc transporter),
FT                   member 3, transcript variant mCT173422"
FT                   /note="gene_id=mCG23488.1 transcript_id=mCT173422.0 created
FT                   on 16-SEP-2002"
FT   CDS             complement(join(<4899070..4899220,4899302..4899448,
FT                   4899804..4899985,4904127..>4904206))
FT                   /codon_start=1
FT                   /gene="Slc30a3"
FT                   /locus_tag="mCG_23488"
FT                   /product="solute carrier family 30 (zinc transporter),
FT                   member 3, isoform CRA_a"
FT                   /note="gene_id=mCG23488.1 transcript_id=mCT173422.0
FT                   protein_id=mCP96341.0 isoform=CRA_a"
FT                   /protein_id="EDL37332.1"
FT   gene            4904692..4907002
FT                   /locus_tag="mCG_148307"
FT                   /note="gene_id=mCG148307.0"
FT   mRNA            4904692..4907002
FT                   /locus_tag="mCG_148307"
FT                   /product="mCG148307"
FT                   /note="gene_id=mCG148307.0 transcript_id=mCT188570.0
FT                   created on 13-JAN-2004"
FT   CDS             4904716..4905021
FT                   /codon_start=1
FT                   /locus_tag="mCG_148307"
FT                   /product="mCG148307"
FT                   /note="gene_id=mCG148307.0 transcript_id=mCT188570.0
FT                   protein_id=mCP109219.0"
FT                   /db_xref="GOA:Q8C950"
FT                   /db_xref="MGI:MGI:3642216"
FT                   /db_xref="UniProtKB/TrEMBL:Q8C950"
FT                   /protein_id="EDL37335.1"
FT   assembly_gap    4912275..4912294
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            4918513..4922716
FT                   /gene="Dnajc5g"
FT                   /locus_tag="mCG_23483"
FT                   /note="gene_id=mCG23483.3"
FT   mRNA            join(4918513..4918613,4919079..4919194,4919687..4919900,
FT                   4920370..4920511,4921305..4921371,4921796..4922716)
FT                   /gene="Dnajc5g"
FT                   /locus_tag="mCG_23483"
FT                   /product="DnaJ (Hsp40) homolog, subfamily C, member 5
FT                   gamma"
FT                   /note="gene_id=mCG23483.3 transcript_id=mCT23338.3 created
FT                   on 13-JUN-2003"
FT   CDS             join(4919082..4919194,4919687..4919900,4920370..4920511,
FT                   4921305..4921333)
FT                   /codon_start=1
FT                   /gene="Dnajc5g"
FT                   /locus_tag="mCG_23483"
FT                   /product="DnaJ (Hsp40) homolog, subfamily C, member 5
FT                   gamma"
FT                   /note="gene_id=mCG23483.3 transcript_id=mCT23338.3
FT                   protein_id=mCP4006.2"
FT                   /db_xref="GOA:Q8C632"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="MGI:MGI:3045263"
FT                   /db_xref="UniProtKB/TrEMBL:Q8C632"
FT                   /protein_id="EDL37336.1"
FT                   ED"
FT   assembly_gap    4926261..4926280
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            4926926..4947833
FT                   /gene="Trim54"
FT                   /locus_tag="mCG_23487"
FT                   /note="gene_id=mCG23487.1"
FT   mRNA            join(4926926..4927291,4941250..4941422,4942196..4942367,
FT                   4944258..4944353,4946251..4946484,4946961..4946983,
FT                   4947096..4947220,4947329..4947421,4947685..4947833)
FT                   /gene="Trim54"
FT                   /locus_tag="mCG_23487"
FT                   /product="tripartite motif-containing 54"
FT                   /note="gene_id=mCG23487.1 transcript_id=mCT23342.1 created
FT                   on 16-SEP-2002"
FT   CDS             join(4927172..4927291,4941250..4941422,4942196..4942367,
FT                   4944258..4944353,4946251..4946484,4946961..4946983,
FT                   4947096..4947220,4947329..4947421,4947685..4947701)
FT                   /codon_start=1
FT                   /gene="Trim54"
FT                   /locus_tag="mCG_23487"
FT                   /product="tripartite motif-containing 54"
FT                   /note="gene_id=mCG23487.1 transcript_id=mCT23342.1
FT                   protein_id=mCP3955.1"
FT                   /protein_id="EDL37337.1"
FT                   LDVPEGSGLH"
FT   gene            complement(4945965..>4947552)
FT                   /locus_tag="mCG_146109"
FT                   /note="gene_id=mCG146109.0"
FT   mRNA            complement(join(4945965..4946510,4946935..4947254,
FT                   4947462..>4947552))
FT                   /locus_tag="mCG_146109"
FT                   /product="mCG146109"
FT                   /note="gene_id=mCG146109.0 transcript_id=mCT186212.0
FT                   created on 14-JUL-2003"
FT   CDS             complement(join(4946422..4946510,4946935..4947254,
FT                   4947462..>4947466))
FT                   /codon_start=1
FT                   /locus_tag="mCG_146109"
FT                   /product="mCG146109"
FT                   /note="gene_id=mCG146109.0 transcript_id=mCT186212.0
FT                   protein_id=mCP107474.0"
FT                   /protein_id="EDL37338.1"
FT   gene            complement(4948197..4949103)
FT                   /gene="Ucn"
FT                   /locus_tag="mCG_23486"
FT                   /note="gene_id=mCG23486.0"
FT   mRNA            complement(join(4948197..4948741,4949005..4949103))
FT                   /gene="Ucn"
FT                   /locus_tag="mCG_23486"
FT                   /product="urocortin"
FT                   /note="gene_id=mCG23486.0 transcript_id=mCT23341.0 created
FT                   on 16-SEP-2002"
FT   CDS             complement(4948360..4948728)
FT                   /codon_start=1
FT                   /gene="Ucn"
FT                   /locus_tag="mCG_23486"
FT                   /product="urocortin"
FT                   /note="gene_id=mCG23486.0 transcript_id=mCT23341.0
FT                   protein_id=mCP3936.1"
FT                   /db_xref="GOA:P81615"
FT                   /db_xref="InterPro:IPR000187"
FT                   /db_xref="InterPro:IPR003620"
FT                   /db_xref="InterPro:IPR018446"
FT                   /db_xref="MGI:MGI:1276123"
FT                   /db_xref="UniProtKB/Swiss-Prot:P81615"
FT                   /protein_id="EDL37339.1"
FT                   SQRERAEQNRIIFDSVGK"
FT   gene            complement(4951181..4964536)
FT                   /gene="Mpv17"
FT                   /locus_tag="mCG_126791"
FT                   /note="gene_id=mCG126791.0"
FT   mRNA            complement(join(4951181..4952060,4954910..4954962,
FT                   4955456..4955488,4955705..4955800,4955894..4955986,
FT                   4956183..4956298,4963970..4964044,4964493..4964536))
FT                   /gene="Mpv17"
FT                   /locus_tag="mCG_126791"
FT                   /product="Mpv17 transgene, kidney disease mutant,
FT                   transcript variant mCT128068"
FT                   /note="gene_id=mCG126791.0 transcript_id=mCT128068.0
FT                   created on 18-FEB-2003"
FT   mRNA            complement(join(4951668..4952060,4954910..4954962,
FT                   4955450..4955488,4955705..4955800,4955894..4955986,
FT                   4956183..4956298,4963970..4964044))
FT                   /gene="Mpv17"
FT                   /locus_tag="mCG_126791"
FT                   /product="Mpv17 transgene, kidney disease mutant,
FT                   transcript variant mCT180115"
FT                   /note="gene_id=mCG126791.0 transcript_id=mCT180115.0
FT                   created on 18-FEB-2003"
FT   mRNA            complement(join(4951868..4952060,4954910..4954962,
FT                   4955705..4955800,4955894..4955986,4956183..4956298,
FT                   4963970..4964044,4964493..>4964522))
FT                   /gene="Mpv17"
FT                   /locus_tag="mCG_126791"
FT                   /product="Mpv17 transgene, kidney disease mutant,
FT                   transcript variant mCT193578"
FT                   /note="gene_id=mCG126791.0 transcript_id=mCT193578.0
FT                   created on 09-MAR-2004"
FT   CDS             complement(join(4951991..4952060,4954910..4954962,
FT                   4955705..4955800,4955894..4955986,4956183..4956298,
FT                   4963970..4964044,4964493..>4964520))
FT                   /codon_start=1
FT                   /gene="Mpv17"
FT                   /locus_tag="mCG_126791"
FT                   /product="Mpv17 transgene, kidney disease mutant, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG126791.0 transcript_id=mCT193578.0
FT                   protein_id=mCP114519.0 isoform=CRA_c"
FT                   /protein_id="EDL37342.1"
FT                   VWNSYLSWKAHQF"
FT   CDS             complement(join(4951991..4952060,4954910..4954962,
FT                   4955456..4955488,4955705..4955800,4955894..4955986,
FT                   4956183..4956298,4963970..4964039))
FT                   /codon_start=1
FT                   /gene="Mpv17"
FT                   /locus_tag="mCG_126791"
FT                   /product="Mpv17 transgene, kidney disease mutant, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG126791.0 transcript_id=mCT128068.0
FT                   protein_id=mCP64603.1 isoform=CRA_a"
FT                   /protein_id="EDL37340.1"
FT                   VWNSYLSWKAHQF"
FT   CDS             complement(join(4951991..4952060,4954910..4954962,
FT                   4955450..4955488,4955705..4955800,4955894..4955986,
FT                   4956183..4956298,4963970..4964039))
FT                   /codon_start=1
FT                   /gene="Mpv17"
FT                   /locus_tag="mCG_126791"
FT                   /product="Mpv17 transgene, kidney disease mutant, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG126791.0 transcript_id=mCT180115.0
FT                   protein_id=mCP103037.0 isoform=CRA_b"
FT                   /db_xref="GOA:G3UVW1"
FT                   /db_xref="InterPro:IPR007248"
FT                   /db_xref="MGI:MGI:97138"
FT                   /db_xref="UniProtKB/TrEMBL:G3UVW1"
FT                   /protein_id="EDL37341.1"
FT                   AIVWNSYLSWKAHQF"
FT   assembly_gap    4959581..4959749
FT                   /estimated_length=169
FT                   /gap_type="unknown"
FT   gene            complement(4966306..4990449)
FT                   /gene="Gtf3c2"
FT                   /locus_tag="mCG_126812"
FT                   /note="gene_id=mCG126812.0"
FT   mRNA            complement(join(4966306..4968069,4968445..4968552,
FT                   4968645..4968797,4969363..4969491,4969736..4969823,
FT                   4970046..4970207,4970294..4970438,4976232..4976361,
FT                   4976707..4976732,4978042..4978150,4978335..4978446,
FT                   4978597..4978824,4979397..4979495,4980183..4980260,
FT                   4980527..4980621,4983130..4983409,4984116..4984437,
FT                   4984580..4984843,4990216..4990449))
FT                   /gene="Gtf3c2"
FT                   /locus_tag="mCG_126812"
FT                   /product="general transcription factor IIIC, polypeptide 2,
FT                   beta, transcript variant mCT128087"
FT                   /note="gene_id=mCG126812.0 transcript_id=mCT128087.1
FT                   created on 25-SEP-2002"
FT   CDS             complement(join(4967851..4968069,4968445..4968552,
FT                   4968645..4968797,4969363..4969491,4969736..4969823,
FT                   4970046..4970207,4970294..4970438,4976232..4976361,
FT                   4976707..4976732,4978042..4978150,4978335..4978446,
FT                   4978597..4978824,4979397..4979495,4980183..4980260,
FT                   4980527..4980621,4983130..4983409,4984116..4984437,
FT                   4984580..4984820))
FT                   /codon_start=1
FT                   /gene="Gtf3c2"
FT                   /locus_tag="mCG_126812"
FT                   /product="general transcription factor IIIC, polypeptide 2,
FT                   beta, isoform CRA_a"
FT                   /note="gene_id=mCG126812.0 transcript_id=mCT128087.1
FT                   protein_id=mCP64754.1 isoform=CRA_a"
FT                   /protein_id="EDL37343.1"
FT   assembly_gap    4969835..4970002
FT                   /estimated_length=168
FT                   /gap_type="unknown"
FT   mRNA            complement(join(4970003..4970207,4970294..4970438,
FT                   4976232..4976361,4976707..4976732,4978042..4978150,
FT                   4978335..4978446,4978597..4978824,4979397..4979495,
FT                   4980183..4980260,4980527..4980621,4983130..4983409,
FT                   4984116..4984437,4984580..4984843,4990216..>4990243))
FT                   /gene="Gtf3c2"
FT                   /locus_tag="mCG_126812"
FT                   /product="general transcription factor IIIC, polypeptide 2,
FT                   beta, transcript variant mCT193531"
FT                   /note="gene_id=mCG126812.0 transcript_id=mCT193531.0
FT                   created on 09-MAR-2004"
FT   CDS             complement(join(4970024..4970207,4970294..4970438,
FT                   4976232..4976361,4976707..4976732,4978042..4978150,
FT                   4978335..4978446,4978597..4978824,4979397..4979495,
FT                   4980183..4980260,4980527..4980621,4983130..4983409,
FT                   4984116..4984437,4984580..4984843,4990216..>4990243))
FT                   /codon_start=1
FT                   /gene="Gtf3c2"
FT                   /locus_tag="mCG_126812"
FT                   /product="general transcription factor IIIC, polypeptide 2,
FT                   beta, isoform CRA_b"
FT                   /note="gene_id=mCG126812.0 transcript_id=mCT193531.0
FT                   protein_id=mCP114520.0 isoform=CRA_b"
FT                   /protein_id="EDL37344.1"
FT                   DKMKI"
FT   assembly_gap    4984877..4984896
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(4997909..5003803)
FT                   /gene="Eif2b4"
FT                   /locus_tag="mCG_141150"
FT                   /note="gene_id=mCG141150.0"
FT   mRNA            complement(join(4997909..4998149,4998263..4998443,
FT                   4999919..5000096,5000231..5000358,5000709..5000811,
FT                   5000932..5001008,5001187..5001301,5001499..5001590,
FT                   5001715..5001797,5001891..5002097,5002503..5002638,
FT                   5002932..5002975,5003343..5003803))
FT                   /gene="Eif2b4"
FT                   /locus_tag="mCG_141150"
FT                   /product="eukaryotic translation initiation factor 2B,
FT                   subunit 4 delta"
FT                   /note="gene_id=mCG141150.0 transcript_id=mCT173398.0
FT                   created on 17-SEP-2002"
FT   CDS             complement(join(4997950..4998149,4998263..4998443,
FT                   4999919..5000096,5000231..5000358,5000709..5000811,
FT                   5000932..5001008,5001187..5001301,5001499..5001590,
FT                   5001715..5001797,5001891..5002097,5002503..5002638,
FT                   5002932..5002975,5003343..5003373))
FT                   /codon_start=1
FT                   /gene="Eif2b4"
FT                   /locus_tag="mCG_141150"
FT                   /product="eukaryotic translation initiation factor 2B,
FT                   subunit 4 delta"
FT                   /note="gene_id=mCG141150.0 transcript_id=mCT173398.0
FT                   protein_id=mCP96317.0"
FT                   /db_xref="GOA:Q61749"
FT                   /db_xref="InterPro:IPR000649"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="MGI:MGI:95300"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q61749"
FT                   /protein_id="EDL37345.1"
FT                   RVKSSDQ"
FT   gene            5001958..5009316
FT                   /gene="Snx17"
FT                   /locus_tag="mCG_23482"
FT                   /note="gene_id=mCG23482.1"
FT   mRNA            join(5001958..5002095,5002492..5002633,5002943..5002977,
FT                   5003331..5003815,5004219..5004293,5005146..5005263,
FT                   5005765..5005829,5006094..5006204,5006299..5006389,
FT                   5006525..5006612,5006829..5006898,5007331..5007423,
FT                   5007518..5007721,5007969..5008094,5008211..5008288,
FT                   5008418..5008492,5008584..5008625,5008706..5009316)
FT                   /gene="Snx17"
FT                   /locus_tag="mCG_23482"
FT                   /product="sorting nexin 17, transcript variant mCT23394"
FT                   /note="gene_id=mCG23482.1 transcript_id=mCT23394.2 created
FT                   on 03-FEB-2003"
FT   mRNA            join(5003677..5003815,5004219..5004293,5005146..5005263,
FT                   5005556..5005629,5005765..5005826)
FT                   /gene="Snx17"
FT                   /locus_tag="mCG_23482"
FT                   /product="sorting nexin 17, transcript variant mCT173716"
FT                   /note="gene_id=mCG23482.1 transcript_id=mCT173716.0 created
FT                   on 03-FEB-2003"
FT   mRNA            join(5003746..5003815,5005146..5005263,5005765..5005829,
FT                   5006094..>5006160)
FT                   /gene="Snx17"
FT                   /locus_tag="mCG_23482"
FT                   /product="sorting nexin 17, transcript variant mCT173715"
FT                   /note="gene_id=mCG23482.1 transcript_id=mCT173715.0 created
FT                   on 03-FEB-2003"
FT   CDS             join(5003753..5003815,5004219..5004293,5005146..5005263,
FT                   5005765..5005829,5006094..5006204,5006299..5006389,
FT                   5006525..5006612,5006829..5006898,5007331..5007423,
FT                   5007518..5007721,5007969..5008094,5008211..5008288,
FT                   5008418..5008492,5008584..5008625,5008706..5008819)
FT                   /codon_start=1
FT                   /gene="Snx17"
FT                   /locus_tag="mCG_23482"
FT                   /product="sorting nexin 17, isoform CRA_b"
FT                   /note="gene_id=mCG23482.1 transcript_id=mCT23394.2
FT                   protein_id=mCP4027.2 isoform=CRA_b"
FT                   /protein_id="EDL37347.1"
FT                   NFAFEGIGDEDL"
FT   CDS             join(5003753..5003815,5005146..5005263,5005765..5005829,
FT                   5006094..>5006160)
FT                   /codon_start=1
FT                   /gene="Snx17"
FT                   /locus_tag="mCG_23482"
FT                   /product="sorting nexin 17, isoform CRA_a"
FT                   /note="gene_id=mCG23482.1 transcript_id=mCT173715.0
FT                   protein_id=mCP96634.0 isoform=CRA_a"
FT                   /protein_id="EDL37346.1"
FT                   "
FT   CDS             join(5003753..5003815,5004219..5004293,5005146..5005263,
FT                   5005556..5005563)
FT                   /codon_start=1
FT                   /gene="Snx17"
FT                   /locus_tag="mCG_23482"
FT                   /product="sorting nexin 17, isoform CRA_c"
FT                   /note="gene_id=mCG23482.1 transcript_id=mCT173716.0
FT                   protein_id=mCP96635.0 isoform=CRA_c"
FT                   /db_xref="GOA:H3BKG9"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="InterPro:IPR028666"
FT                   /db_xref="InterPro:IPR036871"
FT                   /db_xref="InterPro:IPR037831"
FT                   /db_xref="MGI:MGI:2387801"
FT                   /db_xref="UniProtKB/TrEMBL:H3BKG9"
FT                   /protein_id="EDL37348.1"
FT   gene            complement(5009328..>5012581)
FT                   /gene="Zfp513"
FT                   /locus_tag="mCG_23477"
FT                   /note="gene_id=mCG23477.1"
FT   mRNA            complement(join(5009328..5010975,5011045..5011170,
FT                   5011931..5012258))
FT                   /gene="Zfp513"
FT                   /locus_tag="mCG_23477"
FT                   /product="zinc finger protein 513, transcript variant
FT                   mCT23389"
FT                   /note="gene_id=mCG23477.1 transcript_id=mCT23389.1 created
FT                   on 02-OCT-2002"
FT   mRNA            complement(join(5009330..5010495,5010583..5011170,
FT                   5011931..5012086,5012335..>5012581))
FT                   /gene="Zfp513"
FT                   /locus_tag="mCG_23477"
FT                   /product="zinc finger protein 513, transcript variant
FT                   mCT193554"
FT                   /note="gene_id=mCG23477.1 transcript_id=mCT193554.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(5009669..5010495,5010583..5011170,
FT                   5011931..5012086,5012335..>5012476))
FT                   /codon_start=1
FT                   /gene="Zfp513"
FT                   /locus_tag="mCG_23477"
FT                   /product="zinc finger protein 513, isoform CRA_b"
FT                   /note="gene_id=mCG23477.1 transcript_id=mCT193554.0
FT                   protein_id=mCP114541.0 isoform=CRA_b"
FT                   /protein_id="EDL37350.1"
FT   mRNA            complement(join(<5009669..5010146,5011045..5011170,
FT                   5011931..>5012135))
FT                   /gene="Zfp513"
FT                   /locus_tag="mCG_23477"
FT                   /product="zinc finger protein 513, transcript variant
FT                   mCT193553"
FT                   /note="gene_id=mCG23477.1 transcript_id=mCT193553.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(5009669..5010146,5011045..>5011076))
FT                   /codon_start=1
FT                   /gene="Zfp513"
FT                   /locus_tag="mCG_23477"
FT                   /product="zinc finger protein 513, isoform CRA_a"
FT                   /note="gene_id=mCG23477.1 transcript_id=mCT193553.0
FT                   protein_id=mCP114540.0 isoform=CRA_a"
FT                   /protein_id="EDL37349.1"
FT                   LHSDSP"
FT   CDS             complement(5009669..5010877)
FT                   /codon_start=1
FT                   /gene="Zfp513"
FT                   /locus_tag="mCG_23477"
FT                   /product="zinc finger protein 513, isoform CRA_c"
FT                   /note="gene_id=mCG23477.1 transcript_id=mCT23389.1
FT                   protein_id=mCP3950.1 isoform=CRA_c"
FT                   /protein_id="EDL37351.1"
FT                   DSP"
FT   gene            complement(5013018..5031015)
FT                   /gene="Ppm1g"
FT                   /locus_tag="mCG_23473"
FT                   /note="gene_id=mCG23473.2"
FT   mRNA            complement(join(5013018..5013632,5013920..5014022,
FT                   5014378..5014507,5014801..5015035,5015346..5015477,
FT                   5016386..5016801,5017911..5018043,5018361..5018446,
FT                   5018735..5018804,5030677..5031015))
FT                   /gene="Ppm1g"
FT                   /locus_tag="mCG_23473"
FT                   /product="protein phosphatase 1G (formerly 2C),
FT                   magnesium-dependent, gamma isoform, transcript variant
FT                   mCT23385"
FT                   /note="gene_id=mCG23473.2 transcript_id=mCT23385.2 created
FT                   on 18-FEB-2003"
FT   mRNA            complement(join(5013391..5013632,5013920..5014022,
FT                   5014378..5014507,5014801..5014824,5030677..5031002))
FT                   /gene="Ppm1g"
FT                   /locus_tag="mCG_23473"
FT                   /product="protein phosphatase 1G (formerly 2C),
FT                   magnesium-dependent, gamma isoform, transcript variant
FT                   mCT180310"
FT                   /note="gene_id=mCG23473.2 transcript_id=mCT180310.0 created
FT                   on 18-FEB-2003"
FT   CDS             complement(join(5013429..5013632,5013920..5014022,
FT                   5014378..5014507,5014801..5015035,5015346..5015477,
FT                   5016386..5016801,5017911..5018043,5018361..5018446,
FT                   5018735..5018804,5030677..5030796))
FT                   /codon_start=1
FT                   /gene="Ppm1g"
FT                   /locus_tag="mCG_23473"
FT                   /product="protein phosphatase 1G (formerly 2C),
FT                   magnesium-dependent, gamma isoform, isoform CRA_b"
FT                   /note="gene_id=mCG23473.2 transcript_id=mCT23385.2
FT                   protein_id=mCP3925.1 isoform=CRA_b"
FT                   /protein_id="EDL37353.1"
FT   CDS             complement(join(5014457..5014507,5014801..5014824,
FT                   5030677..5030796))
FT                   /codon_start=1
FT                   /gene="Ppm1g"
FT                   /locus_tag="mCG_23473"
FT                   /product="protein phosphatase 1G (formerly 2C),
FT                   magnesium-dependent, gamma isoform, isoform CRA_a"
FT                   /note="gene_id=mCG23473.2 transcript_id=mCT180310.0
FT                   protein_id=mCP103232.0 isoform=CRA_a"
FT                   /protein_id="EDL37352.1"
FT   assembly_gap    5024165..5024304
FT                   /estimated_length=140
FT                   /gap_type="unknown"
FT   gene            5051455..5062015
FT                   /gene="Nrbp"
FT                   /locus_tag="mCG_23472"
FT                   /note="gene_id=mCG23472.1"
FT   mRNA            join(5051455..5051563,5054202..5054430,5054605..5054727,
FT                   5054897..5054998,5055316..5055405,5055814..5055854,
FT                   5056202..5056296,5057793..5057876,5058135..5058193,
FT                   5058349..5058447,5060000..5060132,5060340..5060445,
FT                   5060541..5060591,5060681..5060816,5060995..5061048,
FT                   5061132..5061195,5061343..5061398,5061476..5062015)
FT                   /gene="Nrbp"
FT                   /locus_tag="mCG_23472"
FT                   /product="nuclear receptor binding protein, transcript
FT                   variant mCT23384"
FT                   /note="gene_id=mCG23472.1 transcript_id=mCT23384.2 created
FT                   on 02-OCT-2002"
FT   mRNA            join(5051470..5051564,5054200..5054434,5054603..5054728,
FT                   5054895..5055000,5055315..5055405,5056202..5056258)
FT                   /gene="Nrbp"
FT                   /locus_tag="mCG_23472"
FT                   /product="nuclear receptor binding protein, transcript
FT                   variant mCT174002"
FT                   /note="gene_id=mCG23472.1 transcript_id=mCT174002.0 created
FT                   on 02-OCT-2002"
FT   mRNA            join(<5051485..5051563,5054202..5054430,5054605..5054727,
FT                   5054897..5054998,5055316..5055405,5055814..5055854,
FT                   5056202..5056296,5056773..5056796,5057793..5057876,
FT                   5058135..5058193,5058349..5058447,5060000..5060132,
FT                   5060340..5060445,5060541..5060591,5060681..5060816,
FT                   5060995..5061048,5061132..5061195,5061343..5061398,
FT                   5061476..5062011)
FT                   /gene="Nrbp"
FT                   /locus_tag="mCG_23472"
FT                   /product="nuclear receptor binding protein, transcript
FT                   variant mCT193550"
FT                   /note="gene_id=mCG23472.1 transcript_id=mCT193550.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<5051535..5051563,5054202..5054430,5054605..5054727,
FT                   5054897..5054998,5055316..5055405,5055814..5055854,
FT                   5056202..5056296,5056773..5056796,5057793..5057876,
FT                   5058135..5058193,5058349..5058447,5060000..5060132,
FT                   5060340..5060445,5060541..5060591,5060681..5060816,
FT                   5060995..5061048,5061132..5061195,5061343..5061398,
FT                   5061476..5061580)
FT                   /codon_start=1
FT                   /gene="Nrbp"
FT                   /locus_tag="mCG_23472"
FT                   /product="nuclear receptor binding protein, isoform CRA_b"
FT                   /note="gene_id=mCG23472.1 transcript_id=mCT193550.0
FT                   protein_id=mCP114538.0 isoform=CRA_b"
FT                   /protein_id="EDL37355.1"
FT   assembly_gap    5051647..5051790
FT                   /estimated_length=144
FT                   /gap_type="unknown"
FT   CDS             join(5054221..5054430,5054605..5054727,5054897..5054998,
FT                   5055316..5055405,5055814..5055854,5056202..5056296,
FT                   5057793..5057876,5058135..5058193,5058349..5058447,
FT                   5060000..5060132,5060340..5060445,5060541..5060591,
FT                   5060681..5060816,5060995..5061048,5061132..5061195,
FT                   5061343..5061398,5061476..5061580)
FT                   /codon_start=1
FT                   /gene="Nrbp"
FT                   /locus_tag="mCG_23472"
FT                   /product="nuclear receptor binding protein, isoform CRA_d"
FT                   /note="gene_id=mCG23472.1 transcript_id=mCT23384.2
FT                   protein_id=mCP3921.2 isoform=CRA_d"
FT                   /protein_id="EDL37357.1"
FT                   FNFTRNSTLNTATVTVSS"
FT   CDS             join(5054221..5054434,5054603..5054728,5054895..5055000,
FT                   5055315..5055405,5056202..5056219)
FT                   /codon_start=1
FT                   /gene="Nrbp"
FT                   /locus_tag="mCG_23472"
FT                   /product="nuclear receptor binding protein, isoform CRA_c"
FT                   /note="gene_id=mCG23472.1 transcript_id=mCT174002.0
FT                   protein_id=mCP96921.0 isoform=CRA_c"
FT                   /protein_id="EDL37356.1"
FT   mRNA            join(<5055833..5055854,5056202..5056296,5057793..5057876,
FT                   5058135..5058157,5060073..5060132,5060340..5060445,
FT                   5060541..5060591,5060681..5060709)
FT                   /gene="Nrbp"
FT                   /locus_tag="mCG_23472"
FT                   /product="nuclear receptor binding protein, transcript
FT                   variant mCT174001"
FT                   /note="gene_id=mCG23472.1 transcript_id=mCT174001.0 created
FT                   on 02-OCT-2002"
FT   CDS             join(<5055835..5055854,5056202..5056296,5057793..5057876,
FT                   5058135..5058157,5060073..5060132,5060340..5060345)
FT                   /codon_start=1
FT                   /gene="Nrbp"
FT                   /locus_tag="mCG_23472"
FT                   /product="nuclear receptor binding protein, isoform CRA_a"
FT                   /note="gene_id=mCG23472.1 transcript_id=mCT174001.0
FT                   protein_id=mCP96920.0 isoform=CRA_a"
FT                   /protein_id="EDL37354.1"
FT   gene            <5062151..5063648
FT                   /gene="Krtcap3"
FT                   /locus_tag="mCG_23476"
FT                   /note="gene_id=mCG23476.2"
FT   mRNA            join(<5062151..5062554,5062643..5062702,5062816..5063022,
FT                   5063106..5063240,5063346..5063453,5063545..5063648)
FT                   /gene="Krtcap3"
FT                   /locus_tag="mCG_23476"
FT                   /product="keratinocyte associated protein 3, transcript
FT                   variant mCT193552"
FT                   /note="gene_id=mCG23476.2 transcript_id=mCT193552.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(5062164..5062265,5062370..5062554,5062643..5062702,
FT                   5062816..5063022,5063106..5063240,5063346..5063453,
FT                   5063545..5063648)
FT                   /gene="Krtcap3"
FT                   /locus_tag="mCG_23476"
FT                   /product="keratinocyte associated protein 3, transcript
FT                   variant mCT23388"
FT                   /note="gene_id=mCG23476.2 transcript_id=mCT23388.1 created
FT                   on 13-FEB-2003"
FT   mRNA            join(5062178..5062265,5062370..5062554,5062643..5062702,
FT                   5062816..5063022,5063106..5063240,5063346..5063453,
FT                   5063549..5063648)
FT                   /gene="Krtcap3"
FT                   /locus_tag="mCG_23476"
FT                   /product="keratinocyte associated protein 3, transcript
FT                   variant mCT180311"
FT                   /note="gene_id=mCG23476.2 transcript_id=mCT180311.0 created
FT                   on 13-FEB-2003"
FT   CDS             join(5062211..5062265,5062370..5062554,5062643..5062702,
FT                   5062816..5063022,5063106..5063240,5063346..5063453)
FT                   /codon_start=1
FT                   /gene="Krtcap3"
FT                   /locus_tag="mCG_23476"
FT                   /product="keratinocyte associated protein 3, isoform CRA_a"
FT                   /note="gene_id=mCG23476.2 transcript_id=mCT180311.0
FT                   protein_id=mCP103233.0 isoform=CRA_a"
FT                   /protein_id="EDL37358.1"
FT   CDS             join(5062211..5062265,5062370..5062554,5062643..5062702,
FT                   5062816..5063022,5063106..5063240,5063346..5063453)
FT                   /codon_start=1
FT                   /gene="Krtcap3"
FT                   /locus_tag="mCG_23476"
FT                   /product="keratinocyte associated protein 3, isoform CRA_a"
FT                   /note="gene_id=mCG23476.2 transcript_id=mCT23388.1
FT                   protein_id=mCP3928.2 isoform=CRA_a"
FT                   /protein_id="EDL37360.1"
FT   CDS             join(<5062270..5062554,5062643..5062702,5062816..5063022,
FT                   5063106..5063240,5063346..5063453)
FT                   /codon_start=1
FT                   /gene="Krtcap3"
FT                   /locus_tag="mCG_23476"
FT                   /product="keratinocyte associated protein 3, isoform CRA_b"
FT                   /note="gene_id=mCG23476.2 transcript_id=mCT193552.0
FT                   protein_id=mCP114539.0 isoform=CRA_b"
FT                   /protein_id="EDL37359.1"
FT   gene            complement(5063626..>5101642)
FT                   /gene="Ift172"
FT                   /locus_tag="mCG_23481"
FT                   /note="gene_id=mCG23481.2"
FT   mRNA            complement(join(5063626..5063875,5064004..5064095,
FT                   5064266..5064419,5064670..5064768,5064853..5064912,
FT                   5065104..5065199,5065702..5065821,5066016..5066126,
FT                   5067007..5067123,5067341..5067427,5067781..5067844,
FT                   5067967..5068076,5068264..5068362,5070843..5070972,
FT                   5071072..5071181,5071376..5071556,5071888..5071952,
FT                   5072280..5072409,5073369..5073511,5073815..5073931,
FT                   5074020..5074155,5074227..5074324,5074854..5074943,
FT                   5075765..5075909,5076090..5076210,5076362..5076440,
FT                   5076622..5076870,5077082..5077159,5077681..5077773,
FT                   5078057..5078126,5082077..5082184,5082424..5082560,
FT                   5086296..5086463,5087313..5087425,5090863..5090948,
FT                   5091110..5091213,5091406..5091459,5091788..5091949,
FT                   5093000..5093095,5093477..5093600,5094448..5094662,
FT                   5095696..5095783,5095903..5095982,5096207..5096272,
FT                   5096522..5096561,5097021..5097133,5097338..5097481,
FT                   5101562..5101603))
FT                   /gene="Ift172"
FT                   /locus_tag="mCG_23481"
FT                   /product="intraflagellar transport 172 homolog
FT                   (Chlamydomonas), transcript variant mCT23393"
FT                   /note="gene_id=mCG23481.2 transcript_id=mCT23393.1 created
FT                   on 17-SEP-2002"
FT   mRNA            complement(join(5063731..5063875,5064004..5064095,
FT                   5064266..5064419,5064670..5064768,5064853..5064912,
FT                   5065104..5065199,5065702..5065821,5066016..5066126,
FT                   5067007..5067123,5067341..5067427,5067781..5067844,
FT                   5067967..5068076,5068264..5068362,5070843..5070972,
FT                   5071072..5071181,5071376..5071556,5071888..5071952,
FT                   5072280..5072373,5073369..5073511,5073815..5073931,
FT                   5074020..5074155,5074227..5074324,5074854..5074943,
FT                   5075765..5075909,5076090..5076210,5076362..5076440,
FT                   5076622..5076870,5077082..5077159,5077681..5077773,
FT                   5078042..5078126,5082077..5082184,5082424..5082560,
FT                   5086296..5086463,5087313..5087425,5090863..5090948,
FT                   5091110..5091213,5091406..5091459,5091788..5091949,
FT                   5093000..5093095,5093477..5093600,5094448..5094662,
FT                   5095696..5095783,5095903..5095982,5096207..5096272,
FT                   5096522..5096561,5097021..5097133,5097338..5097481,
FT                   5101562..>5101642))
FT                   /gene="Ift172"
FT                   /locus_tag="mCG_23481"
FT                   /product="intraflagellar transport 172 homolog
FT                   (Chlamydomonas), transcript variant mCT193583"
FT                   /note="gene_id=mCG23481.2 transcript_id=mCT193583.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(5063786..5063875,5064004..5064095,
FT                   5064266..5064419,5064670..5064768,5064853..5064912,
FT                   5065104..5065199,5065702..5065821,5066016..5066126,
FT                   5067007..5067123,5067341..5067427,5067781..5067844,
FT                   5067967..5068076,5068264..5068362,5070843..5070972,
FT                   5071072..5071181,5071376..5071556,5071888..5071952,
FT                   5072280..5072373,5073369..5073511,5073815..5073931,
FT                   5074020..5074155,5074227..5074324,5074854..5074943,
FT                   5075765..5075909,5076090..5076210,5076362..5076440,
FT                   5076622..5076870,5077082..5077159,5077681..5077773,
FT                   5078042..5078126,5082077..5082184,5082424..5082560,
FT                   5086296..5086463,5087313..5087425,5090863..5090948,
FT                   5091110..5091213,5091406..5091459,5091788..5091949,
FT                   5093000..5093095,5093477..5093600,5094448..5094662,
FT                   5095696..5095783,5095903..5095982,5096207..5096272,
FT                   5096522..5096561,5097021..5097133,5097338..5097481,
FT                   5101562..>5101642))
FT                   /codon_start=1
FT                   /gene="Ift172"
FT                   /locus_tag="mCG_23481"
FT                   /product="intraflagellar transport 172 homolog
FT                   (Chlamydomonas), isoform CRA_a"
FT                   /note="gene_id=mCG23481.2 transcript_id=mCT193583.0
FT                   protein_id=mCP114586.0 isoform=CRA_a"
FT                   /protein_id="EDL37361.1"
FT                   STSFSFQ"
FT   CDS             complement(join(5063786..5063875,5064004..5064095,
FT                   5064266..5064419,5064670..5064768,5064853..5064912,
FT                   5065104..5065199,5065702..5065821,5066016..5066126,
FT                   5067007..5067123,5067341..5067427,5067781..5067844,
FT                   5067967..5068076,5068264..5068362,5070843..5070972,
FT                   5071072..5071181,5071376..5071556,5071888..5071952,
FT                   5072280..5072409,5073369..5073511,5073815..5073931,
FT                   5074020..5074155,5074227..5074324,5074854..5074943,
FT                   5075765..5075909,5076090..5076210,5076362..5076440,
FT                   5076622..5076870,5077082..5077159,5077681..5077773,
FT                   5078057..5078126,5082077..5082184,5082424..5082560,
FT                   5086296..5086463,5087313..5087425,5090863..5090948,
FT                   5091110..5091213,5091406..5091459,5091788..5091949,
FT                   5093000..5093095,5093477..5093600,5094448..5094662,
FT                   5095696..5095783,5095903..5095982,5096207..5096272,
FT                   5096522..5096561,5097021..5097133,5097338..5097481,
FT                   5101562..5101600))
FT                   /codon_start=1
FT                   /gene="Ift172"
FT                   /locus_tag="mCG_23481"
FT                   /product="intraflagellar transport 172 homolog
FT                   (Chlamydomonas), isoform CRA_b"
FT                   /note="gene_id=mCG23481.2 transcript_id=mCT23393.1
FT                   protein_id=mCP3908.1 isoform=CRA_b"
FT                   /protein_id="EDL37362.1"
FT                   "
FT   assembly_gap    5069147..5069270
FT                   /estimated_length=124
FT                   /gap_type="unknown"
FT   assembly_gap    5100693..5100712
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(5102843..5106505)
FT                   /gene="Fndc4"
FT                   /locus_tag="mCG_23479"
FT                   /note="gene_id=mCG23479.2"
FT   mRNA            complement(join(5102843..5104074,5104274..5104401,
FT                   5104692..5104781,5105218..5105422,5105594..5105709,
FT                   5105801..5105945,5106122..5106505))
FT                   /gene="Fndc4"
FT                   /locus_tag="mCG_23479"
FT                   /product="fibronectin type III domain containing 4,
FT                   transcript variant mCT23391"
FT                   /note="gene_id=mCG23479.2 transcript_id=mCT23391.2 created
FT                   on 18-FEB-2003"
FT   mRNA            complement(join(5103474..5103752,5104002..5104074,
FT                   5104274..5104401,5104692..5104781,5105218..5105422,
FT                   5105594..5105709,5105801..5105945,5106122..5106461))
FT                   /gene="Fndc4"
FT                   /locus_tag="mCG_23479"
FT                   /product="fibronectin type III domain containing 4,
FT                   transcript variant mCT180312"
FT                   /note="gene_id=mCG23479.2 transcript_id=mCT180312.0 created
FT                   on 18-FEB-2003"
FT   CDS             complement(join(5104039..5104074,5104274..5104401,
FT                   5104692..5104781,5105218..5105422,5105594..5105709,
FT                   5105801..5105921))
FT                   /codon_start=1
FT                   /gene="Fndc4"
FT                   /locus_tag="mCG_23479"
FT                   /product="fibronectin type III domain containing 4, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG23479.2 transcript_id=mCT23391.2
FT                   protein_id=mCP3905.1 isoform=CRA_a"
FT                   /db_xref="GOA:B9EI95"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="MGI:MGI:1917195"
FT                   /db_xref="UniProtKB/TrEMBL:B9EI95"
FT                   /protein_id="EDL37363.1"
FT                   SPSINTIDV"
FT   CDS             complement(join(5104039..5104074,5104274..5104401,
FT                   5104692..5104781,5105218..5105422,5105594..5105709,
FT                   5105801..5105921))
FT                   /codon_start=1
FT                   /gene="Fndc4"
FT                   /locus_tag="mCG_23479"
FT                   /product="fibronectin type III domain containing 4, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG23479.2 transcript_id=mCT180312.0
FT                   protein_id=mCP103234.0 isoform=CRA_a"
FT                   /db_xref="GOA:B9EI95"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="MGI:MGI:1917195"
FT                   /db_xref="UniProtKB/TrEMBL:B9EI95"
FT                   /protein_id="EDL37364.1"
FT                   SPSINTIDV"
FT   assembly_gap    5106509..5106528
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            5108101..5137580
FT                   /gene="Gckr"
FT                   /locus_tag="mCG_23480"
FT                   /note="gene_id=mCG23480.2"
FT   mRNA            join(5108101..5108260,5108746..5108901,5109295..5109363,
FT                   5110139..5110207,5110580..5110653,5111160..5111226,
FT                   5111393..5111446,5112557..5112651,5115369..5115474,
FT                   5116888..5117006,5117466..5117564,5117721..5117818,
FT                   5118155..5118231,5118585..5118681,5119236..5119333,
FT                   5119421..5119504,5134850..5134999,5136635..5136769,
FT                   5137205..5137580)
FT                   /gene="Gckr"
FT                   /locus_tag="mCG_23480"
FT                   /product="glucokinase regulatory protein, transcript
FT                   variant mCT23392"
FT                   /note="gene_id=mCG23480.2 transcript_id=mCT23392.2 created
FT                   on 07-FEB-2003"
FT   mRNA            join(5108162..5108260,5108746..5108901,5109295..5109363,
FT                   5110139..5110207,5110580..5110653,5111160..5111226,
FT                   5111393..5111446,5112557..5112651,5115369..5115474,
FT                   5116888..5117006,5117466..5117564,5117721..5117818,
FT                   5118155..5118231,5118585..5118681,5119236..5119333,
FT                   5119421..5119504,5134850..5134891,5136635..5136769,
FT                   5137205..5137578)
FT                   /gene="Gckr"
FT                   /locus_tag="mCG_23480"
FT                   /product="glucokinase regulatory protein, transcript
FT                   variant mCT179730"
FT                   /note="gene_id=mCG23480.2 transcript_id=mCT179730.0 created
FT                   on 07-FEB-2003"
FT   CDS             join(5108201..5108260,5108746..5108901,5109295..5109363,
FT                   5110139..5110207,5110580..5110653,5111160..5111226,
FT                   5111393..5111446,5112557..5112651,5115369..5115474,
FT                   5116888..5117006,5117466..5117564,5117721..5117818,
FT                   5118155..5118231,5118585..5118681,5119236..5119333,
FT                   5119421..5119504,5134850..5134999,5136635..5136769,
FT                   5137205..5137369)
FT                   /codon_start=1
FT                   /gene="Gckr"
FT                   /locus_tag="mCG_23480"
FT                   /product="glucokinase regulatory protein, isoform CRA_b"
FT                   /note="gene_id=mCG23480.2 transcript_id=mCT23392.2
FT                   protein_id=mCP3986.2 isoform=CRA_b"
FT                   /db_xref="GOA:A0A0J9YUI8"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005486"
FT                   /db_xref="MGI:MGI:1096345"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0J9YUI8"
FT                   /protein_id="EDL37366.1"
FT   CDS             join(5108201..5108260,5108746..5108901,5109295..5109363,
FT                   5110139..5110207,5110580..5110653,5111160..5111226,
FT                   5111393..5111446,5112557..5112651,5115369..5115474,
FT                   5116888..5117006,5117466..5117564,5117721..5117818,
FT                   5118155..5118231,5118585..5118681,5119236..5119333,
FT                   5119421..5119504,5134850..5134891,5136635..5136769,
FT                   5137205..5137369)
FT                   /codon_start=1
FT                   /gene="Gckr"
FT                   /locus_tag="mCG_23480"
FT                   /product="glucokinase regulatory protein, isoform CRA_a"
FT                   /note="gene_id=mCG23480.2 transcript_id=mCT179730.0
FT                   protein_id=mCP102652.0 isoform=CRA_a"
FT                   /protein_id="EDL37365.1"
FT                   SIQAFGDPVVP"
FT   assembly_gap    5112332..5112355
FT                   /estimated_length=24
FT                   /gap_type="unknown"
FT   assembly_gap    5121820..5122025
FT                   /estimated_length=206
FT                   /gap_type="unknown"
FT   assembly_gap    5142638..5142657
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5187556..5187728
FT                   /estimated_length=173
FT                   /gap_type="unknown"
FT   assembly_gap    5233983..5234008
FT                   /estimated_length=26
FT                   /gap_type="unknown"
FT   assembly_gap    5238477..5238496
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            5262578..5291319
FT                   /gene="Zfp512"
FT                   /locus_tag="mCG_141151"
FT                   /note="gene_id=mCG141151.1"
FT   mRNA            join(5262578..5262724,5263303..5263361,5275506..5275687,
FT                   5276292..5276390,5276646..5276729,5277376..5277500,
FT                   5278208..5278294,5280412..5280510,5281051..5281218,
FT                   5282824..5283015,5283507..5283608,5285685..5285789,
FT                   5286835..5286933,5290024..5291319)
FT                   /gene="Zfp512"
FT                   /locus_tag="mCG_141151"
FT                   /product="zinc finger protein 512"
FT                   /note="gene_id=mCG141151.1 transcript_id=mCT173400.1
FT                   created on 01-APR-2004"
FT   CDS             join(5262695..5262724,5263303..5263361,5275506..5275687,
FT                   5276292..5276390,5276646..5276729,5277376..5277500,
FT                   5278208..5278294,5280412..5280510,5281051..5281218,
FT                   5282824..5283015,5283507..5283608,5285685..5285789,
FT                   5286835..5286933,5290024..5290311)
FT                   /codon_start=1
FT                   /gene="Zfp512"
FT                   /locus_tag="mCG_141151"
FT                   /product="zinc finger protein 512"
FT                   /note="gene_id=mCG141151.1 transcript_id=mCT173400.1
FT                   protein_id=mCP96319.1"
FT                   /protein_id="EDL37367.1"
FT   assembly_gap    5266290..5266525
FT                   /estimated_length=236
FT                   /gap_type="unknown"
FT   assembly_gap    5268138..5268319
FT                   /estimated_length=182
FT                   /gap_type="unknown"
FT   assembly_gap    5269868..5270237
FT                   /estimated_length=370
FT                   /gap_type="unknown"
FT   gene            5295917..5298525
FT                   /gene="4930548H24Rik"
FT                   /locus_tag="mCG_142381"
FT                   /note="gene_id=mCG142381.0"
FT   mRNA            join(5295917..5296354,5297332..5298525)
FT                   /gene="4930548H24Rik"
FT                   /locus_tag="mCG_142381"
FT                   /product="RIKEN cDNA 4930548H24"
FT                   /note="gene_id=mCG142381.0 transcript_id=mCT180060.0
FT                   created on 11-FEB-2003"
FT   CDS             join(5295978..5296354,5297332..5298268)
FT                   /codon_start=1
FT                   /gene="4930548H24Rik"
FT                   /locus_tag="mCG_142381"
FT                   /product="RIKEN cDNA 4930548H24"
FT                   /note="gene_id=mCG142381.0 transcript_id=mCT180060.0
FT                   protein_id=mCP102982.0"
FT                   /db_xref="GOA:Q9D496"
FT                   /db_xref="InterPro:IPR032777"
FT                   /db_xref="MGI:MGI:1914906"
FT                   /db_xref="UniProtKB/TrEMBL:Q9D496"
FT                   /protein_id="EDL37368.1"
FT   gene            5304799..5321816
FT                   /gene="Xab1"
FT                   /locus_tag="mCG_141152"
FT                   /note="gene_id=mCG141152.0"
FT   mRNA            join(5304799..5304935,5305570..5305663,5307363..5307402,
FT                   5308392..5308458,5309319..5309356,5310906..5310984,
FT                   5311164..5311258,5313443..5313488,5314099..5314245,
FT                   5315140..5315222,5316380..5316419,5317662..5317752,
FT                   5319487..5319594,5321020..5321816)
FT                   /gene="Xab1"
FT                   /locus_tag="mCG_141152"
FT                   /product="XPA binding protein 1"
FT                   /note="gene_id=mCG141152.0 transcript_id=mCT173399.0
FT                   created on 17-SEP-2002"
FT   CDS             join(5304825..5304935,5305570..5305663,5307363..5307402,
FT                   5308392..5308458,5309319..5309356,5310906..5310984,
FT                   5311164..5311258,5313443..5313488,5314099..5314245,
FT                   5315140..5315222,5316380..5316419,5317662..5317752,
FT                   5319487..5319594,5321020..5321099)
FT                   /codon_start=1
FT                   /gene="Xab1"
FT                   /locus_tag="mCG_141152"
FT                   /product="XPA binding protein 1"
FT                   /note="gene_id=mCG141152.0 transcript_id=mCT173399.0
FT                   protein_id=mCP96318.0"
FT                   /db_xref="GOA:Q4VAB2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004130"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030230"
FT                   /db_xref="MGI:MGI:1921504"
FT                   /db_xref="UniProtKB/TrEMBL:Q4VAB2"
FT                   /protein_id="EDL37369.1"
FT   assembly_gap    5313795..5313974
FT                   /estimated_length=180
FT                   /gap_type="unknown"
FT   gene            complement(5324758..>5336921)
FT                   /gene="Supt7l"
FT                   /locus_tag="mCG_23470"
FT                   /note="gene_id=mCG23470.3"
FT   mRNA            complement(join(5324758..5326114,5328455..5328692,
FT                   5330271..5330595,5332842..5333449,5336803..5336901))
FT                   /gene="Supt7l"
FT                   /locus_tag="mCG_23470"
FT                   /product="suppressor of Ty 7 (S. cerevisiae)-like,
FT                   transcript variant mCT23337"
FT                   /note="gene_id=mCG23470.3 transcript_id=mCT23337.2 created
FT                   on 25-SEP-2002"
FT   CDS             complement(join(5325852..5326114,5328455..5328692,
FT                   5330271..5330595,5332842..5333254))
FT                   /codon_start=1
FT                   /gene="Supt7l"
FT                   /locus_tag="mCG_23470"
FT                   /product="suppressor of Ty 7 (S. cerevisiae)-like, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG23470.3 transcript_id=mCT23337.2
FT                   protein_id=mCP3937.2 isoform=CRA_b"
FT                   /protein_id="EDL37371.1"
FT                   VFNQRCRKRMRKI"
FT   mRNA            complement(join(5326687..5328692,5330271..5330595,
FT                   5332842..5333449,5336803..>5336921))
FT                   /gene="Supt7l"
FT                   /locus_tag="mCG_23470"
FT                   /product="suppressor of Ty 7 (S. cerevisiae)-like,
FT                   transcript variant mCT193544"
FT                   /note="gene_id=mCG23470.3 transcript_id=mCT193544.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(5328396..5328692,5330271..5330595,
FT                   5332842..>5333284))
FT                   /codon_start=1
FT                   /gene="Supt7l"
FT                   /locus_tag="mCG_23470"
FT                   /product="suppressor of Ty 7 (S. cerevisiae)-like, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG23470.3 transcript_id=mCT193544.0
FT                   protein_id=mCP114536.0 isoform=CRA_a"
FT                   /protein_id="EDL37370.1"
FT                   CIHFASGSAHLSTS"
FT   gene            5337185..5363995
FT                   /gene="Slc4a1ap"
FT                   /locus_tag="mCG_23471"
FT                   /note="gene_id=mCG23471.2"
FT   mRNA            join(5337185..5337370,5337411..5337753,5338112..5338307,
FT                   5340661..5340783,5342001..5342061,5342472..5342611,
FT                   5344073..5344233,5344886..5344955,5346166..5346352,
FT                   5350415..5350526,5353699..5353942,5358563..5358633,
FT                   5360665..5360734,5363691..5363995)
FT                   /gene="Slc4a1ap"
FT                   /locus_tag="mCG_23471"
FT                   /product="solute carrier family 4 (anion exchanger), member
FT                   1, adaptor protein, transcript variant mCT23336"
FT                   /note="gene_id=mCG23471.2 transcript_id=mCT23336.2 created
FT                   on 29-OCT-2002"
FT   mRNA            join(5337185..5337370,5337411..5337753,5338112..5338307,
FT                   5342001..5342061,5342472..5342611,5344073..5344477)
FT                   /gene="Slc4a1ap"
FT                   /locus_tag="mCG_23471"
FT                   /product="solute carrier family 4 (anion exchanger), member
FT                   1, adaptor protein, transcript variant mCT173713"
FT                   /note="gene_id=mCG23471.2 transcript_id=mCT173713.0 created
FT                   on 29-OCT-2002"
FT   mRNA            join(<5337199..5337753,5338112..5338307,5340661..5340783,
FT                   5342001..5342061,5342472..5342611,5344073..5344233,
FT                   5344886..5344955,5346166..5346352,5350415..5350526,
FT                   5353699..5353942,5358563..5358633,5360665..5360734,
FT                   5363691..5363995)
FT                   /gene="Slc4a1ap"
FT                   /locus_tag="mCG_23471"
FT                   /product="solute carrier family 4 (anion exchanger), member
FT                   1, adaptor protein, transcript variant mCT193549"
FT                   /note="gene_id=mCG23471.2 transcript_id=mCT193549.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<5337349..5337753,5338112..5338307,5340661..5340783,
FT                   5342001..5342061,5342472..5342611,5344073..5344233,
FT                   5344886..5344955,5346166..5346352,5350415..5350526,
FT                   5353699..5353942,5358563..5358633,5360665..5360734,
FT                   5363691..5363740)
FT                   /codon_start=1
FT                   /gene="Slc4a1ap"
FT                   /locus_tag="mCG_23471"
FT                   /product="solute carrier family 4 (anion exchanger), member
FT                   1, adaptor protein, isoform CRA_c"
FT                   /note="gene_id=mCG23471.2 transcript_id=mCT193549.0
FT                   protein_id=mCP114537.0 isoform=CRA_c partial"
FT                   /protein_id="EDL37374.1"
FT   assembly_gap    5337377..5337396
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(5337715..5337753,5338112..5338307,5340661..5340783,
FT                   5342001..5342061,5342472..5342611,5344073..5344233,
FT                   5344886..5344955,5346166..5346352,5350415..5350526,
FT                   5353699..5353942,5358563..5358633,5360665..5360734,
FT                   5363691..5363740)
FT                   /codon_start=1
FT                   /gene="Slc4a1ap"
FT                   /locus_tag="mCG_23471"
FT                   /product="solute carrier family 4 (anion exchanger), member
FT                   1, adaptor protein, isoform CRA_e"
FT                   /note="gene_id=mCG23471.2 transcript_id=mCT23336.2
FT                   protein_id=mCP3958.2 isoform=CRA_e"
FT                   /db_xref="GOA:Q5BKS1"
FT                   /db_xref="MGI:MGI:1196608"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BKS1"
FT                   /protein_id="EDL37376.1"
FT   CDS             join(5337715..5337753,5338112..5338307,5342001..5342061,
FT                   5342472..5342611,5344073..5344248)
FT                   /codon_start=1
FT                   /gene="Slc4a1ap"
FT                   /locus_tag="mCG_23471"
FT                   /product="solute carrier family 4 (anion exchanger), member
FT                   1, adaptor protein, isoform CRA_d"
FT                   /note="gene_id=mCG23471.2 transcript_id=mCT173713.0
FT                   protein_id=mCP96631.0 isoform=CRA_d"
FT                   /protein_id="EDL37375.1"
FT   assembly_gap    5340103..5340190
FT                   /estimated_length=88
FT                   /gap_type="unknown"
FT   mRNA            join(<5353623..5353942,5356209..5356295,5358563..5358633,
FT                   5360665..5360734,5363691..5363994)
FT                   /gene="Slc4a1ap"
FT                   /locus_tag="mCG_23471"
FT                   /product="solute carrier family 4 (anion exchanger), member
FT                   1, adaptor protein, transcript variant mCT173712"
FT                   /note="gene_id=mCG23471.2 transcript_id=mCT173712.0 created
FT                   on 29-OCT-2002"
FT   mRNA            join(<5353623..5353942,5358563..5358633,5360665..5360734,
FT                   5363691..5363983)
FT                   /gene="Slc4a1ap"
FT                   /locus_tag="mCG_23471"
FT                   /product="solute carrier family 4 (anion exchanger), member
FT                   1, adaptor protein, transcript variant mCT175270"
FT                   /note="gene_id=mCG23471.2 transcript_id=mCT175270.0 created
FT                   on 29-OCT-2002"
FT   CDS             join(<5353699..5353942,5356209..5356295,5358563..5358633,
FT                   5360665..5360734,5363691..5363740)
FT                   /codon_start=1
FT                   /gene="Slc4a1ap"
FT                   /locus_tag="mCG_23471"
FT                   /product="solute carrier family 4 (anion exchanger), member
FT                   1, adaptor protein, isoform CRA_a"
FT                   /note="gene_id=mCG23471.2 transcript_id=mCT173712.0
FT                   protein_id=mCP96632.0 isoform=CRA_a"
FT                   /protein_id="EDL37372.1"
FT                   RTHLNDKYGY"
FT   CDS             join(<5353699..5353942,5358563..5358633,5360665..5360734,
FT                   5363691..5363740)
FT                   /codon_start=1
FT                   /gene="Slc4a1ap"
FT                   /locus_tag="mCG_23471"
FT                   /product="solute carrier family 4 (anion exchanger), member
FT                   1, adaptor protein, isoform CRA_b"
FT                   /note="gene_id=mCG23471.2 transcript_id=mCT175270.0
FT                   protein_id=mCP98189.0 isoform=CRA_b"
FT                   /protein_id="EDL37373.1"
FT   assembly_gap    5357419..5357841
FT                   /estimated_length=423
FT                   /gap_type="unknown"
FT   gene            complement(5379548..>5381344)
FT                   /locus_tag="mCG_1046215"
FT                   /note="gene_id=mCG1046215.1"
FT   mRNA            complement(join(5379548..5380383,5380753..5380872,
FT                   5381137..>5381344))
FT                   /locus_tag="mCG_1046215"
FT                   /product="mCG1046215"
FT                   /note="gene_id=mCG1046215.1 transcript_id=mCT163919.1
FT                   created on 14-OCT-2002"
FT   CDS             complement(5379918..>5380217)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1046215"
FT                   /product="mCG1046215"
FT                   /note="gene_id=mCG1046215.1 transcript_id=mCT163919.1
FT                   protein_id=mCP64692.1"
FT                   /protein_id="EDL37377.1"
FT   gene            <5406949..5464959
FT                   /locus_tag="mCG_146108"
FT                   /note="gene_id=mCG146108.0"
FT   mRNA            join(<5406949..5407036,5418234..5418361,5451663..5453099,
FT                   5464566..5464959)
FT                   /locus_tag="mCG_146108"
FT                   /product="mCG146108"
FT                   /note="gene_id=mCG146108.0 transcript_id=mCT186211.0
FT                   created on 14-JUL-2003"
FT   assembly_gap    5407988..5408236
FT                   /estimated_length=249
FT                   /gap_type="unknown"
FT   assembly_gap    5413093..5413112
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            5423940..5432922
FT                   /gene="Mrpl33"
FT                   /locus_tag="mCG_11595"
FT                   /note="gene_id=mCG11595.2"
FT   mRNA            join(5423940..5424030,5424611..5424629,5426389..5426495,
FT                   5432386..5432922)
FT                   /gene="Mrpl33"
FT                   /locus_tag="mCG_11595"
FT                   /product="mitochondrial ribosomal protein L33, transcript
FT                   variant mCT11915"
FT                   /note="gene_id=mCG11595.2 transcript_id=mCT11915.2 created
FT                   on 18-FEB-2003"
FT   CDS             join(5424009..5424030,5424611..5424629,5426389..5426495,
FT                   5432386..5432435)
FT                   /codon_start=1
FT                   /gene="Mrpl33"
FT                   /locus_tag="mCG_11595"
FT                   /product="mitochondrial ribosomal protein L33, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG11595.2 transcript_id=mCT11915.2
FT                   protein_id=mCP3931.2 isoform=CRA_a"
FT                   /protein_id="EDL37379.1"
FT   mRNA            join(<5424020..5426495,5432386..5432651)
FT                   /gene="Mrpl33"
FT                   /locus_tag="mCG_11595"
FT                   /product="mitochondrial ribosomal protein L33, transcript
FT                   variant mCT193637"
FT                   /note="gene_id=mCG11595.2 transcript_id=mCT193637.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(<5424035..5424164,5424611..5424629,5426389..5426495,
FT                   5432386..5432629)
FT                   /gene="Mrpl33"
FT                   /locus_tag="mCG_11595"
FT                   /product="mitochondrial ribosomal protein L33, transcript
FT                   variant mCT180101"
FT                   /note="gene_id=mCG11595.2 transcript_id=mCT180101.0 created
FT                   on 18-FEB-2003"
FT   CDS             join(<5424035..5424164,5424611..5424629,5426389..5426495,
FT                   5432386..5432435)
FT                   /codon_start=1
FT                   /gene="Mrpl33"
FT                   /locus_tag="mCG_11595"
FT                   /product="mitochondrial ribosomal protein L33, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG11595.2 transcript_id=mCT180101.0
FT                   protein_id=mCP103023.0 isoform=CRA_b"
FT                   /protein_id="EDL37380.1"
FT   CDS             <5424084..5424452
FT                   /codon_start=1
FT                   /gene="Mrpl33"
FT                   /locus_tag="mCG_11595"
FT                   /product="mitochondrial ribosomal protein L33, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG11595.2 transcript_id=mCT193637.0
FT                   protein_id=mCP114610.0 isoform=CRA_c"
FT                   /protein_id="EDL37381.1"
FT                   RWQTTVDYTKTTTTTKHS"
FT   gene            complement(5434446..5507598)
FT                   /gene="Rbks"
FT                   /locus_tag="mCG_11589"
FT                   /note="gene_id=mCG11589.1"
FT   mRNA            complement(join(5434446..5434666,5457639..5457827,
FT                   5461907..5461998,5470005..5470169,5475844..5475906,
FT                   5476986..5477049,5483440..5483572,5507480..5507598))
FT                   /gene="Rbks"
FT                   /locus_tag="mCG_11589"
FT                   /product="ribokinase"
FT                   /note="gene_id=mCG11589.1 transcript_id=mCT11909.1 created
FT                   on 25-SEP-2002"
FT   CDS             complement(join(5434493..5434666,5457639..5457827,
FT                   5461907..5461998,5470005..5470169,5475844..5475906,
FT                   5476986..5477049,5483440..5483572,5507480..5507571))
FT                   /codon_start=1
FT                   /gene="Rbks"
FT                   /locus_tag="mCG_11589"
FT                   /product="ribokinase"
FT                   /note="gene_id=mCG11589.1 transcript_id=mCT11909.1
FT                   protein_id=mCP3996.1"
FT                   /protein_id="EDL37382.1"
FT   assembly_gap    5439901..5439976
FT                   /estimated_length=76
FT                   /gap_type="unknown"
FT   CDS             <5452426..5452779
FT                   /codon_start=1
FT                   /locus_tag="mCG_146108"
FT                   /product="mCG146108"
FT                   /note="gene_id=mCG146108.0 transcript_id=mCT186211.0
FT                   protein_id=mCP107473.0"
FT                   /protein_id="EDL37378.1"
FT                   SSHQNGSVSWLQR"
FT   assembly_gap    5457164..5457190
FT                   /estimated_length=27
FT                   /gap_type="unknown"
FT   assembly_gap    5459923..5460332
FT                   /estimated_length=410
FT                   /gap_type="unknown"
FT   gene            <5465594..5473556
FT                   /locus_tag="mCG_145570"
FT                   /note="gene_id=mCG145570.0"
FT   mRNA            join(<5465594..5465618,5467883..5468073,5472256..5472339,
FT                   5473015..5473556)
FT                   /locus_tag="mCG_145570"
FT                   /product="mCG145570"
FT                   /note="gene_id=mCG145570.0 transcript_id=mCT184994.0
FT                   created on 05-JUN-2003"
FT   assembly_gap    5471261..5471280
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             <5473280..5473453
FT                   /codon_start=1
FT                   /locus_tag="mCG_145570"
FT                   /product="mCG145570"
FT                   /note="gene_id=mCG145570.0 transcript_id=mCT184994.0
FT                   protein_id=mCP105600.0"
FT                   /protein_id="EDL37383.1"
FT                   HNRHFGSQERKN"
FT   gene            <5508020..5887816
FT                   /gene="Bre"
FT                   /locus_tag="mCG_142373"
FT                   /note="gene_id=mCG142373.0"
FT   mRNA            join(5508020..5508047,5511796..5511947,5540931..5541007,
FT                   5595584..5595678,5630668..5630862,5641248..5641322,
FT                   5711284..5711393,5804407..5804506,5807756..5807826,
FT                   5810281..5810363,5860634..5860787,5887658..5887816)
FT                   /gene="Bre"
FT                   /locus_tag="mCG_142373"
FT                   /product="brain and reproductive organ-expressed protein,
FT                   transcript variant mCT180049"
FT                   /note="gene_id=mCG142373.0 transcript_id=mCT180049.0
FT                   created on 11-FEB-2003"
FT   mRNA            join(<5508020..5508047,5511796..5511897,5512001..5512073,
FT                   5540432..5540519,5540931..5541007,5595584..5595678,
FT                   5630668..5630862,5641248..5641322,5711284..5711393,
FT                   5804407..5804506,5807756..5807826,5810281..5810363,
FT                   5860634..5860787,5887658..5887816)
FT                   /gene="Bre"
FT                   /locus_tag="mCG_142373"
FT                   /product="brain and reproductive organ-expressed protein,
FT                   transcript variant mCT193614"
FT                   /note="gene_id=mCG142373.0 transcript_id=mCT193614.0
FT                   created on 09-MAR-2004"
FT   mRNA            join(<5508020..5508047,5512001..5512073,5540432..5540519,
FT                   5540931..5541007,5595584..5595678,5630668..5630862,
FT                   5641248..5641322,5711284..5711393,5804407..5804506,
FT                   5807756..5807826,5810281..5810363,5860634..5860787,
FT                   5887658..5887816)
FT                   /gene="Bre"
FT                   /locus_tag="mCG_142373"
FT                   /product="brain and reproductive organ-expressed protein,
FT                   transcript variant mCT193615"
FT                   /note="gene_id=mCG142373.0 transcript_id=mCT193615.0
FT                   created on 09-MAR-2004"
FT   mRNA            join(<5508020..5508047,5512001..5512073,5540931..5541007,
FT                   5595584..5595678,5630668..5630862,5641248..5641322,
FT                   5711284..5711393,5804407..5804506,5807756..5807826,
FT                   5810281..5810363,5860634..5860787,5887658..5887816)
FT                   /gene="Bre"
FT                   /locus_tag="mCG_142373"
FT                   /product="brain and reproductive organ-expressed protein,
FT                   transcript variant mCT193612"
FT                   /note="gene_id=mCG142373.0 transcript_id=mCT193612.0
FT                   created on 09-MAR-2004"
FT   mRNA            join(<5508020..5508047,5512001..5512073,5595584..5595678,
FT                   5630668..5630862,5641248..5641322,5711284..5711393,
FT                   5804407..5804506,5807756..5807826,5810281..5810363,
FT                   5860634..5860787,5887658..5887816)
FT                   /gene="Bre"
FT                   /locus_tag="mCG_142373"
FT                   /product="brain and reproductive organ-expressed protein,
FT                   transcript variant mCT193613"
FT                   /note="gene_id=mCG142373.0 transcript_id=mCT193613.0
FT                   created on 09-MAR-2004"
FT   CDS             join(<5508021..5508047,5512001..5512073,5540432..5540519,
FT                   5540931..5541007,5595584..5595678,5630668..5630862,
FT                   5641248..5641322,5711284..5711393,5804407..5804506,
FT                   5807756..5807826,5810281..5810363,5860634..5860787,
FT                   5887658..5887721)
FT                   /codon_start=1
FT                   /gene="Bre"
FT                   /locus_tag="mCG_142373"
FT                   /product="brain and reproductive organ-expressed protein,
FT                   isoform CRA_d"
FT                   /note="gene_id=mCG142373.0 transcript_id=mCT193615.0
FT                   protein_id=mCP114572.0 isoform=CRA_d"
FT                   /protein_id="EDL37387.1"
FT                   NGKL"
FT   CDS             join(<5508021..5508047,5512001..5512073,5595584..5595678,
FT                   5630668..5630862,5641248..5641322,5711284..5711393,
FT                   5804407..5804506,5807756..5807826,5810281..5810363,
FT                   5860634..5860787,5887658..5887721)
FT                   /codon_start=1
FT                   /gene="Bre"
FT                   /locus_tag="mCG_142373"
FT                   /product="brain and reproductive organ-expressed protein,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG142373.0 transcript_id=mCT193613.0
FT                   protein_id=mCP114570.0 isoform=CRA_b"
FT                   /protein_id="EDL37385.1"
FT                   AAFANGKL"
FT   CDS             join(<5511802..5511897,5512001..5512073,5540432..5540519,
FT                   5540931..5541007,5595584..5595678,5630668..5630862,
FT                   5641248..5641322,5711284..5711393,5804407..5804506,
FT                   5807756..5807826,5810281..5810363,5860634..5860787,
FT                   5887658..5887721)
FT                   /codon_start=1
FT                   /gene="Bre"
FT                   /locus_tag="mCG_142373"
FT                   /product="brain and reproductive organ-expressed protein,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG142373.0 transcript_id=mCT193614.0
FT                   protein_id=mCP114571.0 isoform=CRA_c"
FT                   /protein_id="EDL37386.1"
FT   CDS             join(5511820..5511947,5540931..5541007,5595584..5595678,
FT                   5630668..5630862,5641248..5641322,5711284..5711393,
FT                   5804407..5804506,5807756..5807826,5810281..5810363,
FT                   5860634..5860787,5887658..5887721)
FT                   /codon_start=1
FT                   /gene="Bre"
FT                   /locus_tag="mCG_142373"
FT                   /product="brain and reproductive organ-expressed protein,
FT                   isoform CRA_e"
FT                   /note="gene_id=mCG142373.0 transcript_id=mCT180049.0
FT                   protein_id=mCP102971.0 isoform=CRA_e"
FT                   /protein_id="EDL37388.1"
FT   CDS             join(<5512009..5512073,5540931..5541007,5595584..5595678,
FT                   5630668..5630862,5641248..5641322,5711284..5711393,
FT                   5804407..5804506,5807756..5807826,5810281..5810363,
FT                   5860634..5860787,5887658..5887721)
FT                   /codon_start=1
FT                   /gene="Bre"
FT                   /locus_tag="mCG_142373"
FT                   /product="brain and reproductive organ-expressed protein,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG142373.0 transcript_id=mCT193612.0
FT                   protein_id=mCP114569.0 isoform=CRA_a"
FT                   /protein_id="EDL37384.1"
FT   assembly_gap    5550494..5550546
FT                   /estimated_length=53
FT                   /gap_type="unknown"
FT   assembly_gap    5569598..5569617
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5574885..5574904
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5591229..5591367
FT                   /estimated_length=139
FT                   /gap_type="unknown"
FT   assembly_gap    5611257..5611417
FT                   /estimated_length=161
FT                   /gap_type="unknown"
FT   assembly_gap    5660502..5660521
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5674676..5674695
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5697836..5697905
FT                   /estimated_length=70
FT                   /gap_type="unknown"
FT   assembly_gap    5738343..5738479
FT                   /estimated_length=137
FT                   /gap_type="unknown"
FT   assembly_gap    5791315..5791334
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5796186..5796463
FT                   /estimated_length=278
FT                   /gap_type="unknown"
FT   assembly_gap    5797082..5797192
FT                   /estimated_length=111
FT                   /gap_type="unknown"
FT   gene            complement(5809023..>5813914)
FT                   /locus_tag="mCG_146318"
FT                   /note="gene_id=mCG146318.0"
FT   mRNA            complement(join(5809023..5811539,5813118..5813189,
FT                   5813817..>5813914))
FT                   /locus_tag="mCG_146318"
FT                   /product="mCG146318"
FT                   /note="gene_id=mCG146318.0 transcript_id=mCT186421.0
FT                   created on 14-JUL-2003"
FT   CDS             complement(5811251..>5811511)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146318"
FT                   /product="mCG146318"
FT                   /note="gene_id=mCG146318.0 transcript_id=mCT186421.0
FT                   protein_id=mCP107487.0"
FT                   /protein_id="EDL37389.1"
FT   assembly_gap    5901255..5901274
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5926588..5926804
FT                   /estimated_length=217
FT                   /gap_type="unknown"
FT   assembly_gap    5931337..5931454
FT                   /estimated_length=118
FT                   /gap_type="unknown"
FT   assembly_gap    5938682..5940045
FT                   /estimated_length=1364
FT                   /gap_type="unknown"
FT   gene            <5949943..5960937
FT                   /gene="Fosl2"
FT                   /locus_tag="mCG_11594"
FT                   /note="gene_id=mCG11594.3"
FT   mRNA            join(<5949943..5950194,5953539..5953646,5955789..5960937)
FT                   /gene="Fosl2"
FT                   /locus_tag="mCG_11594"
FT                   /product="fos-like antigen 2"
FT                   /note="gene_id=mCG11594.3 transcript_id=mCT11914.3 created
FT                   on 24-NOV-2004"
FT   CDS             join(<5949943..5950194,5953539..5953646,5955789..5956307)
FT                   /codon_start=1
FT                   /gene="Fosl2"
FT                   /locus_tag="mCG_11594"
FT                   /product="fos-like antigen 2"
FT                   /note="gene_id=mCG11594.3 transcript_id=mCT11914.3
FT                   protein_id=mCP3929.2 partial"
FT                   /protein_id="EDL37390.1"
FT                   DSLNSPTLLAL"
FT   assembly_gap    5956567..5956586
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5962139..5963110
FT                   /estimated_length=972
FT                   /gap_type="unknown"
FT   assembly_gap    5979656..5979718
FT                   /estimated_length=63
FT                   /gap_type="unknown"
FT   assembly_gap    5986623..5986642
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5998559..5999339
FT                   /estimated_length=781
FT                   /gap_type="unknown"
FT   assembly_gap    6028152..6028323
FT                   /estimated_length=172
FT                   /gap_type="unknown"
FT   gene            6035738..6167336
FT                   /locus_tag="mCG_141231"
FT                   /note="gene_id=mCG141231.0"
FT   mRNA            join(6035738..6035821,6050054..6050259,6065318..6065379,
FT                   6066630..6066702,6067843..6067901,6072765..6072811,
FT                   6073313..6073356,6075979..6076069,6076375..6076426,
FT                   6078907..6078993,6083955..6084017,6084591..6084670,
FT                   6087736..6087808,6088654..6088752,6089655..6089711,
FT                   6092690..6092761,6094061..6094135,6096063..6096126,
FT                   6101397..6101459,6105540..6105609,6106207..6106250,
FT                   6109481..6109589,6112069..6112120,6113743..6113823,
FT                   6116569..6116634,6116900..6117005,6119498..6119577,
FT                   6119929..6120033,6120133..6120228,6120370..6120446,