spacer

EBI Dbfetch

ID   CH466520; SV 2; linear; genomic DNA; CON; MUS; 88119379 BP.
XX
AC   CH466520;
XX
PR   Project:PRJNA11785;
XX
DT   04-AUG-2005 (Rel. 84, Created)
DT   10-JUN-2007 (Rel. 92, Last updated, Version 8)
XX
DE   Mus musculus 232000009837964 genomic scaffold, whole genome shotgun
DE   sequence.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-88119379
RX   DOI; 10.1126/science.1069193.
RX   PUBMED; 12040188.
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Miklos G.L., Wides R.,
RA   Halpern A., Li P.W., Sutton G.G., Nadeau J., Salzberg S.L., Holt R.A.,
RA   Kodira C.D., Lu F., Chen L., Deng Z., Evangelista C.C., Gan W.,
RA   Heiman T.J., Li J., Li Z., Merkulov G.V., Milshina N.V., Naik A.K., Qi R.,
RA   Shue B.C., Wang A., Wang J., Wang X., Yan X., Ye J., Yooseph S., Zhao Q.,
RA   Zheng L., Zhu S.C., Biddick K., Bolanos R., Delcher A.L., Dew I.M.,
RA   Fasulo D., Flanigan M.J., Huson D.H., Kravitz S.A., Miller J.R.,
RA   Mobarry C.M., Reinert K., Remington K.A., Zhang Q., Zheng X.H.,
RA   Nusskern D.R., Lai Z., Lei Y., Zhong W., Yao A., Guan P., Ji R.R., Gu Z.,
RA   Wang Z.Y., Zhong F., Xiao C., Chiang C.C., Yandell M., Wortman J.R.,
RA   Amanatides P.G., Hladun S.L., Pratts E.C., Johnson J.E., Dodson K.L.,
RA   Woodford K.J., Evans C.A., Gropman B., Rusch D.B., Venter E., Wang M.,
RA   Smith T.J., Houck J.T., Tompkins D.E., Haynes C., Jacob D., Chin S.H.,
RA   Allen D.R., Dahlke C.E., Sanders R., Li K., Liu X., Levitsky A.A.,
RA   Majoros W.H., Chen Q., Xia A.C., Lopez J.R., Donnelly M.T., Newman M.H.,
RA   Glodek A., Kraft C.L., Nodell M., Ali F., An H.J., Baldwin-Pitts D.,
RA   Beeson K.Y., Cai S., Carnes M., Carver A., Caulk P.M., Center A.,
RA   Chen Y.H., Cheng M.L., Coyne M.D., Crowder M., Danaher S., Davenport L.B.,
RA   Desilets R., Dietz S.M., Doup L., Dullaghan P., Ferriera S., Fosler C.R.,
RA   Gire H.C., Gluecksmann A., Gocayne J.D., Gray J., Hart B., Haynes J.,
RA   Hoover J., Howland T., Ibegwam C., Jalali M., Johns D., Kline L., Ma D.S.,
RA   MacCawley S., Magoon A., Mann F., May D., McIntosh T.C., Mehta S., Moy L.,
RA   Moy M.C., Murphy B.J., Murphy S.D., Nelson K.A., Nuri Z., Parker K.A.,
RA   Prudhomme A.C., Puri V.N., Qureshi H., Raley J.C., Reardon M.S.,
RA   Regier M.A., Rogers Y.H., Romblad D.L., Schutz J., Scott J.L., Scott R.,
RA   Sitter C.D., Smallwood M., Sprague A.C., Stewart E., Strong R.V., Suh E.,
RA   Sylvester K., Thomas R., Tint N.N., Tsonis C., Wang G., Wang G.,
RA   Williams M.S., Williams S.M., Windsor S.M., Wolfe K., Wu M.M., Zaveri J.,
RA   Chaturvedi K., Gabrielian A.E., Ke Z., Sun J., Subramanian G., Venter J.C.,
RA   Pfannkoch C.M., Barnstead M., Stephenson L.D.;
RT   "A comparison of whole-genome shotgun-derived mouse chromosome 16 and the
RT   human genome";
RL   Science 296(5573):1661-1671(2002).
XX
RN   [2]
RP   1-88119379
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (05-JUL-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
RN   [3]
RP   1-88119379
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (02-SEP-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
DR   MD5; 9f344f294da62609fd03151ec3948931.
DR   ENA; AAHY010000000; SET.
DR   ENA; AAHY000000000; SET.
DR   ENA-CON; CM000209.
DR   Ensembl-Gn; ENSMUSG00000000817; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000001674; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000004552; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000005338; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000005677; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000005681; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000006005; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000007097; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000007805; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000009905; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000009907; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000010311; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000013973; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000014602; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000014980; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000015314; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000015316; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000015484; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000015750; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000016524; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000016529; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000018189; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000018196; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000018199; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020423; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026226; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026228; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026237; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026238; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026241; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026246; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026247; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026251; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026254; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026270; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026271; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026272; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026276; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026277; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026278; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026281; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026285; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026289; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026305; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026309; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026311; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026319; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026331; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026336; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026341; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026355; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026357; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026368; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026374; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026380; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026384; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026385; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026390; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026395; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026405; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026409; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026416; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026421; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026433; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026436; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026437; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026439; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026443; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026450; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026456; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026457; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026458; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026475; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026479; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026482; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026542; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026546; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026547; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026556; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026558; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026573; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026575; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026576; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026581; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026587; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026641; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026678; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026696; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026697; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026700; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026708; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026715; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000030432; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000032487; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000033557; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000033701; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000034088; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000034212; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000034220; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000034353; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000036155; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000036251; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000036707; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000037924; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038026; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038179; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000040113; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000040297; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000040612; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000040710; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000040713; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000040918; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000041559; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000041577; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000041605; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000041926; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000042349; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000042429; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000042554; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000042751; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000042849; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000043282; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000043467; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000044055; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000044594; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000044835; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000045968; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000046300; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000047443; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000048775; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000049456; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000050526; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000050534; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000051081; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000052423; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000052688; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000052760; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000053483; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000054387; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000056220; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000056536; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000056708; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000057329; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000057464; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000058017; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000058904; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000059089; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000060244; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000061616; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000062497; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000062527; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000062963; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000063583; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000063681; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000066797; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000066800; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000067006; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000067064; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000070643; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000071890; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000073557; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000073602; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000073616; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000079180; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000079283; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000079330; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000079434; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000081984; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000086056; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000089943; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000090171; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000090550; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000000834; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000001724; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000005470; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000005820; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000005824; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000007949; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000010049; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000015124; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000015460; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000015628; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000015894; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000016668; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000016673; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020692; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000023861; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027440; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027449; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027455; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027489; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027491; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027498; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027499; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027507; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027538; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027564; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027567; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027569; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027575; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027579; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027601; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027603; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027615; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027623; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027629; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027634; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027639; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027657; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027673; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027677; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027697; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027700; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027706; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027727; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027748; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027753; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027760; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027824; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027860; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027863; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027871; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028020; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028024; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000032597; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000035065; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000035560; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000038191; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000038361; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000038432; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000039173; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000039862; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000040298; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000042498; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000043313; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000043336; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000044021; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000045897; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000045970; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000046110; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000046662; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000048183; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000048377; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000048432; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000049289; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000050010; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000052245; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000053144; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000053686; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000055314; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000055322; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000055884; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000056592; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000059825; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000062108; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000062353; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000062387; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000062964; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000064091; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000064272; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000064480; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000064664; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000064725; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000064950; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000066863; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000067398; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000067429; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000068116; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000070200; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000070699; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000070898; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000071521; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000073252; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000073350; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000073663; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000073748; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000074859; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000076362; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000077340; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000078432; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000078825; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000081274; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000081527; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000085894; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000085913; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000086153; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000086195; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000086209; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000086444; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000086475; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000086556; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000086694; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000086701; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000086837; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000086843; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000086861; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000094646; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000096608; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000097467; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000097561; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000097642; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000097648; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000097659; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000097666; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000111224; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000111228; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000111264; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000111299; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000111300; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000111313; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000111618; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000111620; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000112025; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000112237; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000112362; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000112465; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000112717; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000112736; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000112751; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000112890; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000112999; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113114; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113186; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113190; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113344; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000117814; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000119161; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000119972; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000120339; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000123490; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000124051; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000124973; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000125925; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000129905; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000130504; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000132158; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000143922; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000144386; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000144576; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000145571; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000149187; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000151708; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000152809; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000155077; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000159250; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000159679; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000159879; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000159963; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000160056; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000160548; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000160810; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000161241; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000162038; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000162187; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000162226; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000163079; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000165109; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000166100; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000166259; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000166281; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000167546; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000168381; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000168776; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000169198; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000169659; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000170883; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000171330; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000171405; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000171479; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000171796; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000172044; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000173908; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000178474; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000182283; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000185233; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000185356; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000185436; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000185539; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000186075; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000186255; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000186298; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000186373; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000186485; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000187306; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000187410; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000188081; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000188879; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000189174; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000189361; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000189534; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000189547; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000189999; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000190844; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000191418; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000191947; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000192024; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000193683; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000193808; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000194204; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000194964; mus_musculus.
XX
CC   On Sep 6, 2005 this sequence version replaced gi:70980460.
CC   This is the July 2001 combined whole genome shotgun assembly of Mus
CC   musculus. It contains 27 million Celera reads on four Mus musculus
CC   strains (129X1/SvJ, 129S1/SvImJ, DBA/2J and A/J), 13 million reads
CC   on C57BL/6J from the NCBI Trace Archive, 0.4 million BAC end
CC   sequences from TIGR, and unfinished and finished BACs pulled from
CC   NCBI (Nature 2002. 420:520-562). The assembly process relied on
CC   Celera's paired reads and BAC end reads for long range order and
CC   orientation. Its scaffolds were mapped to chromosomes using STS
CC   maps. For more detailed information about whole genome sequencing
CC   and Celera's assembly process, please refer to Venter, J.C. et al.
CC   Science 2001. 291:1304-1351.
CC   This version of genes, transcripts, and proteins was
CC   computationally created in November 2001 from the whole-genome
CC   mapping of transcript and protein sequences on the Celera mouse
CC   genome assembly by Celera Chromosome Team and Content Systems.  The
CC   data sets used by this annotation process were collected in 2001
CC   and include RefSeq (NM_ from mouse and human) sequences, GenBank
CC   mRNA and dbEST sequences, mammalian SwissProt sequences,  and NRAA
CC   sequences (all mouse unless noted otherwise).  The initial gene set
CC   was manually curated between 2002 and 2003. Subsequently, automated
CC   annotation updates were performed.  The CDS of each transcript was
CC   manually or computationally defined by either the longest
CC   ATG-to-Stop or the longest open reading frame. All CDSs
CC   corresponding to the longest open reading frames with no starting
CC   ATG were flagged as partial.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..88119379
FT                   /organism="Mus musculus"
FT                   /chromosome="1"
FT                   /strain="mixed"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   assembly_gap    1494..4827
FT                   /estimated_length=3334
FT                   /gap_type="unknown"
FT   gene            4829..9881
FT                   /pseudo
FT                   /locus_tag="mCG_128313"
FT                   /note="gene_id=mCG128313.0"
FT   mRNA            join(4829..5196,5530..5613,9779..9881)
FT                   /pseudo
FT                   /locus_tag="mCG_128313"
FT                   /note="gene_id=mCG128313.0 transcript_id=mCT129608.0
FT                   created on 05-FEB-2003"
FT   assembly_gap    6636..7869
FT                   /estimated_length=1234
FT                   /gap_type="unknown"
FT   assembly_gap    10796..41244
FT                   /estimated_length=30449
FT                   /gap_type="unknown"
FT   assembly_gap    42290..43048
FT                   /estimated_length=759
FT                   /gap_type="unknown"
FT   gene            <46279..96107
FT                   /locus_tag="mCG_8527"
FT                   /note="gene_id=mCG8527.3"
FT   mRNA            join(<46279..46440,49050..49218,50103..50174,51856..51921,
FT                   53491..53580,56087..56167,59711..59857,61277..61348,
FT                   65141..65191,67168..67221,78055..78129,80366..80416,
FT                   83113..83217,85714..85856,87224..87256,87512..87550,
FT                   93334..93405,94089..94232,95100..96107)
FT                   /locus_tag="mCG_8527"
FT                   /product="mCG8527, transcript variant mCT185651"
FT                   /note="gene_id=mCG8527.3 transcript_id=mCT185651.0 created
FT                   on 11-JUN-2003"
FT   mRNA            join(<46279..46440,49050..49218,50103..50174,51856..51921,
FT                   53491..53580,56087..56167,59711..59857,61277..61348,
FT                   65141..65191,67168..67221,78055..78129,80366..80416,
FT                   83113..83217,85714..85856,87224..87256,87515..87550,
FT                   91050..91165,92944..93061,93334..93405,94089..94232,
FT                   95100..96104)
FT                   /locus_tag="mCG_8527"
FT                   /product="mCG8527, transcript variant mCT178071"
FT                   /note="gene_id=mCG8527.3 transcript_id=mCT178071.0 created
FT                   on 11-JUN-2003"
FT   CDS             join(<46279..46440,49050..49218,50103..50174,51856..51921,
FT                   53491..53580,56087..56167,59711..59857,61277..61348,
FT                   65141..65191,67168..67221,78055..78129,80366..80416,
FT                   83113..83217,85714..85856,87224..87256,87512..87550,
FT                   93334..93405,94089..94232,95100..95225)
FT                   /codon_start=1
FT                   /locus_tag="mCG_8527"
FT                   /product="mCG8527, isoform CRA_g"
FT                   /note="gene_id=mCG8527.3 transcript_id=mCT185651.0
FT                   protein_id=mCP106908.0 isoform=CRA_g"
FT                   /protein_id="EDL40267.1"
FT                   /translation="RMSTEQENTEMHLIECMLKHFKTQKVAISNAIRSTFPFLESLRDH
FT                   EFITGKMYEDLLDSCRSLVPVDKVIYRALEELEKKFDMTVLCELFNEVNMEKYPDLNLI
FT                   RRSFGCVFPNELCFQGIDGGNPNSQLSLEQGPGASYSQGSPNGSSLDLSASEGWRSNDR
FT                   RNSNLMQANQTENHQLAESPGHLDSCELQVQLNNRDATPESCSLLPQNEERAVQLNYEL
FT                   QINPCFVQLVDVKKENSSFSLAGNQQTRARTNQNEDSEIIELSSGDSDNGENFSEATTT
FT                   VPSQPAPAYSRKPPTLRRDRGGDTSDTESSIIIRRRKRTGRKKRERLGSYLIRNIKIPM
FT                   KPSWKTAFLARSANPSSQRRRKRGPRIPREENADFGGAELPVVCGNAQGFLDKEKFKQG
FT                   IYVRSIRGKTGRLFTPMDFEIEGNCEKAKNWRQSIRCKGWTLRELIQKGVLQDPPRKKK
FT                   ETPRNPRQTRRQKCELLLLTIYCYPKSGFFIPKPKQRKEKFPDLREHMWLNKIKNRLNK
FT                   KAYHSVRRFVEDMRLIFHNHSIFYKKRFKNLGIIVGKKFEKNFKRIFSIEDTSEQHEPC
FT                   NHTVLLT"
FT   CDS             join(<46279..46440,49050..49218,50103..50174,51856..51921,
FT                   53491..53580,56087..56167,59711..59857,61277..61348,
FT                   65141..65191,67168..67221,78055..78129,80366..80416,
FT                   83113..83217,85714..85856,87224..87256,87515..87550,
FT                   91050..91165,92944..93061,93334..93405,94089..94232,
FT                   95100..95225)
FT                   /codon_start=1
FT                   /locus_tag="mCG_8527"
FT                   /product="mCG8527, isoform CRA_d"
FT                   /note="gene_id=mCG8527.3 transcript_id=mCT178071.0
FT                   protein_id=mCP100990.0 isoform=CRA_d"
FT                   /protein_id="EDL40264.1"
FT                   /translation="RMSTEQENTEMHLIECMLKHFKTQKVAISNAIRSTFPFLESLRDH
FT                   EFITGKMYEDLLDSCRSLVPVDKVIYRALEELEKKFDMTVLCELFNEVNMEKYPDLNLI
FT                   RRSFGCVFPNELCFQGIDGGNPNSQLSLEQGPGASYSQGSPNGSSLDLSASEGWRSNDR
FT                   RNSNLMQANQTENHQLAESPGHLDSCELQVQLNNRDATPESCSLLPQNEERAVQLNYEL
FT                   QINPCFVQLVDVKKENSSFSLAGNQQTRARTNQNEDSEIIELSSGDSDNGENFSEATTT
FT                   VPSQPAPAYSRKPPTLRRDRGGDTSDTESSIIIRRRKRTGRKKRERLGSYLIRNIKIPM
FT                   KPSWKTAFLARSANPSSQRRRKRGPRIPREENADFGGAELPVVCGNAQGFLDKEKFKQG
FT                   IYVRSIRGKTGRLFTPMDFEIEGNCEKAKNWRQSIRCKGWTLRELIQKGVLQDPPRKKE
FT                   TPRNPRQTRRQRGNPKACKVCGQPRKVHPCTACKEFYHKNCHIPPVEDKSRSWHCAFCK
FT                   RKNQLRGQKTQACHKEAEVLKRKMSPEEQLKCELLLLTIYCYPKSGFFIPKPKQRKEKF
FT                   PDLREHMWLNKIKNRLNKKAYHSVRRFVEDMRLIFHNHSIFYKKRFKNLGIIVGKKFEK
FT                   NFKRIFSIEDTSEQHEPCNHTVLLT"
FT   mRNA            join(<46279..46440,49050..49218,50103..50174,51856..51921,
FT                   53491..53580,56087..56167,59711..59857,61277..61348,
FT                   65141..65191,78055..78129,80366..80416,83113..83217,
FT                   85714..85856,87224..87256,87512..87678)
FT                   /locus_tag="mCG_8527"
FT                   /product="mCG8527, transcript variant mCT178070"
FT                   /note="gene_id=mCG8527.3 transcript_id=mCT178070.0 created
FT                   on 11-JUN-2003"
FT   mRNA            join(<46279..46440,49050..49218,50103..50174,51856..51921,
FT                   53491..53580,56087..56167,59711..59857,61277..61348,
FT                   65141..65191,67168..67221,80366..80416,83113..83217,
FT                   85714..85856,87224..87256,87512..87676)
FT                   /locus_tag="mCG_8527"
FT                   /product="mCG8527, transcript variant mCT185650"
FT                   /note="gene_id=mCG8527.3 transcript_id=mCT185650.0 created
FT                   on 11-JUN-2003"
FT   mRNA            join(<46279..46440,49050..49218,50103..50174,51856..51921,
FT                   53491..53580,56087..56167,59711..59857,61277..61348,
FT                   65141..65191,67168..67221,78055..78129,80366..80416,
FT                   83113..83217,85714..85856,87224..87256,87512..87668)
FT                   /locus_tag="mCG_8527"
FT                   /product="mCG8527, transcript variant mCT7245"
FT                   /note="gene_id=mCG8527.3 transcript_id=mCT7245.1 created on
FT                   11-JUN-2003"
FT   CDS             join(<46279..46440,49050..49218,50103..50174,51856..51921,
FT                   53491..53580,56087..56167,59711..59857,61277..61348,
FT                   65141..65191,67168..67221,78055..78129,80366..80416,
FT                   83113..83217,85714..85856,87224..87256,87512..87565)
FT                   /codon_start=1
FT                   /locus_tag="mCG_8527"
FT                   /product="mCG8527, isoform CRA_f"
FT                   /note="gene_id=mCG8527.3 transcript_id=mCT7245.1
FT                   protein_id=mCP15644.1 isoform=CRA_f"
FT                   /protein_id="EDL40266.1"
FT                   /translation="RMSTEQENTEMHLIECMLKHFKTQKVAISNAIRSTFPFLESLRDH
FT                   EFITGKMYEDLLDSCRSLVPVDKVIYRALEELEKKFDMTVLCELFNEVNMEKYPDLNLI
FT                   RRSFGCVFPNELCFQGIDGGNPNSQLSLEQGPGASYSQGSPNGSSLDLSASEGWRSNDR
FT                   RNSNLMQANQTENHQLAESPGHLDSCELQVQLNNRDATPESCSLLPQNEERAVQLNYEL
FT                   QINPCFVQLVDVKKENSSFSLAGNQQTRARTNQNEDSEIIELSSGDSDNGENFSEATTT
FT                   VPSQPAPAYSRKPPTLRRDRGGDTSDTESSIIIRRRKRTGRKKRERLGSYLIRNIKIPM
FT                   KPSWKTAFLARSANPSSQRRRKRGPRIPREENADFGGAELPVVCGNAQGFLDKEKFKQG
FT                   IYVRSIRGKTGRLFTPMDFEIEGNCEKAKNWRQSIRCKGWTLRELIQKGVLQDPPRKKK
FT                   ETPRNPRQTRRQVNAL"
FT   CDS             join(<46279..46440,49050..49218,50103..50174,51856..51921,
FT                   53491..53580,56087..56167,59711..59857,61277..61348,
FT                   65141..65191,67168..67221,80366..80416,83113..83217,
FT                   85714..85856,87224..87256,87512..87565)
FT                   /codon_start=1
FT                   /locus_tag="mCG_8527"
FT                   /product="mCG8527, isoform CRA_e"
FT                   /note="gene_id=mCG8527.3 transcript_id=mCT185650.0
FT                   protein_id=mCP106909.0 isoform=CRA_e"
FT                   /protein_id="EDL40265.1"
FT                   /translation="RMSTEQENTEMHLIECMLKHFKTQKVAISNAIRSTFPFLESLRDH
FT                   EFITGKMYEDLLDSCRSLVPVDKVIYRALEELEKKFDMTVLCELFNEVNMEKYPDLNLI
FT                   RRSFGCVFPNELCFQGIDGGNPNSQLSLEQGPGASYSQGSPNGSSLDLSASEGWRSNDR
FT                   RNSNLMQANQTENHQLAESPGHLDSCELQVQLNNRDATPESCSLLPQNEERAVQLNYEL
FT                   QINPCFVQLVDVKKENSSFSLAGNQQTRARTNQNEDSEIIELSSGDSDNGENFSEATTT
FT                   VPSQPAPAYSRKPPTLRRDRGGDTSDTESSIIIRRRKRTGPFLARSANPSSQRRRKRGP
FT                   RIPREENADFGGAELPVVCGNAQGFLDKEKFKQGIYVRSIRGKTGRLFTPMDFEIEGNC
FT                   EKAKNWRQSIRCKGWTLRELIQKGVLQDPPRKKKETPRNPRQTRRQVNAL"
FT   CDS             join(<46279..46440,49050..49218,50103..50174,51856..51921,
FT                   53491..53580,56087..56167,59711..59857,61277..61348,
FT                   65141..65191,78055..78129,80366..80416,83113..83217,
FT                   85714..85856,87224..87256,87512..87565)
FT                   /codon_start=1
FT                   /locus_tag="mCG_8527"
FT                   /product="mCG8527, isoform CRA_c"
FT                   /note="gene_id=mCG8527.3 transcript_id=mCT178070.0
FT                   protein_id=mCP100992.0 isoform=CRA_c"
FT                   /protein_id="EDL40263.1"
FT                   /translation="RMSTEQENTEMHLIECMLKHFKTQKVAISNAIRSTFPFLESLRDH
FT                   EFITGKMYEDLLDSCRSLVPVDKVIYRALEELEKKFDMTVLCELFNEVNMEKYPDLNLI
FT                   RRSFGCVFPNELCFQGIDGGNPNSQLSLEQGPGASYSQGSPNGSSLDLSASEGWRSNDR
FT                   RNSNLMQANQTENHQLAESPGHLDSCELQVQLNNRDATPESCSLLPQNEERAVQLNYEL
FT                   QINPCFVQLVDVKKENSSFSLAGNQQTRARTNQNEDSEIIELSSGDSDNGENFSEATTT
FT                   VPSQPAPAYSRKPPTLRRDRGGGKKRERLGSYLIRNIKIPMKPSWKTAFLARSANPSSQ
FT                   RRRKRGPRIPREENADFGGAELPVVCGNAQGFLDKEKFKQGIYVRSIRGKTGRLFTPMD
FT                   FEIEGNCEKAKNWRQSIRCKGWTLRELIQKGVLQDPPRKKKETPRNPRQTRRQVNAL"
FT   mRNA            join(<46279..46440,49050..49218,50103..50174,51856..51921,
FT                   53491..53580,56087..56167,59711..59857,60737..61348,
FT                   65141..65191,67168..67221,78055..78129,80366..82475)
FT                   /locus_tag="mCG_8527"
FT                   /product="mCG8527, transcript variant mCT178068"
FT                   /note="gene_id=mCG8527.3 transcript_id=mCT178068.1 created
FT                   on 11-JUN-2003"
FT   mRNA            join(<46279..46440,49050..49218,50103..50174,51856..51921,
FT                   53491..53580,56087..56167,59711..59857,61277..61348,
FT                   65141..65191,67168..67221,68299..68765)
FT                   /locus_tag="mCG_8527"
FT                   /product="mCG8527, transcript variant mCT178069"
FT                   /note="gene_id=mCG8527.3 transcript_id=mCT178069.0 created
FT                   on 11-JUN-2003"
FT   CDS             join(<46279..46440,49050..49218,50103..50174,51856..51921,
FT                   53491..53580,56087..56167,59711..59857,61277..61348,
FT                   65141..65191,67168..67221,68299..68357)
FT                   /codon_start=1
FT                   /locus_tag="mCG_8527"
FT                   /product="mCG8527, isoform CRA_b"
FT                   /note="gene_id=mCG8527.3 transcript_id=mCT178069.0
FT                   protein_id=mCP100993.0 isoform=CRA_b"
FT                   /protein_id="EDL40262.1"
FT                   /translation="RMSTEQENTEMHLIECMLKHFKTQKVAISNAIRSTFPFLESLRDH
FT                   EFITGKMYEDLLDSCRSLVPVDKVIYRALEELEKKFDMTVLCELFNEVNMEKYPDLNLI
FT                   RRSFGCVFPNELCFQGIDGGNPNSQLSLEQGPGASYSQGSPNGSSLDLSASEGWRSNDR
FT                   RNSNLMQANQTENHQLAESPGHLDSCELQVQLNNRDATPESCSLLPQNEERAVQLNYEL
FT                   QINPCFVQLVDVKKENSSFSLAGNQQTRARTNQNEDSEIIELSSGDSDNGENFSEATTT
FT                   VPSQPAPAYSRKPPTLRRDRGGDTSDTESSIIIRRRKRTGRVLYSSSSELSSEEESQDS
FT                   "
FT   CDS             join(<46279..46440,49050..49218,50103..50174,51856..51921,
FT                   53491..53580,56087..56167,59711..59857,60737..60840)
FT                   /codon_start=1
FT                   /locus_tag="mCG_8527"
FT                   /product="mCG8527, isoform CRA_a"
FT                   /note="gene_id=mCG8527.3 transcript_id=mCT178068.1
FT                   protein_id=mCP100991.1 isoform=CRA_a"
FT                   /protein_id="EDL40261.1"
FT                   /translation="RMSTEQENTEMHLIECMLKHFKTQKVAISNAIRSTFPFLESLRDH
FT                   EFITGKMYEDLLDSCRSLVPVDKVIYRALEELEKKFDMTVLCELFNEVNMEKYPDLNLI
FT                   RRSFGCVFPNELCFQGIDGGNPNSQLSLEQGPGASYSQGSPNGSSLDLSASEGWRSNDR
FT                   RNSNLMQANQTENHQLAESPGHLDSCELQVQLNNRDATPESCSLLPQNEERAVQLNYEL
FT                   QINPCFVQLVDVKKENSSFSLAGNQQTRARTNQNEDSEIIEPRTTSPGMAIPTMGPRPL
FT                   EKMPNSWISWRHFLN"
FT   assembly_gap    54578..54597
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    78723..79309
FT                   /estimated_length=587
FT                   /gap_type="unknown"
FT   gene            complement(103192..>122865)
FT                   /locus_tag="mCG_8524"
FT                   /note="gene_id=mCG8524.2"
FT   mRNA            complement(join(103192..104477,105134..105238,
FT                   109207..109290,111230..111398,112568..112611,
FT                   122756..>122865))
FT                   /locus_tag="mCG_8524"
FT                   /product="mCG8524, transcript variant mCT179623"
FT                   /note="gene_id=mCG8524.2 transcript_id=mCT179623.0 created
FT                   on 05-FEB-2003"
FT   mRNA            complement(join(103192..104477,105134..105238,
FT                   109207..109496,111230..111398,112568..112724,
FT                   122756..122861))
FT                   /locus_tag="mCG_8524"
FT                   /product="mCG8524, transcript variant mCT7243"
FT                   /note="gene_id=mCG8524.2 transcript_id=mCT7243.2 created on
FT                   05-FEB-2003"
FT   mRNA            complement(join(103799..104477,105134..105238,
FT                   109207..109290,111230..111398,112568..112724,
FT                   122756..>122858))
FT                   /locus_tag="mCG_8524"
FT                   /product="mCG8524, transcript variant mCT193824"
FT                   /note="gene_id=mCG8524.2 transcript_id=mCT193824.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(104302..104477,105134..105238,
FT                   109207..109290,111230..111398,112568..112611,
FT                   122756..>122819))
FT                   /codon_start=1
FT                   /locus_tag="mCG_8524"
FT                   /product="mCG8524, isoform CRA_b"
FT                   /note="gene_id=mCG8524.2 transcript_id=mCT179623.0
FT                   protein_id=mCP102545.0 isoform=CRA_b"
FT                   /protein_id="EDL40259.1"
FT                   /translation="PQLTPAVRKAEGVPCGLPQTQESLRDHSFITDKIYADSYEACRNS
FT                   VPIVEVVYNVLSHLERLSDSSFLWALFNRVNLKEYPALREIHKSLGTELQDGYSPQKCK
FT                   QEEQKKLATVHPSYEQGTNLCTHEKWAQPCFVKQDNLQEPEIQQNQVDEIILISSESSE
FT                   CSDEDEEDQALGTGLRRQMNKEAEDSSPPGFQNIELPAGSHTSCVWTNHS"
FT   CDS             complement(join(104302..104477,105134..105238,
FT                   109207..109290,111230..111398,112568..112724,
FT                   122756..>122787))
FT                   /codon_start=1
FT                   /locus_tag="mCG_8524"
FT                   /product="mCG8524, isoform CRA_a"
FT                   /note="gene_id=mCG8524.2 transcript_id=mCT193824.0
FT                   protein_id=mCP114787.0 isoform=CRA_a"
FT                   /protein_id="EDL40258.1"
FT                   /translation="RCPLRTPPDPSMFGVIQKEERFNEVFLNYFKENKIEIAHAITKLF
FT                   PFLESLRDHSFITDKIYADSYEACRNSVPIVEVVYNVLSHLERLSDSSFLWALFNRVNL
FT                   KEYPALREIHKSLGTELQDGYSPQKCKQEEQKKLATVHPSYEQGTNLCTHEKWAQPCFV
FT                   KQDNLQEPEIQQNQVDEIILISSESSECSDEDEEDQALGTGLRRQMNKEAEDSSPPGFQ
FT                   NIELPAGSHTSCVWTNHS"
FT   CDS             complement(join(109471..109496,111230..111398,
FT                   112568..112723))
FT                   /codon_start=1
FT                   /locus_tag="mCG_8524"
FT                   /product="mCG8524, isoform CRA_c"
FT                   /note="gene_id=mCG8524.2 transcript_id=mCT7243.2
FT                   protein_id=mCP15676.2 isoform=CRA_c"
FT                   /db_xref="GOA:Q8C9T1"
FT                   /db_xref="InterPro:IPR004865"
FT                   /db_xref="MGI:MGI:2443131"
FT                   /db_xref="UniProtKB/TrEMBL:Q8C9T1"
FT                   /protein_id="EDL40260.1"
FT                   /translation="MFGVIQKEERFNEVFLNYFKENKIEIAHAITKLFPFLESLRDHSF
FT                   ITDKIYADSYEACRNSVPIVEVVYNVLSHLERLSDSSFLWALFNRVNLKEYPALREIHK
FT                   SLGTGRDKLFQP"
FT   assembly_gap    112929..113126
FT                   /estimated_length=198
FT                   /gap_type="unknown"
FT   assembly_gap    125635..125654
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    145305..145798
FT                   /estimated_length=494
FT                   /gap_type="unknown"
FT   assembly_gap    150367..150386
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            161385..170745
FT                   /locus_tag="mCG_145600"
FT                   /note="gene_id=mCG145600.0"
FT   mRNA            join(161385..161434,163624..163674,167501..167587,
FT                   170106..170745)
FT                   /locus_tag="mCG_145600"
FT                   /product="mCG145600"
FT                   /note="gene_id=mCG145600.0 transcript_id=mCT185024.0
FT                   created on 05-JUN-2003"
FT   assembly_gap    167197..167253
FT                   /estimated_length=57
FT                   /gap_type="unknown"
FT   CDS             170380..170574
FT                   /codon_start=1
FT                   /locus_tag="mCG_145600"
FT                   /product="mCG145600"
FT                   /note="gene_id=mCG145600.0 transcript_id=mCT185024.0
FT                   protein_id=mCP106076.0"
FT                   /protein_id="EDL40257.1"
FT                   /translation="MQACFLLACLLTLSTIAHFRIPSKEWCYLQWAGLINNRDNPPTDT
FT                   PTGQSIRTIFHLRFSFQGL"
FT   gene            179489..237792
FT                   /gene="Cab39"
FT                   /locus_tag="mCG_66415"
FT                   /note="gene_id=mCG66415.2"
FT   mRNA            join(179489..179853,204504..204660,221533..221697,
FT                   223496..223614,228415..228583,230810..230869,
FT                   233626..233691,234493..234636,235249..237792)
FT                   /gene="Cab39"
FT                   /locus_tag="mCG_66415"
FT                   /product="calcium binding protein 39, transcript variant
FT                   mCT66598"
FT                   /note="gene_id=mCG66415.2 transcript_id=mCT66598.2 created
FT                   on 03-JAN-2003"
FT   mRNA            join(179536..179632,179787..179853,204504..204660,
FT                   221533..221697,223496..223614,228415..228583,
FT                   230810..230869,233626..233691,234493..234636,
FT                   235249..237792)
FT                   /gene="Cab39"
FT                   /locus_tag="mCG_66415"
FT                   /product="calcium binding protein 39, transcript variant
FT                   mCT178043"
FT                   /note="gene_id=mCG66415.2 transcript_id=mCT178043.0 created
FT                   on 03-JAN-2003"
FT   mRNA            join(180499..180580,204504..204660,221533..221697,
FT                   223496..223614,228415..228583,230810..230869,
FT                   233626..233691,234493..234636,235249..237792)
FT                   /gene="Cab39"
FT                   /locus_tag="mCG_66415"
FT                   /product="calcium binding protein 39, transcript variant
FT                   mCT178042"
FT                   /note="gene_id=mCG66415.2 transcript_id=mCT178042.0 created
FT                   on 03-JAN-2003"
FT   mRNA            join(<181396..181506,204504..204660,221533..221697,
FT                   223496..223614,228415..228583,230810..230869,
FT                   233626..233691,234493..234636,235249..236581)
FT                   /gene="Cab39"
FT                   /locus_tag="mCG_66415"
FT                   /product="calcium binding protein 39, transcript variant
FT                   mCT193818"
FT                   /note="gene_id=mCG66415.2 transcript_id=mCT193818.0 created
FT                   on 09-MAR-2004"
FT   assembly_gap    200306..200552
FT                   /estimated_length=247
FT                   /gap_type="unknown"
FT   CDS             join(<204517..204660,221533..221697,223496..223614,
FT                   228415..228583,230810..230869,233626..233691,
FT                   234493..234636,235249..235437)
FT                   /codon_start=1
FT                   /gene="Cab39"
FT                   /locus_tag="mCG_66415"
FT                   /product="calcium binding protein 39, isoform CRA_b"
FT                   /note="gene_id=mCG66415.2 transcript_id=mCT193818.0
FT                   protein_id=mCP114784.0 isoform=CRA_b"
FT                   /protein_id="EDL40255.1"
FT                   /translation="SAVEASGAAVMPFPFGKSHKSPADIVKNLKESMAVLEKQDISDKK
FT                   AEKATEEVSKNLVAMKEILYGTNEKEPQTEAVAQLAQELYNSGLLGTLVADLQLIDFEG
FT                   KKDVAQIFNNILRRQIGTRTPTVEYICTQQNILFMLLKGYESPEIALNCGIMLRECIRH
FT                   EPLAKIILWSEQFYDFFRYVEMSTFDIASDAFATFKDLLTRHKLLSAEFLEQHYDRFFS
FT                   EYEKLLHSENYVTKRQSLKLLGELLLDRHNFTIMTKYISKPENLKLMMNLLRDKSRNIQ
FT                   FEAFHVFKVFVANPNKTQPILDILLKNQTKLIEFLSKFQNDRTEDEQFNDEKTYLVKQI
FT                   RDLKRAAQQEA"
FT   CDS             join(204547..204660,221533..221697,223496..223614,
FT                   228415..228583,230810..230869,233626..233691,
FT                   234493..234636,235249..235437)
FT                   /codon_start=1
FT                   /gene="Cab39"
FT                   /locus_tag="mCG_66415"
FT                   /product="calcium binding protein 39, isoform CRA_a"
FT                   /note="gene_id=mCG66415.2 transcript_id=mCT178042.0
FT                   protein_id=mCP100964.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q06138"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013878"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="MGI:MGI:107438"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q06138"
FT                   /protein_id="EDL40253.1"
FT                   /translation="MPFPFGKSHKSPADIVKNLKESMAVLEKQDISDKKAEKATEEVSK
FT                   NLVAMKEILYGTNEKEPQTEAVAQLAQELYNSGLLGTLVADLQLIDFEGKKDVAQIFNN
FT                   ILRRQIGTRTPTVEYICTQQNILFMLLKGYESPEIALNCGIMLRECIRHEPLAKIILWS
FT                   EQFYDFFRYVEMSTFDIASDAFATFKDLLTRHKLLSAEFLEQHYDRFFSEYEKLLHSEN
FT                   YVTKRQSLKLLGELLLDRHNFTIMTKYISKPENLKLMMNLLRDKSRNIQFEAFHVFKVF
FT                   VANPNKTQPILDILLKNQTKLIEFLSKFQNDRTEDEQFNDEKTYLVKQIRDLKRAAQQE
FT                   A"
FT   CDS             join(204547..204660,221533..221697,223496..223614,
FT                   228415..228583,230810..230869,233626..233691,
FT                   234493..234636,235249..235437)
FT                   /codon_start=1
FT                   /gene="Cab39"
FT                   /locus_tag="mCG_66415"
FT                   /product="calcium binding protein 39, isoform CRA_a"
FT                   /note="gene_id=mCG66415.2 transcript_id=mCT178043.0
FT                   protein_id=mCP100965.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q06138"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013878"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="MGI:MGI:107438"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q06138"
FT                   /protein_id="EDL40254.1"
FT                   /translation="MPFPFGKSHKSPADIVKNLKESMAVLEKQDISDKKAEKATEEVSK
FT                   NLVAMKEILYGTNEKEPQTEAVAQLAQELYNSGLLGTLVADLQLIDFEGKKDVAQIFNN
FT                   ILRRQIGTRTPTVEYICTQQNILFMLLKGYESPEIALNCGIMLRECIRHEPLAKIILWS
FT                   EQFYDFFRYVEMSTFDIASDAFATFKDLLTRHKLLSAEFLEQHYDRFFSEYEKLLHSEN
FT                   YVTKRQSLKLLGELLLDRHNFTIMTKYISKPENLKLMMNLLRDKSRNIQFEAFHVFKVF
FT                   VANPNKTQPILDILLKNQTKLIEFLSKFQNDRTEDEQFNDEKTYLVKQIRDLKRAAQQE
FT                   A"
FT   CDS             join(204547..204660,221533..221697,223496..223614,
FT                   228415..228583,230810..230869,233626..233691,
FT                   234493..234636,235249..235437)
FT                   /codon_start=1
FT                   /gene="Cab39"
FT                   /locus_tag="mCG_66415"
FT                   /product="calcium binding protein 39, isoform CRA_a"
FT                   /note="gene_id=mCG66415.2 transcript_id=mCT66598.2
FT                   protein_id=mCP36523.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q06138"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013878"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="MGI:MGI:107438"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q06138"
FT                   /protein_id="EDL40256.1"
FT                   /translation="MPFPFGKSHKSPADIVKNLKESMAVLEKQDISDKKAEKATEEVSK
FT                   NLVAMKEILYGTNEKEPQTEAVAQLAQELYNSGLLGTLVADLQLIDFEGKKDVAQIFNN
FT                   ILRRQIGTRTPTVEYICTQQNILFMLLKGYESPEIALNCGIMLRECIRHEPLAKIILWS
FT                   EQFYDFFRYVEMSTFDIASDAFATFKDLLTRHKLLSAEFLEQHYDRFFSEYEKLLHSEN
FT                   YVTKRQSLKLLGELLLDRHNFTIMTKYISKPENLKLMMNLLRDKSRNIQFEAFHVFKVF
FT                   VANPNKTQPILDILLKNQTKLIEFLSKFQNDRTEDEQFNDEKTYLVKQIRDLKRAAQQE
FT                   A"
FT   assembly_gap    226969..226988
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    272081..272100
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            280926..295287
FT                   /gene="Itm2c"
FT                   /locus_tag="mCG_8526"
FT                   /note="gene_id=mCG8526.2"
FT   mRNA            join(280926..281437,289638..289778,291844..292032,
FT                   293052..293162,293638..293788,294176..295287)
FT                   /gene="Itm2c"
FT                   /locus_tag="mCG_8526"
FT                   /product="integral membrane protein 2C, transcript variant
FT                   mCT7238"
FT                   /note="gene_id=mCG8526.2 transcript_id=mCT7238.2 created on
FT                   03-JAN-2003"
FT   mRNA            join(280926..281437,289641..289778,291844..292032,
FT                   293052..293162,293638..293788,294176..294778)
FT                   /gene="Itm2c"
FT                   /locus_tag="mCG_8526"
FT                   /product="integral membrane protein 2C, transcript variant
FT                   mCT178067"
FT                   /note="gene_id=mCG8526.2 transcript_id=mCT178067.0 created
FT                   on 03-JAN-2003"
FT   CDS             join(281312..281437,289638..289778,291844..292032,
FT                   293052..293162,293638..293788,294176..294267)
FT                   /codon_start=1
FT                   /gene="Itm2c"
FT                   /locus_tag="mCG_8526"
FT                   /product="integral membrane protein 2C, isoform CRA_c"
FT                   /note="gene_id=mCG8526.2 transcript_id=mCT7238.2
FT                   protein_id=mCP15638.2 isoform=CRA_c"
FT                   /protein_id="EDL40252.1"
FT                   /translation="MVKISFQPAVAGIKADKADKAAASGPASASAPAAEILLTPAREER
FT                   PPRHRSRKGGSVGGVCYLSMGMVVLLMGLVFASVYIYRYFFLAQLARDNFFHCGVLYED
FT                   SLSSQIRTRLELEEDVKIYLEENYERINVPVPQFGGGDPADIIHDFQRGLTAYHDISLD
FT                   KCYVIELNTTIVLPPRNFWELLMNVKRGTYLPQTYIIQEEMVVTEHVRDKEALGSFIYH
FT                   LCNGKDTYRLRRRSTRRRINKRGGKNCNAIRHFENTFVVETLICGVV"
FT   CDS             join(281312..281437,289641..289778,291844..292032,
FT                   293052..293162,293638..293788,294176..294267)
FT                   /codon_start=1
FT                   /gene="Itm2c"
FT                   /locus_tag="mCG_8526"
FT                   /product="integral membrane protein 2C, isoform CRA_b"
FT                   /note="gene_id=mCG8526.2 transcript_id=mCT178067.0
FT                   protein_id=mCP100989.0 isoform=CRA_b"
FT                   /protein_id="EDL40251.1"
FT                   /translation="MVKISFQPAVAGIKADKADKAAASGPASASAPAAEILLTPARERP
FT                   PRHRSRKGGSVGGVCYLSMGMVVLLMGLVFASVYIYRYFFLAQLARDNFFHCGVLYEDS
FT                   LSSQIRTRLELEEDVKIYLEENYERINVPVPQFGGGDPADIIHDFQRGLTAYHDISLDK
FT                   CYVIELNTTIVLPPRNFWELLMNVKRGTYLPQTYIIQEEMVVTEHVRDKEALGSFIYHL
FT                   CNGKDTYRLRRRSTRRRINKRGGKNCNAIRHFENTFVVETLICGVV"
FT   assembly_gap    284828..285044
FT                   /estimated_length=217
FT                   /gap_type="unknown"
FT   mRNA            join(292791..293162,293638..293788,294176..294423)
FT                   /gene="Itm2c"
FT                   /locus_tag="mCG_8526"
FT                   /product="integral membrane protein 2C, transcript variant
FT                   mCT178066"
FT                   /note="gene_id=mCG8526.2 transcript_id=mCT178066.0 created
FT                   on 03-JAN-2003"
FT   CDS             join(292929..293162,293638..293788,294176..294267)
FT                   /codon_start=1
FT                   /gene="Itm2c"
FT                   /locus_tag="mCG_8526"
FT                   /product="integral membrane protein 2C, isoform CRA_a"
FT                   /note="gene_id=mCG8526.2 transcript_id=mCT178066.0
FT                   protein_id=mCP100988.0 isoform=CRA_a"
FT                   /protein_id="EDL40250.1"
FT                   /translation="MSRNLGDATSEVPDSIDGMVGIGPLLAESLPQRLTAIPSPQGLTA
FT                   YHDISLDKCYVIELNTTIVLPPRNFWELLMNVKRGTYLPQTYIIQEEMVVTEHVRDKEA
FT                   LGSFIYHLCNGKDTYRLRRRSTRRRINKRGGKNCNAIRHFENTFVVETLICGVV"
FT   assembly_gap    299436..299455
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            315026..318298
FT                   /locus_tag="mCG_1047521"
FT                   /note="gene_id=mCG1047521.0"
FT   mRNA            join(315026..315636,317015..317080,317829..318298)
FT                   /locus_tag="mCG_1047521"
FT                   /product="mCG1047521"
FT                   /note="gene_id=mCG1047521.0 transcript_id=mCT165225.0
FT                   created on 14-MAR-2003"
FT   CDS             join(315548..315636,317015..317080,317829..318069)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1047521"
FT                   /product="mCG1047521"
FT                   /note="gene_id=mCG1047521.0 transcript_id=mCT165225.0
FT                   protein_id=mCP82304.1"
FT                   /protein_id="EDL40249.1"
FT                   /translation="MHPSETQELRNHTALRERKPPQQRCCSSPGLSGWLATCSDPLVAS
FT                   SEHRDYRIWELSLPCLLVGSEAWSCCLAANLCQACTAERILQDLERDDEQLPFLAWEVG
FT                   LFCALAALRGMHYDSWGTQCAFQFPKT"
FT   assembly_gap    319666..320310
FT                   /estimated_length=645
FT                   /gap_type="unknown"
FT   gene            complement(320311..324115)
FT                   /locus_tag="mCG_148399"
FT                   /note="gene_id=mCG148399.0"
FT   mRNA            complement(join(320311..321141,321234..324115))
FT                   /locus_tag="mCG_148399"
FT                   /product="mCG148399"
FT                   /note="gene_id=mCG148399.0 transcript_id=mCT188662.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(321805..322260)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148399"
FT                   /product="mCG148399"
FT                   /note="gene_id=mCG148399.0 transcript_id=mCT188662.0
FT                   protein_id=mCP108683.0"
FT                   /protein_id="EDL40248.1"
FT                   /translation="MLHGHKTLSYSSLTAASCPSHQLWCLFQRAHTKIMLWSLATFPEP
FT                   LPCLPFTDPVALSPSRLGLQSLAFFQGRVKPGDVQSRRFLASILIIVILGKIIDAWCQD
FT                   DMGKRQHLQSKSTGICASWANATCPLLSGTRKTERAYKYQWFLKRRE"
FT   assembly_gap    362206..362916
FT                   /estimated_length=711
FT                   /gap_type="unknown"
FT   assembly_gap    376063..376082
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    379465..379666
FT                   /estimated_length=202
FT                   /gap_type="unknown"
FT   gene            complement(380027..402700)
FT                   /locus_tag="mCG_1047287"
FT                   /note="gene_id=mCG1047287.1"
FT   mRNA            complement(join(380027..380155,400862..402700))
FT                   /locus_tag="mCG_1047287"
FT                   /product="mCG1047287"
FT                   /note="gene_id=mCG1047287.1 transcript_id=mCT164991.1
FT                   created on 19-SEP-2002"
FT   CDS             complement(401338..402186)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1047287"
FT                   /product="mCG1047287"
FT                   /note="gene_id=mCG1047287.1 transcript_id=mCT164991.1
FT                   protein_id=mCP81392.1"
FT                   /protein_id="EDL40247.1"
FT                   /translation="MNKFTHKRNPMPVNSVTKPLSISVLFKIIKGSIIEKETMRVNNVG
FT                   NLLRDRVMFKPMREITLEKNPMCVSTVGKPILPTVPFEHMKEVTQERNPMCVSIVGKPI
FT                   LPTVPFEHMKEVTQERNPMCVSIVGKPILPTIPFEHMKEVTQERNPMCVSIVGKPILPT
FT                   VPFEHMKEVTQERNPMCVSIVGKHSLNLATFEYIKELTQERNPTSVSNVGKPLLVLATC
FT                   KYIKEVIQEKNPMYVSSVGKPLLNPVTFTYIKEVTLERNLTYVSSVGKPSLCPVPFEGM
FT                   M"
FT   gene            405411..416680
FT                   /gene="Spata3"
FT                   /locus_tag="mCG_8520"
FT                   /note="gene_id=mCG8520.2"
FT   mRNA            join(405411..405542,413155..413298,416300..416679)
FT                   /gene="Spata3"
FT                   /locus_tag="mCG_8520"
FT                   /product="spermatogenesis associated 3, transcript variant
FT                   mCT178065"
FT                   /note="gene_id=mCG8520.2 transcript_id=mCT178065.0 created
FT                   on 16-APR-2003"
FT   CDS             join(405506..405542,413155..413270)
FT                   /codon_start=1
FT                   /gene="Spata3"
FT                   /locus_tag="mCG_8520"
FT                   /product="spermatogenesis associated 3, isoform CRA_b"
FT                   /note="gene_id=mCG8520.2 transcript_id=mCT178065.0
FT                   protein_id=mCP100987.0 isoform=CRA_b"
FT                   /protein_id="EDL40244.1"
FT                   /translation="MVHLVDRQTQTDENRQGSTALPVTLVLQALGTVAVALGALGVAYF
FT                   MAESL"
FT   mRNA            join(408687..409093,411075..411246,413155..413298,
FT                   413593..413899)
FT                   /gene="Spata3"
FT                   /locus_tag="mCG_8520"
FT                   /product="spermatogenesis associated 3, transcript variant
FT                   mCT178062"
FT                   /note="gene_id=mCG8520.2 transcript_id=mCT178062.0 created
FT                   on 16-APR-2003"
FT   mRNA            join(408687..409050,411072..411412)
FT                   /gene="Spata3"
FT                   /locus_tag="mCG_8520"
FT                   /product="spermatogenesis associated 3, transcript variant
FT                   mCT182020"
FT                   /note="gene_id=mCG8520.2 transcript_id=mCT182020.0 created
FT                   on 16-APR-2003"
FT   mRNA            join(408696..409093,411072..411246,413155..413298,
FT                   416300..416680)
FT                   /gene="Spata3"
FT                   /locus_tag="mCG_8520"
FT                   /product="spermatogenesis associated 3, transcript variant
FT                   mCT7253"
FT                   /note="gene_id=mCG8520.2 transcript_id=mCT7253.2 created on
FT                   16-APR-2003"
FT   mRNA            join(408696..409093,411075..411246,413155..413298,
FT                   415933..415983)
FT                   /gene="Spata3"
FT                   /locus_tag="mCG_8520"
FT                   /product="spermatogenesis associated 3, transcript variant
FT                   mCT178064"
FT                   /note="gene_id=mCG8520.2 transcript_id=mCT178064.0 created
FT                   on 16-APR-2003"
FT   CDS             join(408793..409093,411072..411246,413155..413260)
FT                   /codon_start=1
FT                   /gene="Spata3"
FT                   /locus_tag="mCG_8520"
FT                   /product="spermatogenesis associated 3, isoform CRA_d"
FT                   /note="gene_id=mCG8520.2 transcript_id=mCT7253.2
FT                   protein_id=mCP15656.2 isoform=CRA_d"
FT                   /protein_id="EDL40246.1"
FT                   /translation="MKKVKKKKSDSRRRRNSISPQTSSDSSQQPSSETPPSCPEPASPP
FT                   SKPQPCQESTTPHQVNPEPKPQQHTPQPLPPPEKPASSPFLVPMEPKPILPSRKAAVPL
FT                   TYVAPRSCSCAACPGSSACWHRLGLCHSRIFDVLLPRDWSSMPGRGVPNLLTFYRKPSR
FT                   KYCAPRNSRASSSRNCCCGSGGLGSCLLHG"
FT   CDS             join(408793..409093,411075..411246,413155..413260)
FT                   /codon_start=1
FT                   /gene="Spata3"
FT                   /locus_tag="mCG_8520"
FT                   /product="spermatogenesis associated 3, isoform CRA_a"
FT                   /note="gene_id=mCG8520.2 transcript_id=mCT178062.0
FT                   protein_id=mCP100986.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q3V2M5"
FT                   /db_xref="InterPro:IPR026717"
FT                   /db_xref="MGI:MGI:1917310"
FT                   /db_xref="UniProtKB/TrEMBL:Q3V2M5"
FT                   /protein_id="EDL40242.1"
FT                   /translation="MKKVKKKKSDSRRRRNSISPQTSSDSSQQPSSETPPSCPEPASPP
FT                   SKPQPCQESTTPHQVNPEPKPQQHTPQPLPPPEKPASSPFLVPMEPKPILPSRKAVPLT
FT                   YVAPRSCSCAACPGSSACWHRLGLCHSRIFDVLLPRDWSSMPGRGVPNLLTFYRKPSRK
FT                   YCAPRNSRASSSRNCCCGSGGLGSCLLHG"
FT   CDS             join(408793..409093,411075..411246,413155..413260)
FT                   /codon_start=1
FT                   /gene="Spata3"
FT                   /locus_tag="mCG_8520"
FT                   /product="spermatogenesis associated 3, isoform CRA_a"
FT                   /note="gene_id=mCG8520.2 transcript_id=mCT178064.0
FT                   protein_id=mCP100985.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q3V2M5"
FT                   /db_xref="InterPro:IPR026717"
FT                   /db_xref="MGI:MGI:1917310"
FT                   /db_xref="UniProtKB/TrEMBL:Q3V2M5"
FT                   /protein_id="EDL40243.1"
FT                   /translation="MKKVKKKKSDSRRRRNSISPQTSSDSSQQPSSETPPSCPEPASPP
FT                   SKPQPCQESTTPHQVNPEPKPQQHTPQPLPPPEKPASSPFLVPMEPKPILPSRKAVPLT
FT                   YVAPRSCSCAACPGSSACWHRLGLCHSRIFDVLLPRDWSSMPGRGVPNLLTFYRKPSRK
FT                   YCAPRNSRASSSRNCCCGSGGLGSCLLHG"
FT   CDS             join(408793..409050,411072..411083)
FT                   /codon_start=1
FT                   /gene="Spata3"
FT                   /locus_tag="mCG_8520"
FT                   /product="spermatogenesis associated 3, isoform CRA_c"
FT                   /note="gene_id=mCG8520.2 transcript_id=mCT182020.0
FT                   protein_id=mCP104942.0 isoform=CRA_c"
FT                   /protein_id="EDL40245.1"
FT                   /translation="MKKVKKKKSDSRRRRNSISPQTSSDSSQQPSSETPPSCPEPASPP
FT                   SKPQPCQESTTPHQVNPEPKPQQHTPQPLPPPEKPASSPFLQCL"
FT   gene            432985..442187
FT                   /locus_tag="mCG_8521"
FT                   /note="gene_id=mCG8521.1"
FT   mRNA            join(432985..433289,435306..435419,439677..442187)
FT                   /locus_tag="mCG_8521"
FT                   /product="mCG8521"
FT                   /note="gene_id=mCG8521.1 transcript_id=mCT7246.1 created on
FT                   05-FEB-2003"
FT   CDS             join(433037..433289,435306..435419,439677..439816)
FT                   /codon_start=1
FT                   /locus_tag="mCG_8521"
FT                   /product="mCG8521"
FT                   /note="gene_id=mCG8521.1 transcript_id=mCT7246.1
FT                   protein_id=mCP15658.2"
FT                   /protein_id="EDL40241.1"
FT                   /translation="MLRDVRDRRCEGAALVGVLVADTGADDARAPELQLLETLLRTVFG
FT                   RQVGGPVQAAAFRPGCPASSLAVQEAACRALQAAGPGRPAEGAWERPARTGLLTCFSWG
FT                   PRRQRKNRGVTSSQGPAQEHLQFSEEELALTPVFPNGDCEDRGNGSRAQDGGVHIPPDP
FT                   PEDTR"
FT   gene            451380..526053
FT                   /gene="Psmd1"
FT                   /locus_tag="mCG_8522"
FT                   /note="gene_id=mCG8522.1"
FT   mRNA            join(451380..451547,457328..457371,458364..458437,
FT                   458577..458746,462563..462768,464120..464263,
FT                   465334..465560,468799..468859,469909..470037,
FT                   471943..472031,472792..472870,473337..473511,
FT                   475568..475679,476753..476949,478765..478860,
FT                   481044..481108,503350..503464,505285..505401,
FT                   513232..513334,514912..515081,517416..517508,
FT                   519493..519579,520417..520563,523734..523887,
FT                   525843..526053)
FT                   /gene="Psmd1"
FT                   /locus_tag="mCG_8522"
FT                   /product="proteasome (prosome, macropain) 26S subunit,
FT                   non-ATPase, 1"
FT                   /note="gene_id=mCG8522.1 transcript_id=mCT7242.2 created on
FT                   05-FEB-2003"
FT   CDS             join(451532..451547,457328..457371,458364..458437,
FT                   458577..458746,462563..462768,464120..464263,
FT                   465334..465560,468799..468859,469909..470037,
FT                   471943..472031,472792..472870,473337..473465)
FT                   /codon_start=1
FT                   /gene="Psmd1"
FT                   /locus_tag="mCG_8522"
FT                   /product="proteasome (prosome, macropain) 26S subunit,
FT                   non-ATPase, 1"
FT                   /note="gene_id=mCG8522.1 transcript_id=mCT7242.2
FT                   protein_id=mCP15663.2"
FT                   /protein_id="EDL40237.1"
FT                   /translation="MITSAAGIISLLDEEEPQLKEFALHKLNAVVNDFWAEISESVDKI
FT                   EVLYEDEGFRSRQFAALVASKVFYHLGAFEESLNYALGAGDLFNVNDNSEYVETIIAKC
FT                   IDHYTKQCVENADLPEGEKKPIDQRLEGIVNKMFQRCLDDHKYKQAIGIALETRRLDVF
FT                   EKTILESNDVPGMLAYSLKLCMSLMQNKQFRNKVLRVLVKIYMNLEKPDFINVCQCLIF
FT                   LDDPQAVSDILEKLVKEDNLLMAYQICFDLYESASQQFLSSVIQNLRTVGTPIASVPGS
FT                   TNTGTVPGSEKDSDPMETEEKTASAVAGKTPDASPEPKDQTLKMIKILSGEMAIELHLQ
FT                   FLIRNNNTDLMILKNTKDAVRNSVCHTATVIANSFMHCGTTSDQFLRDNLEWLARATNW
FT                   AKFTATASLGVIHKGHEKEALQLMATYLPKDTSPGSAYQEGGRSLCIGSHSCQSWW"
FT   gene            complement(485819..498677)
FT                   /gene="Htr2b"
FT                   /locus_tag="mCG_8510"
FT                   /note="gene_id=mCG8510.2"
FT   mRNA            complement(join(485819..487000,489190..489390,
FT                   497302..497884,498647..498677))
FT                   /gene="Htr2b"
FT                   /locus_tag="mCG_8510"
FT                   /product="5-hydroxytryptamine (serotonin) receptor 2B,
FT                   transcript variant mCT7358"
FT                   /note="gene_id=mCG8510.2 transcript_id=mCT7358.1 created on
FT                   03-JAN-2003"
FT   CDS             complement(join(486111..487000,489190..489390,
FT                   497302..497650))
FT                   /codon_start=1
FT                   /gene="Htr2b"
FT                   /locus_tag="mCG_8510"
FT                   /product="5-hydroxytryptamine (serotonin) receptor 2B,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG8510.2 transcript_id=mCT7358.1
FT                   protein_id=mCP15667.1 isoform=CRA_c"
FT                   /protein_id="EDL40240.1"
FT                   /translation="MASSYKMSEQSTTSEHILQKTCDHLILTNRSGLETDSVAEEMKQT
FT                   VEGQGHTVHWAALLILAVIIPTIGGNILVILAVALEKRLQYATNYFLMSLAIADLLVGL
FT                   FVMPIALLTIMFEAIWPLPLALCPAWLFLDVLFSTASIMHLCAISLDRYIAIKKPIQAN
FT                   QCNSRATAFIKITVVWLISIGIAIPVPIKGIETDVINPHNVTCELTKDRFGSFMVFGSL
FT                   AAFFAPLTIMVVTYFLTIHTLQKKAYLVKNKPPQRLTRWTVPTVFLREDSSFSSPEKVA
FT                   MLDGSHRDKILPNSSDETLMRRMSSVGKRSAQTISNEQRASKALGVVFFLFLLMWCPFF
FT                   ITNLTLALCDSCNQTTLKTLLEIFVWIGYVSSGVNPLIYTLFNKTFREAFGRYITCNYR
FT                   ATKSVKALRKFSSTLCFGNSMVENSKFFTKHGIRNGINPAMYQSPMRLRSSTIQSSSII
FT                   LLDTLLTENDGDKAEEQVSYI"
FT   mRNA            complement(join(486869..487000,489209..489390,
FT                   497302..>497440))
FT                   /gene="Htr2b"
FT                   /locus_tag="mCG_8510"
FT                   /product="5-hydroxytryptamine (serotonin) receptor 2B,
FT                   transcript variant mCT193772"
FT                   /note="gene_id=mCG8510.2 transcript_id=mCT193772.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(<486869..487000,489142..489390,
FT                   497302..>497440))
FT                   /gene="Htr2b"
FT                   /locus_tag="mCG_8510"
FT                   /product="5-hydroxytryptamine (serotonin) receptor 2B,
FT                   transcript variant mCT193773"
FT                   /note="gene_id=mCG8510.2 transcript_id=mCT193773.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(<486869..487000,489142..489390,
FT                   497302..>497440))
FT                   /codon_start=1
FT                   /gene="Htr2b"
FT                   /locus_tag="mCG_8510"
FT                   /product="5-hydroxytryptamine (serotonin) receptor 2B,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG8510.2 transcript_id=mCT193773.0
FT                   protein_id=mCP114766.0 isoform=CRA_b"
FT                   /db_xref="GOA:G3UVT8"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000482"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:109323"
FT                   /db_xref="UniProtKB/TrEMBL:G3UVT8"
FT                   /protein_id="EDL40239.1"
FT                   /translation="NILVILAVALEKRLQYATNYFLMSLAIADLLVGLFVMPIALLTIM
FT                   FEAIWPLPLALCPAWLFLDVLFSTASIMHLCAISLDRYIAIKKPIQANQCNSRATAFIK
FT                   ITVVWLISIGMWGMPLFPYGQNASSGIAIPVPIKGIETDVINPHNVTCELTKDRFGSFM
FT                   VFGSLAAFFA"
FT   CDS             complement(join(486956..487000,489209..489390,
FT                   497302..>497440))
FT                   /codon_start=1
FT                   /gene="Htr2b"
FT                   /locus_tag="mCG_8510"
FT                   /product="5-hydroxytryptamine (serotonin) receptor 2B,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG8510.2 transcript_id=mCT193772.0
FT                   protein_id=mCP114765.0 isoform=CRA_a"
FT                   /protein_id="EDL40238.1"
FT                   /translation="NILVILAVALEKRLQYATNYFLMSLAIADLLVGLFVMPIALLTIM
FT                   FEAIWPLPLALCPAWLFLDVLFSTASIMHLCAISLDRYIAIKKPIQANQCNSRATAFIK
FT                   ITVASPSQSLLKESRLM"
FT   gene            <541704..666453
FT                   /gene="Armc9"
FT                   /locus_tag="mCG_8512"
FT                   /note="gene_id=mCG8512.3"
FT   mRNA            join(<541704..541764,543822..543909,546898..547026,
FT                   549568..549738,551599..551754,557471..557563,
FT                   559690..559714,561123..561280,564488..564586,
FT                   575713..575747,578487..578598,580610..580702,
FT                   583877..583967,585919..586042,587844..587983,
FT                   589440..589516,592108..592182,597658..597748,
FT                   602762..602817,634268..634372,641992..642107,
FT                   646947..649548)
FT                   /gene="Armc9"
FT                   /locus_tag="mCG_8512"
FT                   /product="armadillo repeat containing 9, transcript variant
FT                   mCT193775"
FT                   /note="gene_id=mCG8512.3 transcript_id=mCT193775.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(541705..541764,543822..543909,546898..547026,
FT                   549568..549738,551599..551754,557471..557892)
FT                   /gene="Armc9"
FT                   /locus_tag="mCG_8512"
FT                   /product="armadillo repeat containing 9, transcript variant
FT                   mCT178058"
FT                   /note="gene_id=mCG8512.3 transcript_id=mCT178058.0 created
FT                   on 03-JAN-2003"
FT   mRNA            join(541711..541764,543822..543909,546898..547026,
FT                   549568..549738,551599..551754,557471..557563,
FT                   559690..559714,561123..561280,564488..564586,
FT                   575713..575747,578487..578598,580610..580702,
FT                   583877..583967,585919..586042,587844..587983,
FT                   589440..589516,592108..592182,597658..597748,
FT                   602762..602817,634268..634372,641992..642107,
FT                   646947..647083,651764..651887,664141..664313,
FT                   665418..666010)
FT                   /gene="Armc9"
FT                   /locus_tag="mCG_8512"
FT                   /product="armadillo repeat containing 9, transcript variant
FT                   mCT7356"
FT                   /note="gene_id=mCG8512.3 transcript_id=mCT7356.1 created on
FT                   03-JAN-2003"
FT   mRNA            join(541711..541764,543822..543909,546898..547026,
FT                   551599..551754,557471..557563,559690..559714,
FT                   561123..561280,564488..564586,575713..575747,
FT                   578487..578598,580610..580702,583877..583967,
FT                   585919..586042,587844..587983,589440..589516,
FT                   592108..592182,597658..597748,602762..602817,
FT                   634268..634372,641992..642107,646947..647083,
FT                   651764..651887,664141..664313,665418..666010)
FT                   /gene="Armc9"
FT                   /locus_tag="mCG_8512"
FT                   /product="armadillo repeat containing 9, transcript variant
FT                   mCT178061"
FT                   /note="gene_id=mCG8512.3 transcript_id=mCT178061.0 created
FT                   on 03-JAN-2003"
FT   mRNA            join(541711..541764,543822..543909,546898..547026,
FT                   549568..549738,551599..551754,557471..557563,
FT                   559690..559714,561123..561280,564488..564586,
FT                   575713..575747,578487..578598,580610..580702,
FT                   583877..583967,585919..586042,587844..587983,
FT                   589440..589516,592108..592182,597658..597748,
FT                   602762..602817,634268..634372,646947..647083,
FT                   651764..651887,658665..658845)
FT                   /gene="Armc9"
FT                   /locus_tag="mCG_8512"
FT                   /product="armadillo repeat containing 9, transcript variant
FT                   mCT178060"
FT                   /note="gene_id=mCG8512.3 transcript_id=mCT178060.0 created
FT                   on 03-JAN-2003"
FT   mRNA            join(<541717..541764,543822..543909,546898..547026,
FT                   549568..549738,551599..551754,557471..557563,
FT                   559690..559714,561123..561280,564488..564586,
FT                   575713..575747,578487..578598,580610..580702,
FT                   583877..583967,585919..586042,587844..587983,
FT                   589440..589516,592108..592182,597658..597748,
FT                   602762..602817,634268..634372,641992..642107,
FT                   646947..647083,651761..651887,664141..664313,
FT                   665418..666453)
FT                   /gene="Armc9"
FT                   /locus_tag="mCG_8512"
FT                   /product="armadillo repeat containing 9, transcript variant
FT                   mCT193776"
FT                   /note="gene_id=mCG8512.3 transcript_id=mCT193776.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(541727..541764,543822..543909,546898..547026,
FT                   549568..549738,551599..551754,557471..557563,
FT                   559690..559714,561123..561280,564488..564586,
FT                   575713..575747,578487..578598,580610..580702,
FT                   583877..583967,585990..586042,587844..587983,
FT                   589440..589516,592108..592182,597658..597748,
FT                   602762..602817,608567..608617,634268..634372,
FT                   641992..642107,646947..647083,651761..651887,
FT                   664141..664313,665418..666010)
FT                   /gene="Armc9"
FT                   /locus_tag="mCG_8512"
FT                   /product="armadillo repeat containing 9, transcript variant
FT                   mCT178059"
FT                   /note="gene_id=mCG8512.3 transcript_id=mCT178059.0 created
FT                   on 03-JAN-2003"
FT   mRNA            join(541731..541764,543822..543909,546898..547026,
FT                   549568..549738,551599..551754,557471..557563,
FT                   559690..559714,561123..561280,564488..565375)
FT                   /gene="Armc9"
FT                   /locus_tag="mCG_8512"
FT                   /product="armadillo repeat containing 9, transcript variant
FT                   mCT178057"
FT                   /note="gene_id=mCG8512.3 transcript_id=mCT178057.0 created
FT                   on 03-JAN-2003"
FT   mRNA            join(<541735..541764,543822..543909,546898..547026,
FT                   549568..549738,551599..551754,557471..557563,
FT                   559690..559714,561123..561280,564488..564586,
FT                   575713..575747,578487..578598,580610..580702,
FT                   583877..583967,585919..586042,587844..587983,
FT                   589440..589516,592108..592182,597658..597748,
FT                   602762..602817,634268..634372,641992..642204)
FT                   /gene="Armc9"
FT                   /locus_tag="mCG_8512"
FT                   /product="armadillo repeat containing 9, transcript variant
FT                   mCT193774"
FT                   /note="gene_id=mCG8512.3 transcript_id=mCT193774.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<543850..543909,546898..547026,549568..549738,
FT                   551599..551754,557471..557563,559690..559714,
FT                   561123..561280,564488..564586,575713..575747,
FT                   578487..578598,580610..580702,583877..583967,
FT                   585919..586042,587844..587983,589440..589516,
FT                   592108..592182,597658..597748,602762..602817,
FT                   634268..634372,641992..642107,646947..647083,
FT                   651761..651887,664141..664313,665418..665440)
FT                   /codon_start=1
FT                   /gene="Armc9"
FT                   /locus_tag="mCG_8512"
FT                   /product="armadillo repeat containing 9, isoform CRA_g"
FT                   /note="gene_id=mCG8512.3 transcript_id=mCT193776.0
FT                   protein_id=mCP114769.0 isoform=CRA_g"
FT                   /protein_id="EDL40234.1"
FT                   /translation="LFTMGDILAHESELLGLVKEYLDFAEFEDTLKTFSKECKVKGKPL
FT                   CKNVGGSLKKDSKSLVIQRDLVAAFDSGDQKAFFDLWEGHIPSSVRDTDSLAQKLEFYL
FT                   HIHFAIYLLKYCRGRPDKQELDKRISYFKTYLETKGAALSQTTEFLPFYALPFVPNPMV
FT                   HPSFKELFQDSWTPELKLKLEKFLALTFKANNTPKLLTIYKENGPNSKELLQQLHQQLV
FT                   EAERRAMTYLKRYNKIQADYHNLIGVTAELVDSLEATVSGKMITPEYLQSVCVRLFSNQ
FT                   MRQSLAHSVDFTRPGTASTMLRASLAPEKLKDVPLLPSLDYEKLKKDLIWGSDRLKAFL
FT                   LQALRWRLTTSHPGEQRETVLQAYISNDLLDCHSHNQRSVLQLLHSKSEAVRQYMARLI
FT                   NALASLAEGRLYLAQNTKVLRMLEGRLKEEDKDVITRENVLGALQKFSLRRPLQTAMIR
FT                   DGLIFWLIDLLKDPDCLSDYTLEYSVALLMNLCLRSAGKNMCAKVAGLMLKVLSDLLGH
FT                   ENHEIQPYVNGALYSILSIPSIREEARAMGMEDILRCFIKEGNAEMIRQIEFIIKQLNS
FT                   EDLLDGVLESDDDEDEDDEEDHDIMEADLDKDELIQPQLGELSGEKLLTTEYLGIMTNT
FT                   GKARRKGPASVQWSGDEPLRRPVTPGGHRTGCPVLGDHLISPQNAQQARNGCLRAMPVA
FT                   HPDDYKEGKPGVTGCGTSSSSVMDHKPREWSPAGHQKSRLVPTAALGWPREMTQDPSSG
FT                   HITREFVPAFTCKPQVPSTPETVEQNPLKAKALSLAPQFSSSGPQQASRPASTASSTRG
FT                   LHSSQSIRK"
FT   CDS             join(<543850..543909,546898..547026,549568..549738,
FT                   551599..551754,557471..557563,559690..559714,
FT                   561123..561280,564488..564586,575713..575747,
FT                   578487..578598,580610..580702,583877..583967,
FT                   585919..586042,587844..587983,589440..589516,
FT                   592108..592182,597658..597748,602762..602817,
FT                   634268..634372,641992..642107,646947..647145)
FT                   /codon_start=1
FT                   /gene="Armc9"
FT                   /locus_tag="mCG_8512"
FT                   /product="armadillo repeat containing 9, isoform CRA_f"
FT                   /note="gene_id=mCG8512.3 transcript_id=mCT193775.0
FT                   protein_id=mCP114768.0 isoform=CRA_f"
FT                   /protein_id="EDL40233.1"
FT                   /translation="LFTMGDILAHESELLGLVKEYLDFAEFEDTLKTFSKECKVKGKPL
FT                   CKNVGGSLKKDSKSLVIQRDLVAAFDSGDQKAFFDLWEGHIPSSVRDTDSLAQKLEFYL
FT                   HIHFAIYLLKYCRGRPDKQELDKRISYFKTYLETKGAALSQTTEFLPFYALPFVPNPMV
FT                   HPSFKELFQDSWTPELKLKLEKFLALTFKANNTPKLLTIYKENGPNSKELLQQLHQQLV
FT                   EAERRAMTYLKRYNKIQADYHNLIGVTAELVDSLEATVSGKMITPEYLQSVCVRLFSNQ
FT                   MRQSLAHSVDFTRPGTASTMLRASLAPEKLKDVPLLPSLDYEKLKKDLIWGSDRLKAFL
FT                   LQALRWRLTTSHPGEQRETVLQAYISNDLLDCHSHNQRSVLQLLHSKSEAVRQYMARLI
FT                   NALASLAEGRLYLAQNTKVLRMLEGRLKEEDKDVITRENVLGALQKFSLRRPLQTAMIR
FT                   DGLIFWLIDLLKDPDCLSDYTLEYSVALLMNLCLRSAGKNMCAKVAGLMLKVLSDLLGH
FT                   ENHEIQPYVNGALYSILSIPSIREEARAMGMEDILRCFIKEGNAEMIRQIEFIIKQLNS
FT                   EDLLDGVLESDDDEDEDDEEDHDIMEADLDKDELIQPQLGELSGEKLLTTEYLGIMTNT
FT                   GKARRKGPASVQWSGDEPLRRPVTPGGHRTGCPVLGDHLISPQNAQQARNGCLRAMPVA
FT                   HPDDYKEGKPGVTGCGTSSSCKNAVGAKPVLSSWAQESKR"
FT   CDS             join(<543850..543909,546898..547026,549568..549738,
FT                   551599..551754,557471..557563,559690..559714,
FT                   561123..561280,564488..564586,575713..575747,
FT                   578487..578598,580610..580702,583877..583967,
FT                   585919..586042,587844..587983,589440..589516,
FT                   592108..592182,597658..597748,602762..602817,
FT                   634268..634372,641992..642111)
FT                   /codon_start=1
FT                   /gene="Armc9"
FT                   /locus_tag="mCG_8512"
FT                   /product="armadillo repeat containing 9, isoform CRA_e"
FT                   /note="gene_id=mCG8512.3 transcript_id=mCT193774.0
FT                   protein_id=mCP114767.0 isoform=CRA_e"
FT                   /protein_id="EDL40232.1"
FT                   /translation="LFTMGDILAHESELLGLVKEYLDFAEFEDTLKTFSKECKVKGKPL
FT                   CKNVGGSLKKDSKSLVIQRDLVAAFDSGDQKAFFDLWEGHIPSSVRDTDSLAQKLEFYL
FT                   HIHFAIYLLKYCRGRPDKQELDKRISYFKTYLETKGAALSQTTEFLPFYALPFVPNPMV
FT                   HPSFKELFQDSWTPELKLKLEKFLALTFKANNTPKLLTIYKENGPNSKELLQQLHQQLV
FT                   EAERRAMTYLKRYNKIQADYHNLIGVTAELVDSLEATVSGKMITPEYLQSVCVRLFSNQ
FT                   MRQSLAHSVDFTRPGTASTMLRASLAPEKLKDVPLLPSLDYEKLKKDLIWGSDRLKAFL
FT                   LQALRWRLTTSHPGEQRETVLQAYISNDLLDCHSHNQRSVLQLLHSKSEAVRQYMARLI
FT                   NALASLAEGRLYLAQNTKVLRMLEGRLKEEDKDVITRENVLGALQKFSLRRPLQTAMIR
FT                   DGLIFWLIDLLKDPDCLSDYTLEYSVALLMNLCLRSAGKNMCAKVAGLMLKVLSDLLGH
FT                   ENHEIQPYVNGALYSILSIPSIREEARAMGMEDILRCFIKEGNAEMIRQIEFIIKQLNS
FT                   EDLLDGVLESDDDEDEDDEEDHDIMEADLDKDELIQPQLGELSGEKLLTTEYLGIMTNT
FT                   GKARRKGPASVQWSGDEPLRRPVTPGGHRTGCPV"
FT   CDS             join(543859..543909,546898..547026,549568..549738,
FT                   551599..551754,557471..557563,559690..559714,
FT                   561123..561280,564488..564586,575713..575747,
FT                   578487..578598,580610..580702,583877..583967,
FT                   585919..586042,587844..587983,589440..589516,
FT                   592108..592182,597658..597748,602762..602817,
FT                   634268..634372,641992..642107,646947..647083,
FT                   651764..651887,664141..664313,665418..665440)
FT                   /codon_start=1
FT                   /gene="Armc9"
FT                   /locus_tag="mCG_8512"
FT                   /product="armadillo repeat containing 9, isoform CRA_h"
FT                   /note="gene_id=mCG8512.3 transcript_id=mCT7356.1
FT                   protein_id=mCP15673.1 isoform=CRA_h"
FT                   /protein_id="EDL40235.1"
FT                   /translation="MGDILAHESELLGLVKEYLDFAEFEDTLKTFSKECKVKGKPLCKN
FT                   VGGSLKKDSKSLVIQRDLVAAFDSGDQKAFFDLWEGHIPSSVRDTDSLAQKLEFYLHIH
FT                   FAIYLLKYCRGRPDKQELDKRISYFKTYLETKGAALSQTTEFLPFYALPFVPNPMVHPS
FT                   FKELFQDSWTPELKLKLEKFLALTFKANNTPKLLTIYKENGPNSKELLQQLHQQLVEAE
FT                   RRAMTYLKRYNKIQADYHNLIGVTAELVDSLEATVSGKMITPEYLQSVCVRLFSNQMRQ
FT                   SLAHSVDFTRPGTASTMLRASLAPEKLKDVPLLPSLDYEKLKKDLIWGSDRLKAFLLQA
FT                   LRWRLTTSHPGEQRETVLQAYISNDLLDCHSHNQRSVLQLLHSKSEAVRQYMARLINAL
FT                   ASLAEGRLYLAQNTKVLRMLEGRLKEEDKDVITRENVLGALQKFSLRRPLQTAMIRDGL
FT                   IFWLIDLLKDPDCLSDYTLEYSVALLMNLCLRSAGKNMCAKVAGLMLKVLSDLLGHENH
FT                   EIQPYVNGALYSILSIPSIREEARAMGMEDILRCFIKEGNAEMIRQIEFIIKQLNSEDL
FT                   LDGVLESDDDEDEDDEEDHDIMEADLDKDELIQPQLGELSGEKLLTTEYLGIMTNTGKA
FT                   RRKGPASVQWSGDEPLRRPVTPGGHRTGCPVLGDHLISPQNAQQARNGCLRAMPVAHPD
FT                   DYKEGKPGVTGCGTSSSFMDHKPREWSPAGHQKSRLVPTAALGWPREMTQDPSSGHITR
FT                   EFVPAFTCKPQVPSTPETVEQNPLKAKALSLAPQFSSSGPQQASRPASTASSTRGLHSS
FT                   QSIRK"
FT   CDS             join(543859..543909,546898..547026,551599..551754,
FT                   557471..557563,559690..559714,561123..561280,
FT                   564488..564586,575713..575747,578487..578598,
FT                   580610..580702,583877..583967,585919..586042,
FT                   587844..587983,589440..589516,592108..592182,
FT                   597658..597748,602762..602817,634268..634372,
FT                   641992..642107,646947..647083,651764..651887,
FT                   664141..664313,665418..665440)
FT                   /codon_start=1
FT                   /gene="Armc9"
FT                   /locus_tag="mCG_8512"
FT                   /product="armadillo repeat containing 9, isoform CRA_d"
FT                   /note="gene_id=mCG8512.3 transcript_id=mCT178061.0
FT                   protein_id=mCP100982.0 isoform=CRA_d"
FT                   /protein_id="EDL40231.1"
FT                   /translation="MGDILAHESELLGLVKEYLDFAEFEDTLKTFSKECKVKGKPLCKN
FT                   VGGSLKKDSKSLVIQDKQELDKRISYFKTYLETKGAALSQTTEFLPFYALPFVPNPMVH
FT                   PSFKELFQDSWTPELKLKLEKFLALTFKANNTPKLLTIYKENGPNSKELLQQLHQQLVE
FT                   AERRAMTYLKRYNKIQADYHNLIGVTAELVDSLEATVSGKMITPEYLQSVCVRLFSNQM
FT                   RQSLAHSVDFTRPGTASTMLRASLAPEKLKDVPLLPSLDYEKLKKDLIWGSDRLKAFLL
FT                   QALRWRLTTSHPGEQRETVLQAYISNDLLDCHSHNQRSVLQLLHSKSEAVRQYMARLIN
FT                   ALASLAEGRLYLAQNTKVLRMLEGRLKEEDKDVITRENVLGALQKFSLRRPLQTAMIRD
FT                   GLIFWLIDLLKDPDCLSDYTLEYSVALLMNLCLRSAGKNMCAKVAGLMLKVLSDLLGHE
FT                   NHEIQPYVNGALYSILSIPSIREEARAMGMEDILRCFIKEGNAEMIRQIEFIIKQLNSE
FT                   DLLDGVLESDDDEDEDDEEDHDIMEADLDKDELIQPQLGELSGEKLLTTEYLGIMTNTG
FT                   KARRKGPASVQWSGDEPLRRPVTPGGHRTGCPVLGDHLISPQNAQQARNGCLRAMPVAH
FT                   PDDYKEGKPGVTGCGTSSSFMDHKPREWSPAGHQKSRLVPTAALGWPREMTQDPSSGHI
FT                   TREFVPAFTCKPQVPSTPETVEQNPLKAKALSLAPQFSSSGPQQASRPASTASSTRGLH
FT                   SSQSIRK"
FT   CDS             join(543859..543909,546898..547026,549568..549738,
FT                   551599..551754,557471..557563,559690..559714,
FT                   561123..561280,564488..564586,575713..575747,
FT                   578487..578598,580610..580702,583877..583967,
FT                   585919..586042,587844..587983,589440..589516,
FT                   592108..592182,597658..597748,602762..602817,
FT                   634268..634372,646947..647033)
FT                   /codon_start=1
FT                   /gene="Armc9"
FT                   /locus_tag="mCG_8512"
FT                   /product="armadillo repeat containing 9, isoform CRA_c"
FT                   /note="gene_id=mCG8512.3 transcript_id=mCT178060.0
FT                   protein_id=mCP100981.0 isoform=CRA_c"
FT                   /protein_id="EDL40230.1"
FT                   /translation="MGDILAHESELLGLVKEYLDFAEFEDTLKTFSKECKVKGKPLCKN
FT                   VGGSLKKDSKSLVIQRDLVAAFDSGDQKAFFDLWEGHIPSSVRDTDSLAQKLEFYLHIH
FT                   FAIYLLKYCRGRPDKQELDKRISYFKTYLETKGAALSQTTEFLPFYALPFVPNPMVHPS
FT                   FKELFQDSWTPELKLKLEKFLALTFKANNTPKLLTIYKENGPNSKELLQQLHQQLVEAE
FT                   RRAMTYLKRYNKIQADYHNLIGVTAELVDSLEATVSGKMITPEYLQSVCVRLFSNQMRQ
FT                   SLAHSVDFTRPGTASTMLRASLAPEKLKDVPLLPSLDYEKLKKDLIWGSDRLKAFLLQA
FT                   LRWRLTTSHPGEQRETVLQAYISNDLLDCHSHNQRSVLQLLHSKSEAVRQYMARLINAL
FT                   ASLAEGRLYLAQNTKVLRMLEGRLKEEDKDVITRENVLGALQKFSLRRPLQTAMIRDGL
FT                   IFWLIDLLKDPDCLSDYTLEYSVALLMNLCLRSAGKNMCAKVAGLMLKVLSDLLGHENH
FT                   EIQPYVNGALYSILSIPSIREEARAMGMEDILRCFIKEGNAEMIRQIEFIIKQLNSEDL
FT                   LDGVLESDDDEDEDDEEDHDIMEADLDKDELIQPQLGELSGEKLLTTEYLGARRPSHFS
FT                   PECPTSQKRLPASHASRSSR"
FT   CDS             join(543859..543909,546898..547026,549568..549738,
FT                   551599..551754,557471..557563,559690..559714,
FT                   561123..561280,564488..564643)
FT                   /codon_start=1
FT                   /gene="Armc9"
FT                   /locus_tag="mCG_8512"
FT                   /product="armadillo repeat containing 9, isoform CRA_a"
FT                   /note="gene_id=mCG8512.3 transcript_id=mCT178057.0
FT                   protein_id=mCP100979.0 isoform=CRA_a"
FT                   /protein_id="EDL40228.1"
FT                   /translation="MGDILAHESELLGLVKEYLDFAEFEDTLKTFSKECKVKGKPLCKN
FT                   VGGSLKKDSKSLVIQRDLVAAFDSGDQKAFFDLWEGHIPSSVRDTDSLAQKLEFYLHIH
FT                   FAIYLLKYCRGRPDKQELDKRISYFKTYLETKGAALSQTTEFLPFYALPFVPNPMVHPS
FT                   FKELFQDSWTPELKLKLEKFLALTFKANNTPKLLTIYKENGPNSKELLQQLHQQLVEAE
FT                   RRAMTYLKRYNKIQADYHNLIGVTAELVDSLEATVSGKMITPEYLQSVCVRLFSNQMRQ
FT                   SLAHSVDFTRPGTVRCHERRGILGLSPKTYK"
FT   CDS             join(543859..543909,546898..547026,549568..549738,
FT                   551599..551754,557471..557581)
FT                   /codon_start=1
FT                   /gene="Armc9"
FT                   /locus_tag="mCG_8512"
FT                   /product="armadillo repeat containing 9, isoform CRA_b"
FT                   /note="gene_id=mCG8512.3 transcript_id=mCT178058.0
FT                   protein_id=mCP100980.0 isoform=CRA_b"
FT                   /protein_id="EDL40229.1"
FT                   /translation="MGDILAHESELLGLVKEYLDFAEFEDTLKTFSKECKVKGKPLCKN
FT                   VGGSLKKDSKSLVIQRDLVAAFDSGDQKAFFDLWEGHIPSSVRDTDSLAQKLEFYLHIH
FT                   FAIYLLKYCRGRPDKQELDKRISYFKTYLETKGAALSQTTEFLPFYALPFVPNPMVHPS
FT                   FKELFQDSWTPELKLKLEKFLALTFKANNTPKLLTIYVSFMK"
FT   assembly_gap    553712..553731
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    559082..559119
FT                   /estimated_length=38
FT                   /gap_type="unknown"
FT   CDS             join(580671..580702,583877..583967,585990..586042,
FT                   587844..587983,589440..589516,592108..592182,
FT                   597658..597748,602762..602817,608567..608617,
FT                   634268..634372,641992..642107,646947..647083,
FT                   651761..651887,664141..664313,665418..665440)
FT                   /codon_start=1
FT                   /gene="Armc9"
FT                   /locus_tag="mCG_8512"
FT                   /product="armadillo repeat containing 9, isoform CRA_i"
FT                   /note="gene_id=mCG8512.3 transcript_id=mCT178059.0
FT                   protein_id=mCP100983.0 isoform=CRA_i"
FT                   /protein_id="EDL40236.1"
FT                   /translation="MTSWIATAITRGVCCSCCTPRARLCGSTWPGSSMPWRHWLKDVIT
FT                   RENVLGALQKFSLRRPLQTAMIRDGLIFWLIDLLKDPDCLSDYTLEYSVALLMNLCLRS
FT                   AGKNMCAKVAGLMLKVLSDLLGHENHEIQPYVNGALYSILSIPSIREEARAMGMEDILR
FT                   CFIKEGNAEMIRQIEFIIKQLNSEDLLDGVLESDDDEDEDDETGSHGVQAGLELCNYLK
FT                   EDHDIMEADLDKDELIQPQLGELSGEKLLTTEYLGIMTNTGKARRKGPASVQWSGDEPL
FT                   RRPVTPGGHRTGCPVLGDHLISPQNAQQARNGCLRAMPVAHPDDYKEGKPGVTGCGTSS
FT                   SSVMDHKPREWSPAGHQKSRLVPTAALGWPREMTQDPSSGHITREFVPAFTCKPQVPST
FT                   PETVEQNPLKAKALSLAPQFSSSGPQQASRPASTASSTRGLHSSQSIRK"
FT   assembly_gap    593283..593497
FT                   /estimated_length=215
FT                   /gap_type="unknown"
FT   assembly_gap    610797..610816
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    655957..656011
FT                   /estimated_length=55
FT                   /gap_type="unknown"
FT   assembly_gap    670626..670807
FT                   /estimated_length=182
FT                   /gap_type="unknown"
FT   assembly_gap    677137..677419
FT                   /estimated_length=283
FT                   /gap_type="unknown"
FT   assembly_gap    679748..679805
FT                   /estimated_length=58
FT                   /gap_type="unknown"
FT   assembly_gap    689722..690898
FT                   /estimated_length=1177
FT                   /gap_type="unknown"
FT   gene            692831..696903
FT                   /gene="B3gnt7"
FT                   /locus_tag="mCG_8506"
FT                   /note="gene_id=mCG8506.2"
FT   mRNA            join(692831..693153,694644..696903)
FT                   /gene="B3gnt7"
FT                   /locus_tag="mCG_8506"
FT                   /product="UDP-GlcNAc:betaGal
FT                   beta-1,3-N-acetylglucosaminyltransferase 7"
FT                   /note="gene_id=mCG8506.2 transcript_id=mCT7359.2 created on
FT                   03-JAN-2003"
FT   CDS             join(693143..693153,694644..695826)
FT                   /codon_start=1
FT                   /gene="B3gnt7"
FT                   /locus_tag="mCG_8506"
FT                   /product="UDP-GlcNAc:betaGal
FT                   beta-1,3-N-acetylglucosaminyltransferase 7"
FT                   /note="gene_id=mCG8506.2 transcript_id=mCT7359.2
FT                   protein_id=mCP15637.2"
FT                   /protein_id="EDL40227.1"
FT                   /translation="MSLWKKTLYKSVCLALALLVAVTVFQRSVTPGQFLQDPLPPTPGP
FT                   AKTGNLVNPNSFWKSSKDVAAPTPTVPRGPQVWDVITTNCSININLTHQPWFQSLEPHF
FT                   RQFLAYRHCRYFPMLLNHPEKCAGDVYMLVVVKSVITQHDRREVIRQTWGHEWESAGLG
FT                   RGAVRTLFLLGTASKQEERTHYQQLLAYEDRLYADILQWDFLDSFFNLTLKEIHFLKWL
FT                   DIYCPNVPFVFKGDDDVFVNPTNLLEFLSDRQPQENLFVGDVLKHARPIRKKDNKYYIP
FT                   AVMYGKATYPPYAGGGGFLMSGSLARQLHHACDTLELFPIDDVFLGMCLEVLGVKPTGH
FT                   EGFKTFGISRVRSSRMNKEPCFYRAMLVVHKLLPAELLAMWDLVHSNLTCSVKFQVL"
FT   gene            709467..709796
FT                   /pseudo
FT                   /locus_tag="mCG_142336"
FT                   /note="gene_id=mCG142336.0"
FT   mRNA            709467..709796
FT                   /pseudo
FT                   /locus_tag="mCG_142336"
FT                   /note="gene_id=mCG142336.0 transcript_id=mCT179934.0
FT                   created on 14-FEB-2003"
FT   assembly_gap    710223..710242
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    719469..719625
FT                   /estimated_length=157
FT                   /gap_type="unknown"
FT   gene            complement(735983..745688)
FT                   /gene="Ncl"
FT                   /locus_tag="mCG_8509"
FT                   /note="gene_id=mCG8509.2"
FT   mRNA            complement(join(735983..736968,737333..737366,
FT                   737698..737824,738529..738650,738841..738964,
FT                   739457..739611,740063..740186,741350..741474,
FT                   742382..742523,742701..742787,742886..743071,
FT                   743287..743782,744436..744552,745527..745596))
FT                   /gene="Ncl"
FT                   /locus_tag="mCG_8509"
FT                   /product="nucleolin, transcript variant mCT178296"
FT                   /note="gene_id=mCG8509.2 transcript_id=mCT178296.0 created
FT                   on 03-JAN-2003"
FT   mRNA            complement(join(736137..737018,737143..737366,
FT                   737698..737824,738529..738650,738841..738964,
FT                   739457..739611,740063..740186,741350..741474,
FT                   742382..742523,742701..742787,742886..743071,
FT                   743287..743463,744469..744552,745527..745652))
FT                   /gene="Ncl"
FT                   /locus_tag="mCG_8509"
FT                   /product="nucleolin, transcript variant mCT178294"
FT                   /note="gene_id=mCG8509.2 transcript_id=mCT178294.0 created
FT                   on 03-JAN-2003"
FT   mRNA            complement(join(736137..737027,737143..737366,
FT                   737698..737824,738529..738650,738841..738964,
FT                   739457..739611,740063..740186,741350..741474,
FT                   742382..742523,742701..742787,742886..743071,
FT                   744450..744552,745527..745640))
FT                   /gene="Ncl"
FT                   /locus_tag="mCG_8509"
FT                   /product="nucleolin, transcript variant mCT178293"
FT                   /note="gene_id=mCG8509.2 transcript_id=mCT178293.0 created
FT                   on 03-JAN-2003"
FT   mRNA            complement(join(736137..737027,737143..737366,
FT                   737698..737824,738529..738650,738841..738964,
FT                   739457..739611,740063..740186,741350..741474,
FT                   742382..742523,742701..742787,742886..743071,
FT                   743287..743782,744436..744552,745527..745596))
FT                   /gene="Ncl"
FT                   /locus_tag="mCG_8509"
FT                   /product="nucleolin, transcript variant mCT7362"
FT                   /note="gene_id=mCG8509.2 transcript_id=mCT7362.2 created on
FT                   03-JAN-2003"
FT   mRNA            complement(join(736137..737027,737143..737366,
FT                   737698..737824,738529..738650,738841..738964,
FT                   739457..739611,740063..740186,741350..741474,
FT                   742382..742523,742701..742787,742886..743071,
FT                   743287..743782,744436..744552,745316..745371))
FT                   /gene="Ncl"
FT                   /locus_tag="mCG_8509"
FT                   /product="nucleolin, transcript variant mCT178297"
FT                   /note="gene_id=mCG8509.2 transcript_id=mCT178297.0 created
FT                   on 03-JAN-2003"
FT   mRNA            complement(join(736865..737027,737143..737187,
FT                   743283..743782,744436..744552,745527..745688))
FT                   /gene="Ncl"
FT                   /locus_tag="mCG_8509"
FT                   /product="nucleolin, transcript variant mCT178292"
FT                   /note="gene_id=mCG8509.2 transcript_id=mCT178292.0 created
FT                   on 03-JAN-2003"
FT   CDS             complement(join(736951..737027,737143..737366,
FT                   737698..737824,738529..738650,738841..738964,
FT                   739457..739611,740063..740186,741350..741474,
FT                   742382..742523,742701..742787,742886..743071,
FT                   744450..744552,745527..745544))
FT                   /codon_start=1
FT                   /gene="Ncl"
FT                   /locus_tag="mCG_8509"
FT                   /product="nucleolin, isoform CRA_a"
FT                   /note="gene_id=mCG8509.2 transcript_id=mCT178293.0
FT                   protein_id=mCP101216.0 isoform=CRA_a"
FT                   /protein_id="EDL40220.1"
FT                   /translation="MVKLAKAGKTHGEAKKMAPPPKEVEEDSEDEEMSEDEDDSNSEEE
FT                   VMEITTAKGKKTPAKVVPMKAKSVAEEEDDEEEDEDDEDEDDEEEDDEDDDEEEEEEEP
FT                   VKAAPGKRKKEMTKQKEAPEAKKQKVEGSEPTTPFNLFIGNLNPNKSVNELKFAISELF
FT                   AKNDLAVVDVRTGTNRKFGYVDFESAEDLEKALELTGLKVFGNEIKLEKPKGRDSKKVR
FT                   AARTLLAKNLSFNITEDELKEVFEDAMEIRLVSQDGKSKGIAYIEFKSEADAEKNLEEK
FT                   QGAEIDGRSVSLYYTGEKGQRQERTGKTSTWSGESKTLVLSNLSYSATKETLEEVFEKA
FT                   TFIKVPQNPHGKPKGYAFIEFASFEDAKEALNSCNKMEIEGRTIRLELQGSNSRSQPSK
FT                   TLFVKGLSEDTTEETLKESFEGSVRARIVTDRETGSSKGFGFVDFNSEEDAKAAKEAME
FT                   DGEIDGNKVTLDWAKPKGEGGFGGRGGGRGGFGGRGGGRGGRGGFGGRGRGGFGGRGGF
FT                   RGGRGGGGDFKPQGKKTKFE"
FT   CDS             complement(join(736951..736968,737333..737366,
FT                   737698..737824,738529..738650,738841..738964,
FT                   739457..739611,740063..740186,741350..741474,
FT                   742382..742523,742701..742787,742886..743071,
FT                   743287..743782,744436..744552,745527..745544))
FT                   /codon_start=1
FT                   /gene="Ncl"
FT                   /locus_tag="mCG_8509"
FT                   /product="nucleolin, isoform CRA_d"
FT                   /note="gene_id=mCG8509.2 transcript_id=mCT178296.0
FT                   protein_id=mCP101217.0 isoform=CRA_d"
FT                   /protein_id="EDL40223.1"
FT                   /translation="MVKLAKAGKTHGEAKKMAPPPKEVEEDSEDEEMSEDEDDSSGEEE
FT                   VVIPQKKGKKATTTPAKKVVVSQTKKAAVPTPAKKAAVTPGKKAVATPAKKNITPAKVI
FT                   PTPGKKGAAQAKALVPTPGKKGAATPAKGAKNGKNAKKEDSDEDEDEEDEDDSDEDEDD
FT                   EEEDEFEPPIVKGVKPAKAAPAAPASEDEEDDEDEDDEEDDDEEEEDDSEEEVMEITTA
FT                   KGKKTPAKVVPMKAKSVAEEEDDEEEDEDDEDEDDEEEDDEDDDEEEEEEEPVKAAPGK
FT                   RKKEMTKQKEAPEAKKQKVEGSEPTTPFNLFIGNLNPNKSVNELKFAISELFAKNDLAV
FT                   VDVRTGTNRKFGYVDFESAEDLEKALELTGLKVFGNEIKLEKPKGRDSKKVRAARTLLA
FT                   KNLSFNITEDELKEVFEDAMEIRLVSQDGKSKGIAYIEFKSEADAEKNLEEKQGAEIDG
FT                   RSVSLYYTGEKGQRQERTGKTSTWSGESKTLVLSNLSYSATKETLEEVFEKATFIKVPQ
FT                   NPHGKPKGYAFIEFASFEDAKEALNSCNKMEIEGRTIRLELQGSNSRSQPSKTLFVKGL
FT                   SEDTTEETLKESFEGSVRARIVTDRETGSSKGFGFVDFNSEEDKTKFE"
FT   CDS             complement(join(736951..737027,737143..737366,
FT                   737698..737824,738529..738650,738841..738964,
FT                   739457..739611,740063..740186,741350..741474,
FT                   742382..742523,742701..742787,742886..743071,
FT                   743287..743782,744436..744552,745527..745544))
FT                   /codon_start=1
FT                   /gene="Ncl"
FT                   /locus_tag="mCG_8509"
FT                   /product="nucleolin, isoform CRA_f"
FT                   /note="gene_id=mCG8509.2 transcript_id=mCT7362.2
FT                   protein_id=mCP15659.1 isoform=CRA_f"
FT                   /protein_id="EDL40225.1"
FT                   /translation="MVKLAKAGKTHGEAKKMAPPPKEVEEDSEDEEMSEDEDDSSGEEE
FT                   VVIPQKKGKKATTTPAKKVVVSQTKKAAVPTPAKKAAVTPGKKAVATPAKKNITPAKVI
FT                   PTPGKKGAAQAKALVPTPGKKGAATPAKGAKNGKNAKKEDSDEDEDEEDEDDSDEDEDD
FT                   EEEDEFEPPIVKGVKPAKAAPAAPASEDEEDDEDEDDEEDDDEEEEDDSEEEVMEITTA
FT                   KGKKTPAKVVPMKAKSVAEEEDDEEEDEDDEDEDDEEEDDEDDDEEEEEEEPVKAAPGK
FT                   RKKEMTKQKEAPEAKKQKVEGSEPTTPFNLFIGNLNPNKSVNELKFAISELFAKNDLAV
FT                   VDVRTGTNRKFGYVDFESAEDLEKALELTGLKVFGNEIKLEKPKGRDSKKVRAARTLLA
FT                   KNLSFNITEDELKEVFEDAMEIRLVSQDGKSKGIAYIEFKSEADAEKNLEEKQGAEIDG
FT                   RSVSLYYTGEKGQRQERTGKTSTWSGESKTLVLSNLSYSATKETLEEVFEKATFIKVPQ
FT                   NPHGKPKGYAFIEFASFEDAKEALNSCNKMEIEGRTIRLELQGSNSRSQPSKTLFVKGL
FT                   SEDTTEETLKESFEGSVRARIVTDRETGSSKGFGFVDFNSEEDAKAAKEAMEDGEIDGN
FT                   KVTLDWAKPKGEGGFGGRGGGRGGFGGRGGGRGGRGGFGGRGRGGFGGRGGFRGGRGGG
FT                   GDFKPQGKKTKFE"
FT   CDS             complement(join(736951..737027,737143..737366,
FT                   737698..737824,738529..738650,738841..738964,
FT                   739457..739611,740063..740186,741350..741474,
FT                   742382..742523,742701..742787,742886..743071,
FT                   743287..743782,744436..744552,745316..745330))
FT                   /codon_start=1
FT                   /gene="Ncl"
FT                   /locus_tag="mCG_8509"
FT                   /product="nucleolin, isoform CRA_e"
FT                   /note="gene_id=mCG8509.2 transcript_id=mCT178297.0
FT                   protein_id=mCP101219.0 isoform=CRA_e"
FT                   /protein_id="EDL40224.1"
FT                   /translation="MRRAEAGKTHGEAKKMAPPPKEVEEDSEDEEMSEDEDDSSGEEEV
FT                   VIPQKKGKKATTTPAKKVVVSQTKKAAVPTPAKKAAVTPGKKAVATPAKKNITPAKVIP
FT                   TPGKKGAAQAKALVPTPGKKGAATPAKGAKNGKNAKKEDSDEDEDEEDEDDSDEDEDDE
FT                   EEDEFEPPIVKGVKPAKAAPAAPASEDEEDDEDEDDEEDDDEEEEDDSEEEVMEITTAK
FT                   GKKTPAKVVPMKAKSVAEEEDDEEEDEDDEDEDDEEEDDEDDDEEEEEEEPVKAAPGKR
FT                   KKEMTKQKEAPEAKKQKVEGSEPTTPFNLFIGNLNPNKSVNELKFAISELFAKNDLAVV
FT                   DVRTGTNRKFGYVDFESAEDLEKALELTGLKVFGNEIKLEKPKGRDSKKVRAARTLLAK
FT                   NLSFNITEDELKEVFEDAMEIRLVSQDGKSKGIAYIEFKSEADAEKNLEEKQGAEIDGR
FT                   SVSLYYTGEKGQRQERTGKTSTWSGESKTLVLSNLSYSATKETLEEVFEKATFIKVPQN
FT                   PHGKPKGYAFIEFASFEDAKEALNSCNKMEIEGRTIRLELQGSNSRSQPSKTLFVKGLS
FT                   EDTTEETLKESFEGSVRARIVTDRETGSSKGFGFVDFNSEEDAKAAKEAMEDGEIDGNK
FT                   VTLDWAKPKGEGGFGGRGGGRGGFGGRGGGRGGRGGFGGRGRGGFGGRGGFRGGRGGGG
FT                   DFKPQGKKTKFE"
FT   CDS             complement(join(736951..737018,737143..737366,
FT                   737698..737824,738529..738650,738841..738964,
FT                   739457..739611,740063..740186,741350..741474,
FT                   742382..742523,742701..742787,742886..743054))
FT                   /codon_start=1
FT                   /gene="Ncl"
FT                   /locus_tag="mCG_8509"
FT                   /product="nucleolin, isoform CRA_b"
FT                   /note="gene_id=mCG8509.2 transcript_id=mCT178294.0
FT                   protein_id=mCP101218.0 isoform=CRA_b"
FT                   /protein_id="EDL40221.1"
FT                   /translation="MEITTAKGKKTPAKVVPMKAKSVAEEEDDEEEDEDDEDEDDEEED
FT                   DEDDDEEEEEEEPVKAAPGKRKKEMTKQKEAPEAKKQKVEGSEPTTPFNLFIGNLNPNK
FT                   SVNELKFAISELFAKNDLAVVDVRTGTNRKFGYVDFESAEDLEKALELTGLKVFGNEIK
FT                   LEKPKGRDSKKVRAARTLLAKNLSFNITEDELKEVFEDAMEIRLVSQDGKSKGIAYIEF
FT                   KSEADAEKNLEEKQGAEIDGRSVSLYYTGEKGQRQERTGKTSTWSGESKTLVLSNLSYS
FT                   ATKETLEEVFEKATFIKVPQNPHGKPKGYAFIEFASFEDAKEALNSCNKMEIEGRTIRL
FT                   ELQGSNSRSQPSKTLFVKGLSEDTTEETLKESFEGSVRARIVTDRETGSSKGFGFVDFN
FT                   SEEDAKAAKEAMEDGEIDGNKVTLDWAKPKGEGGFGGRGGGRGGFGGRGGGRGGRGGFG
FT                   GRGRGGFGGFRGGRGGGGDFKPQGKKTKFE"
FT   CDS             complement(join(737024..737027,737143..737187,
FT                   743283..743782,744436..744552,745527..745544))
FT                   /codon_start=1
FT                   /gene="Ncl"
FT                   /locus_tag="mCG_8509"
FT                   /product="nucleolin, isoform CRA_g"
FT                   /note="gene_id=mCG8509.2 transcript_id=mCT178292.0
FT                   protein_id=mCP101215.0 isoform=CRA_g"
FT                   /protein_id="EDL40226.1"
FT                   /translation="MVKLAKAGKTHGEAKKMAPPPKEVEEDSEDEEMSEDEDDSSGEEE
FT                   VVIPQKKGKKATTTPAKKVVVSQTKKAAVPTPAKKAAVTPGKKAVATPAKKNITPAKVI
FT                   PTPGKKGAAQAKALVPTPGKKGAATPAKGAKNGKNAKKEDSDEDEDEEDEDDSDEDEDD
FT                   EEEDEFEPPIVKGVKPAKAAPAAPASEDEEDDEDEDDEEDDDEEEEDGEWKRWIWRKRP
FT                   GRLWR"
FT   mRNA            complement(join(737432..737824,738529..738650,
FT                   738841..738964,739457..739611,740063..740186,
FT                   741350..741474,742382..742523,742701..742787,
FT                   742886..743071,743287..743782,744436..744552,
FT                   745527..745681))
FT                   /gene="Ncl"
FT                   /locus_tag="mCG_8509"
FT                   /product="nucleolin, transcript variant mCT178295"
FT                   /note="gene_id=mCG8509.2 transcript_id=mCT178295.0 created
FT                   on 03-JAN-2003"
FT   CDS             complement(join(737694..737824,738529..738650,
FT                   738841..738964,739457..739611,740063..740186,
FT                   741350..741474,742382..742523,742701..742787,
FT                   742886..743071,743287..743782,744436..744552,
FT                   745527..745544))
FT                   /codon_start=1
FT                   /gene="Ncl"
FT                   /locus_tag="mCG_8509"
FT                   /product="nucleolin, isoform CRA_c"
FT                   /note="gene_id=mCG8509.2 transcript_id=mCT178295.0
FT                   protein_id=mCP101214.0 isoform=CRA_c"
FT                   /protein_id="EDL40222.1"
FT                   /translation="MVKLAKAGKTHGEAKKMAPPPKEVEEDSEDEEMSEDEDDSSGEEE
FT                   VVIPQKKGKKATTTPAKKVVVSQTKKAAVPTPAKKAAVTPGKKAVATPAKKNITPAKVI
FT                   PTPGKKGAAQAKALVPTPGKKGAATPAKGAKNGKNAKKEDSDEDEDEEDEDDSDEDEDD
FT                   EEEDEFEPPIVKGVKPAKAAPAAPASEDEEDDEDEDDEEDDDEEEEDDSEEEVMEITTA
FT                   KGKKTPAKVVPMKAKSVAEEEDDEEEDEDDEDEDDEEEDDEDDDEEEEEEEPVKAAPGK
FT                   RKKEMTKQKEAPEAKKQKVEGSEPTTPFNLFIGNLNPNKSVNELKFAISELFAKNDLAV
FT                   VDVRTGTNRKFGYVDFESAEDLEKALELTGLKVFGNEIKLEKPKGRDSKKVRAARTLLA
FT                   KNLSFNITEDELKEVFEDAMEIRLVSQDGKSKGIAYIEFKSEADAEKNLEEKQGAEIDG
FT                   RSVSLYYTGEKGQRQERTGKTSTWSGESKTLVLSNLSYSATKETLEEVFEKATFIKVPQ
FT                   NPHGKPKGYAFIEFASFEDAKEALNSCNKMEIEGRTIRLELQGSNSRSQPSKTLFVKGL
FT                   SEDTTEETLKESFEGSVRARIVTDRETGSSKG"
FT   gene            <744639..754303
FT                   /locus_tag="mCG_148366"
FT                   /note="gene_id=mCG148366.1"
FT   mRNA            join(<744639..746328,753472..754303)
FT                   /locus_tag="mCG_148366"
FT                   /product="mCG148366, transcript variant mCT188661"
FT                   /note="gene_id=mCG148366.1 transcript_id=mCT188661.1
FT                   created on 19-MAR-2004"
FT   mRNA            <744639..749097
FT                   /locus_tag="mCG_148366"
FT                   /product="mCG148366, transcript variant mCT188629"
FT                   /note="gene_id=mCG148366.1 transcript_id=mCT188629.1
FT                   created on 19-MAR-2004"
FT   CDS             <744639..745700
FT                   /codon_start=1
FT                   /locus_tag="mCG_148366"
FT                   /product="mCG148366, isoform CRA_a"
FT                   /note="gene_id=mCG148366.1 transcript_id=mCT188629.1
FT                   protein_id=mCP108650.1 isoform=CRA_a"
FT                   /protein_id="EDL40218.1"
FT                   /translation="RLLLGQAWHSPGSFFCEPRIIFFSFSQITEQTELYTKKQPQVIKS
FT                   PSRGHLFSGIFHKKKKKKNPVKGIPLSYLLGKGVSRNHLLKQHHVTQLLPTFSRFQPHH
FT                   VESPRRHLRGPPRVHPGHRQRQQIAGPPIHPHAAVPLSGVLQTLPHCPGSRDTCGAPQS
FT                   TWRAAHQSTCAGRRGPGTARRLRLALSSHAVPLSALSSSDLSSHRPLPPATSEPSISPS
FT                   RKPASALLIPLSQRASTARPPASRARLSPPAWRPRTRPGLRASPPPLRDGRAGARASLR
FT                   KQGPSRPRRRAKASYLCELHHGGGLRRRRVWRASSSEELSGSHTKATAVAGTDDSGART
FT                   TACQLQLASEAKD"
FT   CDS             <744639..745700
FT                   /codon_start=1
FT                   /locus_tag="mCG_148366"
FT                   /product="mCG148366, isoform CRA_a"
FT                   /note="gene_id=mCG148366.1 transcript_id=mCT188661.1
FT                   protein_id=mCP108682.1 isoform=CRA_a"
FT                   /protein_id="EDL40219.1"
FT                   /translation="RLLLGQAWHSPGSFFCEPRIIFFSFSQITEQTELYTKKQPQVIKS
FT                   PSRGHLFSGIFHKKKKKKNPVKGIPLSYLLGKGVSRNHLLKQHHVTQLLPTFSRFQPHH
FT                   VESPRRHLRGPPRVHPGHRQRQQIAGPPIHPHAAVPLSGVLQTLPHCPGSRDTCGAPQS
FT                   TWRAAHQSTCAGRRGPGTARRLRLALSSHAVPLSALSSSDLSSHRPLPPATSEPSISPS
FT                   RKPASALLIPLSQRASTARPPASRARLSPPAWRPRTRPGLRASPPPLRDGRAGARASLR
FT                   KQGPSRPRRRAKASYLCELHHGGGLRRRRVWRASSSEELSGSHTKATAVAGTDDSGART
FT                   TACQLQLASEAKD"
FT   assembly_gap    755692..755711
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    757189..757208
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    766314..766333
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    767717..767736
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<776187..>777994)
FT                   /gene="Nmur1"
FT                   /locus_tag="mCG_8508"
FT                   /note="gene_id=mCG8508.1"
FT   mRNA            complement(join(<776187..776575,777166..>777994))
FT                   /gene="Nmur1"
FT                   /locus_tag="mCG_8508"
FT                   /product="neuromedin U receptor 1"
FT                   /note="gene_id=mCG8508.1 transcript_id=mCT7361.0 created on
FT                   02-JAN-2003"
FT   CDS             complement(join(776187..776575,777166..>777994))
FT                   /codon_start=1
FT                   /gene="Nmur1"
FT                   /locus_tag="mCG_8508"
FT                   /product="neuromedin U receptor 1"
FT                   /note="gene_id=mCG8508.1 transcript_id=mCT7361.0
FT                   protein_id=mCP15657.0"
FT                   /db_xref="GOA:G5E871"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR005390"
FT                   /db_xref="InterPro:IPR005391"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:1341898"
FT                   /db_xref="UniProtKB/TrEMBL:G5E871"
FT                   /protein_id="EDL40217.1"
FT                   /translation="LVCNISEFKWPYQPEDLNLTDEALRLKYLGPQQMKQFVPICVTYL
FT                   LIFVVGTLGNGLTCTVILRNKTMRTPTNFYLFSLAVSDMLVLLVGLPLELYEMQQNYPF
FT                   QLGASACYFRILLLETVCLASVLNVTALSVERYVAVVRPLQAKSVMTRAHVRRMVGAIW
FT                   VLATLFSLPNTSLHGLSQLTVPCRGPVPDSAICSLVGPMDFYKLVVLTTALLFFCLPMV
FT                   TISVLYLLIGLRLRRERMLLQVEVKGRKTAATQETSHRRIQLQDRGRRQVTKMLFALVV
FT                   VFGICWAPFHADRIMWSLVYGHSTEGLHLAYQCVHIASGIFFYLGSAANPVLYSLMSTR
FT                   FRETFLQALGLGTQCCHRRQPYHGSHNHIRLTTGSTLCDVGHRNSRDEPLAVNEDPGCQ
FT                   QETDPS"
FT   assembly_gap    781818..781978
FT                   /estimated_length=161
FT                   /gap_type="unknown"
FT   assembly_gap    783753..784059
FT                   /estimated_length=307
FT                   /gap_type="unknown"
FT   assembly_gap    799505..799809
FT                   /estimated_length=305
FT                   /gap_type="unknown"
FT   assembly_gap    814697..814716
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            816856..818567
FT                   /locus_tag="mCG_53109"
FT                   /note="gene_id=mCG53109.2"
FT   mRNA            816856..818567
FT                   /locus_tag="mCG_53109"
FT                   /product="mCG53109"
FT                   /note="gene_id=mCG53109.2 transcript_id=mCT53292.2 created
FT                   on 14-FEB-2003"
FT   CDS             816898..818490
FT                   /codon_start=1
FT                   /locus_tag="mCG_53109"
FT                   /product="mCG53109"
FT                   /note="gene_id=mCG53109.2 transcript_id=mCT53292.2
FT                   protein_id=mCP36520.1"
FT                   /protein_id="EDL40216.1"
FT                   /translation="MTAEPLEDPEASSSSTHDLPEASSDNTADENSADLPGESEGPDSL
FT                   PDDVPPGDIDEVLAEHDVDQTSEAKAITTEQNEEQDFIRTDTFMRQDEDLLSKQISTIT
FT                   EKNVDQAYMQINTVFEQDKDQASIQTATLMGQDEDQAFLQIVTSVGQNKDQASIQTATL
FT                   MGQDEDQASLQIATSVGQNKDQPSMQMDTSIGQDVEPAISTDTATSAVKDESPDIPHQG
FT                   QDNPEETTSLLPQDPGILQVFVGFQNPVWDRLAENNRTSRSRTVSPSDSQTQEKTLGNP
FT                   NVPEGQPVLVPNADVLSNLPEHVQTSVGAADPPPSDTSGRDPEPTPTTNSAKQEAEGFK
FT                   ALNPGSKARSPGLTSEDSAADSGIPPDPPDPGSPGGSPPHSPDFYQVALGRNLLDPNLY
FT                   RPDVENDYMRSMTSLLGCGEGSISSLTDILVWSDTATRMGVAVGILASGCSSPADRLQD
FT                   EGPRLRTVASLLRSARSAFSSGVMSGTGSALHSVTHLLESVERRTMEGIRSAMRYLAHH
FT                   LTSRWARTGPSGN"
FT   assembly_gap    840169..840305
FT                   /estimated_length=137
FT                   /gap_type="unknown"
FT   assembly_gap    847118..847258
FT                   /estimated_length=141
FT                   /gap_type="unknown"
FT   assembly_gap    864062..864344
FT                   /estimated_length=283
FT                   /gap_type="unknown"
FT   gene            864346..864790
FT                   /locus_tag="mCG_142345"
FT                   /note="gene_id=mCG142345.0"
FT   mRNA            864346..864790
FT                   /locus_tag="mCG_142345"
FT                   /product="mCG142345"
FT                   /note="gene_id=mCG142345.0 transcript_id=mCT179976.0
FT                   created on 13-FEB-2003"
FT   CDS             864372..864719
FT                   /codon_start=1
FT                   /locus_tag="mCG_142345"
FT                   /product="mCG142345"
FT                   /note="gene_id=mCG142345.0 transcript_id=mCT179976.0
FT                   protein_id=mCP102898.0"
FT                   /protein_id="EDL40215.1"
FT                   /translation="MVATKKMKESLESINSRLQFVMKSGKYLREFKQTLKMVRQGKAKL
FT                   VILADSCPAWRKSEIEYYAMLAKTGVHHYRGNNMKLGTACGKYYRVCTLASIDPSDSDI
FT                   IRSMPEDTGEK"
FT   gene            <878281..879061
FT                   /locus_tag="mCG_142346"
FT                   /note="gene_id=mCG142346.0"
FT   mRNA            <878281..879061
FT                   /locus_tag="mCG_142346"
FT                   /product="mCG142346"
FT                   /note="gene_id=mCG142346.0 transcript_id=mCT179975.0
FT                   created on 13-FEB-2003"
FT   CDS             <878281..878694
FT                   /codon_start=1
FT                   /locus_tag="mCG_142346"
FT                   /product="mCG142346"
FT                   /note="gene_id=mCG142346.0 transcript_id=mCT179975.0
FT                   protein_id=mCP102897.0"
FT                   /protein_id="EDL40214.1"
FT                   /translation="HEPRPRSAFSLKPFVSPRASGNAGTRAELGACAKKDTPPTGRLRK
FT                   RGRVQVARLRRNRRAPPVLEDGRPALPRPCPPFRVPSPLLSRRSRRLCDGRLEAGTTKA
FT                   VVARAARAACLASGHGTQGRGKWATVHTLAWVC"
FT   assembly_gap    886228..886247
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    894498..894927
FT                   /estimated_length=430
FT                   /gap_type="unknown"
FT   assembly_gap    896997..897016
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    905287..905396
FT                   /estimated_length=110
FT                   /gap_type="unknown"
FT   assembly_gap    917414..917531
FT                   /estimated_length=118
FT                   /gap_type="unknown"
FT   gene            917849..921740
FT                   /gene="Ptma"
FT                   /locus_tag="mCG_133549"
FT                   /note="gene_id=mCG133549.1"
FT   mRNA            join(917849..918074,920215..920286,920498..920558,
FT                   920773..920846,921007..921639)
FT                   /gene="Ptma"
FT                   /locus_tag="mCG_133549"
FT                   /product="prothymosin alpha, transcript variant mCT179535"
FT                   /note="gene_id=mCG133549.1 transcript_id=mCT179535.0
FT                   created on 05-FEB-2003"
FT   mRNA            join(917849..918074,920215..920286,920773..920846,
FT                   921007..921596)
FT                   /gene="Ptma"
FT                   /locus_tag="mCG_133549"
FT                   /product="prothymosin alpha, transcript variant mCT179534"
FT                   /note="gene_id=mCG133549.1 transcript_id=mCT179534.0
FT                   created on 05-FEB-2003"
FT   mRNA            join(917855..918074,920215..920286,920498..920594,
FT                   920773..920810,921046..921466)
FT                   /gene="Ptma"
FT                   /locus_tag="mCG_133549"
FT                   /product="prothymosin alpha, transcript variant mCT179537"
FT                   /note="gene_id=mCG133549.1 transcript_id=mCT179537.0
FT                   created on 05-FEB-2003"
FT   mRNA            join(917860..918074,920215..920286,920498..920594,
FT                   920773..920846,921007..921740)
FT                   /gene="Ptma"
FT                   /locus_tag="mCG_133549"
FT                   /product="prothymosin alpha, transcript variant mCT134918"
FT                   /note="gene_id=mCG133549.1 transcript_id=mCT134918.0
FT                   created on 05-FEB-2003"
FT   mRNA            join(917867..918074,920215..920286,920498..920601,
FT                   920778..920846,921007..921153)
FT                   /gene="Ptma"
FT                   /locus_tag="mCG_133549"
FT                   /product="prothymosin alpha, transcript variant mCT179536"
FT                   /note="gene_id=mCG133549.1 transcript_id=mCT179536.0
FT                   created on 05-FEB-2003"
FT   CDS             join(918030..918074,920215..920286,920498..920594,
FT                   920773..920846,921007..921054)
FT                   /codon_start=1
FT                   /gene="Ptma"
FT                   /locus_tag="mCG_133549"
FT                   /product="prothymosin alpha, isoform CRA_a"
FT                   /note="gene_id=mCG133549.1 transcript_id=mCT134918.0
FT                   protein_id=mCP81858.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q0VGU2"
FT                   /db_xref="InterPro:IPR004931"
FT                   /db_xref="MGI:MGI:97803"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VGU2"
FT                   /protein_id="EDL40209.1"
FT                   /translation="MSDAAVDTSSEITTKDLKEKKEVVEEAENGRDAPANGNAQNEENG
FT                   EQEADNEVDEEEEEGGEEEEEEEEGDGEEEDGDEDEEAEAPTGKRVAEDDEDDDVDTKK
FT                   QKTEEDD"
FT   CDS             join(918030..918074,920215..920286,920498..920594,
FT                   920773..920810,921046..921054)
FT                   /codon_start=1
FT                   /gene="Ptma"
FT                   /locus_tag="mCG_133549"
FT                   /product="prothymosin alpha, isoform CRA_e"
FT                   /note="gene_id=mCG133549.1 transcript_id=mCT179537.0
FT                   protein_id=mCP102458.0 isoform=CRA_e"
FT                   /protein_id="EDL40213.1"
FT                   /translation="MSDAAVDTSSEITTKDLKEKKEVVEEAENGRDAPANGNAQNEENG
FT                   EQEADNEVDEEEEEGGEEEEEEEEGDGEEEDGDEDEEAEDD"
FT   CDS             join(918030..918074,920215..920286,920498..920558,
FT                   920773..920846,921007..921054)
FT                   /codon_start=1
FT                   /gene="Ptma"
FT                   /locus_tag="mCG_133549"
FT                   /product="prothymosin alpha, isoform CRA_b"
FT                   /note="gene_id=mCG133549.1 transcript_id=mCT179535.0
FT                   protein_id=mCP102456.0 isoform=CRA_b"
FT                   /protein_id="EDL40210.1"
FT                   /translation="MSDAAVDTSSEITTKDLKEKKEVVEEAENGRDAPANGNAQNEENG
FT                   EQEADNEVDEEEEEGEEEDGDEDEEAEAPTGKRVAEDDEDDDVDTKKQKTEEDD"
FT   CDS             join(918030..918074,920215..920286,920773..920832)
FT                   /codon_start=1
FT                   /gene="Ptma"
FT                   /locus_tag="mCG_133549"
FT                   /product="prothymosin alpha, isoform CRA_c"
FT                   /note="gene_id=mCG133549.1 transcript_id=mCT179534.0
FT                   protein_id=mCP102459.0 isoform=CRA_c"
FT                   /db_xref="GOA:A0A087WP98"
FT                   /db_xref="InterPro:IPR004931"
FT                   /db_xref="MGI:MGI:97803"
FT                   /db_xref="UniProtKB/TrEMBL:A0A087WP98"
FT                   /protein_id="EDL40211.1"
FT                   /translation="MSDAAVDTSSEITTKDLKEKKEVVEEAENGRDAPANGNAVRRRME
FT                   MKMRKLRLLRASG"
FT   CDS             join(918030..918074,920215..920286,920498..920601,920778)
FT                   /codon_start=1
FT                   /gene="Ptma"
FT                   /locus_tag="mCG_133549"
FT                   /product="prothymosin alpha, isoform CRA_d"
FT                   /note="gene_id=mCG133549.1 transcript_id=mCT179536.0
FT                   protein_id=mCP102457.0 isoform=CRA_d"
FT                   /protein_id="EDL40212.1"
FT                   /translation="MSDAAVDTSSEITTKDLKEKKEVVEEAENGRDAPANGNAQNEENG
FT                   EQEADNEVDEEEEEGGEEEEEEEEGDGE"
FT   assembly_gap    919150..919169
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    925513..925926
FT                   /estimated_length=414
FT                   /gap_type="unknown"
FT   assembly_gap    930926..931928
FT                   /estimated_length=1003
FT                   /gap_type="unknown"
FT   gene            complement(934163..>973452)
FT                   /gene="Pde6d"
FT                   /locus_tag="mCG_8505"
FT                   /note="gene_id=mCG8505.1"
FT   mRNA            complement(join(934163..934730,937803..937928,
FT                   938675..938763,973421..>973452))
FT                   /gene="Pde6d"
FT                   /locus_tag="mCG_8505"
FT                   /product="phosphodiesterase 6D, cGMP-specific, rod, delta,
FT                   transcript variant mCT178054"
FT                   /note="gene_id=mCG8505.1 transcript_id=mCT178054.0 created
FT                   on 02-JAN-2003"
FT   mRNA            complement(join(934163..934730,936849..936954,
FT                   937803..937928,938675..938767,973421..>973452))
FT                   /gene="Pde6d"
FT                   /locus_tag="mCG_8505"
FT                   /product="phosphodiesterase 6D, cGMP-specific, rod, delta,
FT                   transcript variant mCT7363"
FT                   /note="gene_id=mCG8505.1 transcript_id=mCT7363.1 created on
FT                   02-JAN-2003"
FT   CDS             complement(join(934649..934730,936849..936954,
FT                   937803..937928,938675..>938762))
FT                   /codon_start=1
FT                   /gene="Pde6d"
FT                   /locus_tag="mCG_8505"
FT                   /product="phosphodiesterase 6D, cGMP-specific, rod, delta,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG8505.1 transcript_id=mCT7363.1
FT                   protein_id=mCP15650.2 isoform=CRA_c"
FT                   /protein_id="EDL40208.1"
FT                   /translation="NWMNLRDAETGKILWQGTEDLSVPGVEHEARVPKKILKCKAVSRE
FT                   LNFSSAEQMEKFRLEQKVYFKGQCLEEWFFEFGFVIPNSTNTWQSLIEAAPESQMMPAS
FT                   VLTGNVIIETKFFDDDLLVSTSKVRLFYV"
FT   CDS             complement(join(934714..934730,937803..937928,
FT                   938675..>938762))
FT                   /codon_start=1
FT                   /gene="Pde6d"
FT                   /locus_tag="mCG_8505"
FT                   /product="phosphodiesterase 6D, cGMP-specific, rod, delta,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG8505.1 transcript_id=mCT178054.0
FT                   protein_id=mCP100976.0 isoform=CRA_a"
FT                   /protein_id="EDL40206.1"
FT                   /translation="NWMNLRDAETGKILWQGTEDLSVPGVEHEARVPKKILKCKAVSRE
FT                   LNFSSAEQMEKFRLEQKVYFKGQCLEGAMSS"
FT   mRNA            complement(join(936580..936954,937803..937928,
FT                   938675..938763,973421..>973452))
FT                   /gene="Pde6d"
FT                   /locus_tag="mCG_8505"
FT                   /product="phosphodiesterase 6D, cGMP-specific, rod, delta,
FT                   transcript variant mCT178055"
FT                   /note="gene_id=mCG8505.1 transcript_id=mCT178055.0 created
FT                   on 02-JAN-2003"
FT   CDS             complement(join(936845..936954,937803..937928,
FT                   938675..>938762))
FT                   /codon_start=1
FT                   /gene="Pde6d"
FT                   /locus_tag="mCG_8505"
FT                   /product="phosphodiesterase 6D, cGMP-specific, rod, delta,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG8505.1 transcript_id=mCT178055.0
FT                   protein_id=mCP100977.0 isoform=CRA_b"
FT                   /protein_id="EDL40207.1"
FT                   /translation="NWMNLRDAETGKILWQGTEDLSVPGVEHEARVPKKILKCKAVSRE
FT                   LNFSSAEQMEKFRLEQKVYFKGQCLEEWFFEFGFVIPNSTNTWQSLIEAAPESQMMPAS
FT                   VLT"
FT   assembly_gap    963596..963617
FT                   /estimated_length=22
FT                   /gap_type="unknown"
FT   assembly_gap    968579..968744
FT                   /estimated_length=166
FT                   /gap_type="unknown"
FT   assembly_gap    973131..973420
FT                   /estimated_length=290
FT                   /gap_type="unknown"
FT   gene            973928..997513
FT                   /gene="Cops7b"
FT                   /locus_tag="mCG_133548"
FT                   /note="gene_id=mCG133548.1"
FT   mRNA            join(973928..974089,978059..978278,980208..980385,
FT                   983335..983410,987795..987883,990045..990247,
FT                   992125..992230,996100..997304)
FT                   /gene="Cops7b"
FT                   /locus_tag="mCG_133548"
FT                   /product="COP9 (constitutive photomorphogenic) homolog,
FT                   subunit 7b (Arabidopsis thaliana), transcript variant
FT                   mCT134917"
FT                   /note="gene_id=mCG133548.1 transcript_id=mCT134917.1
FT                   created on 02-JAN-2003"
FT   mRNA            join(973935..974089,980208..980385,983335..983410,
FT                   987795..987883,990045..990247,992125..992230,
FT                   996100..997513)
FT                   /gene="Cops7b"
FT                   /locus_tag="mCG_133548"
FT                   /product="COP9 (constitutive photomorphogenic) homolog,
FT                   subunit 7b (Arabidopsis thaliana), transcript variant
FT                   mCT177920"
FT                   /note="gene_id=mCG133548.1 transcript_id=mCT177920.0
FT                   created on 02-JAN-2003"
FT   mRNA            join(973948..974089,978059..978278,980208..980290,
FT                   996532..997304)
FT                   /gene="Cops7b"
FT                   /locus_tag="mCG_133548"
FT                   /product="COP9 (constitutive photomorphogenic) homolog,
FT                   subunit 7b (Arabidopsis thaliana), transcript variant
FT                   mCT177922"
FT                   /note="gene_id=mCG133548.1 transcript_id=mCT177922.0
FT                   created on 02-JAN-2003"
FT   assembly_gap    975324..975369
FT                   /estimated_length=46
FT                   /gap_type="unknown"
FT   assembly_gap    976571..976590
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            join(978173..978278,978390..978510,980208..980385,
FT                   983335..983410,987795..987883,990045..990247,
FT                   992125..992230,996100..997149)
FT                   /gene="Cops7b"
FT                   /locus_tag="mCG_133548"
FT                   /product="COP9 (constitutive photomorphogenic) homolog,
FT                   subunit 7b (Arabidopsis thaliana), transcript variant
FT                   mCT177921"
FT                   /note="gene_id=mCG133548.1 transcript_id=mCT177921.0
FT                   created on 02-JAN-2003"
FT   mRNA            join(978192..978278,980208..980385,983335..983410,
FT                   990045..990247,992125..992230,996100..997304)
FT                   /gene="Cops7b"
FT                   /locus_tag="mCG_133548"
FT                   /product="COP9 (constitutive photomorphogenic) homolog,
FT                   subunit 7b (Arabidopsis thaliana), transcript variant
FT                   mCT177919"
FT                   /note="gene_id=mCG133548.1 transcript_id=mCT177919.0
FT                   created on 02-JAN-2003"
FT   CDS             join(980224..980290,996532..996713)
FT                   /codon_start=1
FT                   /gene="Cops7b"
FT                   /locus_tag="mCG_133548"
FT                   /product="COP9 (constitutive photomorphogenic) homolog,
FT                   subunit 7b (Arabidopsis thaliana), isoform CRA_c"
FT                   /note="gene_id=mCG133548.1 transcript_id=mCT177922.0
FT                   protein_id=mCP100844.0 isoform=CRA_c"
FT                   /protein_id="EDL40204.1"
FT                   /translation="MAGEQKPSSNLLEQFILLAKGTRATSLPVVLCSLSFCQAGPKLEA
FT                   VYPAPRDDCGGGSSLSEEGALLLQPHVPQYPQWCKCL"
FT   CDS             join(980224..980385,983335..983410,987795..987883,
FT                   990045..990247,992125..992230,996100..996258)
FT                   /codon_start=1
FT                   /gene="Cops7b"
FT                   /locus_tag="mCG_133548"
FT                   /product="COP9 (constitutive photomorphogenic) homolog,
FT                   subunit 7b (Arabidopsis thaliana), isoform CRA_b"
FT                   /note="gene_id=mCG133548.1 transcript_id=mCT177920.0
FT                   protein_id=mCP100843.0 isoform=CRA_b"
FT                   /protein_id="EDL40202.1"
FT                   /translation="MAGEQKPSSNLLEQFILLAKGTSGSALTTLISQVLEAPGVYVFGE
FT                   LLELANVQELAEGANAAYLQLLNLFAYGTYPDYIANKESLPELSVAQQNKLKHLTIVSL
FT                   ASRMKCIPYSVLLKDLEMRNLRELEDLIIEAVYTDIIQGKLDQRNQLLEVDFCIGRDIR
FT                   KKDINNIVKTLHEWCDGCEAVLLGIEQQVLRANQYKENHHRTQQQVEAEVSNIKKTLKA
FT                   TASSSAQEMEQQLAERECPPHTEQRQPTKKMSKVKGLVSSRH"
FT   CDS             join(980224..980385,983335..983410,987795..987883,
FT                   990045..990247,992125..992230,996100..996258)
FT                   /codon_start=1
FT                   /gene="Cops7b"
FT                   /locus_tag="mCG_133548"
FT                   /product="COP9 (constitutive photomorphogenic) homolog,
FT                   subunit 7b (Arabidopsis thaliana), isoform CRA_b"
FT                   /note="gene_id=mCG133548.1 transcript_id=mCT177921.0
FT                   protein_id=mCP100841.0 isoform=CRA_b"
FT                   /protein_id="EDL40203.1"
FT                   /translation="MAGEQKPSSNLLEQFILLAKGTSGSALTTLISQVLEAPGVYVFGE
FT                   LLELANVQELAEGANAAYLQLLNLFAYGTYPDYIANKESLPELSVAQQNKLKHLTIVSL
FT                   ASRMKCIPYSVLLKDLEMRNLRELEDLIIEAVYTDIIQGKLDQRNQLLEVDFCIGRDIR
FT                   KKDINNIVKTLHEWCDGCEAVLLGIEQQVLRANQYKENHHRTQQQVEAEVSNIKKTLKA
FT                   TASSSAQEMEQQLAERECPPHTEQRQPTKKMSKVKGLVSSRH"
FT   CDS             join(980224..980385,983335..983410,987795..987883,
FT                   990045..990247,992125..992230,996100..996258)
FT                   /codon_start=1
FT                   /gene="Cops7b"
FT                   /locus_tag="mCG_133548"
FT                   /product="COP9 (constitutive photomorphogenic) homolog,
FT                   subunit 7b (Arabidopsis thaliana), isoform CRA_b"
FT                   /note="gene_id=mCG133548.1 transcript_id=mCT134917.1
FT                   protein_id=mCP81831.1 isoform=CRA_b"
FT                   /protein_id="EDL40205.1"
FT                   /translation="MAGEQKPSSNLLEQFILLAKGTSGSALTTLISQVLEAPGVYVFGE
FT                   LLELANVQELAEGANAAYLQLLNLFAYGTYPDYIANKESLPELSVAQQNKLKHLTIVSL
FT                   ASRMKCIPYSVLLKDLEMRNLRELEDLIIEAVYTDIIQGKLDQRNQLLEVDFCIGRDIR
FT                   KKDINNIVKTLHEWCDGCEAVLLGIEQQVLRANQYKENHHRTQQQVEAEVSNIKKTLKA
FT                   TASSSAQEMEQQLAERECPPHTEQRQPTKKMSKVKGLVSSRH"
FT   CDS             join(990081..990247,992125..992230,996100..996258)
FT                   /codon_start=1
FT                   /gene="Cops7b"
FT                   /locus_tag="mCG_133548"
FT                   /product="COP9 (constitutive photomorphogenic) homolog,
FT                   subunit 7b (Arabidopsis thaliana), isoform CRA_a"
FT                   /note="gene_id=mCG133548.1 transcript_id=mCT177919.0
FT                   protein_id=mCP100842.0 isoform=CRA_a"
FT                   /protein_id="EDL40201.1"
FT                   /translation="MRNLRELEDLIIEAVYTDIIQGKLDQRNQLLEVDFCIGRDIRKKD
FT                   INNIVKTLHEWCDGCEAVLLGIEQQVLRANQYKENHHRTQQQVEAEVSNIKKTLKATAS
FT                   SSAQEMEQQLAERECPPHTEQRQPTKKMSKVKGLVSSRH"
FT   assembly_gap    1018787..1018875
FT                   /estimated_length=89
FT                   /gap_type="unknown"
FT   assembly_gap    1024063..1024152
FT                   /estimated_length=90
FT                   /gap_type="unknown"
FT   assembly_gap    1026352..1027065
FT                   /estimated_length=714
FT                   /gap_type="unknown"
FT   assembly_gap    1039088..1039107
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1042224..1043623
FT                   /estimated_length=1400
FT                   /gap_type="unknown"
FT   assembly_gap    1045074..1045093
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1046636..1046655
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1057490..1061761)
FT                   /gene="Nppc"
FT                   /locus_tag="mCG_8516"
FT                   /note="gene_id=mCG8516.1"
FT   mRNA            complement(join(1057490..1057986,1060832..1061142,
FT                   1061537..1061761))
FT                   /gene="Nppc"
FT                   /locus_tag="mCG_8516"
FT                   /product="natriuretic peptide precursor type C"
FT                   /note="gene_id=mCG8516.1 transcript_id=mCT7350.1 created on
FT                   02-JAN-2003"
FT   CDS             complement(join(1060852..1061142,1061537..1061626))
FT                   /codon_start=1
FT                   /gene="Nppc"
FT                   /locus_tag="mCG_8516"
FT                   /product="natriuretic peptide precursor type C"
FT                   /note="gene_id=mCG8516.1 transcript_id=mCT7350.1
FT                   protein_id=mCP15640.1"
FT                   /db_xref="GOA:Q544K5"
FT                   /db_xref="InterPro:IPR000663"
FT                   /db_xref="InterPro:IPR002406"
FT                   /db_xref="InterPro:IPR030480"
FT                   /db_xref="MGI:MGI:97369"
FT                   /db_xref="UniProtKB/TrEMBL:Q544K5"
FT                   /protein_id="EDL40200.1"
FT                   /translation="MHLSQLIACALLLALLSLRPSEAKPGTPPKVPRTPPGEELADSQA
FT                   AGGNQKKGDKTPGSGGANLKGDRSRLLRDLRVDTKSRAAWARLLHEHPNARKYKGGNKK
FT                   GLSKGCFGLKLDRIGSMSGLGC"
FT   assembly_gap    1081931..1081950
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1086932..1086951
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            1094913..1443717
FT                   /gene="4930429A22Rik"
FT                   /locus_tag="mCG_8515"
FT                   /note="gene_id=mCG8515.2"
FT   mRNA            join(1094913..1094965,1135814..1135961,1136474..1136631,
FT                   1145357..1145410,1151417..1151518,1183684..1183725,
FT                   1215098..1215326,1248198..1248298,1250965..1251212,
FT                   1272401..1272574,1324307..1324386,1353302..1353414,
FT                   1366983..1367090,1383697..1383930,1414663..1414742,
FT                   1437639..1437822,1438452..1438538,1440659..1440806,
FT                   1441070..1441200,1441310..1441414,1442455..1442556,
FT                   1443245..1443717)
FT                   /gene="4930429A22Rik"
FT                   /locus_tag="mCG_8515"
FT                   /product="RIKEN cDNA 4930429A22, transcript variant
FT                   mCT179621"
FT                   /note="gene_id=mCG8515.2 transcript_id=mCT179621.0 created
FT                   on 04-FEB-2003"
FT   mRNA            join(1094921..1094965,1135814..1135961,1136474..1136631,
FT                   1145357..1145410,1151417..1151518,1206389..1206466,
FT                   1215098..1215326,1248198..1248298,1250965..1251212,
FT                   1272401..1272574,1324307..1324386,1353302..1353414,
FT                   1366983..1367090,1383697..1383930,1414663..1414742,
FT                   1437639..1437822,1438452..1438538,1440659..1440806,
FT                   1441070..1441200,1441310..1441414,1442455..1442817)
FT                   /gene="4930429A22Rik"
FT                   /locus_tag="mCG_8515"
FT                   /product="RIKEN cDNA 4930429A22, transcript variant
FT                   mCT179620"
FT                   /note="gene_id=mCG8515.2 transcript_id=mCT179620.0 created
FT                   on 04-FEB-2003"
FT   mRNA            join(1094921..1094965,1135814..1135961,1136474..1136631,
FT                   1145357..1145410,1151417..1151518,1183684..1183725,
FT                   1206389..1206466,1215098..1215326,1248198..1248298,
FT                   1250965..1251212,1272401..1274034)
FT                   /gene="4930429A22Rik"
FT                   /locus_tag="mCG_8515"
FT                   /product="RIKEN cDNA 4930429A22, transcript variant
FT                   mCT179622"
FT                   /note="gene_id=mCG8515.2 transcript_id=mCT179622.0 created
FT                   on 04-FEB-2003"
FT   mRNA            join(1094937..1094965,1135814..1135961,1136474..1136631,
FT                   1145357..1145410,1151417..1151518,1215098..1215326,
FT                   1248198..1248298,1250965..1251212,1272401..1272574,
FT                   1324307..1324386,1353302..1353414,1366983..1367090,
FT                   1383697..1383930,1414663..1414742,1437639..1437822,
FT                   1438452..1438538,1440659..1440806,1441070..1441200,
FT                   1441310..1441414,1442455..1442556,1443245..1443712)
FT                   /gene="4930429A22Rik"
FT                   /locus_tag="mCG_8515"
FT                   /product="RIKEN cDNA 4930429A22, transcript variant
FT                   mCT7349"
FT                   /note="gene_id=mCG8515.2 transcript_id=mCT7349.2 created on
FT                   04-FEB-2003"
FT   assembly_gap    1122980..1122999
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1130065..1130347
FT                   /estimated_length=283
FT                   /gap_type="unknown"
FT   assembly_gap    1132819..1133168
FT                   /estimated_length=350
FT                   /gap_type="unknown"
FT   CDS             join(1135910..1135961,1136474..1136631,1145357..1145410,
FT                   1151417..1151518,1183684..1183725,1215098..1215326,
FT                   1248198..1248298,1250965..1251212,1272401..1272574,
FT                   1324307..1324386,1353302..1353414,1366983..1367090,
FT                   1383697..1383930,1414663..1414742,1437639..1437822,
FT                   1438452..1438538,1440659..1440806,1441070..1441200,
FT                   1441310..1441414,1442455..1442556,1443245..1443367)
FT                   /codon_start=1
FT                   /gene="4930429A22Rik"
FT                   /locus_tag="mCG_8515"
FT                   /product="RIKEN cDNA 4930429A22, isoform CRA_d"
FT                   /note="gene_id=mCG8515.2 transcript_id=mCT179621.0
FT                   protein_id=mCP102543.0 isoform=CRA_d"
FT                   /protein_id="EDL40198.1"
FT                   /translation="MNHPDYKLNLRSPGTPRGVSSVVGPSAVGASPGDKKSKNKSMRGK
FT                   KKSIFETYMSKEDVSEGLKRGTLIQGVLRINPKKFHEAFIPSPDGDRDIFIDGVVARNR
FT                   ALNGDLVVVKLLPEDQWKPRITLSLPGVLGLQAVKPESNDKEIEATYEADIPEEGCGHH
FT                   PLQQSRKGWSGPDVIIEAQFDDSDSEDRHGNTSGLVDGVKKLSISTPDRGKEDSSTPVM
FT                   KDENTPIPQDTRGLSEKSLQKSAKVVYILEKKHSRAATGILKLLADKNSDLFKKYALFS
FT                   PSDHRVPRIYVPLKDCPQDFMTRPKDFANTLFICRIIDWKEDCNFALGQLAKSLGQAGE
FT                   IEPETEGILTEYGVDFSDFSSEVLECLPQSLPWTIPPDEVGKRRDLRKDCIFTIDPSTA
FT                   RDLDDALACRRLTDGTFEVGVHIADVSYFVPEGSSLDKVAAERATSVYLVQKVVPMLPR
FT                   LLCEELCSLNPMTDKLTFSVIWKLTPEGKILEEWFGRTIIRSCTKLSYDHAQSMIENPT
FT                   EKIPEEELPPISPEHSVEEVHQAVLNLHSIAKQLRRQRFVDGALRLDQLKLAFTLDHET
FT                   GLPQGCHIYEYRDSNKLVEEFMLLANMAVAHKIFRTFPEQALLRRHPPPQTKMLSDLVE
FT                   FCDQMGLPMDVSSAGALNKSLTKTFGDDKYSLARKEVLTNMYSRPMQMALYFCSGMLQD
FT                   QEQFRHYALNVPLYTHFTSPIRRFADVIVHRLLAAALGYSEQPDVEPDTLQKQADHCND
FT                   RRMASKRVQELSIGLFFAVLVKESGPLESEAMVMGVLNQAFDVLVLRFGVQKRIYCNAL
FT                   ALRSYSFQKVGKKPELTLVWEPDDLEEEPTQQVITIFSLVDVVLQAEATALKYSAILKR
FT                   PGLEKASDEEPED"
FT   CDS             join(1135910..1135961,1136474..1136631,1145357..1145410,
FT                   1151417..1151518,1215098..1215326,1248198..1248298,
FT                   1250965..1251212,1272401..1272574,1324307..1324386,
FT                   1353302..1353414,1366983..1367090,1383697..1383930,
FT                   1414663..1414742,1437639..1437822,1438452..1438538,
FT                   1440659..1440806,1441070..1441200,1441310..1441414,
FT                   1442455..1442556,1443245..1443367)
FT                   /codon_start=1
FT                   /gene="4930429A22Rik"
FT                   /locus_tag="mCG_8515"
FT                   /product="RIKEN cDNA 4930429A22, isoform CRA_c"
FT                   /note="gene_id=mCG8515.2 transcript_id=mCT7349.2
FT                   protein_id=mCP15655.1 isoform=CRA_c"
FT                   /protein_id="EDL40197.1"
FT                   /translation="MNHPDYKLNLRSPGTPRGVSSVVGPSAVGASPGDKKSKNKSMRGK
FT                   KKSIFETYMSKEDVSEGLKRGTLIQGVLRINPKKFHEAFIPSPDGDRDIFIDGVVARNR
FT                   ALNGDLVVVKLLPEDQWKAVKPESNDKEIEATYEADIPEEGCGHHPLQQSRKGWSGPDV
FT                   IIEAQFDDSDSEDRHGNTSGLVDGVKKLSISTPDRGKEDSSTPVMKDENTPIPQDTRGL
FT                   SEKSLQKSAKVVYILEKKHSRAATGILKLLADKNSDLFKKYALFSPSDHRVPRIYVPLK
FT                   DCPQDFMTRPKDFANTLFICRIIDWKEDCNFALGQLAKSLGQAGEIEPETEGILTEYGV
FT                   DFSDFSSEVLECLPQSLPWTIPPDEVGKRRDLRKDCIFTIDPSTARDLDDALACRRLTD
FT                   GTFEVGVHIADVSYFVPEGSSLDKVAAERATSVYLVQKVVPMLPRLLCEELCSLNPMTD
FT                   KLTFSVIWKLTPEGKILEEWFGRTIIRSCTKLSYDHAQSMIENPTEKIPEEELPPISPE
FT                   HSVEEVHQAVLNLHSIAKQLRRQRFVDGALRLDQLKLAFTLDHETGLPQGCHIYEYRDS
FT                   NKLVEEFMLLANMAVAHKIFRTFPEQALLRRHPPPQTKMLSDLVEFCDQMGLPMDVSSA
FT                   GALNKSLTKTFGDDKYSLARKEVLTNMYSRPMQMALYFCSGMLQDQEQFRHYALNVPLY
FT                   THFTSPIRRFADVIVHRLLAAALGYSEQPDVEPDTLQKQADHCNDRRMASKRVQELSIG
FT                   LFFAVLVKESGPLESEAMVMGVLNQAFDVLVLRFGVQKRIYCNALALRSYSFQKVGKKP
FT                   ELTLVWEPDDLEEEPTQQVITIFSLVDVVLQAEATALKYSAILKRPGLEKASDEEPED"
FT   assembly_gap    1165976..1168571
FT                   /estimated_length=2596
FT                   /gap_type="unknown"
FT   assembly_gap    1179700..1179719
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1189391..1189653
FT                   /estimated_length=263
FT                   /gap_type="unknown"
FT   assembly_gap    1199405..1199509
FT                   /estimated_length=105
FT                   /gap_type="unknown"
FT   CDS             join(1248224..1248298,1250965..1251212,1272401..1272574,
FT                   1324307..1324386,1353302..1353414,1366983..1367090,
FT                   1383697..1383930,1414663..1414742,1437639..1437822,
FT                   1438452..1438538,1440659..1440806,1441070..1441200,
FT                   1441310..1441414,1442455..1442580)
FT                   /codon_start=1
FT                   /gene="4930429A22Rik"
FT                   /locus_tag="mCG_8515"
FT                   /product="RIKEN cDNA 4930429A22, isoform CRA_a"
FT                   /note="gene_id=mCG8515.2 transcript_id=mCT179620.0
FT                   protein_id=mCP102544.0 isoform=CRA_a"
FT                   /protein_id="EDL40195.1"
FT                   /translation="MKDENTPIPQDTRGLSEKSLQKSAKVVYILEKKHSRAATGILKLL
FT                   ADKNSDLFKKYALFSPSDHRVPRIYVPLKDCPQDFMTRPKDFANTLFICRIIDWKEDCN
FT                   FALGQLAKSLGQAGEIEPETEGILTEYGVDFSDFSSEVLECLPQSLPWTIPPDEVGKRR
FT                   DLRKDCIFTIDPSTARDLDDALACRRLTDGTFEVGVHIADVSYFVPEGSSLDKVAAERA
FT                   TSVYLVQKVVPMLPRLLCEELCSLNPMTDKLTFSVIWKLTPEGKILEEWFGRTIIRSCT
FT                   KLSYDHAQSMIENPTEKIPEEELPPISPEHSVEEVHQAVLNLHSIAKQLRRQRFVDGAL
FT                   RLDQLKLAFTLDHETGLPQGCHIYEYRDSNKLVEEFMLLANMAVAHKIFRTFPEQALLR
FT                   RHPPPQTKMLSDLVEFCDQMGLPMDVSSAGALNKSLTKTFGDDKYSLARKEVLTNMYSR
FT                   PMQMALYFCSGMLQDQEQFRHYALNVPLYTHFTSPIRRFADVIVHRLLAAALGYSEQPD
FT                   VEPDTLQKQADHCNDRRMASKRVQELSIGLFFAVLVKESGPLESEAMVMGVLNQAFDVL
FT                   VLRFGVQKRIYCNALALRSYSFQKVGKKPELTLVWEPDDLEEEPTQQVSPLLCP"
FT   CDS             join(1248224..1248298,1250965..1251212,1272401..1272578)
FT                   /codon_start=1
FT                   /gene="4930429A22Rik"
FT                   /locus_tag="mCG_8515"
FT                   /product="RIKEN cDNA 4930429A22, isoform CRA_b"
FT                   /note="gene_id=mCG8515.2 transcript_id=mCT179622.0
FT                   protein_id=mCP102542.0 isoform=CRA_b"
FT                   /protein_id="EDL40196.1"
FT                   /translation="MKDENTPIPQDTRGLSEKSLQKSAKVVYILEKKHSRAATGILKLL
FT                   ADKNSDLFKKYALFSPSDHRVPRIYVPLKDCPQDFMTRPKDFANTLFICRIIDWKEDCN
FT                   FALGQLAKSLGQAGEIEPETEGILTEYGVDFSDFSSEVLECLPQSLPWTIPPDEVGKRR
FT                   DLR"
FT   assembly_gap    1260890..1261392
FT                   /estimated_length=503
FT                   /gap_type="unknown"
FT   assembly_gap    1270703..1270789
FT                   /estimated_length=87
FT                   /gap_type="unknown"
FT   assembly_gap    1272006..1272091
FT                   /estimated_length=86
FT                   /gap_type="unknown"
FT   assembly_gap    1276556..1276700
FT                   /estimated_length=145
FT                   /gap_type="unknown"
FT   assembly_gap    1297123..1297202
FT                   /estimated_length=80
FT                   /gap_type="unknown"
FT   gene            complement(1302390..1303302)
FT                   /locus_tag="mCG_8513"
FT                   /note="gene_id=mCG8513.1"
FT   mRNA            complement(1302390..1303302)
FT                   /locus_tag="mCG_8513"
FT                   /product="mCG8513"
FT                   /note="gene_id=mCG8513.1 transcript_id=mCT7357.1 created on
FT                   04-FEB-2003"
FT   CDS             complement(1302421..1303107)
FT                   /codon_start=1
FT                   /locus_tag="mCG_8513"
FT                   /product="mCG8513"
FT                   /note="gene_id=mCG8513.1 transcript_id=mCT7357.1
FT                   protein_id=mCP15639.1"
FT                   /protein_id="EDL40199.1"
FT                   /translation="MYSRKALYKRKYSAAKTKVEKKKKKEKVLATVTKTVGGDKNGGTR
FT                   VVKLQKMPRYYPTEDVPRKLLSHGKKPFSQHVRRLRSSITPGTVLIILTGRHRGKRVVF
FT                   LKQLDSGLLLVTGPLVINRVPLRRTHQKFVIATSTKVDISDVKIPKHLTDAYFKKKQLR
FT                   KPRHQEGEIFDTEKEKYEITEQRKADQKAVDLQILPKIKAVPQLQGYLRSQFSLTNGMY
FT                   PHKLVF"
FT   assembly_gap    1314162..1314424
FT                   /estimated_length=263
FT                   /gap_type="unknown"
FT   assembly_gap    1471166..1471733
FT                   /estimated_length=568
FT                   /gap_type="unknown"
FT   gene            1473662..1490025
FT                   /locus_tag="mCG_148379"
FT                   /note="gene_id=mCG148379.0"
FT   mRNA            join(1473662..1473785,1489263..1490025)
FT                   /locus_tag="mCG_148379"
FT                   /product="mCG148379"
FT                   /note="gene_id=mCG148379.0 transcript_id=mCT188642.0
FT                   created on 13-JAN-2004"
FT   CDS             join(1473688..1473785,1489263..1489338)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148379"
FT                   /product="mCG148379"
FT                   /note="gene_id=mCG148379.0 transcript_id=mCT188642.0
FT                   protein_id=mCP108663.0"
FT                   /protein_id="EDL40192.1"
FT                   /translation="MKDPRGETLPQTLKSRDSRVPKKTLRPYIKCRRCCIQQTSLDQVP
FT                   SPQTRQGFGRLV"
FT   assembly_gap    1479299..1479423
FT                   /estimated_length=125
FT                   /gap_type="unknown"
FT   gene            complement(1480301..1483530)
FT                   /gene="Akp5"
FT                   /locus_tag="mCG_8511"
FT                   /note="gene_id=mCG8511.1"
FT   mRNA            complement(join(1480301..1480947,1481036..1481152,
FT                   1481265..1481456,1481540..1481674,1481781..1481853,
FT                   1481963..1482097,1482313..1482485,1482557..1482731,
FT                   1482880..1482995,1483102..1483218,1483307..1483518))
FT                   /gene="Akp5"
FT                   /locus_tag="mCG_8511"
FT                   /product="alkaline phosphatase 5, transcript variant
FT                   mCT7355"
FT                   /note="gene_id=mCG8511.1 transcript_id=mCT7355.1 created on
FT                   02-JAN-2003"
FT   CDS             complement(join(1480655..1480947,1481036..1481152,
FT                   1481265..1481456,1481540..1481674,1481781..1481853,
FT                   1481963..1482097,1482313..1482485,1482557..1482731,
FT                   1482880..1482995,1483102..1483218,1483307..1483370))
FT                   /codon_start=1
FT                   /gene="Akp5"
FT                   /locus_tag="mCG_8511"
FT                   /product="alkaline phosphatase 5, isoform CRA_b"
FT                   /note="gene_id=mCG8511.1 transcript_id=mCT7355.1
FT                   protein_id=mCP15675.0 isoform=CRA_b"
FT                   /db_xref="GOA:P24823"
FT                   /db_xref="InterPro:IPR001952"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR018299"
FT                   /db_xref="MGI:MGI:108009"
FT                   /db_xref="UniProtKB/Swiss-Prot:P24823"
FT                   /protein_id="EDL40194.1"
FT                   /translation="MWGACLLLLGLSLQVCPSVIPVEEENPAFWNRKAAEALDAAKKLK
FT                   PIQTSAKNLVILMGDGMGVSTVTATRILKGQQQGHLGPETQLAMDRFPHMALSKTYNTD
FT                   KQIPDSAGTGTAFLCGVKTNMKVIGLSAAARFNQCNTTWGNEVVSVMHRAKKAGKSVGV
FT                   VTTTSVQHASPAGTYAHTVNRGWYSDAQMPASALQDGCKDISTQLISNMDIDVILGGGR
FT                   KFMFPKGTPDQEYPTDTKQAGTRLDGRNLVQEWLAKHQGARYVWNRSELIQASLNRSVT
FT                   HLMGLFEPNDMKYEIHRDPAQDPSLAEMTEVAVRMLSRNPKGFYLFVEGGRIDHGHHET
FT                   VAYRALTEAVMFDSAVDKADKLTSEQDTMILVTADHSHVFSFGGYTQRGASIFGLAPFK
FT                   AEDGKSFTSILYGNGPGYKLHNGARADVTEEESSNPTYQQQAAVPLSSETHSGEDVAIF
FT                   ARGPQAHLVHGVQEQNYIAHVMAFAACLEPYTDCGLASPAGQSSAVSPGYMSTLLCLLA
FT                   GKMLMLMAAAEP"
FT   mRNA            complement(join(1482899..1483218,1483307..1483530))
FT                   /gene="Akp5"
FT                   /locus_tag="mCG_8511"
FT                   /product="alkaline phosphatase 5, transcript variant
FT                   mCT178056"
FT                   /note="gene_id=mCG8511.1 transcript_id=mCT178056.0 created
FT                   on 02-JAN-2003"
FT   CDS             complement(join(1482926..1483218,1483307..1483370))
FT                   /codon_start=1
FT                   /gene="Akp5"
FT                   /locus_tag="mCG_8511"
FT                   /product="alkaline phosphatase 5, isoform CRA_a"
FT                   /note="gene_id=mCG8511.1 transcript_id=mCT178056.0
FT                   protein_id=mCP100978.0 isoform=CRA_a"
FT                   /protein_id="EDL40193.1"
FT                   /translation="MWGACLLLLGLSLQVCPSVIPVEEENPAFWNRKAAEALDAAKKLK
FT                   PIQTSAKNLVILMGDGEIVRPAYPGTLLHPPPEEAPGGPKGLVLIMFCSFRDGGVYSNR
FT                   YPDPKGAAARPSGT"
FT   gene            complement(1491618..>1495150)
FT                   /locus_tag="mCG_132688"
FT                   /note="gene_id=mCG132688.0"
FT   mRNA            complement(join(1491618..1492579,1492667..1492783,
FT                   1492985..1493176,1493264..1493398,1493520..1493592,
FT                   1493686..1493820,1494064..1494236,1494304..1494478,
FT                   1494646..1494761,1494879..1494995,1495081..>1495150))
FT                   /locus_tag="mCG_132688"
FT                   /product="mCG132688"
FT                   /note="gene_id=mCG132688.0 transcript_id=mCT134038.1
FT                   created on 04-FEB-2003"
FT   CDS             complement(join(1492218..1492579,1492667..1492783,
FT                   1492985..1493176,1493264..1493398,1493520..1493592,
FT                   1493686..1493820,1494064..1494236,1494304..1494478,
FT                   1494646..1494761,1494879..1494995,1495081..1495150))
FT                   /codon_start=1
FT                   /locus_tag="mCG_132688"
FT                   /product="mCG132688"
FT                   /note="gene_id=mCG132688.0 transcript_id=mCT134038.1
FT                   protein_id=mCP81318.1"
FT                   /protein_id="EDL40191.1"
FT                   /translation="MQGDWVLLLFLGLRIHLSFGIIPAEEENPAFWNKKAAEALDAAKK
FT                   LQPIQTSAKNLIIFLGDGMGVPTVTATRILKGQLEGHLGPETPLAMDLFPYMALSKTYN
FT                   VDRQVPDSAGTATAYLCGVKANYKTIGLSAAARLDQCNTTFGNEVFSVMYRAKKAGKSV
FT                   GVVTTTRVQHASPAGTYAHTVNRNWYSDAEMPASALQDGCKDIATQLISNMDIDVILGG
FT                   GRKFMFPKGTPDPEYPSDSNQSGTRLDDQNLVQTWLSKHQGARYVWNRSELIQASQDPA
FT                   VTHLMGLFEPTEMKYDANRNPSVDPSLAEMTEVAVRMLSRNPQGFYLFVEGGRIDQGHH
FT                   AGTAYLALTEAVMFDSAIEKASQLTNEKDTLILITADHSHVFAFGGYTLRGTSIFGLAP
FT                   LKALDDKSYTSILYGNGPGYELKSGNRPNVTEAQSVDPNYKQQAAVPLSSETHGGEDVA
FT                   IFARGPQAHLVHGVQEQNYIAHVMAFAGCLEPYTDCGLAPPAGQSPVITPGQATTTNNA
FT                   AGQATTTNNAASQATVLLSLQLLVSMLLLVGTAMVVS"
FT   assembly_gap    1505704..1505723
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1509216..1510586
FT                   /estimated_length=1371
FT                   /gap_type="unknown"
FT   assembly_gap    1513996..1514015
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <1517699..>1520606
FT                   /gene="Akp3"
FT                   /locus_tag="mCG_68161"
FT                   /note="gene_id=mCG68161.1"
FT   mRNA            join(<1517699..1517765,1517849..1517965,1518083..1518198,
FT                   1518318..1518492,1518571..1518743,1519004..1519138,
FT                   1519220..1519292,1519422..1519556,1519630..1519821,
FT                   1520024..1520137,1520224..>1520606)
FT                   /gene="Akp3"
FT                   /locus_tag="mCG_68161"
FT                   /product="alkaline phosphatase 3, intestine, not Mn
FT                   requiring"
FT                   /note="gene_id=mCG68161.1 transcript_id=mCT68348.1 created
FT                   on 02-JAN-2003"
FT   CDS             join(1517699..1517765,1517849..1517965,1518083..1518198,
FT                   1518318..1518492,1518571..1518743,1519004..1519138,
FT                   1519220..1519292,1519422..1519556,1519630..1519821,
FT                   1520024..1520137,1520224..1520606)
FT                   /codon_start=1
FT                   /gene="Akp3"
FT                   /locus_tag="mCG_68161"
FT                   /product="alkaline phosphatase 3, intestine, not Mn
FT                   requiring"
FT                   /note="gene_id=mCG68161.1 transcript_id=mCT68348.1
FT                   protein_id=mCP43338.1"
FT                   /protein_id="EDL40190.1"
FT                   /translation="MQGTWVLLLLGLRLQLSLSVIPVEEENPAFWNKKAAEALDAAKKL
FT                   QPIQTSAKNLIIFLGDGMGVPTVTATRILKGQLEGHLGPETPLAMDRFPYMALSKTYSV
FT                   DRQVPDSASTATAYLCGVKTNYKTIGVSAAARFDQCNTTFGNEVFSVMYRAKKAGKSVG
FT                   VVTTTRVQHASPSGTYVHTVNRNWYGDADMPASALREGCKDIATQLISNMDINVILGGG
FT                   RKYMFPAGTPDPEYPNDANETGTRLDGRNLVQEWLSKHQGSQYVWNREQLIQKAQDPSV
FT                   TYLMGLFEPVDTKFDIQRDPLMDPSLKDMTEAAVKVLSRNPKGFYLFVEGGRIDRGHHL
FT                   GTAYLALTEAVMFDLAIERASQLTSERDTLTIVTADHSHVFSFGGYTLRGTSIFGLAPL
FT                   NALDGKPYTSILYGNGPGYVGTGERPNVTAAESSGSSYRQQAAVPVKSETHGGEDVAIF
FT                   ARGPQAHLLHGVQEQNYIAHVMASAGCLEPYTDCGLAPPADESQTTTTTRQTTITTTTT
FT                   TTTTTTTPVHNSARSLGPATAPLALALLAGMLMLLLGAPAES"
FT   assembly_gap    1524529..1524779
FT                   /estimated_length=251
FT                   /gap_type="unknown"
FT   assembly_gap    1526877..1533861
FT                   /estimated_length=6985
FT                   /gap_type="unknown"
FT   gene            complement(1541051..>1549749)
FT                   /gene="Ecel1"
FT                   /locus_tag="mCG_16197"
FT                   /note="gene_id=mCG16197.2"
FT   mRNA            complement(join(1541051..1541482,1541622..1541698,
FT                   1542021..1542116,1542526..1542591,1542889..1543013,
FT                   1543177..1543244,1543870..1543921,1543999..1544057,
FT                   1544293..1544396,1544528..1544602,1544842..1544940,
FT                   1545376..1545598,1546212..1546336,1546513..1546605,
FT                   1546694..1546804,1546911..1546979,1547597..1548481,
FT                   1549413..1549522))
FT                   /gene="Ecel1"
FT                   /locus_tag="mCG_16197"
FT                   /product="endothelin converting enzyme-like 1, transcript
FT                   variant mCT16280"
FT                   /note="gene_id=mCG16197.2 transcript_id=mCT16280.1 created
FT                   on 02-JAN-2003"
FT   mRNA            complement(join(1541058..1541482,1541622..1541698,
FT                   1542021..1542116,1542526..1542591,1542889..1543013,
FT                   1543177..1543244,1543870..1543921,1543999..1544057,
FT                   1544293..1544396,1544528..1544602,1544842..1544940,
FT                   1545376..1545598,1546212..1546336,1546513..1546605,
FT                   1546694..1546804,1546911..1546979,1547597..1548481,
FT                   1549641..>1549749))
FT                   /gene="Ecel1"
FT                   /locus_tag="mCG_16197"
FT                   /product="endothelin converting enzyme-like 1, transcript
FT                   variant mCT193838"
FT                   /note="gene_id=mCG16197.2 transcript_id=mCT193838.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(1541383..1541482,1541622..1541698,
FT                   1542021..1542116,1542526..1542591,1542889..1543013,
FT                   1543177..1543244,1543870..1543921,1543999..1544057,
FT                   1544293..1544396,1544528..1544602,1544842..1544940,
FT                   1545376..1545598,1546212..1546336,1546513..1546605,
FT                   1546694..1546804,1546911..1546979,1547597..>1548421))
FT                   /codon_start=1
FT                   /gene="Ecel1"
FT                   /locus_tag="mCG_16197"
FT                   /product="endothelin converting enzyme-like 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG16197.2 transcript_id=mCT193838.0
FT                   protein_id=mCP114818.0 isoform=CRA_a"
FT                   /protein_id="EDL40188.1"
FT                   /translation="STKQGVCSQSLGTMEAPYSMTAHYDEFQEVKYVSRCGTGGARGTS
FT                   LPPGFPRGSGRSASGSRSGLPRWNRREVCLLSGLVFAAGLCAILAAMLALKYLGPGAAG
FT                   GGGACPEGCPERKAFARAARFLSANLDASIDPCQDFYSFACGGWLRRHAIPDDKLTYGT
FT                   IAAIGEQNEERLRRLLARPTGGPGGAAQRKVRAFFRSCLDMREIERLGPRPMLEVIEDC
FT                   GGWDLGGAADRPGAARWDLNRLLYKAQGVYSAAALFSLTVSLDDRNSSRYVIRIDQDGL
FT                   TLPERTLYLAQDEESEKILAAYRVFMQRLLRLLGADAVEQKAQEILQLEQRLANISVSE
FT                   YDDLRRDVSSAYNKVTLGQLQKIIPHLQWKWLLDQIFQEDFSEEEEVVLLATDYMQQVS
FT                   QLIRSTPRRILHNYLVWRVVVVLSEHLSSPFREALHELAKEMEGNDKPQELARVCLGQA
FT                   NRHFGMALGALFVHEHFSAASKAKVQQLVEDIKYILGQRLEELDWMDAQTKAAARAKLQ
FT                   YMMVMVGYPDFLLKPEAVDKEYEFEVHEKTYFKNILNSIRFSIQLSVKKIRQEVDKSSW
FT                   LLPPQALNAYYLPNKNQMVFPAGILQPTLYDPDFPQSLNYGGIGTIIGHELTHGYDDWG
FT                   GQYDRSGNLLHWWTETSYSHFLRKAECIVRLYDNFTVYNQRVNGKHTLGENIADMGGLK
FT                   LAYYAYQKWVREHGPEHPLHRLKYTHNQLFFIAFAQNWCIKRRSQSIYLQVLTDKHAPE
FT                   HYRVLGSVSQFEEFGRAFHCPKDSPMNPVHKCSVW"
FT   CDS             complement(join(1541383..1541482,1541622..1541698,
FT                   1542021..1542116,1542526..1542591,1542889..1543013,
FT                   1543177..1543244,1543870..1543921,1543999..1544057,
FT                   1544293..1544396,1544528..1544602,1544842..1544940,
FT                   1545376..1545598,1546212..1546336,1546513..1546605,
FT                   1546694..1546804,1546911..1546979,1547597..1548382))
FT                   /codon_start=1
FT                   /gene="Ecel1"
FT                   /locus_tag="mCG_16197"
FT                   /product="endothelin converting enzyme-like 1, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG16197.2 transcript_id=mCT16280.1
FT                   protein_id=mCP15665.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q9JMI0"
FT                   /db_xref="InterPro:IPR000718"
FT                   /db_xref="InterPro:IPR008753"
FT                   /db_xref="InterPro:IPR018497"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR029736"
FT                   /db_xref="MGI:MGI:1343461"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JMI0"
FT                   /protein_id="EDL40189.1"
FT                   /translation="MEAPYSMTAHYDEFQEVKYVSRCGTGGARGTSLPPGFPRGSGRSA
FT                   SGSRSGLPRWNRREVCLLSGLVFAAGLCAILAAMLALKYLGPGAAGGGGACPEGCPERK
FT                   AFARAARFLSANLDASIDPCQDFYSFACGGWLRRHAIPDDKLTYGTIAAIGEQNEERLR
FT                   RLLARPTGGPGGAAQRKVRAFFRSCLDMREIERLGPRPMLEVIEDCGGWDLGGAADRPG
FT                   AARWDLNRLLYKAQGVYSAAALFSLTVSLDDRNSSRYVIRIDQDGLTLPERTLYLAQDE
FT                   ESEKILAAYRVFMQRLLRLLGADAVEQKAQEILQLEQRLANISVSEYDDLRRDVSSAYN
FT                   KVTLGQLQKIIPHLQWKWLLDQIFQEDFSEEEEVVLLATDYMQQVSQLIRSTPRRILHN
FT                   YLVWRVVVVLSEHLSSPFREALHELAKEMEGNDKPQELARVCLGQANRHFGMALGALFV
FT                   HEHFSAASKAKVQQLVEDIKYILGQRLEELDWMDAQTKAAARAKLQYMMVMVGYPDFLL
FT                   KPEAVDKEYEFEVHEKTYFKNILNSIRFSIQLSVKKIRQEVDKSSWLLPPQALNAYYLP
FT                   NKNQMVFPAGILQPTLYDPDFPQSLNYGGIGTIIGHELTHGYDDWGGQYDRSGNLLHWW
FT                   TETSYSHFLRKAECIVRLYDNFTVYNQRVNGKHTLGENIADMGGLKLAYYAYQKWVREH
FT                   GPEHPLHRLKYTHNQLFFIAFAQNWCIKRRSQSIYLQVLTDKHAPEHYRVLGSVSQFEE
FT                   FGRAFHCPKDSPMNPVHKCSVW"
FT   assembly_gap    1553400..1553419
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1554633..1554652
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1564035..1564078
FT                   /estimated_length=44
FT                   /gap_type="unknown"
FT   assembly_gap    1574472..1574767
FT                   /estimated_length=296
FT                   /gap_type="unknown"
FT   assembly_gap    1576013..1576032
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            1577634..1582816
FT                   /locus_tag="mCG_16201"
FT                   /note="gene_id=mCG16201.2"
FT   mRNA            join(1577634..1577920,1579075..1579264,1579646..1579745,
FT                   1579928..1579991,1580216..1580358,1580593..1580755,
FT                   1580897..1581076,1581295..1581459,1581557..1581619,
FT                   1581907..1582013,1582356..1582816)
FT                   /locus_tag="mCG_16201"
FT                   /product="mCG16201"
FT                   /note="gene_id=mCG16201.2 transcript_id=mCT16283.2 created
FT                   on 04-FEB-2003"
FT   CDS             join(1577815..1577920,1579075..1579264,1579646..1579745,
FT                   1579928..1579991,1580216..1580358,1580593..1580755,
FT                   1580897..1581076,1581295..1581459,1581557..1581619,
FT                   1581907..1582013,1582356..1582631)
FT                   /codon_start=1
FT                   /locus_tag="mCG_16201"
FT                   /product="mCG16201"
FT                   /note="gene_id=mCG16201.2 transcript_id=mCT16283.2
FT                   protein_id=mCP15645.2"
FT                   /protein_id="EDL40187.1"
FT                   /translation="MPLAMLLLLLLLLSPDSQTAHGHPLYTRLSPGALQVQCGERHQGV
FT                   ANTTRAHGRIVGGSTAPSGAWPWLVRLQLGGLPLCGGVLVAASWVLTAAHCFAGASNEL
FT                   LWTVMLAEGPQGEQAEEVQVNRILPHPKGSREPPAGTPCAIAGWGALFEDGPESEAVRE
FT                   ARVPLLSADTCQKVLGPGLRPSTMLCAGYLAGGIDSCQGDSGGPLTCSEPGPRPREVLF
FT                   GVTSWGDGCGEPGKPGVYTRVTVFKDWLQEQMSAGPSTREPSCRELLNWNAREEEPFTD
FT                   APGLCAFYARQCLGSESSCARLALQQCLQRRRRCELRSLAHTLLGLLRGAQELLGPRPG
FT                   LRRGVSAPARSAPSLQELPGHNPREQRLYSGSRIAGTWLQKPKPERRPETKGCPGLEPL
FT                   QQKLAAIQRAHAWILQIPAEHLAMNFHEVLADLGSKTLTGLFRAWVRAGLGDQRVVFSG
FT                   LVGLEPSTLAHSLPRLLVQALKAFRSASLTEGEPQAPWIGADQGQRLGKERQGQLQPPV
FT                   P"
FT   assembly_gap    1581236..1581255
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            1585020..1593595
FT                   /gene="Chrnd"
FT                   /locus_tag="mCG_16196"
FT                   /note="gene_id=mCG16196.2"
FT   mRNA            join(1585020..1585155,1585388..1585542,1585933..1586343)
FT                   /gene="Chrnd"
FT                   /locus_tag="mCG_16196"
FT                   /product="cholinergic receptor, nicotinic, delta
FT                   polypeptide, transcript variant mCT177933"
FT                   /note="gene_id=mCG16196.2 transcript_id=mCT177933.0 created
FT                   on 02-JAN-2003"
FT   mRNA            join(1585050..1585155,1585388..1585542,1585933..1585977,
FT                   1586627..1586736,1586899..1587054,1587259..1587368,
FT                   1589209..1589409,1589894..1590005,1590092..1590206,
FT                   1591772..1591976,1592064..1592182,1593069..1593595)
FT                   /gene="Chrnd"
FT                   /locus_tag="mCG_16196"
FT                   /product="cholinergic receptor, nicotinic, delta
FT                   polypeptide, transcript variant mCT16278"
FT                   /note="gene_id=mCG16196.2 transcript_id=mCT16278.1 created
FT                   on 02-JAN-2003"
FT   CDS             join(1585104..1585155,1585388..1585542,1585933..1585977,
FT                   1586627..1586736,1586899..1587054,1587259..1587368,
FT                   1589209..1589409,1589894..1590005,1590092..1590206,
FT                   1591772..1591976,1592064..1592182,1593069..1593251)
FT                   /codon_start=1
FT                   /gene="Chrnd"
FT                   /locus_tag="mCG_16196"
FT                   /product="cholinergic receptor, nicotinic, delta
FT                   polypeptide, isoform CRA_a"
FT                   /note="gene_id=mCG16196.2 transcript_id=mCT16278.1
FT                   protein_id=mCP15661.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q80VZ5"
FT                   /db_xref="InterPro:IPR002394"
FT                   /db_xref="InterPro:IPR006029"
FT                   /db_xref="InterPro:IPR006201"
FT                   /db_xref="InterPro:IPR006202"
FT                   /db_xref="InterPro:IPR018000"
FT                   /db_xref="InterPro:IPR027361"
FT                   /db_xref="MGI:MGI:87893"
FT                   /db_xref="UniProtKB/TrEMBL:Q80VZ5"
FT                   /protein_id="EDL40184.1"
FT                   /translation="MAGPVLTLGLLAALVVCALPGSWGLNEEQRLIQHLFNEKGYDKDL
FT                   RPVARKEDKVDVALSLTLSNLISLKEVEETLTTNVWIDHAWVDSRLQWDANDFGNITVL
FT                   RLPPDMVWLPEIVLENNNDGSFQISYACNVLVYDSGYVTWLPPAIFRSSCPISVTYFPF
FT                   DWQNCSLKFSSLKYTAKEITLSLKQEEENNRSYPIEWIIIDPEGFTENGEWEIVHRAAK
FT                   LNVDPSVPMDSTNHQDVTFYLIIRRKPLFYIINILVPCVLISFMINLVFYLPGDCGEKT
FT                   SVAISVLLAQSVFLLLISKRLPATSMAIPLVGKFLLFGMVLVTMVVVICVIVLNIHFRT
FT                   PSTHVLSEGVKKFFLETLPKLLHMSRPAEEDPGPRALIRRSSSLGYICKAEEYFSLKSR
FT                   SDLMFEKQSERHGLARRLTTARRPPASSEQVQQELFNEMKPAVDGANFIVNHMRDQNSY
FT                   NEEKDNWNQVARTVDRLCLFVVTPVMVVGTAWIFLQGVYNQPPLQPFPGDPFSYSEQDK
FT                   RFI"
FT   CDS             join(1585104..1585155,1585388..1585542,1585933..1586070)
FT                   /codon_start=1
FT                   /gene="Chrnd"
FT                   /locus_tag="mCG_16196"
FT                   /product="cholinergic receptor, nicotinic, delta
FT                   polypeptide, isoform CRA_c"
FT                   /note="gene_id=mCG16196.2 transcript_id=mCT177933.0
FT                   protein_id=mCP100856.0 isoform=CRA_c"
FT                   /protein_id="EDL40186.1"
FT                   /translation="MAGPVLTLGLLAALVVCALPGSWGLNEEQRLIQHLFNEKGYDKDL
FT                   RPVARKEDKVDVALSLTLSNLISLKEVEETLTTNVWIDHVRTPCRRFQVPWCSLMLGTT
FT                   SSYGHTFGGA"
FT   mRNA            join(1585256..1585542,1585933..1585977,1586627..1586736,
FT                   1586899..1587054,1587259..1587368,1589209..1589409,
FT                   1589894..1590005,1590092..1590206,1591772..1591976,
FT                   1592064..1592182,1593069..1593595)
FT                   /gene="Chrnd"
FT                   /locus_tag="mCG_16196"
FT                   /product="cholinergic receptor, nicotinic, delta
FT                   polypeptide, transcript variant mCT177934"
FT                   /note="gene_id=mCG16196.2 transcript_id=mCT177934.0 created
FT                   on 02-JAN-2003"
FT   CDS             join(1586702..1586736,1586899..1587054,1587259..1587368,
FT                   1589209..1589409,1589894..1590005,1590092..1590206,
FT                   1591772..1591976,1592064..1592182,1593069..1593251)
FT                   /codon_start=1
FT                   /gene="Chrnd"
FT                   /locus_tag="mCG_16196"
FT                   /product="cholinergic receptor, nicotinic, delta
FT                   polypeptide, isoform CRA_b"
FT                   /note="gene_id=mCG16196.2 transcript_id=mCT177934.0
FT                   protein_id=mCP100855.0 isoform=CRA_b"
FT                   /db_xref="GOA:A0A087WNX8"
FT                   /db_xref="InterPro:IPR002394"
FT                   /db_xref="InterPro:IPR006029"
FT                   /db_xref="InterPro:IPR006201"
FT                   /db_xref="InterPro:IPR006202"
FT                   /db_xref="InterPro:IPR018000"
FT                   /db_xref="InterPro:IPR027361"
FT                   /db_xref="MGI:MGI:87893"
FT                   /db_xref="UniProtKB/TrEMBL:A0A087WNX8"
FT                   /protein_id="EDL40185.1"
FT                   /translation="MVWLPEIVLENNNDGSFQISYACNVLVYDSGYVTWLPPAIFRSSC
FT                   PISVTYFPFDWQNCSLKFSSLKYTAKEITLSLKQEEENNRSYPIEWIIIDPEGFTENGE
FT                   WEIVHRAAKLNVDPSVPMDSTNHQDVTFYLIIRRKPLFYIINILVPCVLISFMINLVFY
FT                   LPGDCGEKTSVAISVLLAQSVFLLLISKRLPATSMAIPLVGKFLLFGMVLVTMVVVICV
FT                   IVLNIHFRTPSTHVLSEGVKKFFLETLPKLLHMSRPAEEDPGPRALIRRSSSLGYICKA
FT                   EEYFSLKSRSDLMFEKQSERHGLARRLTTARRPPASSEQVQQELFNEMKPAVDGANFIV
FT                   NHMRDQNSYNEEKDNWNQVARTVDRLCLFVVTPVMVVGTAWIFLQGVYNQPPLQPFPGD
FT                   PFSYSEQDKRFI"
FT   assembly_gap    1590954..1591208
FT                   /estimated_length=255
FT                   /gap_type="unknown"
FT   gene            <1600287..1606189
FT                   /gene="Chrng"
FT                   /locus_tag="mCG_16217"
FT                   /note="gene_id=mCG16217.2"
FT   mRNA            join(<1600287..1600363,1600645..1600719,1600973..1601017,
FT                   1601155..1601264,1601896..1603104)
FT                   /gene="Chrng"
FT                   /locus_tag="mCG_16217"
FT                   /product="cholinergic receptor, nicotinic, gamma
FT                   polypeptide, transcript variant mCT177959"
FT                   /note="gene_id=mCG16217.2 transcript_id=mCT177959.0 created
FT                   on 02-JAN-2003"
FT   mRNA            join(1600298..1600363,1600444..1600451,1600645..1600719,
FT                   1600973..1601017,1601155..1601264,1601896..1602051,
FT                   1602717..1602814,1603516..1603716,1603984..1604098,
FT                   1604320..1604434,1605080..1605296,1605459..1605592,
FT                   1605871..1606189)
FT                   /gene="Chrng"
FT                   /locus_tag="mCG_16217"
FT                   /product="cholinergic receptor, nicotinic, gamma
FT                   polypeptide, transcript variant mCT16429"
FT                   /note="gene_id=mCG16217.2 transcript_id=mCT16429.2 created
FT                   on 02-JAN-2003"
FT   CDS             join(1600309..1600363,1600444..1600451,1600645..1600719,
FT                   1600973..1601017,1601155..1601264,1601896..1602051,
FT                   1602717..1602814,1603516..1603716,1603984..1604098,
FT                   1604320..1604434,1605080..1605296,1605459..1605592,
FT                   1605871..1606044)
FT                   /codon_start=1
FT                   /gene="Chrng"
FT                   /locus_tag="mCG_16217"
FT                   /product="cholinergic receptor, nicotinic, gamma
FT                   polypeptide, isoform CRA_a"
FT                   /note="gene_id=mCG16217.2 transcript_id=mCT16429.2
FT                   protein_id=mCP15652.2 isoform=CRA_a"
FT                   /protein_id="EDL40182.1"
FT                   /translation="MQGGQRPHLLLLLLAVCLGSGLRPAERDSNVVNVSLKLTLTNLIS
FT                   LNEREEALTTNVWIEMQWCDYRLRWDPKDYEGLWILRVPSTMVWRPDIVLENNVDGVFE
FT                   VALYCNVLVSPDGCIYWLPPAIFRSSCSISVTYFPFDWQNCSLIFQSQTYSTSEINLQL
FT                   SQEDGQAIEWIFIDPEAFTENGEWAIRHRPAKMLLDSVAPAEEAGHQKVVFYLLIQRKP
FT                   LFYVINIIAPCVLISSVAILIYFLPAKAGGQKCTVATNVLLAQTVFLFLVAKKVPETSQ
FT                   AVPLISKYLTFLMVVTILIVVNSVVVLNVSLRSPHTHSMARGVRKVFLRLLPQLLRMHV
FT                   RPLAPAAVQDARFRLQNGSSSGWPIMAREEGDLCLPRSELLFRQRQRNGLVQAVLEKLE
FT                   NGPEVRQSQEFCGSLKQASPAIQACVDACNLMARARRQQSHFDSGNEEWLLVGRVLDRV
FT                   CFLAMLSLFICGTAGIFLMAHYNQVPDLPFPGDPRPYLPLPD"
FT   assembly_gap    1600528..1600642
FT                   /estimated_length=115
FT                   /gap_type="unknown"
FT   CDS             join(<1600645..1600719,1600973..1601017,1601155..1601264,
FT                   1601896..1602055)
FT                   /codon_start=1
FT                   /gene="Chrng"
FT                   /locus_tag="mCG_16217"
FT                   /product="cholinergic receptor, nicotinic, gamma
FT                   polypeptide, isoform CRA_b"
FT                   /note="gene_id=mCG16217.2 transcript_id=mCT177959.0
FT                   protein_id=mCP100881.0 isoform=CRA_b"
FT                   /protein_id="EDL40183.1"
FT                   /translation="LRPAERDSNVVNVSLKLTLTNLISLNEREEALTTNVWIEMQWCDY
FT                   RLRWDPKDYEGLWILRVPSTMVWRPDIVLENNVDGVFEVALYCNVLVSPDGCIYWLPPA
FT                   IFRSSCSISVTYFPFDWQNCSLIFQ"
FT   assembly_gap    1603880..1603964
FT                   /estimated_length=85
FT                   /gap_type="unknown"
FT   gene            1608472..1633343
FT                   /gene="Eif4e2"
FT                   /locus_tag="mCG_16205"
FT                   /note="gene_id=mCG16205.2"
FT   mRNA            join(1608472..1608575,1614181..1614295,1615520..1615654,
FT                   1618953..1619057,1620450..1620602,1620697..1620833,
FT                   1632445..1633343)
FT                   /gene="Eif4e2"
FT                   /locus_tag="mCG_16205"
FT                   /product="eukaryotic translation initiation factor 4E
FT                   member 2, transcript variant mCT16417"
FT                   /note="gene_id=mCG16205.2 transcript_id=mCT16417.2 created
FT                   on 02-JAN-2003"
FT   mRNA            join(1608490..1608575,1614181..1614281,1632503..1633061)
FT                   /gene="Eif4e2"
FT                   /locus_tag="mCG_16205"
FT                   /product="eukaryotic translation initiation factor 4E
FT                   member 2, transcript variant mCT177941"
FT                   /note="gene_id=mCG16205.2 transcript_id=mCT177941.0 created
FT                   on 02-JAN-2003"
FT   mRNA            join(<1608493..1609040,1614168..1614295,1615520..1615654,
FT                   1618953..1619057,1620450..1620602,1620697..1621200)
FT                   /gene="Eif4e2"
FT                   /locus_tag="mCG_16205"
FT                   /product="eukaryotic translation initiation factor 4E
FT                   member 2, transcript variant mCT177939"
FT                   /note="gene_id=mCG16205.2 transcript_id=mCT177939.0 created
FT                   on 02-JAN-2003"
FT   mRNA            join(<1608502..1608575,1614181..1614295,1615520..1615654,
FT                   1618953..1619057,1620450..1620602,1620697..1620826,
FT                   1627193..1629308)
FT                   /gene="Eif4e2"
FT                   /locus_tag="mCG_16205"
FT                   /product="eukaryotic translation initiation factor 4E
FT                   member 2, transcript variant mCT193876"
FT                   /note="gene_id=mCG16205.2 transcript_id=mCT193876.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(<1608520..1608575,1614181..1614295,1615520..1615654,
FT                   1618953..1619057,1620450..1620602,1620697..1620833,
FT                   1631355..>1631448)
FT                   /gene="Eif4e2"
FT                   /locus_tag="mCG_16205"
FT                   /product="eukaryotic translation initiation factor 4E
FT                   member 2, transcript variant mCT193875"
FT                   /note="gene_id=mCG16205.2 transcript_id=mCT193875.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(1608524..1608575,1614181..1614295,1615520..1615654,
FT                   1618953..1619057,1620450..1620602,1620697..1620833,
FT                   1622401..1622662)
FT                   /gene="Eif4e2"
FT                   /locus_tag="mCG_16205"
FT                   /product="eukaryotic translation initiation factor 4E
FT                   member 2, transcript variant mCT177940"
FT                   /note="gene_id=mCG16205.2 transcript_id=mCT177940.0 created
FT                   on 02-JAN-2003"
FT   CDS             join(<1608529..1608575,1614181..1614295,1615520..1615654,
FT                   1618953..1619057,1620450..1620602,1620697..1620833,
FT                   1631355..>1631448)
FT                   /codon_start=1
FT                   /gene="Eif4e2"
FT                   /locus_tag="mCG_16205"
FT                   /product="eukaryotic translation initiation factor 4E
FT                   member 2, isoform CRA_d"
FT                   /note="gene_id=mCG16205.2 transcript_id=mCT193875.0
FT                   protein_id=mCP114841.0 isoform=CRA_d"
FT                   /protein_id="EDL40179.1"
FT                   /translation="GSGDSGGKRMNNKFDALKDDDSGDHDQNEENSTQKDGEKEKTDRD
FT                   KSQSSGKRKAVVPGPAEHPLQYNYTFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFW
FT                   KFYSHMVRPGDLTGHSDFHLFKEGIKPMWEDDANKNGGKWIIRLRKGLASRCWENLILA
FT                   MLGEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQATTARIRDTLRRVLNLPPNTIME
FT                   YKTHTDSINFPRAAHPSLATEQLMSGCGTLSRLLPAASSR"
FT   CDS             join(<1608529..1608575,1614181..1614295,1615520..1615654,
FT                   1618953..1619057,1620450..1620602,1620697..1620826,
FT                   1627193..1627215)
FT                   /codon_start=1
FT                   /gene="Eif4e2"
FT                   /locus_tag="mCG_16205"
FT                   /product="eukaryotic translation initiation factor 4E
FT                   member 2, isoform CRA_e"
FT                   /note="gene_id=mCG16205.2 transcript_id=mCT193876.0
FT                   protein_id=mCP114842.0 isoform=CRA_e"
FT                   /protein_id="EDL40180.1"
FT                   /translation="GSGDSGGKRMNNKFDALKDDDSGDHDQNEENSTQKDGEKEKTDRD
FT                   KSQSSGKRKAVVPGPAEHPLQYNYTFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFW
FT                   KFYSHMVRPGDLTGHSDFHLFKEGIKPMWEDDANKNGGKWIIRLRKGLASRCWENLILA
FT                   MLGEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQATTARIRDTLRRVLNLPPNTIME
FT                   YKTHTDTLHLREP"
FT   CDS             join(1608556..1608575,1614181..1614281,1632503..1632588)
FT                   /codon_start=1
FT                   /gene="Eif4e2"
FT                   /locus_tag="mCG_16205"
FT                   /product="eukaryotic translation initiation factor 4E
FT                   member 2, isoform CRA_c"
FT                   /note="gene_id=mCG16205.2 transcript_id=mCT177941.0
FT                   protein_id=mCP100861.0 isoform=CRA_c"
FT                   /protein_id="EDL40178.1"
FT                   /translation="MNNKFDALKDDDSGDHDQNEENSTQKDGEKEKTDRDKSQSIILFS
FT                   LCVCLNWMRGSGSSSVCSLKGCT"
FT   CDS             join(1608556..1608575,1614181..1614295,1615520..1615654,
FT                   1618953..1619057,1620450..1620602,1620697..1620833,
FT                   1632445..1632484)
FT                   /codon_start=1
FT                   /gene="Eif4e2"
FT                   /locus_tag="mCG_16205"
FT                   /product="eukaryotic translation initiation factor 4E
FT                   member 2, isoform CRA_a"
FT                   /note="gene_id=mCG16205.2 transcript_id=mCT16417.2
FT                   protein_id=mCP15660.2 isoform=CRA_a"
FT                   /db_xref="GOA:G3X9H1"
FT                   /db_xref="InterPro:IPR001040"
FT                   /db_xref="InterPro:IPR019770"
FT                   /db_xref="InterPro:IPR023398"
FT                   /db_xref="MGI:MGI:1914440"
FT                   /db_xref="UniProtKB/TrEMBL:G3X9H1"
FT                   /protein_id="EDL40176.1"
FT                   /translation="MNNKFDALKDDDSGDHDQNEENSTQKDGEKEKTDRDKSQSSGKRK
FT                   AVVPGPAEHPLQYNYTFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWKFYSHMVRP
FT                   GDLTGHSDFHLFKEGIKPMWEDDANKNGGKWIIRLRKGLASRCWENLILAMLGEQFMVG
FT                   EEICGAVVSVRFQEDIISIWNKTASDQATTARIRDTLRRVLNLPPNTIMEYKTHTDSIK
FT                   DNSSFRNTKITL"
FT   CDS             join(1608556..1608575,1614181..1614295,1615520..1615654,
FT                   1618953..1619057,1620450..1620602,1620697..1620833,
FT                   1622401..1622473)
FT                   /codon_start=1
FT                   /gene="Eif4e2"
FT                   /locus_tag="mCG_16205"
FT                   /product="eukaryotic translation initiation factor 4E
FT                   member 2, isoform CRA_b"
FT                   /note="gene_id=mCG16205.2 transcript_id=mCT177940.0
FT                   protein_id=mCP100863.0 isoform=CRA_b"
FT                   /protein_id="EDL40177.1"
FT                   /translation="MNNKFDALKDDDSGDHDQNEENSTQKDGEKEKTDRDKSQSSGKRK
FT                   AVVPGPAEHPLQYNYTFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWKFYSHMVRP
FT                   GDLTGHSDFHLFKEGIKPMWEDDANKNGGKWIIRLRKGLASRCWENLILAMLGEQFMVG
FT                   EEICGAVVSVRFQEDIISIWNKTASDQATTARIRDTLRRVLNLPPNTIMEYKTHTDSIK
FT                   MPGRLGPQRLLFQNLWKPRLNVP"
FT   CDS             join(<1608560..1609040,1614168..1614295,1615520..1615654,
FT                   1618953..1619057,1620450..1620602,1620697..1620870)
FT                   /codon_start=1
FT                   /gene="Eif4e2"
FT                   /locus_tag="mCG_16205"
FT                   /product="eukaryotic translation initiation factor 4E
FT                   member 2, isoform CRA_f"
FT                   /note="gene_id=mCG16205.2 transcript_id=mCT177939.0
FT                   protein_id=mCP100862.0 isoform=CRA_f"
FT                   /protein_id="EDL40181.1"
FT                   /translation="TTSSTREWRVADPGAPSPNRLPGPLPPGPGAPSAEPLAPGPPQPE
FT                   PSCARGPDGAGRARPRSPGPLSRWTPARHGPGEGRPRRPEGDFRTPRPGGCGLPAAWRG
FT                   GTSALRVFPQPCCLLSERGFPPALARRPGKVTSPFRASILSSASGDGNRARVVELGTFL
FT                   CSLKDDDSGDHDQNEENSTQKDGEKEKTDRDKSQSSGKRKAVVPGPAEHPLQYNYTFWY
FT                   SRRTPGRPTSSQSYEQNIKQIGTFASVEQFWKFYSHMVRPGDLTGHSDFHLFKEGIKPM
FT                   WEDDANKNGGKWIIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISI
FT                   WNKTASDQATTARIRDTLRRVLNLPPNTIMEYKTHTDSIKYVLGGLGGTGP"
FT   assembly_gap    1609043..1609079
FT                   /estimated_length=37
FT                   /gap_type="unknown"
FT   assembly_gap    1641139..1641242
FT                   /estimated_length=104
FT                   /gap_type="unknown"
FT   assembly_gap    1646818..1647206
FT                   /estimated_length=389
FT                   /gap_type="unknown"
FT   assembly_gap    1654430..1655220
FT                   /estimated_length=791
FT                   /gap_type="unknown"
FT   gene            <1658596..1705168
FT                   /gene="Efhd1"
FT                   /locus_tag="mCG_16216"
FT                   /note="gene_id=mCG16216.3"
FT   mRNA            join(<1658596..1658988,1683690..1683837,1691868..1692002,
FT                   1703989..1704174,1704300..1705166)
FT                   /gene="Efhd1"
FT                   /locus_tag="mCG_16216"
FT                   /product="EF hand domain containing 1, transcript variant
FT                   mCT193777"
FT                   /note="gene_id=mCG16216.3 transcript_id=mCT193777.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<1658597..1658988,1683690..1683837,1691868..1692002,
FT                   1703989..1704123)
FT                   /codon_start=1
FT                   /gene="Efhd1"
FT                   /locus_tag="mCG_16216"
FT                   /product="EF hand domain containing 1, isoform CRA_c"
FT                   /note="gene_id=mCG16216.3 transcript_id=mCT193777.0
FT                   protein_id=mCP114747.0 isoform=CRA_c"
FT                   /protein_id="EDL40175.1"
FT                   /translation="RKPRARKERTTLCPRTGSRTSVPSPQPAIMSSEELACKLQRRLRL
FT                   EVRAETDQGDPQPAPCDAPAGHPEPEPPARAPTASADSELNLKLSRRLDIHQGTARPGR
FT                   SKVFNPYTEFPEFSRRLLKDLEKMFKTYDAGRDGFIDLMELKLMMEKLGAPQTHLGLKS
FT                   MIKEVDEDFDGKLSFREFLLIFHKAAAGELQEDSGLLALAKFSEIDVALEGVRGAKNFF
FT                   EAKAQALSCSSKFEAELKAEQEERKREEEARRLRQAAFRELKAAFSA"
FT   mRNA            join(1658598..1658988,1683690..1683837,1691868..1692002,
FT                   1703989..1705119)
FT                   /gene="Efhd1"
FT                   /locus_tag="mCG_16216"
FT                   /product="EF hand domain containing 1, transcript variant
FT                   mCT16428"
FT                   /note="gene_id=mCG16216.3 transcript_id=mCT16428.0 created
FT                   on 02-JAN-2003"
FT   CDS             join(1658684..1658988,1683690..1683837,1691868..1692002,
FT                   1703989..1704123)
FT                   /codon_start=1
FT                   /gene="Efhd1"
FT                   /locus_tag="mCG_16216"
FT                   /product="EF hand domain containing 1, isoform CRA_a"
FT                   /note="gene_id=mCG16216.3 transcript_id=mCT16428.0
FT                   protein_id=mCP15649.1 isoform=CRA_a"
FT                   /protein_id="EDL40173.1"
FT                   /translation="MSSEELACKLQRRLRLEVRAETDQGDPQPAPCDAPAGHPEPEPPA
FT                   RAPTASADSELNLKLSRRLDIHQGTARPGRSKVFNPYTEFPEFSRRLLKDLEKMFKTYD
FT                   AGRDGFIDLMELKLMMEKLGAPQTHLGLKSMIKEVDEDFDGKLSFREFLLIFHKAAAGE
FT                   LQEDSGLLALAKFSEIDVALEGVRGAKNFFEAKAQALSCSSKFEAELKAEQEERKREEE
FT                   ARRLRQAAFRELKAAFSA"
FT   assembly_gap    1661232..1661516
FT                   /estimated_length=285
FT                   /gap_type="unknown"
FT   assembly_gap    1702554..1702653
FT                   /estimated_length=100
FT                   /gap_type="unknown"
FT   mRNA            join(1703553..1703824,1703989..1705168)
FT                   /gene="Efhd1"
FT                   /locus_tag="mCG_16216"
FT                   /product="EF hand domain containing 1, transcript variant
FT                   mCT177958"
FT                   /note="gene_id=mCG16216.3 transcript_id=mCT177958.0 created
FT                   on 02-JAN-2003"
FT   CDS             join(1703582..1703824,1703989..1704123)
FT                   /codon_start=1
FT                   /gene="Efhd1"
FT                   /locus_tag="mCG_16216"
FT                   /product="EF hand domain containing 1, isoform CRA_b"
FT                   /note="gene_id=mCG16216.3 transcript_id=mCT177958.0
FT                   protein_id=mCP100880.0 isoform=CRA_b"
FT                   /protein_id="EDL40174.1"
FT                   /translation="MNREPSLLRSEDTTRPSSRTGPQECSDTAVKPKKRKCGNLGKWLH
FT                   RRACLPPRASGCAFSTLKKESRKNNPEIEAGRSQPQAQALSCSSKFEAELKAEQEERKR
FT                   EEEARRLRQAAFRELKAAFSA"
FT   gene            1721344..1845170
FT                   /gene="Tnrc15"
FT                   /locus_tag="mCG_16210"
FT                   /note="gene_id=mCG16210.2"
FT   mRNA            join(1721344..1721433,1728672..1728736,1748779..1748861,
FT                   1758567..1758696,1759647..1759742,1768460..1768574,
FT                   1773440..1773551,1774436..1774476,1798138..1798317,
FT                   1801451..1801668,1801760..1801922,1802002..1802190,
FT                   1805129..1805325,1806175..1806334,1811302..1811468,
FT                   1813573..1813664,1814772..1814879,1815879..1815979,
FT                   1817567..1817667,1819451..1819612,1822955..1823113,
FT                   1828087..1828323,1831128..1831250,1834775..1834999,
FT                   1835104..1835309,1836398..1836552,1838032..1838213,
FT                   1840699..1840846,1843465..1845170)
FT                   /gene="Tnrc15"
FT                   /locus_tag="mCG_16210"
FT                   /product="trinucleotide repeat containing 15, transcript
FT                   variant mCT16422"
FT                   /note="gene_id=mCG16210.2 transcript_id=mCT16422.2 created
FT                   on 02-JAN-2003"
FT   mRNA            join(1721344..1721433,1728672..1728736,1748779..1748861,
FT                   1758567..1758696,1759647..1759742,1768460..1768574,
FT                   1798138..1798317,1801469..1801668,1801760..1801922,
FT                   1802002..1802190,1805129..1805325,1806175..1806334,
FT                   1811302..1811468,1813573..1813664,1814772..1814879,
FT                   1815879..1815979,1817567..1817667,1819451..1819612,
FT                   1822955..1823113,1828087..1828323,1831128..1831250,
FT                   1834775..1834999,1835104..1835309,1836398..1836552,
FT                   1838032..1838213,1840699..1840846,1843465..1845164)
FT                   /gene="Tnrc15"
FT                   /locus_tag="mCG_16210"
FT                   /product="trinucleotide repeat containing 15, transcript
FT                   variant mCT177942"
FT                   /note="gene_id=mCG16210.2 transcript_id=mCT177942.0 created
FT                   on 02-JAN-2003"
FT   mRNA            join(1721370..1721433,1728672..1728736,1748779..1748861,
FT                   1749346..1750097)
FT                   /gene="Tnrc15"
FT                   /locus_tag="mCG_16210"
FT                   /product="trinucleotide repeat containing 15, transcript
FT                   variant mCT177946"
FT                   /note="gene_id=mCG16210.2 transcript_id=mCT177946.0 created
FT                   on 02-JAN-2003"
FT   mRNA            join(1721374..1721433,1728672..1728736,1748779..1748861,
FT                   1758567..1758696,1759647..1759742,1768460..1768574,
FT                   1798138..1798317,1801469..1801668,1801760..1801922,
FT                   1802002..1802190,1805129..1805325,1806175..1806334,
FT                   1811302..1811468,1813573..1813664,1814772..1814879,
FT                   1815879..1816254)
FT                   /gene="Tnrc15"
FT                   /locus_tag="mCG_16210"
FT                   /product="trinucleotide repeat containing 15, transcript
FT                   variant mCT177947"
FT                   /note="gene_id=mCG16210.2 transcript_id=mCT177947.0 created
FT                   on 02-JAN-2003"
FT   mRNA            join(1721386..1721433,1728672..1728736,1748779..1748861,
FT                   1758567..1758696,1759647..1759691,1773519..1773551,
FT                   1774436..1774476,1798138..1798317,1801451..1801668,
FT                   1801760..1801922,1802002..1802190,1805129..1805325,
FT                   1806175..1806334,1811302..1811468,1813573..1813664,
FT                   1814772..1814879,1815879..1815979,1817567..1817667,
FT                   1819451..1819612,1822955..1823113,1828087..1828323,
FT                   1831128..1831250,1834775..1834999,1835104..1835309,
FT                   1836398..1836552,1838032..1838213,1840699..1840846,
FT                   1843465..1845164)
FT                   /gene="Tnrc15"
FT                   /locus_tag="mCG_16210"
FT                   /product="trinucleotide repeat containing 15, transcript
FT                   variant mCT177943"
FT                   /note="gene_id=mCG16210.2 transcript_id=mCT177943.0 created
FT                   on 02-JAN-2003"
FT   assembly_gap    1721647..1721666
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            join(<1728672..1728736,1748779..1748861,1758567..1758696,
FT                   1759647..1759742,1768460..1768574,1773440..1773551,
FT                   1774436..1774476,1798138..1798317,1801469..1801668,
FT                   1801760..1801922,1802005..1802190,1805129..1805325,
FT                   1806175..1806334,1811302..1811468,1813573..1813664,
FT                   1814772..1814879,1815879..1815979,1817567..1817667,
FT                   1819451..1819612,1822955..1823113,1828087..>1828189)
FT                   /gene="Tnrc15"
FT                   /locus_tag="mCG_16210"
FT                   /product="trinucleotide repeat containing 15, transcript
FT                   variant mCT193761"
FT                   /note="gene_id=mCG16210.2 transcript_id=mCT193761.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<1728716..1728736,1748779..1748861,1758567..1758696,
FT                   1759647..1759742,1768460..1768574,1773440..1773551,
FT                   1774436..1774476,1798138..1798317,1801469..1801668,
FT                   1801760..1801922,1802005..1802190,1805129..1805325,
FT                   1806175..1806334,1811302..1811468,1813573..1813664,
FT                   1814772..1814879,1815879..1815979,1817567..1817667,
FT                   1819451..1819612,1822955..1823113,1828087..>1828189)
FT                   /codon_start=1
FT                   /gene="Tnrc15"
FT                   /locus_tag="mCG_16210"
FT                   /product="trinucleotide repeat containing 15, isoform
FT                   CRA_g"
FT                   /note="gene_id=mCG16210.2 transcript_id=mCT193761.0
FT                   protein_id=mCP114743.0 isoform=CRA_g"
FT                   /protein_id="EDL40170.1"
FT                   /translation="DSRTFEQVSLHIKIFSKIRRRMAAETQTLNFGPEWLRALSSGGSI
FT                   TSPPLSPALPKYKLADYRYGREEMLALFLKDYKIPFDLLEKEFLPILQEEPLPPLALVP
FT                   FTEEEQRNFSMSVNSAAVLRLTGRGGGGGTVVGAPRGRSSSRGRGRGRGECGFYQRSFD
FT                   EVEGVFGRGGGREMHRSQSWEERGDRRFEKPGRKDVGRPNFEESGPTSVGRKHEFIRSE
FT                   SENWRIFREEQNGEDEDGGWRLAGSRRDGERWRPHSPGWREHMERRRRFEFDFRDRDDE
FT                   RGYRRVRSGSGSIDDDRDSLPEWCLEDAEEEMGTFDSSGAFLSLKKVQKEPIPEEQEMD
FT                   FRPVEEGEERSDSDSSHNEEAKEPDKTNRREGEKTDRAGAASEEVPQTSLSSARPGTPS
FT                   DHQPQEATQFERKDEPKAEQVEKAEEENRSENSLSAKVPSRGDETVPASQQPSTPLPPD
FT                   TASPLLILSPPVPTPSSASRPVETAAVEAPGMSSVSTEPDDEEGLKHLEQQAEKMVAYL
FT                   QDSALDDERLTSKLQEHRAKGVSIPLMHEAMQKWYYKDPQGEIQGPFNNQEMAEWFQAG
FT                   YFTMSLLVKRACDESFQPLGDIMKMWGRVPFSPGPAPPPHMGELDQERLTRQQELTALY
FT                   QMQHLQYQQFLIQQQYAQVLAQQQKAALSSQQQQQLALLLQQFQALKMRMSDQNIIPSV
FT                   TRSVSVPDTGSIWELQPAASQPAVWEGGSVWDLPLDTTAPGPSLEQLQQLEKAKAAKLE
FT                   QERREAEMRAKREEEERKRQEELRRQQEEILRRQQEEERKRREEEELARRKQEEALRRQ
FT                   REQEIALRRQREEEERQQQEEALRRLEERRREEEERRKQEELLRKQEEEAAKWAREEEE
FT                   AQRRLEENRLRMEEEAARLRH"
FT   assembly_gap    1730111..1730130
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(1748821..1748861,1758567..1758696,1759647..1759742,
FT                   1768460..1768574,1773440..1773551,1774436..1774476,
FT                   1798138..1798317,1801451..1801668,1801760..1801922,
FT                   1802002..1802190,1805129..1805325,1806175..1806334,
FT                   1811302..1811468,1813573..1813664,1814772..1814879,
FT                   1815879..1815979,1817567..1817667,1819451..1819612,
FT                   1822955..1823113,1828087..1828323,1831128..1831250,
FT                   1834775..1834999,1835104..1835309,1836398..1836552,
FT                   1838032..1838213,1840699..1840846,1843465..1843532)
FT                   /codon_start=1
FT                   /gene="Tnrc15"
FT                   /locus_tag="mCG_16210"
FT                   /product="trinucleotide repeat containing 15, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG16210.2 transcript_id=mCT16422.2
FT                   protein_id=mCP15642.2 isoform=CRA_a"
FT                   /protein_id="EDL40164.1"
FT                   /translation="MAAETQTLNFGPEWLRALSSGGSITSPPLSPALPKYKLADYRYGR
FT                   EEMLALFLKDYKIPFDLLEKEFLPILQEEPLPPLALVPFTEEEQRNFSMSVNSAAVLRL
FT                   TGRGGGGGTVVGAPRGRSSSRGRGRGRGECGFYQRSFDEVEGVFGRGGGREMHRSQSWE
FT                   ERGDRRFEKPGRKDVGRPNFEESGPTSVGRKHEFIRSESENWRIFREEQNGEDEDGGWR
FT                   LAGSRRDGERWRPHSPDGPRSTGWREHMERRRRFEFDFRDRDDERGYRRVRSGSGSIDD
FT                   DRDSLPEWCLEDAEEEMGTFDSSGAFLSLKKVQKEPIPEEQEMDFRPVEEGEERSDSDS
FT                   SHNEEAKEPDKTNRREGEKTDRAGAEASEEVPQTSLSSARPGTPSDHQPQEATQFERKD
FT                   EPKAEQVEKAEEENRSENSLSAKVPSRGDETVPASQQPSTPLPPDTASPLLILSPPVPT
FT                   PSSASRPVETAAVEAPGMSSVSTEPDDEEGLKHLEQQAEKMVAYLQDSALDDERLTSKL
FT                   QEHRAKGVSIPLMHEAMQKWYYKDPQGEIQGPFNNQEMAEWFQAGYFTMSLLVKRACDE
FT                   SFQPLGDIMKMWGRVPFSPGPAPPPHMGELDQERLTRQQELTALYQMQHLQYQQFLIQQ
FT                   QYAQVLAQQQKAALSSQQQQQLALLLQQFQALKMRMSDQNIIPSVTRSVSVPDTGSIWE
FT                   LQPAASQPAVWEGGSVWDLPLDTTAPGPSLEQLQQLEKAKAAKLEQERREAEMRAKREE
FT                   EERKRQEELRRQQEEILRRQQEEERKRREEEELARRKQEEALRRQREQEIALRRQREEE
FT                   ERQQQEEALRRLEERRREEEERRKQEELLRKQEEEAAKWAREEEEAQRRLEENRLRMEE
FT                   EAARLRHEEEERKRKELELQRQKDLMRQRQQQQEALRRLQQQQQQQQLAQMKLPSSSTW
FT                   GQQSNTATCQSQATLSLAEIQKLEEERERQLREEQRRQQRELMKALQQQQQQQQQQKLS
FT                   GWGNVSKPAGTTKSLLEIQQEEARQMQKQQQQQQQQQQQHQQSNRARNSTHSNLHTSLG
FT                   NSVWGSINTGPSNQWASELVSSIWSNADTKNSNMGFWDDAVKEVGPRNSTNKNKNNASL
FT                   SKSVGVSNRQNKKVEEEEKLLKLFQGVNKAQDGFTQWCEQMLHALNTANNLDVPTFVSF
FT                   LKEVESPYEVHDYTRAYLGDTSEAKEFAKQFLERRAKQKVNQQRQQQQQQQQQQDSVWG
FT                   MNHSTLHSVFQTNQSNNQQSNFEAVQSGKKKKKQKMVRADPSLLGFSVNASSERLNMGE
FT                   IETLDDY"
FT   CDS             join(1748821..1748861,1758567..1758696,1759647..1759742,
FT                   1768460..1768574,1798138..1798317,1801469..1801668,
FT                   1801760..1801922,1802002..1802190,1805129..1805325,
FT                   1806175..1806334,1811302..1811468,1813573..1813664,
FT                   1814772..1814879,1815879..1815979,1817567..1817667,
FT                   1819451..1819612,1822955..1823113,1828087..1828323,
FT                   1831128..1831250,1834775..1834999,1835104..1835309,
FT                   1836398..1836552,1838032..1838213,1840699..1840846,
FT                   1843465..1843532)
FT                   /codon_start=1
FT                   /gene="Tnrc15"
FT                   /locus_tag="mCG_16210"
FT                   /product="trinucleotide repeat containing 15, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG16210.2 transcript_id=mCT177942.0
FT                   protein_id=mCP100864.0 isoform=CRA_b"
FT                   /protein_id="EDL40165.1"
FT                   /translation="MAAETQTLNFGPEWLRALSSGGSITSPPLSPALPKYKLADYRYGR
FT                   EEMLALFLKDYKIPFDLLEKEFLPILQEEPLPPLALVPFTEEEQRNFSMSVNSAAVLRL
FT                   TGRGGGGGTVVGAPRGRSSSRGRGRPNFEESGPTSVGRKHEFIRSESENWRIFREEQNG
FT                   EDEDGGWRLAGSRRDGERWRPHSPGWREHMERRRRFEFDFRDRDDERGYRRVRSGSGSI
FT                   DDDRDSLPEWCLEDAEEEMGTFDSSGAFLSLKKVQKEPIPEEQEMDFRPVEEGEERSDS
FT                   DSSHNEEAKEPDKTNRREGEKTDRAGAEASEEVPQTSLSSARPGTPSDHQPQEATQFER
FT                   KDEPKAEQVEKAEEENRSENSLSAKVPSRGDETVPASQQPSTPLPPDTASPLLILSPPV
FT                   PTPSSASRPVETAAVEAPGMSSVSTEPDDEEGLKHLEQQAEKMVAYLQDSALDDERLTS
FT                   KLQEHRAKGVSIPLMHEAMQKWYYKDPQGEIQGPFNNQEMAEWFQAGYFTMSLLVKRAC
FT                   DESFQPLGDIMKMWGRVPFSPGPAPPPHMGELDQERLTRQQELTALYQMQHLQYQQFLI
FT                   QQQYAQVLAQQQKAALSSQQQQQLALLLQQFQALKMRMSDQNIIPSVTRSVSVPDTGSI
FT                   WELQPAASQPAVWEGGSVWDLPLDTTAPGPSLEQLQQLEKAKAAKLEQERREAEMRAKR
FT                   EEEERKRQEELRRQQEEILRRQQEEERKRREEEELARRKQEEALRRQREQEIALRRQRE
FT                   EEERQQQEEALRRLEERRREEEERRKQEELLRKQEEEAAKWAREEEEAQRRLEENRLRM
FT                   EEEAARLRHEEEERKRKELELQRQKDLMRQRQQQQEALRRLQQQQQQQQLAQMKLPSSS
FT                   TWGQQSNTATCQSQATLSLAEIQKLEEERERQLREEQRRQQRELMKALQQQQQQQQQQK
FT                   LSGWGNVSKPAGTTKSLLEIQQEEARQMQKQQQQQQQQQQQHQQSNRARNSTHSNLHTS
FT                   LGNSVWGSINTGPSNQWASELVSSIWSNADTKNSNMGFWDDAVKEVGPRNSTNKNKNNA
FT                   SLSKSVGVSNRQNKKVEEEEKLLKLFQGVNKAQDGFTQWCEQMLHALNTANNLDVPTFV
FT                   SFLKEVESPYEVHDYTRAYLGDTSEAKEFAKQFLERRAKQKVNQQRQQQQQQQQQQDSV
FT                   WGMNHSTLHSVFQTNQSNNQQSNFEAVQSGKKKKKQKMVRADPSLLGFSVNASSERLNM
FT                   GEIETLDDY"
FT   CDS             join(1748821..1748861,1758567..1758696,1759647..1759742,
FT                   1768460..1768574,1798138..1798317,1801469..1801668,
FT                   1801760..1801922,1802002..1802190,1805129..1805325,
FT                   1806175..1806334,1811302..1811468,1813573..1813664,
FT                   1814772..1814879,1815879..1816029)
FT                   /codon_start=1
FT                   /gene="Tnrc15"
FT                   /locus_tag="mCG_16210"
FT                   /product="trinucleotide repeat containing 15, isoform
FT                   CRA_f"
FT                   /note="gene_id=mCG16210.2 transcript_id=mCT177947.0
FT                   protein_id=mCP100869.0 isoform=CRA_f"
FT                   /protein_id="EDL40169.1"
FT                   /translation="MAAETQTLNFGPEWLRALSSGGSITSPPLSPALPKYKLADYRYGR
FT                   EEMLALFLKDYKIPFDLLEKEFLPILQEEPLPPLALVPFTEEEQRNFSMSVNSAAVLRL
FT                   TGRGGGGGTVVGAPRGRSSSRGRGRPNFEESGPTSVGRKHEFIRSESENWRIFREEQNG
FT                   EDEDGGWRLAGSRRDGERWRPHSPGWREHMERRRRFEFDFRDRDDERGYRRVRSGSGSI
FT                   DDDRDSLPEWCLEDAEEEMGTFDSSGAFLSLKKVQKEPIPEEQEMDFRPVEEGEERSDS
FT                   DSSHNEEAKEPDKTNRREGEKTDRAGAEASEEVPQTSLSSARPGTPSDHQPQEATQFER
FT                   KDEPKAEQVEKAEEENRSENSLSAKVPSRGDETVPASQQPSTPLPPDTASPLLILSPPV
FT                   PTPSSASRPVETAAVEAPGMSSVSTEPDDEEGLKHLEQQAEKMVAYLQDSALDDERLTS
FT                   KLQEHRAKGVSIPLMHEAMQKWYYKDPQGEIQGPFNNQEMAEWFQAGYFTMSLLVKRAC
FT                   DESFQPLGDIMKMWGRVPFSPGPAPPPHMGELDQERLTRQQELTALYQMQHLQYQQFLI
FT                   QQQYAQVLAQQQKAALSSQQQQQLALLLQQFQALKMRMSDQNIIPSVTRSVSVPDTGSI
FT                   WELQPAASQPAGKNLTLLMLQLNGFRM"
FT   CDS             join(1748821..1748861,1749346..1749397)
FT                   /codon_start=1
FT                   /gene="Tnrc15"
FT                   /locus_tag="mCG_16210"
FT                   /product="trinucleotide repeat containing 15, isoform
FT                   CRA_h"
FT                   /note="gene_id=mCG16210.2 transcript_id=mCT177946.0
FT                   protein_id=mCP100867.0 isoform=CRA_h"
FT                   /protein_id="EDL40171.1"
FT                   /translation="MAAETQTLNFGPECLLQICLDPEYGILMEF"
FT   assembly_gap    1753888..1753907
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1754983..1755184
FT                   /estimated_length=202
FT                   /gap_type="unknown"
FT   mRNA            join(1758264..1758696,1759647..1759742,1768460..1768574,
FT                   1773440..1773551,1774436..1774476,1798138..1798317,
FT                   1801451..1801668,1801760..1801922,1802002..1802190,
FT                   1805129..1805325,1806175..1806334,1811302..1811468,
FT                   1813573..1813664,1814772..1814879,1815879..1815979,
FT                   1817567..1817667,1819451..1819612,1822955..1823113,
FT                   1828087..1828323,1831128..1831250,1834775..1834999,
FT                   1835104..1835309,1836398..1836552,1838032..1838213,
FT                   1840699..1840846,1843465..1845164)
FT                   /gene="Tnrc15"
FT                   /locus_tag="mCG_16210"
FT                   /product="trinucleotide repeat containing 15, transcript
FT                   variant mCT177944"
FT                   /note="gene_id=mCG16210.2 transcript_id=mCT177944.0 created
FT                   on 02-JAN-2003"
FT   CDS             join(1758667..1758696,1759647..1759742,1768460..1768574,
FT                   1773440..1773551,1774436..1774476,1798138..1798317,
FT                   1801451..1801668,1801760..1801922,1802002..1802190,
FT                   1805129..1805325,1806175..1806334,1811302..1811468,
FT                   1813573..1813664,1814772..1814879,1815879..1815979,
FT                   1817567..1817667,1819451..1819612,1822955..1823113,
FT                   1828087..1828323,1831128..1831250,1834775..1834999,
FT                   1835104..1835309,1836398..1836552,1838032..1838213,
FT                   1840699..1840846,1843465..1843532)
FT                   /codon_start=1
FT                   /gene="Tnrc15"
FT                   /locus_tag="mCG_16210"
FT                   /product="trinucleotide repeat containing 15, isoform
FT                   CRA_d"
FT                   /note="gene_id=mCG16210.2 transcript_id=mCT177944.0
FT                   protein_id=mCP100866.0 isoform=CRA_d"
FT                   /protein_id="EDL40167.1"
FT                   /translation="MLALFLKDYKIPFDLLEKEFLPILQEEPLPPLALVPFTEEEQRNF
FT                   SMSVNSAAVLRLTGRGGGGGTVVGAPRGRSSSRGRGRGRGECGFYQRSFDEVEGVFGRG
FT                   GGREMHRSQSWEERGDRRFEKPGRKDVGRPNFEESGPTSVGRKHEFIRSESENWRIFRE
FT                   EQNGEDEDGGWRLAGSRRDGERWRPHSPDGPRSTGWREHMERRRRFEFDFRDRDDERGY
FT                   RRVRSGSGSIDDDRDSLPEWCLEDAEEEMGTFDSSGAFLSLKKVQKEPIPEEQEMDFRP
FT                   VEEGEERSDSDSSHNEEAKEPDKTNRREGEKTDRAGAEASEEVPQTSLSSARPGTPSDH
FT                   QPQEATQFERKDEPKAEQVEKAEEENRSENSLSAKVPSRGDETVPASQQPSTPLPPDTA
FT                   SPLLILSPPVPTPSSASRPVETAAVEAPGMSSVSTEPDDEEGLKHLEQQAEKMVAYLQD
FT                   SALDDERLTSKLQEHRAKGVSIPLMHEAMQKWYYKDPQGEIQGPFNNQEMAEWFQAGYF
FT                   TMSLLVKRACDESFQPLGDIMKMWGRVPFSPGPAPPPHMGELDQERLTRQQELTALYQM
FT                   QHLQYQQFLIQQQYAQVLAQQQKAALSSQQQQQLALLLQQFQALKMRMSDQNIIPSVTR
FT                   SVSVPDTGSIWELQPAASQPAVWEGGSVWDLPLDTTAPGPSLEQLQQLEKAKAAKLEQE
FT                   RREAEMRAKREEEERKRQEELRRQQEEILRRQQEEERKRREEEELARRKQEEALRRQRE
FT                   QEIALRRQREEEERQQQEEALRRLEERRREEEERRKQEELLRKQEEEAAKWAREEEEAQ
FT                   RRLEENRLRMEEEAARLRHEEEERKRKELELQRQKDLMRQRQQQQEALRRLQQQQQQQQ
FT                   LAQMKLPSSSTWGQQSNTATCQSQATLSLAEIQKLEEERERQLREEQRRQQRELMKALQ
FT                   QQQQQQQQQKLSGWGNVSKPAGTTKSLLEIQQEEARQMQKQQQQQQQQQQQHQQSNRAR
FT                   NSTHSNLHTSLGNSVWGSINTGPSNQWASELVSSIWSNADTKNSNMGFWDDAVKEVGPR
FT                   NSTNKNKNNASLSKSVGVSNRQNKKVEEEEKLLKLFQGVNKAQDGFTQWCEQMLHALNT
FT                   ANNLDVPTFVSFLKEVESPYEVHDYTRAYLGDTSEAKEFAKQFLERRAKQKVNQQRQQQ
FT                   QQQQQQQDSVWGMNHSTLHSVFQTNQSNNQQSNFEAVQSGKKKKKQKMVRADPSLLGFS
FT                   VNASSERLNMGEIETLDDY"
FT   assembly_gap    1763317..1763475
FT                   /estimated_length=159
FT                   /gap_type="unknown"
FT   CDS             join(1773523..1773551,1774436..1774476,1798138..1798317,
FT                   1801451..1801668,1801760..1801922,1802002..1802190,
FT                   1805129..1805325,1806175..1806334,1811302..1811468,
FT                   1813573..1813664,1814772..1814879,1815879..1815979,
FT                   1817567..1817667,1819451..1819612,1822955..1823113,
FT                   1828087..1828323,1831128..1831250,1834775..1834999,
FT                   1835104..1835309,1836398..1836552,1838032..1838213,
FT                   1840699..1840846,1843465..1843532)
FT                   /codon_start=1
FT                   /gene="Tnrc15"
FT                   /locus_tag="mCG_16210"
FT                   /product="trinucleotide repeat containing 15, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG16210.2 transcript_id=mCT177943.0
FT                   protein_id=mCP100868.0 isoform=CRA_c"
FT                   /protein_id="EDL40166.1"
FT                   /translation="MHRSQSWEERGDRRFEKPGRKDVGRPNFEESGPTSVGRKHEFIRS
FT                   ESENWRIFREEQNGEDEDGGWRLAGSRRDGERWRPHSPDGPRSTGWREHMERRRRFEFD
FT                   FRDRDDERGYRRVRSGSGSIDDDRDSLPEWCLEDAEEEMGTFDSSGAFLSLKKVQKEPI
FT                   PEEQEMDFRPVEEGEERSDSDSSHNEEAKEPDKTNRREGEKTDRAGAEASEEVPQTSLS
FT                   SARPGTPSDHQPQEATQFERKDEPKAEQVEKAEEENRSENSLSAKVPSRGDETVPASQQ
FT                   PSTPLPPDTASPLLILSPPVPTPSSASRPVETAAVEAPGMSSVSTEPDDEEGLKHLEQQ
FT                   AEKMVAYLQDSALDDERLTSKLQEHRAKGVSIPLMHEAMQKWYYKDPQGEIQGPFNNQE
FT                   MAEWFQAGYFTMSLLVKRACDESFQPLGDIMKMWGRVPFSPGPAPPPHMGELDQERLTR
FT                   QQELTALYQMQHLQYQQFLIQQQYAQVLAQQQKAALSSQQQQQLALLLQQFQALKMRMS
FT                   DQNIIPSVTRSVSVPDTGSIWELQPAASQPAVWEGGSVWDLPLDTTAPGPSLEQLQQLE
FT                   KAKAAKLEQERREAEMRAKREEEERKRQEELRRQQEEILRRQQEEERKRREEEELARRK
FT                   QEEALRRQREQEIALRRQREEEERQQQEEALRRLEERRREEEERRKQEELLRKQEEEAA
FT                   KWAREEEEAQRRLEENRLRMEEEAARLRHEEEERKRKELELQRQKDLMRQRQQQQEALR
FT                   RLQQQQQQQQLAQMKLPSSSTWGQQSNTATCQSQATLSLAEIQKLEEERERQLREEQRR
FT                   QQRELMKALQQQQQQQQQQKLSGWGNVSKPAGTTKSLLEIQQEEARQMQKQQQQQQQQQ
FT                   QQHQQSNRARNSTHSNLHTSLGNSVWGSINTGPSNQWASELVSSIWSNADTKNSNMGFW
FT                   DDAVKEVGPRNSTNKNKNNASLSKSVGVSNRQNKKVEEEEKLLKLFQGVNKAQDGFTQW
FT                   CEQMLHALNTANNLDVPTFVSFLKEVESPYEVHDYTRAYLGDTSEAKEFAKQFLERRAK
FT                   QKVNQQRQQQQQQQQQQDSVWGMNHSTLHSVFQTNQSNNQQSNFEAVQSGKKKKKQKMV
FT                   RADPSLLGFSVNASSERLNMGEIETLDDY"
FT   gene            complement(1780758..1789173)
FT                   /locus_tag="mCG_16200"
FT                   /note="gene_id=mCG16200.1"
FT   mRNA            complement(join(1780758..1781511,1783403..1783878,
FT                   1789079..1789173))
FT                   /locus_tag="mCG_16200"
FT                   /product="mCG16200"
FT                   /note="gene_id=mCG16200.1 transcript_id=mCT16279.1 created
FT                   on 04-FEB-2003"
FT   CDS             complement(join(1780889..1781511,1783403..1783862))
FT                   /codon_start=1
FT                   /locus_tag="mCG_16200"
FT                   /product="mCG16200"
FT                   /note="gene_id=mCG16200.1 transcript_id=mCT16279.1
FT                   protein_id=mCP15666.1"
FT                   /protein_id="EDL40172.1"
FT                   /translation="MDSSNCKVNAPLLSQRHRRMVTKDGHSTLQMDGAQRGLVYLRDAW
FT                   GILMDMRWRWMMLVFSASFVVHWLVFAVLWYAVAEMNGDLEIDHDVPPENHTICVKHIT
FT                   SFTAAFSFSLETQLTIGYGTMFPSGDCPSAIALLAIQMLLGLMLEAFITGAFVAKIARP
FT                   KNRAFSIRFTDLAVVAHKDGKPNLIFQVANTRPSPLTNVRVSAVLYQERENGELYQTSV
FT                   DFHLDGISSEECPFFIFPLTYYHTISPSSPLATLLQHETPPHFELVVFLSAMQEGTGEI
FT                   CQRRTSYLPSEIMLHHRFAALMTRGSKGEYQVKMENFDKTVPEHPTPVVSKSPHRTDLD
FT                   IHINGQSIDNFQIAETGLTE"
FT   assembly_gap    1810412..1810431
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1815262..1815471
FT                   /estimated_length=210
FT                   /gap_type="unknown"
FT   assembly_gap    1827344..1827363
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            join(1827527..1827605,1828087..1828323,1831128..1831250,
FT                   1834775..1834999,1835104..1835309,1836398..1836552,
FT                   1838032..1838213,1840699..1840846,1843465..1845164)
FT                   /gene="Tnrc15"
FT                   /locus_tag="mCG_16210"
FT                   /product="trinucleotide repeat containing 15, transcript
FT                   variant mCT177945"
FT                   /note="gene_id=mCG16210.2 transcript_id=mCT177945.0 created
FT                   on 02-JAN-2003"
FT   CDS             join(1828159..1828323,1831128..1831250,1834775..1834999,
FT                   1835104..1835309,1836398..1836552,1838032..1838213,
FT                   1840699..1840846,1843465..1843532)
FT                   /codon_start=1
FT                   /gene="Tnrc15"
FT                   /locus_tag="mCG_16210"
FT                   /product="trinucleotide repeat containing 15, isoform
FT                   CRA_e"
FT                   /note="gene_id=mCG16210.2 transcript_id=mCT177945.0
FT                   protein_id=mCP100865.0 isoform=CRA_e"
FT                   /protein_id="EDL40168.1"
FT                   /translation="MEEEAARLRHEEEERKRKELELQRQKDLMRQRQQQQEALRRLQQQ
FT                   QQQQQLAQMKLPSSSTWGQQSNTATCQSQATLSLAEIQKLEEERERQLREEQRRQQREL
FT                   MKALQQQQQQQQQQKLSGWGNVSKPAGTTKSLLEIQQEEARQMQKQQQQQQQQQQQHQQ
FT                   SNRARNSTHSNLHTSLGNSVWGSINTGPSNQWASELVSSIWSNADTKNSNMGFWDDAVK
FT                   EVGPRNSTNKNKNNASLSKSVGVSNRQNKKVEEEEKLLKLFQGVNKAQDGFTQWCEQML
FT                   HALNTANNLDVPTFVSFLKEVESPYEVHDYTRAYLGDTSEAKEFAKQFLERRAKQKVNQ
FT                   QRQQQQQQQQQQDSVWGMNHSTLHSVFQTNQSNNQQSNFEAVQSGKKKKKQKMVRADPS
FT                   LLGFSVNASSERLNMGEIETLDDY"
FT   assembly_gap    1831973..1831992
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1833940..1834010
FT                   /estimated_length=71
FT                   /gap_type="unknown"
FT   assembly_gap    1857038..1857119
FT                   /estimated_length=82
FT                   /gap_type="unknown"
FT   gene            1857352..1862970
FT                   /locus_tag="mCG_16208"
FT                   /note="gene_id=mCG16208.2"
FT   mRNA            join(1857352..1857505,1862118..1862301,1862425..1862970)
FT                   /locus_tag="mCG_16208"
FT                   /product="mCG16208"
FT                   /note="gene_id=mCG16208.2 transcript_id=mCT16420.2 created
FT                   on 04-FEB-2003"
FT   CDS             join(1857433..1857505,1862118..1862301,1862425..1862902)
FT                   /codon_start=1
FT                   /locus_tag="mCG_16208"
FT                   /product="mCG16208"
FT                   /note="gene_id=mCG16208.2 transcript_id=mCT16420.2
FT                   protein_id=mCP15671.2"
FT                   /protein_id="EDL40163.1"
FT                   /translation="MASCLALRVALLLISGVLAPAVLTAEGPQEPDPTLWNEPIELPSG
FT                   EGPLESTSHNQEFAVSGPPFPTSAPAPEDSTPSCQGGPGWRIAWTRRHCSHRDRCPAGY
FT                   LRGAGTRGRRAKEVFRFLKPIKEPHRPARGDSASCALLCPLRIPACASPCAGAAACEPG
FT                   WGRIAGPRRVPGGSWVAGREHVHAWSRACVAPRVSECRAPERKCLLSTTHCVPCCAPTA
FT                   VCLSAPPPAPATTPGPKRFRLV"
FT   gene            complement(1863933..1961328)
FT                   /gene="Ngef"
FT                   /locus_tag="mCG_16215"
FT                   /note="gene_id=mCG16215.2"
FT   mRNA            complement(join(1863933..1864839,1866198..1866302,
FT                   1866932..1867011,1867682..1867837,1868211..1868374,
FT                   1869726..1869815,1871695..1871769,1873252..1873381,
FT                   1874896..1875048,1876681..1876841,1890329..1890636,
FT                   1896578..1896720,1928095..1928209,1933252..1933586,
FT                   1961155..1961328))
FT                   /gene="Ngef"
FT                   /locus_tag="mCG_16215"
FT                   /product="neuronal guanine nucleotide exchange factor,
FT                   transcript variant mCT177955"
FT                   /note="gene_id=mCG16215.2 transcript_id=mCT177955.0 created
FT                   on 02-JAN-2003"
FT   mRNA            complement(join(1863933..1864839,1866198..1866302,
FT                   1866932..1867011,1867682..1867837,1868211..1868374,
FT                   1869726..1869815,1871695..1871769,1873252..1873381,
FT                   1874896..1875048,1876681..1876841,1890329..1890636,
FT                   1896578..1896720,1928095..1928209,1933252..1933586,
FT                   1949952..1950090,1961155..1961265))
FT                   /gene="Ngef"
FT                   /locus_tag="mCG_16215"
FT                   /product="neuronal guanine nucleotide exchange factor,
FT                   transcript variant mCT177956"
FT                   /note="gene_id=mCG16215.2 transcript_id=mCT177956.0 created
FT                   on 02-JAN-2003"
FT   mRNA            complement(join(1863933..1864839,1866198..1866302,
FT                   1866932..1867011,1867682..1867837,1868211..1868374,
FT                   1869726..1869815,1871695..1871769,1873252..1873381,
FT                   1874896..1875048,1876681..1876841,1890329..1890636,
FT                   1896578..1896720,1897426..1897601,1897683..1897753))
FT                   /gene="Ngef"
FT                   /locus_tag="mCG_16215"
FT                   /product="neuronal guanine nucleotide exchange factor,
FT                   transcript variant mCT16427"
FT                   /note="gene_id=mCG16215.2 transcript_id=mCT16427.1 created
FT                   on 02-JAN-2003"
FT   CDS             complement(join(1864649..1864839,1866198..1866302,
FT                   1866932..1867011,1867682..1867837,1868211..1868374,
FT                   1869726..1869815,1871695..1871769,1873252..1873381,
FT                   1874896..1875048,1876681..1876841,1890329..1890636,
FT                   1896578..1896720,1928095..1928209,1933252..1933513))
FT                   /codon_start=1
FT                   /gene="Ngef"
FT                   /locus_tag="mCG_16215"
FT                   /product="neuronal guanine nucleotide exchange factor,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG16215.2 transcript_id=mCT177955.0
FT                   protein_id=mCP100879.0 isoform=CRA_a"
FT                   /protein_id="EDL40159.1"
FT                   /translation="METKNSEDWGKPQRKSESSSRKSNHGPAEMRPALPPENREAPETG
FT                   EETQNEEPRRLIPIQRHSLFNRAVRHRHKARSTSERRASDQADLPKMGKSVNERSAFNL
FT                   PQGRLSPWRTPAQRDTGAQEASESSSTPGNGTTPEECPALTDSPTTLTEALQMIHPIPA
FT                   DSWRNLIEQIGLLYQEYRDKSTLQEIETRRQQDAEIQGNSDGSQVGEDAGEEEEEEEEG
FT                   EEEELASPPERRALPQICLLSNPHSRFNLWQDLPEIQSSGVLDILQPEEIRLQEAMFEL
FT                   VTSEASYYKSLNLLVSHFMENERLKKILHPSEAHILFSNVLDVMAVSERFLLELEHRME
FT                   ENIVISDVCDIVYRYAADHFSVYITYVSNQTYQERTYKQLLQEKAAFRELIAQLELDPK
FT                   CKGLPFSSFLILPFQRITRLKLLVQNILKRVEERSEREGTALDAHKELEMVVKACNEGV
FT                   RKMSRTEQMISIQKKMEFKIKSVPIISHSRWLLKQGELQQMSGPKTSRTLRTKKLFREI
FT                   YLFLFNDLLVICRQIPGDKYQVFDSAPRGLLRVEELEDQGQTLANVFILRLLENADDRE
FT                   ATYMLKASSQSEMKRWMTSLAPNRRTKFVSFTSRLLDCPQVQCVHPYVAQQPDELTLEL
FT                   ADILNILEKTEDGWIFGERLHDQERGWFPSSMTEEILNPKIRSQNLKECFRVHKMEDPQ
FT                   RSQNKDRRKLGSRNRQ"
FT   CDS             complement(join(1864649..1864839,1866198..1866302,
FT                   1866932..1867011,1867682..1867837,1868211..1868374,
FT                   1869726..1869815,1871695..1871769,1873252..1873381,
FT                   1874896..1875048,1876681..1876841,1890329..1890636,
FT                   1896578..1896720,1928095..1928209,1933252..1933513))
FT                   /codon_start=1
FT                   /gene="Ngef"
FT                   /locus_tag="mCG_16215"
FT                   /product="neuronal guanine nucleotide exchange factor,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG16215.2 transcript_id=mCT177956.0
FT                   protein_id=mCP100877.0 isoform=CRA_a"
FT                   /protein_id="EDL40160.1"
FT                   /translation="METKNSEDWGKPQRKSESSSRKSNHGPAEMRPALPPENREAPETG
FT                   EETQNEEPRRLIPIQRHSLFNRAVRHRHKARSTSERRASDQADLPKMGKSVNERSAFNL
FT                   PQGRLSPWRTPAQRDTGAQEASESSSTPGNGTTPEECPALTDSPTTLTEALQMIHPIPA
FT                   DSWRNLIEQIGLLYQEYRDKSTLQEIETRRQQDAEIQGNSDGSQVGEDAGEEEEEEEEG
FT                   EEEELASPPERRALPQICLLSNPHSRFNLWQDLPEIQSSGVLDILQPEEIRLQEAMFEL
FT                   VTSEASYYKSLNLLVSHFMENERLKKILHPSEAHILFSNVLDVMAVSERFLLELEHRME
FT                   ENIVISDVCDIVYRYAADHFSVYITYVSNQTYQERTYKQLLQEKAAFRELIAQLELDPK
FT                   CKGLPFSSFLILPFQRITRLKLLVQNILKRVEERSEREGTALDAHKELEMVVKACNEGV
FT                   RKMSRTEQMISIQKKMEFKIKSVPIISHSRWLLKQGELQQMSGPKTSRTLRTKKLFREI
FT                   YLFLFNDLLVICRQIPGDKYQVFDSAPRGLLRVEELEDQGQTLANVFILRLLENADDRE
FT                   ATYMLKASSQSEMKRWMTSLAPNRRTKFVSFTSRLLDCPQVQCVHPYVAQQPDELTLEL
FT                   ADILNILEKTEDGWIFGERLHDQERGWFPSSMTEEILNPKIRSQNLKECFRVHKMEDPQ
FT                   RSQNKDRRKLGSRNRQ"
FT   CDS             complement(join(1864649..1864839,1866198..1866302,
FT                   1866932..1867011,1867682..1867837,1868211..1868374,
FT                   1869726..1869815,1871695..1871769,1873252..1873381,
FT                   1874896..1875048,1876681..1876841,1890329..1890636,
FT                   1896578..1896629))
FT                   /codon_start=1
FT                   /gene="Ngef"
FT                   /locus_tag="mCG_16215"
FT                   /product="neuronal guanine nucleotide exchange factor,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG16215.2 transcript_id=mCT16427.1
FT                   protein_id=mCP15634.2 isoform=CRA_c"
FT                   /protein_id="EDL40162.1"
FT                   /translation="MIHPIPADSWRNLIEQIGLLYQEYRDKSTLQEIETRRQQDAEIQG
FT                   NSDGSQVGEDAGEEEEEEEEGEEEELASPPERRALPQICLLSNPHSRFNLWQDLPEIQS
FT                   SGVLDILQPEEIRLQEAMFELVTSEASYYKSLNLLVSHFMENERLKKILHPSEAHILFS
FT                   NVLDVMAVSERFLLELEHRMEENIVISDVCDIVYRYAADHFSVYITYVSNQTYQERTYK
FT                   QLLQEKAAFRELIAQLELDPKCKGLPFSSFLILPFQRITRLKLLVQNILKRVEERSERE
FT                   GTALDAHKELEMVVKACNEGVRKMSRTEQMISIQKKMEFKIKSVPIISHSRWLLKQGEL
FT                   QQMSGPKTSRTLRTKKLFREIYLFLFNDLLVICRQIPGDKYQVFDSAPRGLLRVEELED
FT                   QGQTLANVFILRLLENADDREATYMLKASSQSEMKRWMTSLAPNRRTKFVSFTSRLLDC
FT                   PQVQCVHPYVAQQPDELTLELADILNILEKTEDGWIFGERLHDQERGWFPSSMTEEILN
FT                   PKIRSQNLKECFRVHKMEDPQRSQNKDRRKLGSRNRQ"
FT   mRNA            complement(join(1865808..1866302,1866932..1867011,
FT                   1867682..1867837,1868211..1868374,1869726..1869815,
FT                   1871695..1871769,1873252..1873381,1874896..1875048,
FT                   1876681..1876841,1890329..1890636,1896578..1896720,
FT                   1897426..1897601,1897683..1897753))
FT                   /gene="Ngef"
FT                   /locus_tag="mCG_16215"
FT                   /product="neuronal guanine nucleotide exchange factor,
FT                   transcript variant mCT177957"
FT                   /note="gene_id=mCG16215.2 transcript_id=mCT177957.0 created
FT                   on 02-JAN-2003"
FT   CDS             complement(join(1866154..1866302,1866932..1867011,
FT                   1867682..1867837,1868211..1868374,1869726..1869815,
FT                   1871695..1871769,1873252..1873381,1874896..1875048,
FT                   1876681..1876841,1890329..1890636,1896578..1896629))
FT                   /codon_start=1
FT                   /gene="Ngef"
FT                   /locus_tag="mCG_16215"
FT                   /product="neuronal guanine nucleotide exchange factor,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG16215.2 transcript_id=mCT177957.0
FT                   protein_id=mCP100878.0 isoform=CRA_b"
FT                   /protein_id="EDL40161.1"
FT                   /translation="MIHPIPADSWRNLIEQIGLLYQEYRDKSTLQEIETRRQQDAEIQG
FT                   NSDGSQVGEDAGEEEEEEEEGEEEELASPPERRALPQICLLSNPHSRFNLWQDLPEIQS
FT                   SGVLDILQPEEIRLQEAMFELVTSEASYYKSLNLLVSHFMENERLKKILHPSEAHILFS
FT                   NVLDVMAVSERFLLELEHRMEENIVISDVCDIVYRYAADHFSVYITYVSNQTYQERTYK
FT                   QLLQEKAAFRELIAQLELDPKCKGLPFSSFLILPFQRITRLKLLVQNILKRVEERSERE
FT                   GTALDAHKELEMVVKACNEGVRKMSRTEQMISIQKKMEFKIKSVPIISHSRWLLKQGEL
FT                   QQMSGPKTSRTLRTKKLFREIYLFLFNDLLVICRQIPGDKYQVFDSAPRGLLRVEELED
FT                   QGQTLANVFILRLLENADDREATYMLKASSQSEMKRWMTSLAPNRRTKFVSFTSRLLDC
FT                   PQVQCVHPYVAQQPDELTLELADILNILEKTEDGEPRTKGTLHLGQP"
FT   assembly_gap    1887208..1887306
FT                   /estimated_length=99
FT                   /gap_type="unknown"
FT   assembly_gap    1890715..1890734
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1897598..1897682
FT                   /estimated_length=85
FT                   /gap_type="unknown"
FT   assembly_gap    1901196..1901268
FT                   /estimated_length=73
FT                   /gap_type="unknown"
FT   gene            complement(1930366..1932162)
FT                   /pseudo
FT                   /locus_tag="mCG_48804"
FT                   /note="gene_id=mCG48804.2"
FT   mRNA            complement(1930366..1932162)
FT                   /pseudo
FT                   /locus_tag="mCG_48804"
FT                   /note="gene_id=mCG48804.2 transcript_id=mCT48987.2 created
FT                   on 04-FEB-2003"
FT   assembly_gap    1937596..1937639
FT                   /estimated_length=44
FT                   /gap_type="unknown"
FT   assembly_gap    1941671..1941690
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            1971475..1985463
FT                   /gene="Neu2"
FT                   /locus_tag="mCG_16214"
FT                   /note="gene_id=mCG16214.1"
FT   mRNA            join(1971475..1971656,1982505..1982716,1984163..1985448)
FT                   /gene="Neu2"
FT                   /locus_tag="mCG_16214"
FT                   /product="neuraminidase 2, transcript variant mCT181772"
FT                   /note="gene_id=mCG16214.1 transcript_id=mCT181772.0 created
FT                   on 11-APR-2003"
FT   CDS             join(1971650..1971656,1982505..1982716,1984163..1985101)
FT                   /codon_start=1
FT                   /gene="Neu2"
FT                   /locus_tag="mCG_16214"
FT                   /product="neuraminidase 2, isoform CRA_b"
FT                   /note="gene_id=mCG16214.1 transcript_id=mCT181772.0
FT                   protein_id=mCP104695.0 isoform=CRA_b"
FT                   /protein_id="EDL40157.1"
FT                   /translation="MEDLRPMATCPVLQKETLFRTGVHAYRIPALLYLKKQKTLLAFAE
FT                   KRASKTDEHAELIVLRRGSYNEATNRVKWQPEEVVTQAQLEGHRSMNPCPLYDKQTKTL
FT                   FLFFIAVPGRVSEHHQLHTKVNVTRLCCVSSTDHGRTWSPIQDLTETTIGSTHQEWATF
FT                   AVGPGHCLQLRNPAGSLLVPAYAYRKLHPAQKPTPFAFCFISLDHGHTWKLGNFVAENS
FT                   LECQVAEVGTGAQRMVYLNARSFLGARVQAQSPNDGLDFQDNRVVSKLVEPPHGCHGSV
FT                   VAFHNPISKPHALDTWLLYTHPTDSRNRTNLGVYLNQMPLDPTAWSEPTLLAMGICAYS
FT                   DLQNMGQGPDGSPQFGCLYESGNYEEIIFLIFTLKQAFPTVFDAQ"
FT   assembly_gap    1972569..1972941
FT                   /estimated_length=373
FT                   /gap_type="unknown"
FT   mRNA            join(1982175..1982244,1982505..1982716,1984163..1985451)
FT                   /gene="Neu2"
FT                   /locus_tag="mCG_16214"
FT                   /product="neuraminidase 2, transcript variant mCT16426"
FT                   /note="gene_id=mCG16214.1 transcript_id=mCT16426.0 created
FT                   on 11-APR-2003"
FT   mRNA            join(1982223..1982716,1984163..1985463)
FT                   /gene="Neu2"
FT                   /locus_tag="mCG_16214"
FT                   /product="neuraminidase 2, transcript variant mCT181773"
FT                   /note="gene_id=mCG16214.1 transcript_id=mCT181773.0 created
FT                   on 11-APR-2003"
FT   CDS             join(1982516..1982716,1984163..1985101)
FT                   /codon_start=1
FT                   /gene="Neu2"
FT                   /locus_tag="mCG_16214"
FT                   /product="neuraminidase 2, isoform CRA_a"
FT                   /note="gene_id=mCG16214.1 transcript_id=mCT16426.0
FT                   protein_id=mCP15633.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q0VGI4"
FT                   /db_xref="InterPro:IPR011040"
FT                   /db_xref="InterPro:IPR026856"
FT                   /db_xref="InterPro:IPR026945"
FT                   /db_xref="MGI:MGI:1344417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VGI4"
FT                   /protein_id="EDL40156.1"
FT                   /translation="MATCPVLQKETLFRTGVHAYRIPALLYLKKQKTLLAFAEKRASKT
FT                   DEHAELIVLRRGSYNEATNRVKWQPEEVVTQAQLEGHRSMNPCPLYDKQTKTLFLFFIA
FT                   VPGRVSEHHQLHTKVNVTRLCCVSSTDHGRTWSPIQDLTETTIGSTHQEWATFAVGPGH
FT                   CLQLRNPAGSLLVPAYAYRKLHPAQKPTPFAFCFISLDHGHTWKLGNFVAENSLECQVA
FT                   EVGTGAQRMVYLNARSFLGARVQAQSPNDGLDFQDNRVVSKLVEPPHGCHGSVVAFHNP
FT                   ISKPHALDTWLLYTHPTDSRNRTNLGVYLNQMPLDPTAWSEPTLLAMGICAYSDLQNMG
FT                   QGPDGSPQFGCLYESGNYEEIIFLIFTLKQAFPTVFDAQ"
FT   CDS             join(1982516..1982716,1984163..1985101)
FT                   /codon_start=1
FT                   /gene="Neu2"
FT                   /locus_tag="mCG_16214"
FT                   /product="neuraminidase 2, isoform CRA_a"
FT                   /note="gene_id=mCG16214.1 transcript_id=mCT181773.0
FT                   protein_id=mCP104694.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q0VGI4"
FT                   /db_xref="InterPro:IPR011040"
FT                   /db_xref="InterPro:IPR026856"
FT                   /db_xref="InterPro:IPR026945"
FT                   /db_xref="MGI:MGI:1344417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VGI4"
FT                   /protein_id="EDL40158.1"
FT                   /translation="MATCPVLQKETLFRTGVHAYRIPALLYLKKQKTLLAFAEKRASKT
FT                   DEHAELIVLRRGSYNEATNRVKWQPEEVVTQAQLEGHRSMNPCPLYDKQTKTLFLFFIA
FT                   VPGRVSEHHQLHTKVNVTRLCCVSSTDHGRTWSPIQDLTETTIGSTHQEWATFAVGPGH
FT                   CLQLRNPAGSLLVPAYAYRKLHPAQKPTPFAFCFISLDHGHTWKLGNFVAENSLECQVA
FT                   EVGTGAQRMVYLNARSFLGARVQAQSPNDGLDFQDNRVVSKLVEPPHGCHGSVVAFHNP
FT                   ISKPHALDTWLLYTHPTDSRNRTNLGVYLNQMPLDPTAWSEPTLLAMGICAYSDLQNMG
FT                   QGPDGSPQFGCLYESGNYEEIIFLIFTLKQAFPTVFDAQ"
FT   gene            2006131..2106126
FT                   /gene="Inpp5d"
FT                   /locus_tag="mCG_16213"
FT                   /note="gene_id=mCG16213.2"
FT   mRNA            join(2006131..2006402,2021072..2021135,2051002..2051152,
FT                   2053507..2053678,2055257..2055397,2061895..2061982,
FT                   2067120..2067200,2067318..2067389,2069375..2069498,
FT                   2077269..2077375,2080951..2081053,2082966..2083084,
FT                   2105976..2106126)
FT                   /gene="Inpp5d"
FT                   /locus_tag="mCG_16213"
FT                   /product="inositol polyphosphate-5-phosphatase D,
FT                   transcript variant mCT177952"
FT                   /note="gene_id=mCG16213.2 transcript_id=mCT177952.0 created
FT                   on 02-JAN-2003"
FT   mRNA            join(2006150..2006402,2021072..2021135,2051002..2051152,
FT                   2053504..2053678,2055257..2055397,2061895..2061982,
FT                   2067120..2067200,2067318..2067389,2069375..2069498,
FT                   2077269..2077375,2080951..2081053,2082966..2083162,
FT                   2083730..2083847,2084645..2084741,2085257..2085395,
FT                   2086777..2086885,2087032..2087120,2088755..2088836,
FT                   2091608..2091697,2093771..2093884,2095264..2095346,
FT                   2096665..2096752,2097631..2097780,2098793..2098889,
FT                   2100638..2100917,2103304..2103898,2104935..2106116)
FT                   /gene="Inpp5d"
FT                   /locus_tag="mCG_16213"
FT                   /product="inositol polyphosphate-5-phosphatase D,
FT                   transcript variant mCT16425"
FT                   /note="gene_id=mCG16213.2 transcript_id=mCT16425.1 created
FT                   on 02-JAN-2003"
FT   mRNA            join(<2006169..2006402,2021072..2021135,2051002..2051152,
FT                   2053507..2053678,2055257..2055397,2061895..2061982,
FT                   2067120..2067200,2067318..2067389,2069375..2069498,
FT                   2077269..2077375,2080951..2081053,2082966..2083162,
FT                   2083730..2083847,2084645..2084741,2085257..2085395,
FT                   2086777..2086885,2087032..2087120,2088755..2088836,
FT                   2091608..2091697,2093771..2093884,2095264..2095346,
FT                   2096665..2096752,2097631..2097780,2098793..2098889,
FT                   2100638..2100917,2103304..2103898,2104935..2106115)
FT                   /gene="Inpp5d"
FT                   /locus_tag="mCG_16213"
FT                   /product="inositol polyphosphate-5-phosphatase D,
FT                   transcript variant mCT193766"
FT                   /note="gene_id=mCG16213.2 transcript_id=mCT193766.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(2006169..2006402,2021072..2021135,2051002..2051152,
FT                   2053507..2053678,2055257..2055397,2061895..2061982,
FT                   2067120..2067200,2067318..2067389,2069375..2069498,
FT                   2077269..2077375,2080951..2081053,2082966..2083162,
FT                   2083730..2083847,2084645..2084741,2085257..2085395,
FT                   2086777..2086885,2087032..2087120,2088755..2088836,
FT                   2091608..2091697,2093771..2093884,2095264..2095346,
FT                   2096665..2096752,2097631..2097780,2098793..2098889,
FT                   2100638..2100693,2100865..2100917,2103304..2103898,
FT                   2104935..2106115)
FT                   /gene="Inpp5d"
FT                   /locus_tag="mCG_16213"
FT                   /product="inositol polyphosphate-5-phosphatase D,
FT                   transcript variant mCT177954"
FT                   /note="gene_id=mCG16213.2 transcript_id=mCT177954.0 created
FT                   on 02-JAN-2003"
FT   mRNA            join(<2006170..2006402,2021072..2021135,2051002..2051152,
FT                   2053504..2053678,2055257..2055397,2061895..2061982,
FT                   2067120..2067200,2067318..2067389,2069375..2069498,
FT                   2077269..2077375,2080951..2081053,2082966..2083162,
FT                   2083730..2083847,2084645..2084741,2085257..2085395,
FT                   2086777..2086885,2087032..2087120,2088755..2088836,
FT                   2091608..2091697,2093771..2093884,2095264..2095346,
FT                   2096665..2096752,2097631..2097780,2098793..2098889,
FT                   2100638..2100693,2100881..2100917,2103304..2103898,
FT                   2104935..2105081)
FT                   /gene="Inpp5d"
FT                   /locus_tag="mCG_16213"
FT                   /product="inositol polyphosphate-5-phosphatase D,
FT                   transcript variant mCT193767"
FT                   /note="gene_id=mCG16213.2 transcript_id=mCT193767.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<2006203..2006402,2021072..2021135,2051002..2051152,
FT                   2053504..2053678,2055257..2055397,2061895..2061982,
FT                   2067120..2067200,2067318..2067389,2069375..2069498,
FT                   2077269..2077375,2080951..2081053,2082966..2083162,
FT                   2083730..2083847,2084645..2084741,2085257..2085395,
FT                   2086777..2086885,2087032..2087120,2088755..2088836,
FT                   2091608..2091697,2093771..2093884,2095264..2095346,
FT                   2096665..2096752,2097631..2097780,2098793..2098889,
FT                   2100638..2100693,2100881..2100917,2103304..2103898,
FT                   2104935..2104937)
FT                   /codon_start=1
FT                   /gene="Inpp5d"
FT                   /locus_tag="mCG_16213"
FT                   /product="inositol polyphosphate-5-phosphatase D, isoform
FT                   CRA_g"
FT                   /note="gene_id=mCG16213.2 transcript_id=mCT193767.0
FT                   protein_id=mCP114746.0 isoform=CRA_g"
FT                   /protein_id="EDL40155.1"
FT                   /translation="TTLLECPSWEWLLTQSRRPMPAMVPGWNHGNITRSKAEELLSRAG
FT                   KDGSFLVRASESIPRAYALCVLFRNCVYTYRILPNEDDKFTVQASEGVPMRFFTKLDQL
FT                   IDFYKKENMGLVTHLQYPVPLEEEDAIDEAEEDTVESVMSPPELPPRNIPMSAGPSEAK
FT                   DLPLATENPRAPEVTRLSLSETLFQRLQSMDTSGLPEEHLKAIQDYLSTQLLLDSDFLK
FT                   TGSSNLPHLKKLMSLLCKELHGEVIRTLPSLESLQRLFDQQLSPGLRPRPQVPGEASPI
FT                   TMVAKLSQLTSLLSSIEDKVKSLLHEGSESTNRRSLIPPVTFEVKSESLGIPQKMHLKV
FT                   DVESGKLIVKKSKDGSEDKFYSHKKILQLIKSQKFLNKLVILVETEKEKILRKEYVFAD
FT                   SKKREGFCQLLQQMKNKHSEQPEPDMITIFIGTWNMGNAPPPKKITSWFLSKGQGKTRD
FT                   DSADYIPHDIYVIGTQEDPLGEKEWLELLRHSLQEVTSMTFKTVAIHTLWNIRIVVLAK
FT                   PEHENRISHICTDNVKTGIANTLGNKGAVGVSFMFNGTSLGFVNSHLTSGSEKKLRRNQ
FT                   NYMNILRFLALGDKKLSPFNITHRFTHLFWLGDLNYRVELPTWEAEAIIQKIKQQQYSD
FT                   LLAHDQLLLERKDQKVFLHFEEEEITFAPTYRFERLTRDKYAYTKQKATGMKYNLPSWC
FT                   DRVLWKSYPLVHVVCQSYGSTSDIMTSDHSPVFATFEAGVTSQFVSKNGPGTVDSQGQI
FT                   EFLACYATLKTKSQTKFYLEFHSSCLESFVKSQEGENEEGSEGELVVRFGETLPKLKPI
FT                   ISDPEYLLDQHILISIKSSDSDESYGEGCIALRLETTEAQHPIYTPLTHHGEMTGHFRG
FT                   EIKLQTSQGKMREKLYDFVKTERDESSGMKCLKNLTSHDPMRQWEPSGRVPACGVSSLN
FT                   EMINPNYIANRGPCPRVQEARPGDLGKVEALLQEDLLLTKPEMFENPLYGSVSSFPKLV
FT                   PRKEQESPKMLRKEPPPCPDPGISSPSIVLPKAQEVESVKGTSKQAPVPVLGPTPRIRS
FT                   FTCSSSAEGRMTSGDKSQGKPKASASSQAPVPVKRPVKPSRSEMSQQTTPIPAPRPPLP
FT                   VKSPAVLQLQHSKGRDYRDNTELPHHGKHRQEEGLLGRTAMQ"
FT   CDS             join(<2006203..2006402,2021072..2021135,2051002..2051152,
FT                   2053507..2053678,2055257..2055397,2061895..2061982,
FT                   2067120..2067200,2067318..2067389,2069375..2069498,
FT                   2077269..2077375,2080951..2081053,2082966..2083162,
FT                   2083730..2083847,2084645..2084741,2085257..2085395,
FT                   2086777..2086885,2087032..2087120,2088755..2088836,
FT                   2091608..2091697,2093771..2093884,2095264..2095346,
FT                   2096665..2096752,2097631..2097780,2098793..2098889,
FT                   2100638..2100917,2103304..2103375)
FT                   /codon_start=1
FT                   /gene="Inpp5d"
FT                   /locus_tag="mCG_16213"
FT                   /product="inositol polyphosphate-5-phosphatase D, isoform
FT                   CRA_f"
FT                   /note="gene_id=mCG16213.2 transcript_id=mCT193766.0
FT                   protein_id=mCP114745.0 isoform=CRA_f partial"
FT                   /protein_id="EDL40154.1"
FT                   /translation="TTLLECPSWEWLLTQSRRPMPAMVPGWNHGNITRSKAEELLSRAG
FT                   KDGSFLVRASESIPRAYALCVLFRNCVYTYRILPNEDDKFTVQASEGVPMRFFTKLDQL
FT                   IDFYKKENMGLVTHLQYPVPLEEEDAIDEAEEDTESVMSPPELPPRNIPMSAGPSEAKD
FT                   LPLATENPRAPEVTRLSLSETLFQRLQSMDTSGLPEEHLKAIQDYLSTQLLLDSDFLKT
FT                   GSSNLPHLKKLMSLLCKELHGEVIRTLPSLESLQRLFDQQLSPGLRPRPQVPGEASPIT
FT                   MVAKLSQLTSLLSSIEDKVKSLLHEGSESTNRRSLIPPVTFEVKSESLGIPQKMHLKVD
FT                   VESGKLIVKKSKDGSEDKFYSHKKILQLIKSQKFLNKLVILVETEKEKILRKEYVFADS
FT                   KKREGFCQLLQQMKNKHSEQPEPDMITIFIGTWNMGNAPPPKKITSWFLSKGQGKTRDD
FT                   SADYIPHDIYVIGTQEDPLGEKEWLELLRHSLQEVTSMTFKTVAIHTLWNIRIVVLAKP
FT                   EHENRISHICTDNVKTGIANTLGNKGAVGVSFMFNGTSLGFVNSHLTSGSEKKLRRNQN
FT                   YMNILRFLALGDKKLSPFNITHRFTHLFWLGDLNYRVELPTWEAEAIIQKIKQQQYSDL
FT                   LAHDQLLLERKDQKVFLHFEEEEITFAPTYRFERLTRDKYAYTKQKATGMKYNLPSWCD
FT                   RVLWKSYPLVHVVCQSYGSTSDIMTSDHSPVFATFEAGVTSQFVSKNGPGTVDSQGQIE
FT                   FLACYATLKTKSQTKFYLEFHSSCLESFVKSQEGENEEGSEGELVVRFGETLPKLKPII
FT                   SDPEYLLDQHILISIKSSDSDESYGEGCIALRLETTEAQHPIYTPLTHHGEMTGHFRGE
FT                   IKLQTSQGKMREKLYDFVKTERDESSGMKCLKNLTSHDPMRQWEPSGRVPACGVSSLNE
FT                   MINPNYIGMGPFGQPLHGKSTLSPDQQLTAWSYDQLPKDSSLGPGRGEGXXXXXXXPTT
FT                   SVAKEVFIFHSQPRSLPQGARGKTWGSGKGGSSAPGGPAADEARDV"
FT   mRNA            join(2006222..2006402,2021072..2021135,2051002..2051152,
FT                   2053507..2053678,2055257..2055397,2061895..2061982,
FT                   2067120..2067200,2067318..2067389,2069375..2069498,
FT                   2077269..2077375,2080951..2081053,2082966..2083162,
FT                   2083730..2083847,2084645..2084741,2085257..2085395,
FT                   2086777..2086885,2087032..2087120,2088755..2088836,
FT                   2091608..2091697,2093771..2093884,2095264..2095346,
FT                   2096665..2096678,2105866..2106117)
FT                   /gene="Inpp5d"
FT                   /locus_tag="mCG_16213"
FT                   /product="inositol polyphosphate-5-phosphatase D,
FT                   transcript variant mCT177953"
FT                   /note="gene_id=mCG16213.2 transcript_id=mCT177953.0 created
FT                   on 02-JAN-2003"
FT   CDS             join(2006260..2006402,2021072..2021135,2051002..2051152,
FT                   2053507..2053678,2055257..2055397,2061895..2061982,
FT                   2067120..2067200,2067318..2067389,2069375..2069498,
FT                   2077269..2077375,2080951..2081053,2082966..2083084,
FT                   2105976..2106032)
FT                   /codon_start=1
FT                   /gene="Inpp5d"
FT                   /locus_tag="mCG_16213"
FT                   /product="inositol polyphosphate-5-phosphatase D, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG16213.2 transcript_id=mCT177952.0
FT                   protein_id=mCP100874.0 isoform=CRA_c"
FT                   /protein_id="EDL40151.1"
FT                   /translation="MPAMVPGWNHGNITRSKAEELLSRAGKDGSFLVRASESIPRAYAL
FT                   CVLFRNCVYTYRILPNEDDKFTVQASEGVPMRFFTKLDQLIDFYKKENMGLVTHLQYPV
FT                   PLEEEDAIDEAEEDTESVMSPPELPPRNIPMSAGPSEAKDLPLATENPRAPEVTRLSLS
FT                   ETLFQRLQSMDTSGLPEEHLKAIQDYLSTQLLLDSDFLKTGSSNLPHLKKLMSLLCKEL
FT                   HGEVIRTLPSLESLQRLFDQQLSPGLRPRPQVPGEASPITMVAKLSQLTSLLSSIEDKV
FT                   KSLLHEGSESTNRRSLIPPVTFEVKSESLGIPQKMHLKVDVESGKLIVKKSKDGSEDKF
FT                   YSHKKILQLIKSQKFLNKLVILVETEKEKILRKEYVFADSKKREGFCQLLQQMKNKHSE
FT                   QPEPDMITIFIGTWNMGNAPPPKKITSWFLSKGQGKTRDDSADYIPHDIYVIGTQETRV
FT                   VISFLVLLFDISGLM"
FT   CDS             join(2006260..2006402,2021072..2021135,2051002..2051152,
FT                   2053507..2053678,2055257..2055397,2061895..2061982,
FT                   2067120..2067200,2067318..2067389,2069375..2069498,
FT                   2077269..2077375,2080951..2081053,2082966..2083162,
FT                   2083730..2083847,2084645..2084741,2085257..2085395,
FT                   2086777..2086885,2087032..2087120,2088755..2088836,
FT                   2091608..2091697,2093771..2093884,2095264..2095346,
FT                   2096665..2096678,2105866..2105893)
FT                   /codon_start=1
FT                   /gene="Inpp5d"
FT                   /locus_tag="mCG_16213"
FT                   /product="inositol polyphosphate-5-phosphatase D, isoform
FT                   CRA_d"
FT                   /note="gene_id=mCG16213.2 transcript_id=mCT177953.0
FT                   protein_id=mCP100875.0 isoform=CRA_d"
FT                   /protein_id="EDL40152.1"
FT                   /translation="MPAMVPGWNHGNITRSKAEELLSRAGKDGSFLVRASESIPRAYAL
FT                   CVLFRNCVYTYRILPNEDDKFTVQASEGVPMRFFTKLDQLIDFYKKENMGLVTHLQYPV
FT                   PLEEEDAIDEAEEDTESVMSPPELPPRNIPMSAGPSEAKDLPLATENPRAPEVTRLSLS
FT                   ETLFQRLQSMDTSGLPEEHLKAIQDYLSTQLLLDSDFLKTGSSNLPHLKKLMSLLCKEL
FT                   HGEVIRTLPSLESLQRLFDQQLSPGLRPRPQVPGEASPITMVAKLSQLTSLLSSIEDKV
FT                   KSLLHEGSESTNRRSLIPPVTFEVKSESLGIPQKMHLKVDVESGKLIVKKSKDGSEDKF
FT                   YSHKKILQLIKSQKFLNKLVILVETEKEKILRKEYVFADSKKREGFCQLLQQMKNKHSE
FT                   QPEPDMITIFIGTWNMGNAPPPKKITSWFLSKGQGKTRDDSADYIPHDIYVIGTQEDPL
FT                   GEKEWLELLRHSLQEVTSMTFKTVAIHTLWNIRIVVLAKPEHENRISHICTDNVKTGIA
FT                   NTLGNKGAVGVSFMFNGTSLGFVNSHLTSGSEKKLRRNQNYMNILRFLALGDKKLSPFN
FT                   ITHRFTHLFWLGDLNYRVELPTWEAEAIIQKIKQQQYSDLLAHDQLLLERKDQKVFLHF
FT                   EEEEITFAPTYRFERLTRDKYAYTKQKATGMKYNLPSWCDRVLWKSYPLVHVVCQSYGS
FT                   TSDIMTSDHSPVFATFEAGVTSQFVSKNGPGTVDSQGQIEFLACYATLKTKSQTKFYLE
FT                   FHSSCLESFVKSQEGENEEGSEGELVVRFGETLPKLKPIISPACYQGR"
FT   CDS             join(2006260..2006402,2021072..2021135,2051002..2051152,
FT                   2053504..2053678,2055257..2055397,2061895..2061982,
FT                   2067120..2067200,2067318..2067389,2069375..2069498,
FT                   2077269..2077375,2080951..2081053,2082966..2083162,
FT                   2083730..2083847,2084645..2084741,2085257..2085395,
FT                   2086777..2086885,2087032..2087120,2088755..2088836,
FT                   2091608..2091697,2093771..2093884,2095264..2095346,
FT                   2096665..2096752,2097631..2097780,2098793..2098889,
FT                   2100638..2100917,2103304..2103375)
FT                   /codon_start=1
FT                   /gene="Inpp5d"
FT                   /locus_tag="mCG_16213"
FT                   /product="inositol polyphosphate-5-phosphatase D, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG16213.2 transcript_id=mCT16425.1
FT                   protein_id=mCP15664.2 isoform=CRA_a partial"
FT                   /protein_id="EDL40149.1"
FT                   /translation="MPAMVPGWNHGNITRSKAEELLSRAGKDGSFLVRASESIPRAYAL
FT                   CVLFRNCVYTYRILPNEDDKFTVQASEGVPMRFFTKLDQLIDFYKKENMGLVTHLQYPV
FT                   PLEEEDAIDEAEEDTVESVMSPPELPPRNIPMSAGPSEAKDLPLATENPRAPEVTRLSL
FT                   SETLFQRLQSMDTSGLPEEHLKAIQDYLSTQLLLDSDFLKTGSSNLPHLKKLMSLLCKE
FT                   LHGEVIRTLPSLESLQRLFDQQLSPGLRPRPQVPGEASPITMVAKLSQLTSLLSSIEDK
FT                   VKSLLHEGSESTNRRSLIPPVTFEVKSESLGIPQKMHLKVDVESGKLIVKKSKDGSEDK
FT                   FYSHKKILQLIKSQKFLNKLVILVETEKEKILRKEYVFADSKKREGFCQLLQQMKNKHS
FT                   EQPEPDMITIFIGTWNMGNAPPPKKITSWFLSKGQGKTRDDSADYIPHDIYVIGTQEDP
FT                   LGEKEWLELLRHSLQEVTSMTFKTVAIHTLWNIRIVVLAKPEHENRISHICTDNVKTGI
FT                   ANTLGNKGAVGVSFMFNGTSLGFVNSHLTSGSEKKLRRNQNYMNILRFLALGDKKLSPF
FT                   NITHRFTHLFWLGDLNYRVELPTWEAEAIIQKIKQQQYSDLLAHDQLLLERKDQKVFLH
FT                   FEEEEITFAPTYRFERLTRDKYAYTKQKATGMKYNLPSWCDRVLWKSYPLVHVVCQSYG
FT                   STSDIMTSDHSPVFATFEAGVTSQFVSKNGPGTVDSQGQIEFLACYATLKTKSQTKFYL
FT                   EFHSSCLESFVKSQEGENEEGSEGELVVRFGETLPKLKPIISDPEYLLDQHILISIKSS
FT                   DSDESYGEGCIALRLETTEAQHPIYTPLTHHGEMTGHFRGEIKLQTSQGKMREKLYDFV
FT                   KTERDESSGMKCLKNLTSHDPMRQWEPSGRVPACGVSSLNEMINPNYIGMGPFGQPLHG
FT                   KSTLSPDQQLTAWSYDQLPKDSSLGPGRGEGXXXXXXXPTTSVAKEVFIFHSQPRSLPQ
FT                   GARGKTWGSGKGGSSAPGGPAADEARDV"
FT   CDS             join(2006260..2006402,2021072..2021135,2051002..2051152,
FT                   2053507..2053678,2055257..2055397,2061895..2061982,
FT                   2067120..2067200,2067318..2067389,2069375..2069498,
FT                   2077269..2077375,2080951..2081053,2082966..2083162,
FT                   2083730..2083847,2084645..2084741,2085257..2085395,
FT                   2086777..2086885,2087032..2087120,2088755..2088836,
FT                   2091608..2091697,2093771..2093884,2095264..2095346,
FT                   2096665..2096752,2097631..2097780,2098793..2098889,
FT                   2100638..2100693,2100865..2100917,2103304..2103375)
FT                   /codon_start=1
FT                   /gene="Inpp5d"
FT                   /locus_tag="mCG_16213"
FT                   /product="inositol polyphosphate-5-phosphatase D, isoform
FT                   CRA_e"
FT                   /note="gene_id=mCG16213.2 transcript_id=mCT177954.0
FT                   protein_id=mCP100873.0 isoform=CRA_e"
FT                   /protein_id="EDL40153.1"
FT                   /translation="MPAMVPGWNHGNITRSKAEELLSRAGKDGSFLVRASESIPRAYAL
FT                   CVLFRNCVYTYRILPNEDDKFTVQASEGVPMRFFTKLDQLIDFYKKENMGLVTHLQYPV
FT                   PLEEEDAIDEAEEDTESVMSPPELPPRNIPMSAGPSEAKDLPLATENPRAPEVTRLSLS
FT                   ETLFQRLQSMDTSGLPEEHLKAIQDYLSTQLLLDSDFLKTGSSNLPHLKKLMSLLCKEL
FT                   HGEVIRTLPSLESLQRLFDQQLSPGLRPRPQVPGEASPITMVAKLSQLTSLLSSIEDKV
FT                   KSLLHEGSESTNRRSLIPPVTFEVKSESLGIPQKMHLKVDVESGKLIVKKSKDGSEDKF
FT                   YSHKKILQLIKSQKFLNKLVILVETEKEKILRKEYVFADSKKREGFCQLLQQMKNKHSE
FT                   QPEPDMITIFIGTWNMGNAPPPKKITSWFLSKGQGKTRDDSADYIPHDIYVIGTQEDPL
FT                   GEKEWLELLRHSLQEVTSMTFKTVAIHTLWNIRIVVLAKPEHENRISHICTDNVKTGIA
FT                   NTLGNKGAVGVSFMFNGTSLGFVNSHLTSGSEKKLRRNQNYMNILRFLALGDKKLSPFN
FT                   ITHRFTHLFWLGDLNYRVELPTWEAEAIIQKIKQQQYSDLLAHDQLLLERKDQKVFLHF
FT                   EEEEITFAPTYRFERLTRDKYAYTKQKATGMKYNLPSWCDRVLWKSYPLVHVVCQSYGS
FT                   TSDIMTSDHSPVFATFEAGVTSQFVSKNGPGTVDSQGQIEFLACYATLKTKSQTKFYLE
FT                   FHSSCLESFVKSQEGENEEGSEGELVVRFGETLPKLKPIISDPEYLLDQHILISIKSSD
FT                   SDESYGEGCIALRLETTEAQHPIYTPLTHHGEMTGHFRGEIKLQTSQGKMREKLYDFVK
FT                   TERDESSGMKCLKNLTSHDPMRQWEPSGRVPACGVSSLNEMINPNYIVFIFHSQPRSLP
FT                   QGARGKTWGSGKGGSSAPGGPAADEARDV"
FT   assembly_gap    2028290..2030844
FT                   /estimated_length=2555
FT                   /gap_type="unknown"
FT   assembly_gap    2033163..2033502
FT                   /estimated_length=340
FT                   /gap_type="unknown"
FT   assembly_gap    2038945..2039216
FT                   /estimated_length=272
FT                   /gap_type="unknown"
FT   mRNA            join(2061851..2061982,2067120..2067200,2067318..2067389,
FT                   2069375..2069498,2077269..2077375,2080951..2081053,
FT                   2082966..2083162,2083730..2083847,2084645..2084741,
FT                   2085257..2085395,2086777..2086885,2087032..2087120,
FT                   2088755..2088836,2091608..2091697,2093771..2093884,
FT                   2095264..2095346,2096665..2096752,2097631..2097780,
FT                   2098793..2098889,2100638..2100693,2100881..2100917,
FT                   2103304..2103898,2104935..2106116)
FT                   /gene="Inpp5d"
FT                   /locus_tag="mCG_16213"
FT                   /product="inositol polyphosphate-5-phosphatase D,
FT                   transcript variant mCT177951"
FT                   /note="gene_id=mCG16213.2 transcript_id=mCT177951.0 created
FT                   on 02-JAN-2003"
FT   CDS             join(2067147..2067200,2067318..2067389,2069375..2069498,
FT                   2077269..2077375,2080951..2081053,2082966..2083162,
FT                   2083730..2083847,2084645..2084741,2085257..2085395,
FT                   2086777..2086885,2087032..2087120,2088755..2088836,
FT                   2091608..2091697,2093771..2093884,2095264..2095346,
FT                   2096665..2096752,2097631..2097780,2098793..2098889,
FT                   2100638..2100693,2100881..2100917,2103304..2103898,
FT                   2104935..2104937)
FT                   /codon_start=1
FT                   /gene="Inpp5d"
FT                   /locus_tag="mCG_16213"
FT                   /product="inositol polyphosphate-5-phosphatase D, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG16213.2 transcript_id=mCT177951.0
FT                   protein_id=mCP100876.0 isoform=CRA_b"
FT                   /protein_id="EDL40150.1"
FT                   /translation="MVAKLSQLTSLLSSIEDKVKSLLHEGSESTNRRSLIPPVTFEVKS
FT                   ESLGIPQKMHLKVDVESGKLIVKKSKDGSEDKFYSHKKILQLIKSQKFLNKLVILVETE
FT                   KEKILRKEYVFADSKKREGFCQLLQQMKNKHSEQPEPDMITIFIGTWNMGNAPPPKKIT
FT                   SWFLSKGQGKTRDDSADYIPHDIYVIGTQEDPLGEKEWLELLRHSLQEVTSMTFKTVAI
FT                   HTLWNIRIVVLAKPEHENRISHICTDNVKTGIANTLGNKGAVGVSFMFNGTSLGFVNSH
FT                   LTSGSEKKLRRNQNYMNILRFLALGDKKLSPFNITHRFTHLFWLGDLNYRVELPTWEAE
FT                   AIIQKIKQQQYSDLLAHDQLLLERKDQKVFLHFEEEEITFAPTYRFERLTRDKYAYTKQ
FT                   KATGMKYNLPSWCDRVLWKSYPLVHVVCQSYGSTSDIMTSDHSPVFATFEAGVTSQFVS
FT                   KNGPGTVDSQGQIEFLACYATLKTKSQTKFYLEFHSSCLESFVKSQEGENEEGSEGELV
FT                   VRFGETLPKLKPIISDPEYLLDQHILISIKSSDSDESYGEGCIALRLETTEAQHPIYTP
FT                   LTHHGEMTGHFRGEIKLQTSQGKMREKLYDFVKTERDESSGMKCLKNLTSHDPMRQWEP
FT                   SGRVPACGVSSLNEMINPNYIANRGPCPRVQEARPGDLGKVEALLQEDLLLTKPEMFEN
FT                   PLYGSVSSFPKLVPRKEQESPKMLRKEPPPCPDPGISSPSIVLPKAQEVESVKGTSKQA
FT                   PVPVLGPTPRIRSFTCSSSAEGRMTSGDKSQGKPKASASSQAPVPVKRPVKPSRSEMSQ
FT                   QTTPIPAPRPPLPVKSPAVLQLQHSKGRDYRDNTELPHHGKHRQEEGLLGRTAMQ"
FT   assembly_gap    2100820..2100839
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2108864..2112119
FT                   /estimated_length=3256
FT                   /gap_type="unknown"
FT   assembly_gap    2117895..2117998
FT                   /estimated_length=104
FT                   /gap_type="unknown"
FT   gene            2135238..2171778
FT                   /gene="Atg16l1"
FT                   /locus_tag="mCG_16203"
FT                   /note="gene_id=mCG16203.2"
FT   mRNA            join(2135238..2135453,2139419..2139512,2144705..2144810,
FT                   2145476..2145549,2146173..2146424,2150752..2150817,
FT                   2153505..2153591,2154173..2154229,2154441..2154488,
FT                   2155117..2155219,2158286..2158391,2159489..2159559,
FT                   2161035..2161106,2165233..2165353,2165598..2165703,
FT                   2168687..2168836,2168928..2168975,2169942..2170043,
FT                   2170572..2171778)
FT                   /gene="Atg16l1"
FT                   /locus_tag="mCG_16203"
FT                   /product="autophagy-related 16-like 1 (yeast), transcript
FT                   variant mCT177936"
FT                   /note="gene_id=mCG16203.2 transcript_id=mCT177936.0 created
FT                   on 02-JAN-2003"
FT   mRNA            join(2135448..2135682,2139419..2139512,2144705..2144810,
FT                   2145476..2145549,2146173..2146424,2150752..2150817,
FT                   2153505..2153591,2154173..2154229,2154441..2154488,
FT                   2155117..2155219,2158286..2158391,2159489..2159559,
FT                   2161035..2161106,2165233..2165353,2165598..2165703,
FT                   2168687..2168836,2168928..2168975,2169942..2170043,
FT                   2170572..2171778)
FT                   /gene="Atg16l1"
FT                   /locus_tag="mCG_16203"
FT                   /product="autophagy-related 16-like 1 (yeast), transcript
FT                   variant mCT177935"
FT                   /note="gene_id=mCG16203.2 transcript_id=mCT177935.0 created
FT                   on 02-JAN-2003"
FT   mRNA            join(2135448..2135682,2139419..2139512,2144705..2144810,
FT                   2145476..2145549,2146173..2146424,2150752..2150817,
FT                   2153505..2153591,2154173..2154229,2155117..2155219,
FT                   2158286..2158391,2159489..2159559,2161035..2161106,
FT                   2165233..2165353,2165598..2165703,2168687..2168836,
FT                   2168928..2168975,2169942..2170043,2170572..2171778)
FT                   /gene="Atg16l1"
FT                   /locus_tag="mCG_16203"
FT                   /product="autophagy-related 16-like 1 (yeast), transcript
FT                   variant mCT177938"
FT                   /note="gene_id=mCG16203.2 transcript_id=mCT177938.0 created
FT                   on 02-JAN-2003"
FT   mRNA            join(2135448..2135682,2139419..2139512,2144705..2144810,
FT                   2145476..2145549,2146173..2146424,2150752..2150817,
FT                   2153505..2153591,2155117..2155219,2158286..2158391,
FT                   2159489..2159559,2161035..2161106,2165233..2165353,
FT                   2165598..2165703,2168687..2168836,2168928..2168975,
FT                   2169942..2170043,2170572..2171778)
FT                   /gene="Atg16l1"
FT                   /locus_tag="mCG_16203"
FT                   /product="autophagy-related 16-like 1 (yeast), transcript
FT                   variant mCT177937"
FT                   /note="gene_id=mCG16203.2 transcript_id=mCT177937.0 created
FT                   on 02-JAN-2003"
FT   mRNA            join(2135456..2135682,2139419..2139512,2144705..2144810,
FT                   2145476..2145549,2146173..2146424,2150752..2150817,
FT                   2153505..2153591,2154173..2154229,2154441..2154488,
FT                   2155117..2155219,2158286..2158391,2159489..2159559,
FT                   2161035..2161106,2165233..2165703,2168687..2168836,
FT                   2168928..2168975,2169942..2170043,2170572..2171778)
FT                   /gene="Atg16l1"
FT                   /locus_tag="mCG_16203"
FT                   /product="autophagy-related 16-like 1 (yeast), transcript
FT                   variant mCT16285"
FT                   /note="gene_id=mCG16203.2 transcript_id=mCT16285.2 created
FT                   on 02-JAN-2003"
FT   CDS             join(2135568..2135682,2139419..2139512,2144705..2144810,
FT                   2145476..2145549,2146173..2146424,2150752..2150817,
FT                   2153505..2153591,2154173..2154229,2154441..2154488,
FT                   2155117..2155219,2158286..2158391,2159489..2159559,
FT                   2161035..2161106,2165233..2165353,2165598..2165703,
FT                   2168687..2168836,2168928..2168975,2169942..2170043,
FT                   2170572..2170665)
FT                   /codon_start=1
FT                   /gene="Atg16l1"
FT                   /locus_tag="mCG_16203"
FT                   /product="autophagy-related 16-like 1 (yeast), isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG16203.2 transcript_id=mCT177935.0
FT                   protein_id=mCP100859.0 isoform=CRA_a"
FT                   /db_xref="GOA:G9M4M6"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR013923"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="MGI:MGI:1924290"
FT                   /db_xref="UniProtKB/TrEMBL:G9M4M6"
FT                   /protein_id="EDL40144.1"
FT                   /translation="MSSGLRAADFPRWKRHIAEELRRRDRLQRQAFEEIILQYTKLLEK
FT                   SDLHSVLTQKLQAEKHDMPNRHEISPGHDGAWNDSQLQEMAQLRIKHQEELTELHKKRG
FT                   ELAQLVIDLNNQMQQKDKEIQMNEAKISEYLQTISDLETNCLDLRTKLQDLEVANQTLK
FT                   DEYDALQITFTALEEKLRKTTEENQELVTRWMAEKAQEANRLNAENEKDSRRRQARLQK
FT                   ELAEAAKEPLPVEQDDDIEVIVDETSDHTEETSPVRAVSRAATKRLSQPAGGLLDSITN
FT                   IFGLSESPLLGHHSSDAARRRSVSSIPVPQDIMDTHPASGKDVRVPTTASYVFDAHDGE
FT                   VNAVQFSPGSRLLATGGMDRRVKLWEAFGDKCEFKGSLSGSNAGITSIEFDSAGAYLLA
FT                   ASNDFASRIWTVDDYRLRHTLTGHSGKVLSAKFLLDNARIVSGSHDRTLKLWDLRSKVC
FT                   IKTVFAGSSCNDIVCTEQCVMSGHFDKKIRFWDIRSESVVREMELLGKITALDLNPERT
FT                   ELLSCSRDDLLKVIDLRTNAVKQTFSAPGFKCGSDWTRVVFSPDGSYVAAGSAEGSLYV
FT                   WSVLTGKVEKVLSKQHSSSINAVAWAPSGLHVVSVDKGSRAVLWAQP"
FT   CDS             join(2135568..2135682,2139419..2139512,2144705..2144810,
FT                   2145476..2145549,2146173..2146424,2150752..2150817,
FT                   2153505..2153591,2154173..2154229,2155117..2155219,
FT                   2158286..2158391,2159489..2159559,2161035..2161106,
FT                   2165233..2165353,2165598..2165703,2168687..2168836,
FT                   2168928..2168975,2169942..2170043,2170572..2170665)
FT                   /codon_start=1
FT                   /gene="Atg16l1"
FT                   /locus_tag="mCG_16203"
FT                   /product="autophagy-related 16-like 1 (yeast), isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG16203.2 transcript_id=mCT177938.0
FT                   protein_id=mCP100860.0 isoform=CRA_c"
FT                   /protein_id="EDL40146.1"
FT                   /translation="MSSGLRAADFPRWKRHIAEELRRRDRLQRQAFEEIILQYTKLLEK
FT                   SDLHSVLTQKLQAEKHDMPNRHEISPGHDGAWNDSQLQEMAQLRIKHQEELTELHKKRG
FT                   ELAQLVIDLNNQMQQKDKEIQMNEAKISEYLQTISDLETNCLDLRTKLQDLEVANQTLK
FT                   DEYDALQITFTALEEKLRKTTEENQELVTRWMAEKAQEANRLNAENEKDSRRRQARLQK
FT                   ELAEAAKEPLPVEQDDDIEVIVDETSDHTEETSPVRAVSRAATKRLSQPAGGLLDSITN
FT                   IFGRRSVSSIPVPQDIMDTHPASGKDVRVPTTASYVFDAHDGEVNAVQFSPGSRLLATG
FT                   GMDRRVKLWEAFGDKCEFKGSLSGSNAGITSIEFDSAGAYLLAASNDFASRIWTVDDYR
FT                   LRHTLTGHSGKVLSAKFLLDNARIVSGSHDRTLKLWDLRSKVCIKTVFAGSSCNDIVCT
FT                   EQCVMSGHFDKKIRFWDIRSESVVREMELLGKITALDLNPERTELLSCSRDDLLKVIDL
FT                   RTNAVKQTFSAPGFKCGSDWTRVVFSPDGSYVAAGSAEGSLYVWSVLTGKVEKVLSKQH
FT                   SSSINAVAWAPSGLHVVSVDKGSRAVLWAQP"
FT   CDS             join(2135568..2135682,2139419..2139512,2144705..2144810,
FT                   2145476..2145549,2146173..2146424,2150752..2150817,
FT                   2153505..2153591,2155117..2155219,2158286..2158391,
FT                   2159489..2159559,2161035..2161106,2165233..2165353,
FT                   2165598..2165703,2168687..2168836,2168928..2168975,
FT                   2169942..2170043,2170572..2170665)
FT                   /codon_start=1
FT                   /gene="Atg16l1"
FT                   /locus_tag="mCG_16203"
FT                   /product="autophagy-related 16-like 1 (yeast), isoform
FT                   CRA_e"
FT                   /note="gene_id=mCG16203.2 transcript_id=mCT177937.0
FT                   protein_id=mCP100857.0 isoform=CRA_e"
FT                   /db_xref="GOA:Q3TDQ5"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR013923"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="MGI:MGI:1924290"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TDQ5"
FT                   /protein_id="EDL40148.1"
FT                   /translation="MSSGLRAADFPRWKRHIAEELRRRDRLQRQAFEEIILQYTKLLEK
FT                   SDLHSVLTQKLQAEKHDMPNRHEISPGHDGAWNDSQLQEMAQLRIKHQEELTELHKKRG
FT                   ELAQLVIDLNNQMQQKDKEIQMNEAKISEYLQTISDLETNCLDLRTKLQDLEVANQTLK
FT                   DEYDALQITFTALEEKLRKTTEENQELVTRWMAEKAQEANRLNAENEKDSRRRQARLQK
FT                   ELAEAAKEPLPVEQDDDIEVIVDETSDHTEETSPVRAVSRAATRRSVSSIPVPQDIMDT
FT                   HPASGKDVRVPTTASYVFDAHDGEVNAVQFSPGSRLLATGGMDRRVKLWEAFGDKCEFK
FT                   GSLSGSNAGITSIEFDSAGAYLLAASNDFASRIWTVDDYRLRHTLTGHSGKVLSAKFLL
FT                   DNARIVSGSHDRTLKLWDLRSKVCIKTVFAGSSCNDIVCTEQCVMSGHFDKKIRFWDIR
FT                   SESVVREMELLGKITALDLNPERTELLSCSRDDLLKVIDLRTNAVKQTFSAPGFKCGSD
FT                   WTRVVFSPDGSYVAAGSAEGSLYVWSVLTGKVEKVLSKQHSSSINAVAWAPSGLHVVSV
FT                   DKGSRAVLWAQP"
FT   CDS             join(2135568..2135682,2139419..2139512,2144705..2144810,
FT                   2145476..2145549,2146173..2146424,2150752..2150817,
FT                   2153505..2153591,2154173..2154229,2154441..2154488,
FT                   2155117..2155219,2158286..2158391,2159489..2159559,
FT                   2161035..2161106,2165233..2165388)
FT                   /codon_start=1
FT                   /gene="Atg16l1"
FT                   /locus_tag="mCG_16203"
FT                   /product="autophagy-related 16-like 1 (yeast), isoform
FT                   CRA_d"
FT                   /note="gene_id=mCG16203.2 transcript_id=mCT16285.2
FT                   protein_id=mCP15646.2 isoform=CRA_d"
FT                   /protein_id="EDL40147.1"
FT                   /translation="MSSGLRAADFPRWKRHIAEELRRRDRLQRQAFEEIILQYTKLLEK
FT                   SDLHSVLTQKLQAEKHDMPNRHEISPGHDGAWNDSQLQEMAQLRIKHQEELTELHKKRG
FT                   ELAQLVIDLNNQMQQKDKEIQMNEAKISEYLQTISDLETNCLDLRTKLQDLEVANQTLK
FT                   DEYDALQITFTALEEKLRKTTEENQELVTRWMAEKAQEANRLNAENEKDSRRRQARLQK
FT                   ELAEAAKEPLPVEQDDDIEVIVDETSDHTEETSPVRAVSRAATKRLSQPAGGLLDSITN
FT                   IFGLSESPLLGHHSSDAARRRSVSSIPVPQDIMDTHPASGKDVRVPTTASYVFDAHDGE
FT                   VNAVQFSPGSRLLATGGMDRRVKLWEAFGDKCEFKGSLSGSNAGITSIEFDSAGAYLLA
FT                   ASNDFASRIWTVDDYRLRHTLTGHSGKVLSAKFLLDNARIVSGSHDRTLKLWDLRSKVC
FT                   EEMQSLCVFM"
FT   CDS             join(2139490..2139512,2144705..2144810,2145476..2145549,
FT                   2146173..2146424,2150752..2150817,2153505..2153591,
FT                   2154173..2154229,2154441..2154488,2155117..2155219,
FT                   2158286..2158391,2159489..2159559,2161035..2161106,
FT                   2165233..2165353,2165598..2165703,2168687..2168836,
FT                   2168928..2168975,2169942..2170043,2170572..2170665)
FT                   /codon_start=1
FT                   /gene="Atg16l1"
FT                   /locus_tag="mCG_16203"
FT                   /product="autophagy-related 16-like 1 (yeast), isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG16203.2 transcript_id=mCT177936.0
FT                   protein_id=mCP100858.0 isoform=CRA_b"
FT                   /protein_id="EDL40145.1"
FT                   /translation="MPNRHEISPGHDGAWNDSQLQEMAQLRIKHQEELTELHKKRGELA
FT                   QLVIDLNNQMQQKDKEIQMNEAKISEYLQTISDLETNCLDLRTKLQDLEVANQTLKDEY
FT                   DALQITFTALEEKLRKTTEENQELVTRWMAEKAQEANRLNAENEKDSRRRQARLQKELA
FT                   EAAKEPLPVEQDDDIEVIVDETSDHTEETSPVRAVSRAATKRLSQPAGGLLDSITNIFG
FT                   LSESPLLGHHSSDAARRRSVSSIPVPQDIMDTHPASGKDVRVPTTASYVFDAHDGEVNA
FT                   VQFSPGSRLLATGGMDRRVKLWEAFGDKCEFKGSLSGSNAGITSIEFDSAGAYLLAASN
FT                   DFASRIWTVDDYRLRHTLTGHSGKVLSAKFLLDNARIVSGSHDRTLKLWDLRSKVCIKT
FT                   VFAGSSCNDIVCTEQCVMSGHFDKKIRFWDIRSESVVREMELLGKITALDLNPERTELL
FT                   SCSRDDLLKVIDLRTNAVKQTFSAPGFKCGSDWTRVVFSPDGSYVAAGSAEGSLYVWSV
FT                   LTGKVEKVLSKQHSSSINAVAWAPSGLHVVSVDKGSRAVLWAQP"
FT   assembly_gap    2163878..2163897
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            2183010..2224429
FT                   /gene="Sag"
FT                   /locus_tag="mCG_16212"
FT                   /note="gene_id=mCG16212.2"
FT   mRNA            join(2183010..2183341,2184596..2184700,2189569..2189629,
FT                   2192235..2192279,2193930..2194123,2196766..2196825,
FT                   2200674..2200750,2202655..2202790,2203744..2203828,
FT                   2207506..2207578,2210998..2211135,2213709..2213786,
FT                   2216779..2216802,2220288..2220343,2224187..2224429)
FT                   /gene="Sag"
FT                   /locus_tag="mCG_16212"
FT                   /product="retinal S-antigen, transcript variant mCT16424"
FT                   /note="gene_id=mCG16212.2 transcript_id=mCT16424.2 created
FT                   on 02-JAN-2003"
FT   mRNA            join(2183010..2183341,2184596..2184700,2189569..2189629,
FT                   2192235..2192279,2193930..2194123,2196766..2196825,
FT                   2200674..2200750,2202655..2202790,2203744..2203828,
FT                   2207506..2207578,2210998..2211135,2213709..2214069)
FT                   /gene="Sag"
FT                   /locus_tag="mCG_16212"
FT                   /product="retinal S-antigen, transcript variant mCT177949"
FT                   /note="gene_id=mCG16212.2 transcript_id=mCT177949.0 created
FT                   on 02-JAN-2003"
FT   mRNA            join(2183010..2183341,2184596..2184700,2189569..2189629,
FT                   2192235..2192279,2193930..2194123,2196766..2196825,
FT                   2200674..2200750,2202655..2202790,2203744..2204082)
FT                   /gene="Sag"
FT                   /locus_tag="mCG_16212"
FT                   /product="retinal S-antigen, transcript variant mCT177950"
FT                   /note="gene_id=mCG16212.2 transcript_id=mCT177950.0 created
FT                   on 02-JAN-2003"
FT   mRNA            join(2183010..2183341,2184596..2184700,2189569..2189629,
FT                   2192235..2192279,2193930..2194123,2196766..2197082)
FT                   /gene="Sag"
FT                   /locus_tag="mCG_16212"
FT                   /product="retinal S-antigen, transcript variant mCT177948"
FT                   /note="gene_id=mCG16212.2 transcript_id=mCT177948.0 created
FT                   on 02-JAN-2003"
FT   mRNA            join(<2183221..2183341,2184596..2184700,2189569..2189629,
FT                   2192235..2192279,2193930..2194123,2196766..2196825,
FT                   2200674..2200750,2202655..2202790,2203744..2203828,
FT                   2207506..2207578,2210998..2211135,2213709..2213786,
FT                   2216779..2216802,2220288..2220347,2224187..2224429)
FT                   /gene="Sag"
FT                   /locus_tag="mCG_16212"
FT                   /product="retinal S-antigen, transcript variant mCT193765"
FT                   /note="gene_id=mCG16212.2 transcript_id=mCT193765.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<2184611..2184700,2189569..2189629,2192235..2192279,
FT                   2193930..2194123,2196766..2196825,2200674..2200750,
FT                   2202655..2202790,2203744..2203828,2207506..2207578,
FT                   2210998..2211135,2213709..2213786,2216779..2216802,
FT                   2220288..2220347,2224187..2224295)
FT                   /codon_start=1
FT                   /gene="Sag"
FT                   /locus_tag="mCG_16212"
FT                   /product="retinal S-antigen, isoform CRA_d"
FT                   /note="gene_id=mCG16212.2 transcript_id=mCT193765.0
FT                   protein_id=mCP114744.0 isoform=CRA_d"
FT                   /protein_id="EDL40142.1"
FT                   /translation="RTSQGTDNMAACGKTNKSHVIFKKVSRDKSVTIYLGKRDYVDHVS
FT                   QVEPVDGVVLVDPELVKGKKVYVTLTCAFRYGQEDIDVMGLTFRRDLYFSRVQVYPPVG
FT                   AMSVLTQLQESLLKKLGDNTYPFLLTFPDYLPCSVMLQPAPQDVGKSCGVDFEVKAFAS
FT                   DITDPEEDKIPKKSSVRLLIRKVQHAPPEMGPQPSAEASWQFFMSDKPLNLSVSLSKEI
FT                   YFHGEPIPVTVTVTNNTDKVVKKIKVSVEQIANVVLYSSDYYVKPVASEETQEKVQPNS
FT                   TLTKTLVLVPLLANNRERRGIALDGKIKHEDTNLASSTIIKEGIDRTVMGILVSYHIKV
FT                   KLTVSGFLGELTSSEVATEVPFRLMHPQPEDPGHVQDENLVFEEFARQNLKDTGENTEG
FT                   KKDEDAGQDE"
FT   CDS             join(2184635..2184700,2189569..2189629,2192235..2192279,
FT                   2193930..2194123,2196766..2196825,2200674..2200750,
FT                   2202655..2202790,2203744..2203828,2207506..2207578,
FT                   2210998..2211135,2213709..2213786,2216779..2216802,
FT                   2220288..2220343,2224187..2224236)
FT                   /codon_start=1
FT                   /gene="Sag"
FT                   /locus_tag="mCG_16212"
FT                   /product="retinal S-antigen, isoform CRA_e"
FT                   /note="gene_id=mCG16212.2 transcript_id=mCT16424.2
FT                   protein_id=mCP15654.2 isoform=CRA_e"
FT                   /protein_id="EDL40143.1"
FT                   /translation="MAACGKTNKSHVIFKKVSRDKSVTIYLGKRDYVDHVSQVEPVDGV
FT                   VLVDPELVKGKKVYVTLTCAFRYGQEDIDVMGLTFRRDLYFSRVQVYPPVGAMSVLTQL
FT                   QESLLKKLGDNTYPFLLTFPDYLPCSVMLQPAPQDVGKSCGVDFEVKAFASDITDPEED
FT                   KIPKKSSVRLLIRKVQHAPPEMGPQPSAEASWQFFMSDKPLNLSVSLSKEIYFHGEPIP
FT                   VTVTVTNNTDKVVKKIKVSVEQIANVVLYSSDYYVKPVASEETQEKVQPNSTLTKTLVL
FT                   VPLLANNRERRGIALDGKIKHEDTNLASSTIIKEGIDRTVMGILVSYHIKVKLTVSGFL
FT                   GELTSSEVATEVPFRLMHPQPEDPVFRMKIWFLKSLLAKI"
FT   CDS             join(2184635..2184700,2189569..2189629,2192235..2192279,
FT                   2193930..2194123,2196766..2196825,2200674..2200750,
FT                   2202655..2202790,2203744..2203828,2207506..2207578,
FT                   2210998..2211135,2213709..2213790)
FT                   /codon_start=1
FT                   /gene="Sag"
FT                   /locus_tag="mCG_16212"
FT                   /product="retinal S-antigen, isoform CRA_b"
FT                   /note="gene_id=mCG16212.2 transcript_id=mCT177949.0
FT                   protein_id=mCP100871.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q8C8Y8"
FT                   /db_xref="InterPro:IPR000698"
FT                   /db_xref="InterPro:IPR011021"
FT                   /db_xref="InterPro:IPR011022"
FT                   /db_xref="InterPro:IPR014752"
FT                   /db_xref="InterPro:IPR014753"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017864"
FT                   /db_xref="MGI:MGI:98227"
FT                   /db_xref="UniProtKB/TrEMBL:Q8C8Y8"
FT                   /protein_id="EDL40140.1"
FT                   /translation="MAACGKTNKSHVIFKKVSRDKSVTIYLGKRDYVDHVSQVEPVDGV
FT                   VLVDPELVKGKKVYVTLTCAFRYGQEDIDVMGLTFRRDLYFSRVQVYPPVGAMSVLTQL
FT                   QESLLKKLGDNTYPFLLTFPDYLPCSVMLQPAPQDVGKSCGVDFEVKAFASDITDPEED
FT                   KIPKKSSVRLLIRKVQHAPPEMGPQPSAEASWQFFMSDKPLNLSVSLSKEIYFHGEPIP
FT                   VTVTVTNNTDKVVKKIKVSVEQIANVVLYSSDYYVKPVASEETQEKVQPNSTLTKTLVL
FT                   VPLLANNRERRGIALDGKIKHEDTNLASSTIIKEGIDRTVMGILVSYHIKVKLTVSG"
FT   CDS             join(2184635..2184700,2189569..2189629,2192235..2192279,
FT                   2193930..2194123,2196766..2196825,2200674..2200750,
FT                   2202655..2202790,2203744..2203869)
FT                   /codon_start=1
FT                   /gene="Sag"
FT                   /locus_tag="mCG_16212"
FT                   /product="retinal S-antigen, isoform CRA_c"
FT                   /note="gene_id=mCG16212.2 transcript_id=mCT177950.0
FT                   protein_id=mCP100872.0 isoform=CRA_c"
FT                   /protein_id="EDL40141.1"
FT                   /translation="MAACGKTNKSHVIFKKVSRDKSVTIYLGKRDYVDHVSQVEPVDGV
FT                   VLVDPELVKGKKVYVTLTCAFRYGQEDIDVMGLTFRRDLYFSRVQVYPPVGAMSVLTQL
FT                   QESLLKKLGDNTYPFLLTFPDYLPCSVMLQPAPQDVGKSCGVDFEVKAFASDITDPEED
FT                   KIPKKSSVRLLIRKVQHAPPEMGPQPSAEASWQFFMSDKPLNLSVSLSKEIYFHGEPIP
FT                   VTVTVTNNTDKVVKKIKVSGGTLISILRLGAF"
FT   CDS             join(2184635..2184700,2189569..2189629,2192235..2192279,
FT                   2193930..2194123,2196766..2196834)
FT                   /codon_start=1
FT                   /gene="Sag"
FT                   /locus_tag="mCG_16212"
FT                   /product="retinal S-antigen, isoform CRA_a"
FT                   /note="gene_id=mCG16212.2 transcript_id=mCT177948.0
FT                   protein_id=mCP100870.0 isoform=CRA_a"
FT                   /protein_id="EDL40139.1"
FT                   /translation="MAACGKTNKSHVIFKKVSRDKSVTIYLGKRDYVDHVSQVEPVDGV
FT                   VLVDPELVKGKKVYVTLTCAFRYGQEDIDVMGLTFRRDLYFSRVQVYPPVGAMSVLTQL
FT                   QESLLKKLGDNTYPFLLTFPDYLPCSVMLQPAPQDVGKVS"
FT   assembly_gap    2199526..2199725
FT                   /estimated_length=200
FT                   /gap_type="unknown"
FT   assembly_gap    2209727..2209746
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2215876..2216407
FT                   /estimated_length=532
FT                   /gap_type="unknown"
FT   assembly_gap    2217878..2218011
FT                   /estimated_length=134
FT                   /gap_type="unknown"
FT   assembly_gap    2232390..2232566
FT                   /estimated_length=177
FT                   /gap_type="unknown"
FT   assembly_gap    2243785..2243804
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2247285..2247472
FT                   /estimated_length=188
FT                   /gap_type="unknown"
FT   assembly_gap    2252096..2252160
FT                   /estimated_length=65
FT                   /gap_type="unknown"
FT   assembly_gap    2254001..2254020
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <2259578..2325167
FT                   /locus_tag="mCG_131116"
FT                   /note="gene_id=mCG131116.1"
FT   mRNA            join(<2259578..2259690,2261075..2261155,2294556..2294660,
FT                   2294948..2295080,2295824..2295930,2296260..2296385,
FT                   2297354..2297456,2298021..2298183,2301035..2301433)
FT                   /locus_tag="mCG_131116"
FT                   /product="mCG131116, transcript variant mCT179528"
FT                   /note="gene_id=mCG131116.1 transcript_id=mCT179528.0
FT                   created on 04-FEB-2003"
FT   mRNA            join(<2259579..2259690,2261075..2261155,2294556..2294660,
FT                   2294948..2295080,2295824..2295930,2296260..2296385,
FT                   2297354..2297456,2298021..2298183,2301035..2301143,
FT                   2303533..2303672,2303941..2304025,2305168..2305262,
FT                   2305347..2305446,2305525..2305798,2306341..2306499,
FT                   2307160..2307285,2309219..2309315,2311410..2311520,
FT                   2313584..2313680,2313872..2313997,2314816..2314929,
FT                   2315762..2315896,2316228..2316379,2317633..2317744,
FT                   2317825..2317917,2318675..2318794,2319656..2319785,
FT                   2321862..2324659)
FT                   /locus_tag="mCG_131116"
FT                   /product="mCG131116, transcript variant mCT179526"
FT                   /note="gene_id=mCG131116.1 transcript_id=mCT179526.0
FT                   created on 04-FEB-2003"
FT   mRNA            join(<2259580..2259690,2261075..2261155,2294556..2294660,
FT                   2294948..2295080,2295824..2295930,2296260..2296385,
FT                   2297354..2297456,2298021..2298183,2301035..2301143,
FT                   2303533..2303672,2303941..2304025,2305168..2305262,
FT                   2305347..2305446,2305525..2305798,2306341..2306499,
FT                   2307160..2307285,2309219..2309315,2311410..2311520,
FT                   2313584..2313680,2313872..2313979,2314816..2314929,
FT                   2315762..2315896,2316228..2316379,2317633..2317744,
FT                   2317825..2317917,2318675..2318794,2319656..2319785,
FT                   2320848..2320978,2321862..2325167)
FT                   /locus_tag="mCG_131116"
FT                   /product="mCG131116, transcript variant mCT132444"
FT                   /note="gene_id=mCG131116.1 transcript_id=mCT132444.1
FT                   created on 04-FEB-2003"
FT   CDS             join(<2259580..2259690,2261075..2261155,2294556..2294660,
FT                   2294948..2295080,2295824..2295930,2296260..2296385,
FT                   2297354..2297456,2298021..2298183,2301035..2301143,
FT                   2303533..2303672,2303941..2304025,2305168..2305262,
FT                   2305347..2305446,2305525..2305798,2306341..2306499,
FT                   2307160..2307285,2309219..2309315,2311410..2311520,
FT                   2313584..2313680,2313872..2313997,2314816..2314929,
FT                   2315762..2315896,2316228..2316379,2317633..2317744,
FT                   2317825..2317917,2318675..2318794,2319656..2319785,
FT                   2321862..2321995)
FT                   /codon_start=1
FT                   /locus_tag="mCG_131116"
FT                   /product="mCG131116, isoform CRA_b"
FT                   /note="gene_id=mCG131116.1 transcript_id=mCT179526.0
FT                   protein_id=mCP102449.0 isoform=CRA_b"
FT                   /protein_id="EDL40136.1"
FT                   /translation="TILKEGMLTKQNNSFQRSKRRYFKLRGRTLYYAKTAKSIIFDEVD
FT                   LTDASVAESSTKNVNNSFTVITPCRKLILCADNRKEMEDWIAALKTVQNKEHFEPTQYS
FT                   MDHFSGMHNWYACSHARPTYCNVCREVLSGVTSHGLSCEVCKFKAHKRCAVRATSNCKW
FT                   TTLASIGKDIIEDEDGIAMPHQWLEGNLPVSAKCIVCDKTCGSVLRLQDWRCLWCKAMV
FT                   HTSCKESLVMKCPLGLCKVSVIPPTALNSIDSDGFWKATCPPSCTSPLLVFVNSKSGDN
FT                   QGVKFLRRFKQLLNPAQVFDLMNGGPHLGLRLFQKFDTFRILVCGGDGSVGWVLSEIDS
FT                   LNLHKQCQLGVLPLGTGNDLARVLGWGSACDDDTQLPQILAKLERASTKMLDRWSVMAY
FT                   ETKLPRQASSSTVTEDFSEDSEVQQILFYEDSVAAHLSKILTSDQHSVVISSAKVLCET
FT                   VKDFVARVGKAYEKTTESSQESEVMAKKCSVLKEKLDSLLKTLDDESQASSSLSNPPPT
FT                   IAEEAEDGDGSGNICSSTGDHLVGSACPSRPQIFRPREQLMLRANSLKKAIRQIIEHTE
FT                   KAVDEQNAQTQEQQGFVLGLSESEKKDLKTDNRVCTSSVHSESCVIAKGRSQRKASRAP
FT                   CEKLVSKGLSLGSSASLPPGTGSRDSLPALNTKILYPSVRAGMSGSLPGGSVISRLLIN
FT                   ADPFNAEPENLEYYTEKCVMNNYFGIGLDAKISLDFNNKRDEHPEKCRSRTKNMMWYGV
FT                   LGTKELLHRTYRNLEQKVLLECDGRPIPLPSLQGIAVLNIPSYAGGTNFWGGTKEDDVR
FT                   MGFETFAAPSFDDKILEVVAVFGSMQMAVSRVIKLQHHRIAQCRTVKISILGDEGVPVQ
FT                   VDGEAWIQPPGYIRIVHKNRAQTLTRDRAFENTLKSWEDKQKCELSRPPSFSLHPEILS
FT                   EEEATQMDQFGQAAGGLIHSIREIAQSHRAMEQELAHAVNASSKAMERVYGKPRTAEGL
FT                   NCSFVLEMVNNIRALRSETELLLAGKMALQLDPPQKERLGAALIEMDQQLRKLTDTPWL
FT                   CQPLEPGEEESLQQNVMLDLTKRSRSGKFRLVTKFKKEKNNKNKEVHSNLGGPGPWCDQ
FT                   SGPYEEDPLWDQGAEPELPCRRGLASAFSACILRSSRD"
FT   CDS             join(<2259580..2259690,2261075..2261155,2294556..2294660,
FT                   2294948..2295080,2295824..2295930,2296260..2296385,
FT                   2297354..2297456,2298021..2298183,2301035..2301143,
FT                   2303533..2303672,2303941..2304025,2305168..2305262,
FT                   2305347..2305446,2305525..2305798,2306341..2306499,
FT                   2307160..2307285,2309219..2309315,2311410..2311520,
FT                   2313584..2313680,2313872..2313979,2314816..2314929,
FT                   2315762..2315896,2316228..2316379,2317633..2317744,
FT                   2317825..2317917,2318675..2318794,2319656..2319785,
FT                   2320848..2320978,2321862..2321951)
FT                   /codon_start=1
FT                   /locus_tag="mCG_131116"
FT                   /product="mCG131116, isoform CRA_a"
FT                   /note="gene_id=mCG131116.1 transcript_id=mCT132444.1
FT                   protein_id=mCP82473.1 isoform=CRA_a"
FT                   /protein_id="EDL40135.1"
FT                   /translation="TILKEGMLTKQNNSFQRSKRRYFKLRGRTLYYAKTAKSIIFDEVD
FT                   LTDASVAESSTKNVNNSFTVITPCRKLILCADNRKEMEDWIAALKTVQNKEHFEPTQYS
FT                   MDHFSGMHNWYACSHARPTYCNVCREVLSGVTSHGLSCEVCKFKAHKRCAVRATSNCKW
FT                   TTLASIGKDIIEDEDGIAMPHQWLEGNLPVSAKCIVCDKTCGSVLRLQDWRCLWCKAMV
FT                   HTSCKESLVMKCPLGLCKVSVIPPTALNSIDSDGFWKATCPPSCTSPLLVFVNSKSGDN
FT                   QGVKFLRRFKQLLNPAQVFDLMNGGPHLGLRLFQKFDTFRILVCGGDGSVGWVLSEIDS
FT                   LNLHKQCQLGVLPLGTGNDLARVLGWGSACDDDTQLPQILAKLERASTKMLDRWSVMAY
FT                   ETKLPRQASSSTVTEDFSEDSEVQQILFYEDSVAAHLSKILTSDQHSVVISSAKVLCET
FT                   VKDFVARVGKAYEKTTESSQESEVMAKKCSVLKEKLDSLLKTLDDESQASSSLSNPPPT
FT                   IAEEAEDGDGSGNICSSTGDHLVGSACPSRPQIFRPREQLMLRANSLKKAIRQIIEHTE
FT                   KAVDEQNAQTQEQQGFVLGLSESEKKDLKTDNRVCTSSVHSESCVIAKGRSQRKASRAP
FT                   CEKLVSKGLSLGSSASLPPGTGSRDSLPALNTKILYPSVRAGMSGSLPGGSVISRLLIN
FT                   ADPFNAEPENLEYYTEKCVMNNYFGIGLDAKISLDFNNKRDEHPEKCRSRTKNMMWYGV
FT                   LGTKELLHRTYRNLEQKVLLECDGRPIPLPSLQGIAVLNIPSYAGGTNFWGGTKEDDTF
FT                   AAPSFDDKILEVVAVFGSMQMAVSRVIKLQHHRIAQCRTVKISILGDEGVPVQVDGEAW
FT                   IQPPGYIRIVHKNRAQTLTRDRAFENTLKSWEDKQKCELSRPPSFSLHPEILSEEEATQ
FT                   MDQFGQAAGGLIHSIREIAQSHRAMEQELAHAVNASSKAMERVYGKPRTAEGLNCSFVL
FT                   EMVNNIRALRSETELLLAGKMALQLDPPQKERLGAALIEMDQQLRKLTDTPWLCQPLEP
FT                   GEEESLQQNVMLDLTKRSRSGKFRLVTKFKKEKNNKNKEVHSNLGGPVHLWGTEEVAAW
FT                   LEHLSLCEYKDIFTRHDIRGSELLHLERRDLKDLGVTKVGHMKRILCGIKELSRSSPAA
FT                   EA"
FT   CDS             join(<2259580..2259690,2261075..2261155,2294556..2294660,
FT                   2294948..2295080,2295824..2295930,2296260..2296385,
FT                   2297354..2297456,2298021..2298183,2301035..2301209)
FT                   /codon_start=1
FT                   /locus_tag="mCG_131116"
FT                   /product="mCG131116, isoform CRA_c"
FT                   /note="gene_id=mCG131116.1 transcript_id=mCT179528.0
FT                   protein_id=mCP102448.0 isoform=CRA_c"
FT                   /protein_id="EDL40137.1"
FT                   /translation="TILKEGMLTKQNNSFQRSKRRYFKLRGRTLYYAKTAKSIIFDEVD
FT                   LTDASVAESSTKNVNNSFTVITPCRKLILCADNRKEMEDWIAALKTVQNKEHFEPTQYS
FT                   MDHFSGMHNWYACSHARPTYCNVCREVLSGVTSHGLSCEVCKFKAHKRCAVRATSNCKW
FT                   TTLASIGKDIIEDEDGIAMPHQWLEGNLPVSAKCIVCDKTCGSVLRLQDWRCLWCKAMV
FT                   HTSCKESLVMKCPLGLCKVSVIPPTALNSIDSDGFWKATCPPSCTSPLLVFVNSKSGDN
FT                   QGVKFLRRFKQLLNPAQVFDLMNGGPHLGLRLFQKFDTFRILVCGGDGSVGWVLSEIDS
FT                   LNLHKQVLQTGVEGHPTVMDEWENHVG"
FT   mRNA            join(<2259647..2259690,2261075..2261155,2294556..2294660,
FT                   2294948..2295200)
FT                   /locus_tag="mCG_131116"
FT                   /product="mCG131116, transcript variant mCT179527"
FT                   /note="gene_id=mCG131116.1 transcript_id=mCT179527.0
FT                   created on 04-FEB-2003"
FT   CDS             join(<2259649..2259690,2261075..2261155,2294556..2294660,
FT                   2294948..2295184)
FT                   /codon_start=1
FT                   /locus_tag="mCG_131116"
FT                   /product="mCG131116, isoform CRA_d"
FT                   /note="gene_id=mCG131116.1 transcript_id=mCT179527.0
FT                   protein_id=mCP102450.0 isoform=CRA_d"
FT                   /protein_id="EDL40138.1"
FT                   /translation="KLRGRTLYYAKTAKSIIFDEVDLTDASVAESSTKNVNNSFTVITP
FT                   CRKLILCADNRKEMEDWIAALKTVQNKEHFEPTQYSMDHFSGMHNWYACSHARPTYCNV
FT                   CREVLSGVTSHGLSCEGKKAAFVTLVKGDRRFYLINCLKFKNSLNKNIAA"
FT   assembly_gap    2268134..2268416
FT                   /estimated_length=283
FT                   /gap_type="unknown"
FT   assembly_gap    2284870..2285316
FT                   /estimated_length=447
FT                   /gap_type="unknown"
FT   assembly_gap    2290583..2290602
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(2324245..2388648)
FT                   /locus_tag="mCG_142257"
FT                   /note="gene_id=mCG142257.0"
FT   mRNA            complement(join(2324245..2326187,2327982..2328076,
FT                   2329415..2329510,2329642..2329852,2331126..2331191,
FT                   2331823..2331941,2333634..2333728,2336700..2336823,
FT                   2339274..2339348,2341909..2341973,2344814..2344850,
FT                   2346692..2346778,2347018..2347106,2347904..2347957,
FT                   2353557..2353614,2355291..2355414,2357794..2358116,
FT                   2359489..2359559,2360446..2360530,2361486..2361657,
FT                   2363231..2363312,2365377..2365674,2368367..2368474,
FT                   2369543..2369638,2374268..2374396,2375815..2375958,
FT                   2377917..2378063,2379848..2380012,2382527..2382640,
FT                   2384360..2384427,2387321..2387538,2388534..2388630))
FT                   /locus_tag="mCG_142257"
FT                   /product="mCG142257, transcript variant mCT179568"
FT                   /note="gene_id=mCG142257.0 transcript_id=mCT179568.0
FT                   created on 04-FEB-2003"
FT   CDS             complement(join(2326076..2326187,2327982..2328076,
FT                   2329415..2329510,2329642..2329852,2331126..2331191,
FT                   2331823..2331941,2333634..2333728,2336700..2336823,
FT                   2339274..2339348,2341909..2341973,2344814..2344850,
FT                   2346692..2346778,2347018..2347106,2347904..2347957,
FT                   2353557..2353614,2355291..2355414,2357794..2358116,
FT                   2359489..2359559,2360446..2360530,2361486..2361657,
FT                   2363231..2363312,2365377..2365674,2368367..2368474,
FT                   2369543..2369638,2374268..2374396,2375815..2375958,
FT                   2377917..2378063,2379848..2380012,2382527..2382640,
FT                   2384360..2384427,2387321..2387519))
FT                   /codon_start=1
FT                   /locus_tag="mCG_142257"
FT                   /product="mCG142257, isoform CRA_d"
FT                   /note="gene_id=mCG142257.0 transcript_id=mCT179568.0
FT                   protein_id=mCP102490.0 isoform=CRA_d"
FT                   /protein_id="EDL40134.1"
FT                   /translation="MFGNLFEEDYSSVSSSQYGRGKKLKTKGLEPPAPREFTNLSGIRN
FT                   QGGTCYLSSLLQTLHFTPEFREALFSLGPEELGSLEDKDKPDAKVRIIPLQLQRLFAQL
FT                   LLLDQEAASTIDLTDSFGWTNDEEMRQHDVQELNRILFSALETSLVGTSGHDLIHRLYH
FT                   GTIVNQIVCKECKNISERQEDFLDLTVAVKNVSGLEDALCNMYVEEEIFDYDNLYHCGT
FT                   CDRLVKAAKSAKLRKLPPFLTISLLRFNFDFVKCERYKDTSCYTFPLRINLKPFCEQSE
FT                   LDDMEYMYDLFSVIIHKGGCYGGHYHVYIKDVDHLGNWQCQEEISDTNVNVKAPQSEEE
FT                   ANDPLVVLKTILLQEEANQIPVDQLGQKLLKKTGISWNKKYRKQHGPLRKFLQLHPQIF
FT                   LLSTDESTVSLLRNHLTQAPSDLQSCEQILHTLASESPGLNDDTSCPHWFDINDSKVHP
FT                   IREKDITQQFQGKESAYMLFYRKATLQRPPEARANPRYRVPCHLLKEMDAANILLQMRR
FT                   AECDSANSTFELHLHLGPHYRFFNGALHPAVSETESVWDLTFDKRKTLGDLRQSIFQLL
FT                   ECWEGDMVLSVAKRVPAGLHVYHTLDGDDLTLCEAEVADGEDIFVWNGVEVGGVQIQTG
FT                   FDCEPLLLNILHLELSGEGSKCEQLVESPHVFPANAEVGAVFTALGTPAGAILMNSVES
FT                   ADGECWTAVPKEDMKKTFREQGLRNGSLILVQDSDSDNNSLLPKQGRWTNSMNELNWLQ
FT                   VKNFCQSESEEKQVQIAVTMHTVVFDIRIKAIKELKLMKELAENSCLRPIDRNGKLLCP
FT                   VPDSSTLEEAEVKMGSSVGLCLGKAPTSSQLFLFFALGTDIHPGAEMDIIVEETLSVRD
FT                   CLKIMLEKSGQQGEIWHLRKMDWCYEAGEPLCEEDATLKELMIRSGDTLLLTEGKLPPP
FT                   GHLKMPIWWYQPARLSGHCESRDHLNCAFSQDSTWRAAPTQGAPGPEPAEVSLLYLGDM
FT                   EISEEATLVELKSQALALPSVSKLAVQSTALLRVWTVESKRPSRLLRTNWRQLKEYRLG
FT                   RRAELCLELLQKEEDLGPRDVLLRTQLRIPGERAYSLATDLIWDTTRGWTAGSLRQRVA
FT                   DFYSLPVEKIEIAKYFPEKFEWLPISSWNQQVAKRKKKKNQDTLQGGPYYLKDGDTIGI
FT                   KNLLFDDNDDFSTIRDDIGKENQKRLALEKKKSREVHRAQSSDLFSNAGVPARFRGPEA
FT                   SLSIHVASFR"
FT   mRNA            complement(join(2329182..2329510,2329642..2329852,
FT                   2331126..2331191,2331823..2331941,2333634..2333728,
FT                   2336700..2336823,2339274..2339348,2341909..2341973,
FT                   2344814..2344850,2346692..2346778,2347018..2347106,
FT                   2355291..2355414,2357794..2358116,2359489..2359559,
FT                   2360446..2360530,2361486..2361657,2363231..2363312,
FT                   2365377..2365674,2368367..2368474,2369543..2369638,
FT                   2374268..2374396,2375815..2375958,2377917..2378063,
FT                   2379848..2380012,2382527..2382640,2384360..2384427,
FT                   2387321..2387538,2388534..2388647))
FT                   /locus_tag="mCG_142257"
FT                   /product="mCG142257, transcript variant mCT179566"
FT                   /note="gene_id=mCG142257.0 transcript_id=mCT179566.0
FT                   created on 04-FEB-2003"
FT   mRNA            complement(join(2329182..2329510,2329642..2329852,
FT                   2331126..2331191,2331823..2331941,2333634..2333728,
FT                   2336700..2336823,2339274..2339348,2341909..2341973,
FT                   2344814..2344850,2346692..2346778,2347018..2347106,
FT                   2347904..2347957,2353557..2353614,2355291..2355414,
FT                   2357794..2358116,2359489..2359559,2360446..2360530,
FT                   2361486..2361657,2363231..2363312,2365377..2365674,
FT                   2368367..2368474,2369543..2369638,2374268..2374396,
FT                   2375815..2375958,2377917..2378063,2379848..2380012,
FT                   2382527..2382640,2384360..2384427,2387321..2387538,
FT                   2388534..2388644))
FT                   /locus_tag="mCG_142257"
FT                   /product="mCG142257, transcript variant mCT179565"
FT                   /note="gene_id=mCG142257.0 transcript_id=mCT179565.0
FT                   created on 04-FEB-2003"
FT   CDS             complement(join(2329406..2329510,2329642..2329852,
FT                   2331126..2331191,2331823..2331941,2333634..2333728,
FT                   2336700..2336823,2339274..2339348,2341909..2341973,
FT                   2344814..2344850,2346692..2346778,2347018..2347106,
FT                   2347904..2347957,2353557..2353614,2355291..2355414,
FT                   2357794..2358116,2359489..2359559,2360446..2360530,
FT                   2361486..2361657,2363231..2363312,2365377..2365674,
FT                   2368367..2368474,2369543..2369638,2374268..2374396,
FT                   2375815..2375958,2377917..2378063,2379848..2380012,
FT                   2382527..2382640,2384360..2384427,2387321..2387519))
FT                   /codon_start=1
FT                   /locus_tag="mCG_142257"
FT                   /product="mCG142257, isoform CRA_a"
FT                   /note="gene_id=mCG142257.0 transcript_id=mCT179565.0
FT                   protein_id=mCP102488.0 isoform=CRA_a"
FT                   /protein_id="EDL40131.1"
FT                   /translation="MFGNLFEEDYSSVSSSQYGRGKKLKTKGLEPPAPREFTNLSGIRN
FT                   QGGTCYLSSLLQTLHFTPEFREALFSLGPEELGSLEDKDKPDAKVRIIPLQLQRLFAQL
FT                   LLLDQEAASTIDLTDSFGWTNDEEMRQHDVQELNRILFSALETSLVGTSGHDLIHRLYH
FT                   GTIVNQIVCKECKNISERQEDFLDLTVAVKNVSGLEDALCNMYVEEEIFDYDNLYHCGT
FT                   CDRLVKAAKSAKLRKLPPFLTISLLRFNFDFVKCERYKDTSCYTFPLRINLKPFCEQSE
FT                   LDDMEYMYDLFSVIIHKGGCYGGHYHVYIKDVDHLGNWQCQEEISDTNVNVKAPQSEEE
FT                   ANDPLVVLKTILLQEEANQIPVDQLGQKLLKKTGISWNKKYRKQHGPLRKFLQLHPQIF
FT                   LLSTDESTVSLLRNHLTQAPSDLQSCEQILHTLASESPGLNDDTSCPHWFDINDSKVHP
FT                   IREKDITQQFQGKESAYMLFYRKATLQRPPEARANPRYRVPCHLLKEMDAANILLQMRR
FT                   AECDSANSTFELHLHLGPHYRFFNGALHPAVSETESVWDLTFDKRKTLGDLRQSIFQLL
FT                   ECWEGDMVLSVAKRVPAGLHVYHTLDGDDLTLCEAEVADGEDIFVWNGVEVGGVQIQTG
FT                   FDCEPLLLNILHLELSGEGSKCEQLVESPHVFPANAEVGAVFTALGTPAGAILMNSVES
FT                   ADGECWTAVPKEDMKKTFREQGLRNGSLILVQDSDSDNNSLLPKQGRWTNSMNELNWLQ
FT                   VKNFCQSESEEKQVQIAVTMHTVVFDIRIKAIKELKLMKELAENSCLRPIDRNGKLLCP
FT                   VPDSSTLEEAEVKMGSSVGLCLGKAPTSSQLFLFFALGTDIHPGAEMDIIVEETLSVRD
FT                   CLKIMLEKSGQQGEIWHLRKMDWCYEAGEPLCEEDATLKELMIRSGDTLLLTEGKLPPP
FT                   GHLKMPIWWYQPARLSGHCESRDHLNCAFSQDSTWRAAPTQGAPGPEPAEVSLLYLGDM
FT                   EISEEATLVELKSQALALPSVSKLAVQSTALLRVWTVESKRPSRLLRTNWRQLKEYRLG
FT                   RRAELCLELLQKEEDLGPRDVLLRTQLRIPGERAYSLATDLIWDTTRGWTAGSLRQRVA
FT                   DFYSLPVEKIEIAKYFPEKFEWLPISSWNQQVAKRKKKKNQDTLQGGPYYLKDGDTIGI
FT                   KVG"
FT   CDS             complement(join(2347071..2347106,2355291..2355414,
FT                   2357794..2358116,2359489..2359559,2360446..2360530,
FT                   2361486..2361657,2363231..2363312,2365377..2365674,
FT                   2368367..2368474,2369543..2369638,2374268..2374396,
FT                   2375815..2375958,2377917..2378063,2379848..2380012,
FT                   2382527..2382640,2384360..2384427,2387321..2387519))
FT                   /codon_start=1
FT                   /locus_tag="mCG_142257"
FT                   /product="mCG142257, isoform CRA_b"
FT                   /note="gene_id=mCG142257.0 transcript_id=mCT179566.0
FT                   protein_id=mCP102487.0 isoform=CRA_b"
FT                   /protein_id="EDL40132.1"
FT                   /translation="MFGNLFEEDYSSVSSSQYGRGKKLKTKGLEPPAPREFTNLSGIRN
FT                   QGGTCYLSSLLQTLHFTPEFREALFSLGPEELGSLEDKDKPDAKVRIIPLQLQRLFAQL
FT                   LLLDQEAASTIDLTDSFGWTNDEEMRQHDVQELNRILFSALETSLVGTSGHDLIHRLYH
FT                   GTIVNQIVCKECKNISERQEDFLDLTVAVKNVSGLEDALCNMYVEEEIFDYDNLYHCGT
FT                   CDRLVKAAKSAKLRKLPPFLTISLLRFNFDFVKCERYKDTSCYTFPLRINLKPFCEQSE
FT                   LDDMEYMYDLFSVIIHKGGCYGGHYHVYIKDVDHLGNWQCQEEISDTNVNVKAPQSEEE
FT                   ANDPLVVLKTILLQEEANQIPVDQLGQKLLKKTGISWNKKYRKQHGPLRKFLQLHPQIF
FT                   LLSTDESTVSLLRNHLTQAPSDLQSCEQILHTLASESPGLNDDTSCPHWFDINDSKVHP
FT                   IREKDITQQFQGKESAYMLFYRKATLQRPPEARANPRYRVPCHLLKEMDAANILLQMRR
FT                   AECDSANSTFELHLHLGPHYRFFNGALHPAVSETESVWDLTFDKRKTLGDLRQSIFQLL
FT                   ECWEGDMVLSVAKRVPAGLHVYHTLDGDDLTLCEAEVADGEDIFVWNGVEVGGVQIQTG
FT                   FDCEPLLLNILHLELSGEGSKCEQLVESPHVFPANAEVGAVFTALGTPAGAILMNSVES
FT                   ADGECWTAVPKEDMKKTFREQGLRNGSLILVQDSDSDNNSLLPKQGRWTNSMNELNWLQ
FT                   VKNFCQSESEEKQVQIAVTMHTSQTVALWRKQR"
FT   assembly_gap    2351407..2351426
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2370160..2370179
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            complement(join(2385999..2387538,2388534..2388648))
FT                   /locus_tag="mCG_142257"
FT                   /product="mCG142257, transcript variant mCT179567"
FT                   /note="gene_id=mCG142257.0 transcript_id=mCT179567.0
FT                   created on 04-FEB-2003"
FT   CDS             complement(2387268..2387519)
FT                   /codon_start=1
FT                   /locus_tag="mCG_142257"
FT                   /product="mCG142257, isoform CRA_c"
FT                   /note="gene_id=mCG142257.0 transcript_id=mCT179567.0
FT                   protein_id=mCP102489.0 isoform=CRA_c"
FT                   /protein_id="EDL40133.1"
FT                   /translation="MFGNLFEEDYSSVSSSQYGRGKKLKTKGLEPPAPREFTNLSGIRN
FT                   QGGTCYLSSLLQTLHFTPEFRGMLCDMHLNNMYRGLYM"
FT   gene            2401780..2403703
FT                   /pseudo
FT                   /locus_tag="mCG_16211"
FT                   /note="gene_id=mCG16211.2"
FT   mRNA            2401780..2403703
FT                   /pseudo
FT                   /locus_tag="mCG_16211"
FT                   /note="gene_id=mCG16211.2 transcript_id=mCT16423.2 created
FT                   on 04-FEB-2003"
FT   gene            2404737..2405561
FT                   /pseudo
FT                   /locus_tag="mCG_1047516"
FT                   /note="gene_id=mCG1047516.0"
FT   mRNA            2404737..2405561
FT                   /pseudo
FT                   /locus_tag="mCG_1047516"
FT                   /note="gene_id=mCG1047516.0 transcript_id=mCT165220.0
FT                   created on 31-JUL-2003"
FT   gene            2410263..2411503
FT                   /pseudo
FT                   /locus_tag="mCG_146402"
FT                   /note="gene_id=mCG146402.0"
FT   mRNA            join(2410263..2410776,2411217..2411503)
FT                   /pseudo
FT                   /locus_tag="mCG_146402"
FT                   /note="gene_id=mCG146402.0 transcript_id=mCT186618.0
FT                   created on 31-JUL-2003"
FT   assembly_gap    2413016..2416856
FT                   /estimated_length=3841
FT                   /gap_type="unknown"
FT   assembly_gap    2420350..2420369
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2423873..2423892
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2425016..2425421
FT                   /estimated_length=406
FT                   /gap_type="unknown"
FT   assembly_gap    2427911..2433275
FT                   /estimated_length=5365
FT                   /gap_type="unknown"
FT   gene            2434746..2601488
FT                   /locus_tag="mCG_14318"
FT                   /note="gene_id=mCG14318.3"
FT   mRNA            join(2434746..2435688,2597536..2597667,2598284..2598371,
FT                   2598624..2598843,2600612..2601488)
FT                   /locus_tag="mCG_14318"
FT                   /product="mCG14318, transcript variant mCT179551"
FT                   /note="gene_id=mCG14318.3 transcript_id=mCT179551.1 created
FT                   on 31-JUL-2003"
FT   CDS             join(2434834..2435688,2597536..2597667,2598284..2598371,
FT                   2598624..2598843,2600612..2600909)
FT                   /codon_start=1
FT                   /locus_tag="mCG_14318"
FT                   /product="mCG14318, isoform CRA_c"
FT                   /note="gene_id=mCG14318.3 transcript_id=mCT179551.1
FT                   protein_id=mCP102477.0 isoform=CRA_c"
FT                   /protein_id="EDL40123.1"
FT                   /translation="MVPAAFPTSLPLCVCLLLASGLVQADRLLMVPMGGSHWFDMQMVM
FT                   EKLIQRGHEVVVVIPEVSWRLGKSLNCTVKTYSVSHTLEDLEREFKYFTYTQWKTPEQS
FT                   IRSFMTGSGRTVFDLIFSQCRGLFNDKKLVEYLKQRSFDAVLLDPFNVCGLTIAKYLSL
FT                   PSVIFARIAFCYYLEEGAQCPSLPSYVPRLFSKYTDTMTFKERVWNHLIYIEEHAFCSY
FT                   LYKTAVEIASEVLQTPVTMTDLFSPVSIWLLHTDFVLEFPRPVMPNMVFVGGMSCLQGK
FT                   PLSKEFEAYVNASGEHGIVVFSLGSMVSEIPEKKAMEIAEALGRIPQTVLWRYTGTRPS
FT                   NLAKNTILVKWLPQNDLLGHPKTRAFITHSGSHGIYEGICNGVPMVMMPLFGDQMDNAK
FT                   RMETRGAGVTLNVLEMTADDLENALKTVINNKSYKENIMRLSSLHKDRPIEPLDLAVFW
FT                   VEYVMRHKGAPHLRPAAHDLTWYQYHSLDVIGFLLAIVLTVVFIVFKCCAYGCRKCFGG
FT                   KGRVKKSHKSKTH"
FT   gene            2440285..2440830
FT                   /pseudo
FT                   /locus_tag="mCG_146404"
FT                   /note="gene_id=mCG146404.0"
FT   mRNA            2440285..2440830
FT                   /pseudo
FT                   /locus_tag="mCG_146404"
FT                   /note="gene_id=mCG146404.0 transcript_id=mCT186622.0
FT                   created on 31-JUL-2003"
FT   assembly_gap    2441803..2441822
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            join(2453566..2454439,2597536..2597667,2598284..2598371,
FT                   2598624..2598843,2600612..2601488)
FT                   /locus_tag="mCG_14318"
FT                   /product="mCG14318, transcript variant mCT179555"
FT                   /note="gene_id=mCG14318.3 transcript_id=mCT179555.1 created
FT                   on 31-JUL-2003"
FT   CDS             join(2453681..2454439,2597536..2597667,2598284..2598371,
FT                   2598624..2598843,2600612..2600909)
FT                   /codon_start=1
FT                   /locus_tag="mCG_14318"
FT                   /product="mCG14318, isoform CRA_f"
FT                   /note="gene_id=mCG14318.3 transcript_id=mCT179555.1
FT                   protein_id=mCP102475.0 isoform=CRA_f"
FT                   /protein_id="EDL40126.1"
FT                   /translation="MDGSHWFTMQMVVEKLIHRGHEVVVVIPEVSWQLGKSLNCTVKTY
FT                   SISHTLEDLDREFKYLSYTQWKTPEHSIRSFLTGSARGFFELTFSHCRSLFNDKKLVEY
FT                   LKQRSFDAVFLDPFDVCGLIVAKYFSLPSVIFARGVFCDYLEEGGQCPSLPSYVPRLFS
FT                   KYTDTMTFKERVWNHLIYIEEHAFCSYFLRTAVEVASEILQTPVTMTDLFSPVSIWLLR
FT                   TDFVLEFPRPVMPNMVFIGGINCLQKKSLSKEFEAYVNASGEHGIVVFSLGSMVSEIPE
FT                   KKAMEIAEALGRIPQTVLWRYTGTRPSNLAKNTILVKWLPQNDLLGHPKTRAFITHSGS
FT                   HGIYEGICNGVPMVMMPLFGDQMDNAKRMETRGAGVTLNVLEMTADDLENALKTVINNK
FT                   SYKENIMRLSSLHKDRPIEPLDLAVFWVEYVMRHKGAPHLRPAAHDLTWYQYHSLDVIG
FT                   FLLAIVLTVVFIVFKCCAYGCRKCFGGKGRVKKSHKSKTH"
FT   gene            2457657..2458132
FT                   /pseudo
FT                   /locus_tag="mCG_146405"
FT                   /note="gene_id=mCG146405.0"
FT   mRNA            2457657..2458132
FT                   /pseudo
FT                   /locus_tag="mCG_146405"
FT                   /note="gene_id=mCG146405.0 transcript_id=mCT186623.0
FT                   created on 31-JUL-2003"
FT   mRNA            join(<2470628..2471482,2597536..2597667,2598284..2598371,
FT                   2598624..2598843,2600612..2601488)
FT                   /locus_tag="mCG_14318"
FT                   /product="mCG14318, transcript variant mCT179552"
FT                   /note="gene_id=mCG14318.3 transcript_id=mCT179552.1 created
FT                   on 31-JUL-2003"
FT   CDS             join(2470628..2471482,2597536..2597667,2598284..2598371,
FT                   2598624..2598843,2600612..2600909)
FT                   /codon_start=1
FT                   /locus_tag="mCG_14318"
FT                   /product="mCG14318, isoform CRA_d"
FT                   /note="gene_id=mCG14318.3 transcript_id=mCT179552.1
FT                   protein_id=mCP102476.1 isoform=CRA_d"
FT                   /protein_id="EDL40124.1"
FT                   /translation="MAPAVFPASLPLRVCLLLAFGLAQAGRLLVVPMDGSHWFSMKMVV
FT                   EKLSHRGHEVVVVIPEVSWHLGKSQNFTVKTYSVSYTLEDLSHHFNFFAHKQWENREVG
FT                   MFSLLKHSGKGFFQVLFSHCRSLFNDKKLVEYLKQRSFDAVFLDPFDVCGLTIAKYFSL
FT                   PSVVFSGGIFCHYLDEGAQCPSPPSYVPRILSKFADTMTFKERVWNYFSYMKERAFCPY
FT                   FFKTAIEIASEVLQTPVTMTDLFSSVSIWMFRTDFVLEFPRPVMPNMVYIGGINCHPGK
FT                   PLSKEFEAYVNASGEHGIVVFSLGSMVSEIPEKKAMEIAEALGRIPQTVLWRYTGTRPS
FT                   NLAKNTILVKWLPQNDLLGHPKTRAFITHSGSHGIYEGICNGVPMVMMPLFGDQMDNAK
FT                   RMETRGAGVTLNVLEMTADDLENALKTVINNKSYKENIMRLSSLHKDRPIEPLDLAVFW
FT                   VEYVMRHKGAPHLRPAAHDLTWYQYHSLDVIGFLLAIVLTVVFIVFKCCAYGCRKCFGG
FT                   KGRVKKSHKSKTH"
FT   mRNA            join(2477766..2478721,2597536..2597667,2598284..2598371,
FT                   2598624..2598843,2600612..2601488)
FT                   /locus_tag="mCG_14318"
FT                   /product="mCG14318, transcript variant mCT179557"
FT                   /note="gene_id=mCG14318.3 transcript_id=mCT179557.1 created
FT                   on 31-JUL-2003"
FT   CDS             join(2477864..2478721,2597536..2597667,2598284..2598371,
FT                   2598624..2598843,2600612..2600909)
FT                   /codon_start=1
FT                   /locus_tag="mCG_14318"
FT                   /product="mCG14318, isoform CRA_g"
FT                   /note="gene_id=mCG14318.3 transcript_id=mCT179557.1
FT                   protein_id=mCP102474.1 isoform=CRA_g"
FT                   /protein_id="EDL40127.1"
FT                   /translation="MAPADFPASLPLRVCLLLASGLAQAGRLLVVPMDGSHWFTMQTVV
FT                   EKLIHRGHEVVVVVPEVSWQLRKPLNFVVKTYAVSHTQEDLNREFKIFIDAQWKSQQEG
FT                   GILPLLDSPAKGFFELLFSHCRSLFNDKKLVEYLKQTSFDAVFLDPFDVCGLTVAKYFS
FT                   LPSVVFSRGIFCHYLEDAAQCPSPPSYIPRMLLKFTDTMTFKERTRNLLAYMGERAFCH
FT                   KFFKSAADIASEVLQTPVTMTDLFSPVSIWLLRTDFVLEFPRPVMPNVIYIGGINCHQG
FT                   KPLSKEFEAYVNASGEHGIVVFSLGSMVSEIPEKKAMEIAEALGRIPQTVLWRYTGTRP
FT                   SNLAKNTILVKWLPQNDLLGHPKTRAFITHSGSHGIYEGICNGVPMVMMPLFGDQMDNA
FT                   KRMETRGAGVTLNVLEMTADDLENALKTVINNKSYKENIMRLSSLHKDRPIEPLDLAVF
FT                   WVEYVMRHKGAPHLRPAAHDLTWYQYHSLDVIGFLLAIVLTVVFIVFKCCAYGCRKCFG
FT                   GKGRVKKSHKSKTH"
FT   gene            2480645..2480979
FT                   /pseudo
FT                   /locus_tag="mCG_146410"
FT                   /note="gene_id=mCG146410.0"
FT   mRNA            2480645..2480979
FT                   /pseudo
FT                   /locus_tag="mCG_146410"
FT                   /note="gene_id=mCG146410.0 transcript_id=mCT186628.0
FT                   created on 31-JUL-2003"
FT   mRNA            join(<2489663..2490520,2597536..2597667,2598284..2598371,
FT                   2598624..2598843,2600612..2601488)
FT                   /locus_tag="mCG_14318"
FT                   /product="mCG14318, transcript variant mCT179554"
FT                   /note="gene_id=mCG14318.3 transcript_id=mCT179554.1 created
FT                   on 31-JUL-2003"
FT   CDS             join(2489663..2490520,2597536..2597667,2598284..2598371,
FT                   2598624..2598843,2600612..2600909)
FT                   /codon_start=1
FT                   /locus_tag="mCG_14318"
FT                   /product="mCG14318, isoform CRA_e"
FT                   /note="gene_id=mCG14318.3 transcript_id=mCT179554.1
FT                   protein_id=mCP102478.1 isoform=CRA_e"
FT                   /db_xref="GOA:Q8R0P3"
FT                   /db_xref="InterPro:IPR002213"
FT                   /db_xref="MGI:MGI:3580629"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R0P3"
FT                   /protein_id="EDL40125.1"
FT                   /translation="MACLLPAAQTLPAGFLFLVLWASVLGDKLLVVPQDGSHWLSMKEI
FT                   VEHLSERGHDIVVLVPEVNLLLGESKYYRRKIFSVPYSLEELQTRFRTFGRNQFVPGAP
FT                   LMGPLREYRNSMLTLEMFFSNCQSLLKDSATLSFLRENKFDALFTDPAMPCGVILAEYL
FT                   NLPSVYLFRGFPCSLEHMLGQSPSPVSYVPRFYTKFSDHMTFPQRLANFIVNILENYLY
FT                   YCLYSKYEIIASDLLKRDVSLPSLHQNSLWLLRYDFVFEYPRPVMPNMIFLGGINCKKK
FT                   GKLTQEFEAYVNASGEHGIVVFSLGSMVSEIPEKKAMEIAEALGRIPQTVLWRYTGTRP
FT                   SNLAKNTILVKWLPQNDLLGHPKTRAFITHSGSHGIYEGICNGVPMVMMPLFGDQMDNA
FT                   KRMETRGAGVTLNVLEMTADDLENALKTVINNKSYKENIMRLSSLHKDRPIEPLDLAVF
FT                   WVEYVMRHKGAPHLRPAAHDLTWYQYHSLDVIGFLLAIVLTVVFIVFKCCAYGCRKCFG
FT                   GKGRVKKSHKSKTH"
FT   assembly_gap    2491453..2491493
FT                   /estimated_length=41
FT                   /gap_type="unknown"
FT   assembly_gap    2493666..2493725
FT                   /estimated_length=60
FT                   /gap_type="unknown"
FT   assembly_gap    2501074..2502587
FT                   /estimated_length=1514
FT                   /gap_type="unknown"
FT   gene            2508315..2509166
FT                   /pseudo
FT                   /locus_tag="mCG_146406"
FT                   /note="gene_id=mCG146406.0"
FT   mRNA            2508315..2509166
FT                   /pseudo
FT                   /locus_tag="mCG_146406"
FT                   /note="gene_id=mCG146406.0 transcript_id=mCT186624.0
FT                   created on 31-JUL-2003"
FT   assembly_gap    2509844..2510879
FT                   /estimated_length=1036
FT                   /gap_type="unknown"
FT   assembly_gap    2512134..2513028
FT                   /estimated_length=895
FT                   /gap_type="unknown"
FT   mRNA            join(2516006..2516132,2519692..2520550,2597536..2597667,
FT                   2598284..2598371,2598624..2598843,2600612..2601488)
FT                   /locus_tag="mCG_14318"
FT                   /product="mCG14318, transcript variant mCT15933"
FT                   /note="gene_id=mCG14318.3 transcript_id=mCT15933.2 created
FT                   on 31-JUL-2003"
FT   CDS             join(2519693..2520550,2597536..2597667,2598284..2598371,
FT                   2598624..2598843,2600612..2600909)
FT                   /codon_start=1
FT                   /locus_tag="mCG_14318"
FT                   /product="mCG14318, isoform CRA_a"
FT                   /note="gene_id=mCG14318.3 transcript_id=mCT15933.2
FT                   protein_id=mCP21466.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q6NSR5"
FT                   /db_xref="InterPro:IPR002213"
FT                   /db_xref="MGI:MGI:2137698"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NSR5"
FT                   /protein_id="EDL40121.1"
FT                   /translation="MACLLPAAQTLPAGFLFLVLWASVLGDKLLVVPQDGSHWLSMKEI
FT                   VEHLSERGHDIMVLVPEVNLLLGESKYYRRKIFSVTYSLEELQTRFRTFGNNHFLPSAA
FT                   LIGPLREYRNNMIVVDMCFFSCQSLLKDSATLSFLRENKFDALFTDPAMPCGVILAEYL
FT                   NLPSVYLFRGFPCSLEHMLGQSPSPVSYVPRFYTKFSDHMTFPQRLANFIVNILENYLY
FT                   YCLYSKYEIIASDLLKRDVSLPSLHQNSLWLLRYDFVFEYPRPVMPNMIFIGGINCKKK
FT                   GKLTQEFEAYVNASGEHGIVVFSLGSMVSEIPEKKAMEIAEALGRIPQTVLWRYTGTRP
FT                   SNLAKNTILVKWLPQNDLLGHPKTRAFITHSGSHGIYEGICNGVPMVMMPLFGDQMDNA
FT                   KRMETRGAGVTLNVLEMTADDLENALKTVINNKSYKENIMRLSSLHKDRPIEPLDLAVF
FT                   WVEYVMRHKGAPHLRPAAHDLTWYQYHSLDVIGFLLAIVLTVVFIVFKCCAYGCRKCFG
FT                   GKGRVKKSHKSKTH"
FT   gene            2532317..2533160
FT                   /pseudo
FT                   /locus_tag="mCG_131123"
FT                   /note="gene_id=mCG131123.0"
FT   mRNA            2532317..2533160
FT                   /pseudo
FT                   /locus_tag="mCG_131123"
FT                   /note="gene_id=mCG131123.0 transcript_id=mCT132451.1
FT                   created on 04-FEB-2003"
FT   gene            2535085..2535863
FT                   /pseudo
FT                   /locus_tag="mCG_146407"
FT                   /note="gene_id=mCG146407.0"
FT   mRNA            2535085..2535863
FT                   /pseudo
FT                   /locus_tag="mCG_146407"
FT                   /note="gene_id=mCG146407.0 transcript_id=mCT186625.0
FT                   created on 31-JUL-2003"
FT   assembly_gap    2545413..2545734
FT                   /estimated_length=322
FT                   /gap_type="unknown"
FT   mRNA            join(<2547621..2548472,2597536..2597667,2598284..2598371,
FT                   2598624..2598843,2600612..2601488)
FT                   /locus_tag="mCG_14318"
FT                   /product="mCG14318, transcript variant mCT179553"
FT                   /note="gene_id=mCG14318.3 transcript_id=mCT179553.1 created
FT                   on 31-JUL-2003"
FT   CDS             join(2547621..2548472,2597536..2597667,2598284..2598371,
FT                   2598624..2598843,2600612..2600909)
FT                   /codon_start=1
FT                   /locus_tag="mCG_14318"
FT                   /product="mCG14318, isoform CRA_h"
FT                   /note="gene_id=mCG14318.3 transcript_id=mCT179553.1
FT                   protein_id=mCP102472.1 isoform=CRA_h"
FT                   /db_xref="GOA:B2RT14"
FT                   /db_xref="InterPro:IPR002213"
FT                   /db_xref="MGI:MGI:3032634"
FT                   /db_xref="UniProtKB/TrEMBL:B2RT14"
FT                   /protein_id="EDL40128.1"
FT                   /translation="MGLRMPLQGLVGLLLLCALPWTEGEKVLVFPVGGSHWLSMRDVVR
FT                   ELHAQGHQTVVLAPEVNMRIKEEDFFTFKVYAVPYTRQELEEMMENLKVFFDTGNYMKK
FT                   IFKTSEALRNMSTVLLKTCTNILHNESLLHHLNSSSFDVVFTDPVFPCGALLAKYLGIP
FT                   AVFFLRYIPCGIEYEATQCPSPSSYIPNLFTRLSDHMDFLQRVQNMLYHLVLKYICHLL
FT                   ITPYESLASELFQREVSSVELFSYASVWLFRGDFVLDYPRPIMPNMVFIGGINCVTKKP
FT                   LSQEFEAYVNASGEHGIVVFSLGSMVSEIPEKKAMEIAEALGRIPQTVLWRYTGTRPSN
FT                   LAKNTILVKWLPQNDLLGHPKTRAFITHSGSHGIYEGICNGVPMVMMPLFGDQMDNAKR
FT                   METRGAGVTLNVLEMTADDLENALKTVINNKSYKENIMRLSSLHKDRPIEPLDLAVFWV
FT                   EYVMRHKGAPHLRPAAHDLTWYQYHSLDVIGFLLAIVLTVVFIVFKCCAYGCRKCFGGK
FT                   GRVKKSHKSKTH"
FT   assembly_gap    2550085..2550997
FT                   /estimated_length=913
FT                   /gap_type="unknown"
FT   gene            2569150..2570013
FT                   /pseudo
FT                   /locus_tag="mCG_146409"
FT                   /note="gene_id=mCG146409.0"
FT   mRNA            2569150..2570013
FT                   /pseudo
FT                   /locus_tag="mCG_146409"
FT                   /note="gene_id=mCG146409.0 transcript_id=mCT186626.0
FT                   created on 31-JUL-2003"
FT   gene            2574363..2575166
FT                   /pseudo
FT                   /locus_tag="mCG_146408"
FT                   /note="gene_id=mCG146408.0"
FT   mRNA            2574363..2575166
FT                   /pseudo
FT                   /locus_tag="mCG_146408"
FT                   /note="gene_id=mCG146408.0 transcript_id=mCT186627.0
FT                   created on 31-JUL-2003"
FT   mRNA            join(2583106..2583996,2597536..2597667,2598284..2598371,
FT                   2598624..2598843,2600612..2601488)
FT                   /locus_tag="mCG_14318"
FT                   /product="mCG14318, transcript variant mCT179550"
FT                   /note="gene_id=mCG14318.3 transcript_id=mCT179550.1 created
FT                   on 31-JUL-2003"
FT   CDS             join(2583133..2583996,2597536..2597667,2598284..2598371,
FT                   2598624..2598843,2600612..2600909)
FT                   /codon_start=1
FT                   /locus_tag="mCG_14318"
FT                   /product="mCG14318, isoform CRA_b"
FT                   /note="gene_id=mCG14318.3 transcript_id=mCT179550.1
FT                   protein_id=mCP102473.0 isoform=CRA_b"
FT                   /db_xref="GOA:P70691"
FT                   /db_xref="InterPro:IPR002213"
FT                   /db_xref="MGI:MGI:3576049"
FT                   /db_xref="UniProtKB/Swiss-Prot:P70691"
FT                   /protein_id="EDL40122.1"
FT                   /translation="MDTGLCVPLRGISGLLLLLCALPWAEGAKVLVLPMEGSQWLSMRD
FT                   VVRELHARGHQTVVLASEVTVHIKGEDFFTLKTYAFPYTKEEYQQEILSDIEKTFKTQH
FT                   FVKAFFETTASIRNFFDLYSNSCIALLHNKMLIQQLNSSFFDVILTDPIFPCGAVLAKY
FT                   LQIPAVFILRSLSCGIEYEATQCPNPSSYIPNLLTRLSDHMDFLQRVQNMLYYLVLKYI
FT                   CRLSITPYESLASELLQREVSLVEVLSHASVWLFRGDFVLDYPRPIMPNMVFIGGINCV
FT                   TKKPLSQEFEAYVNASGEHGIVVFSLGSMVSEIPEKKAMEIAEALGRIPQTVLWRYTGT
FT                   RPSNLAKNTILVKWLPQNDLLGHPKTRAFITHSGSHGIYEGICNGVPMVMMPLFGDQMD
FT                   NAKRMETRGAGVTLNVLEMTADDLENALKTVINNKSYKENIMRLSSLHKDRPIEPLDLA
FT                   VFWVEYVMRHKGAPHLRPAAHDLTWYQYHSLDVIGFLLAIVLTVVFIVFKCCAYGCRKC
FT                   FGGKGRVKKSHKSKTH"
FT   gene            complement(2587228..2588243)
FT                   /gene="Dnajb3"
FT                   /locus_tag="mCG_14317"
FT                   /note="gene_id=mCG14317.1"
FT   mRNA            complement(2587228..2588243)
FT                   /gene="Dnajb3"
FT                   /locus_tag="mCG_14317"
FT                   /product="DnaJ (Hsp40) homolog, subfamily B, member 3"
FT                   /note="gene_id=mCG14317.1 transcript_id=mCT15932.1 created
FT                   on 02-JAN-2003"
FT   CDS             complement(2587442..2588170)
FT                   /codon_start=1
FT                   /gene="Dnajb3"
FT                   /locus_tag="mCG_14317"
FT                   /product="DnaJ (Hsp40) homolog, subfamily B, member 3"
FT                   /note="gene_id=mCG14317.1 transcript_id=mCT15932.1
FT                   protein_id=mCP21465.1"
FT                   /db_xref="GOA:Q5RL26"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="MGI:MGI:1306822"
FT                   /db_xref="UniProtKB/TrEMBL:Q5RL26"
FT                   /protein_id="EDL40130.1"
FT                   /translation="MVDYYEVLGVPRQASAEAIRKAYRKLALKWHPDKNPEHKEEAERR
FT                   FKQVAQAYEVLSDVRKREVYDRCGEVGEVGGGGAAGSPFHDAFQYVFSFRDPAEVFREF
FT                   FGGHDPFSFDFFGGDPLENFFGDRRSTRGSRSRGAVPFSTSFTEFPGFGGGFASLDTGF
FT                   TSFGSPGNSGLSSFSMSCGGGAAGNYKSVSTSTEIINGKKITTKRIVENGQERVEVEED
FT                   GELKSLIINGKEQLLRINTQ"
FT   mRNA            join(2594404..2595364,2597536..2597667,2598284..2598371,
FT                   2598624..2598843,2600612..2601488)
FT                   /locus_tag="mCG_14318"
FT                   /product="mCG14318, transcript variant mCT179556"
FT                   /note="gene_id=mCG14318.3 transcript_id=mCT179556.1 created
FT                   on 31-JUL-2003"
FT   CDS             join(2594495..2595364,2597536..2597667,2598284..2598371,
FT                   2598624..2598843,2600612..2600909)
FT                   /codon_start=1
FT                   /locus_tag="mCG_14318"
FT                   /product="mCG14318, isoform CRA_i"
FT                   /note="gene_id=mCG14318.3 transcript_id=mCT179556.1
FT                   protein_id=mCP102479.0 isoform=CRA_i"
FT                   /protein_id="EDL40129.1"
FT                   /translation="MTVVCWSSRLLLLLPYLLLCVFGPSASHAGRLLVFPMDGSHWLSM
FT                   LGVIQQLQQKGHEVVVIAPEASIHIKEGSFYTLRKFPVPFQKENVTATLVELGRTAFNQ
FT                   DSFLLRVVKIYMKVKRDSSMLLAGCSHLLHNAEFMASLEESHFDALLTDPFLPCGSIVA
FT                   QYLTVPTVYFLNTLPCSLDLEATQCPVPLSYVPKSLSFNSDRMNFLQRVKNVLLAVSEN
FT                   FMCRVVYSPYGSLATEILQKEVTVKDLLSPASIWLMRSDFVKDYPRPIMPNMVFIGGIN
FT                   CLQKKPLSQEFEAYVNASGEHGIVVFSLGSMVSEIPEKKAMEIAEALGRIPQTVLWRYT
FT                   GTRPSNLAKNTILVKWLPQNDLLGHPKTRAFITHSGSHGIYEGICNGVPMVMMPLFGDQ
FT                   MDNAKRMETRGAGVTLNVLEMTADDLENALKTVINNKSYKENIMRLSSLHKDRPIEPLD
FT                   LAVFWVEYVMRHKGAPHLRPAAHDLTWYQYHSLDVIGFLLAIVLTVVFIVFKCCAYGCR
FT                   KCFGGKGRVKKSHKSKTH"
FT   gene            2609474..>2641238
FT                   /locus_tag="mCG_131122"
FT                   /note="gene_id=mCG131122.1"
FT   mRNA            join(2609474..2609704,2610541..2610633,2610714..2610895,
FT                   2612830..2612961,2613114..2613276,2614735..2614833,
FT                   2615808..2615959,2616493..2616636,2617461..2617553,
FT                   2617681..2617759,2617864..2617977,2619148..2619224,
FT                   2620339..2620449,2621388..2621535,2622613..2622653,
FT                   2623174..2623315,2623566..2623618,2624038..2624145,
FT                   2624899..2625018,2625164..2625286,2626426..2626578,
FT                   2627439..2627561,2628484..2628563,2629632..2629740,
FT                   2631048..2631152,2632202..2632325,2632764..2632882,
FT                   2633744..2633896,2634835..2634989,2637465..2637540,
FT                   2637613..2637806,2638066..2638203,2638581..2638695,
FT                   2638924..2639073,2639175..2639357,2640234..2640389,
FT                   2641107..>2641238)
FT                   /locus_tag="mCG_131122"
FT                   /product="mCG131122"
FT                   /note="gene_id=mCG131122.1 transcript_id=mCT132450.1
FT                   created on 04-FEB-2003"
FT   CDS             join(2610555..2610633,2610714..2610895,2612830..2612961,
FT                   2613114..2613276,2614735..2614833,2615808..2615959,
FT                   2616493..2616636,2617461..2617553,2617681..2617759,
FT                   2617864..2617977,2619148..2619224,2620339..2620449,
FT                   2621388..2621535,2622613..2622653,2623174..2623315,
FT                   2623566..2623618,2624038..2624145,2624899..2625018,
FT                   2625164..2625286,2626426..2626578,2627439..2627561,
FT                   2628484..2628563,2629632..2629740,2631048..2631152,
FT                   2632202..2632325,2632764..2632882,2633744..2633896,
FT                   2634835..2634989,2637465..2637540,2637613..2637806,
FT                   2638066..2638203,2638581..2638695,2638924..2639073,
FT                   2639175..2639357,2640234..2640389,2641107..>2641238)
FT                   /codon_start=1
FT                   /locus_tag="mCG_131122"
FT                   /product="mCG131122"
FT                   /note="gene_id=mCG131122.1 transcript_id=mCT132450.1
FT                   protein_id=mCP81850.1"
FT                   /protein_id="EDL40120.1"
FT                   /translation="MKEATELNEDMLEEAEHLALLEPEDDGTFFQVTNLLNIMDSESAK
FT                   TDTTGPGLDMRKTLASVIITEKATTDPCVVMNALIRCLQMPEISTQRKMNIYNIMQEII
FT                   QQEGEMEEHCIQRLVAIASKQMRDITEAEDFETAEVASETLVALSRNHFSLVMYELQHH
FT                   LKPLNLTDEFVIVTLAKLANGNVFEFMPYMGITLATIFTMLRLANEAKMRQVICSAMET
FT                   FCETVQFYLRHLEDSLYPVMTEDQFAVKLFPMYRYFVTVWLRHQDLEVKLGVIKSLRPM
FT                   LSLLLPNDDLREQVYDYIPLLLAEFQGGLEALFVTQVLRQILEASVTTNTPIPPMLLHP
FT                   IFTELHVQVCSKAPAQQQFSSQNLMEIVHCFIALARSYPKELMKFFFSQVEMSKEAVHV
FT                   GTLALIRAVVSADDPKMNIKTIYLAIRVVKNTLSDTRSKTNRRECFYQRDLEEKMVHKV
FT                   TMDTVKIITSSISGMTNEFWVRLLCYIMETDYTEALTPICISLTNLAENQIHGKDTEAG
FT                   IAGKSKHVDLPAPQKLLVRLLVLMSSPYKGEGRGIAMLNLLRTLSQSIAPSMADMWEQE
FT                   IPLLVQYLEEHTEFTWNQKTWEDMLIQFLRNSLKKTRGTSWSLRLSKELNNQIETFDSP
FT                   SLEKGFLYRALGFTLGMGLEADRVEVLLLELLYKTDYSNDFDREGVILCFGLCARGQVK
FT                   TVLNVLQDFEERIQESEQSWQIGAWRKDHPWRRETVKSALMVMYSCVSSYCHPQMLLTH
FT                   VDSPITSKIIHHYSSSCQDISLKMAFMKSVVQVTNAIKSIQDPEDFQFAHKSALTGLIV
FT                   VIIKAEPPDHLVSPVRSMAMDALSQLSTMKPFYSPEESTELMDISIHTVISLQPPGEDN
FT                   ESVKLLEKWILSEKEWEREKAMALHLHLMQIYVQSIGVCIPLKLGQFGVLVGLIAPCTC
FT                   DAHRRTRLASINVLSSLLDLHVSQTCSLWGTSKEQELQKCKEDLQDTDMNKISSASSRV
FT                   AKVVCPEFNCDEVVSLIQKLCENIGAMDLQHDRAAVTWIGIFLQMRVKELEDKVAEILG
FT                   AILVHLPVVDHPEVRRHLIEGILLLAHYHQETVLTSLLRQPLPMESRGSLPKINATSKA
FT                   DIWRLAAVDPLMTLCTIQLLMEKMDQDDKFPDLFPDLLYTFLLQLGSSHGPEAASPVLK
FT                   TWRLVHTGPLPQEMTLQRITIKSMQLLVKRINREPLEQALEEQSVWSLLENGGTFLEGV
FT                   SLMARLCMQNMENYMQRLAELVLTGMGSEILSCCISSTAICVEFMSDPVLHQEKLLRPV
FT                   VLMLEKGAGQDKDETLQVLSLRALGNMALGAPRKVKQYRKLLLEKCLGSLQGQVSSSAM
FT                   AEGMEALTKVLAELREGDIGSSFEAISKQCRAFFDNESELLRLKAFVLFGKLTKVVGIS
FT                   KKHFFKGEVKRGWVSLLLHCQDPCPSVAQACVATMFQCVHFWGWKSLESSFGHSNDSIN
FT                   EQMTVFQTNMCSVL"
FT   assembly_gap    2641406..2648285
FT                   /estimated_length=6880
FT                   /gap_type="unknown"
FT   gene            complement(2648286..2656970)
FT                   /locus_tag="mCG_131124"
FT                   /note="gene_id=mCG131124.1"
FT   mRNA            complement(join(2648286..2648750,2649539..2649636,
FT                   2652066..2652509))
FT                   /locus_tag="mCG_131124"
FT                   /product="mCG131124, transcript variant mCT179529"
FT                   /note="gene_id=mCG131124.1 transcript_id=mCT179529.0
FT                   created on 25-MAR-2003"
FT   mRNA            complement(join(2648286..2648750,2649539..2649656,
FT                   2650780..2650950))
FT                   /locus_tag="mCG_131124"
FT                   /product="mCG131124, transcript variant mCT179532"
FT                   /note="gene_id=mCG131124.1 transcript_id=mCT179532.0
FT                   created on 25-MAR-2003"
FT   mRNA            complement(join(2648287..2648750,2649539..2649636,
FT                   2652066..2652102,2654379..2654434,2656556..2656622,
FT                   2656711..2656970))
FT                   /locus_tag="mCG_131124"
FT                   /product="mCG131124, transcript variant mCT132452"
FT                   /note="gene_id=mCG131124.1 transcript_id=mCT132452.1
FT                   created on 25-MAR-2003"
FT   CDS             complement(join(2648634..2648750,2649539..2649636,
FT                   2652066..2652102,2654379..2654434,2656556..2656622,
FT                   2656711..2656806))
FT                   /codon_start=1
FT                   /locus_tag="mCG_131124"
FT                   /product="mCG131124, isoform CRA_a"
FT                   /note="gene_id=mCG131124.1 transcript_id=mCT132452.1
FT                   protein_id=mCP81857.1 isoform=CRA_a"
FT                   /protein_id="EDL40115.1"
FT                   /translation="MESMGRQDRRLHQQLKESSSRFQTLMKRLIAKYNQPFEDDPLVEM
FT                   RTLTYETPQGLRVWGGKLMKKEDKEYTQVIDRLNGQAPEGDSESSGADTSLEENWPSCS
FT                   SAMREASGDPRQRQPAVPGNTLETDLRRKYLTQVDILPQDEEYFKVIYVCMC"
FT   CDS             complement(join(2648634..2648750,2649539..2649574))
FT                   /codon_start=1
FT                   /locus_tag="mCG_131124"
FT                   /product="mCG131124, isoform CRA_b"
FT                   /note="gene_id=mCG131124.1 transcript_id=mCT179529.0
FT                   protein_id=mCP102452.0 isoform=CRA_b"
FT                   /protein_id="EDL40116.1"
FT                   /translation="MREASGDPRQRQPAVPGNTLETDLRRKYLTQVDILPQDEEYFKVI
FT                   YVCMC"
FT   CDS             complement(join(2648634..2648750,2649539..2649574))
FT                   /codon_start=1
FT                   /locus_tag="mCG_131124"
FT                   /product="mCG131124, isoform CRA_b"
FT                   /note="gene_id=mCG131124.1 transcript_id=mCT179532.0
FT                   protein_id=mCP102454.0 isoform=CRA_b"
FT                   /protein_id="EDL40118.1"
FT                   /translation="MREASGDPRQRQPAVPGNTLETDLRRKYLTQVDILPQDEEYFKVI
FT                   YVCMC"
FT   mRNA            complement(join(2648658..2648750,2649539..2649636,
FT                   2654379..2654434,2656556..2656622,2656711..2656914))
FT                   /locus_tag="mCG_131124"
FT                   /product="mCG131124, transcript variant mCT179530"
FT                   /note="gene_id=mCG131124.1 transcript_id=mCT179530.0
FT                   created on 25-MAR-2003"
FT   CDS             complement(join(2649604..2649636,2654379..2654434,
FT                   2656556..2656622,2656711..2656806))
FT                   /codon_start=1
FT                   /locus_tag="mCG_131124"
FT                   /product="mCG131124, isoform CRA_d"
FT                   /note="gene_id=mCG131124.1 transcript_id=mCT179530.0
FT                   protein_id=mCP102451.0 isoform=CRA_d"
FT                   /protein_id="EDL40119.1"
FT                   /translation="MESMGRQDRRLHQQLKESSSRFQTLMKRLIAKYNQPFEDDPLVEM
FT                   RTLTYETPQGLRVWGGKLMKKEDKEYTQIQRAAVRIRA"
FT   mRNA            complement(join(2654061..2656622,2656711..2656895))
FT                   /locus_tag="mCG_131124"
FT                   /product="mCG131124, transcript variant mCT179531"
FT                   /note="gene_id=mCG131124.1 transcript_id=mCT179531.0
FT                   created on 25-MAR-2003"
FT   CDS             complement(join(2656506..2656622,2656711..2656806))
FT                   /codon_start=1
FT                   /locus_tag="mCG_131124"
FT                   /product="mCG131124, isoform CRA_c"
FT                   /note="gene_id=mCG131124.1 transcript_id=mCT179531.0
FT                   protein_id=mCP102453.0 isoform=CRA_c"
FT                   /db_xref="GOA:Q99KB1"
FT                   /db_xref="InterPro:IPR018465"
FT                   /db_xref="MGI:MGI:2685821"
FT                   /db_xref="UniProtKB/TrEMBL:Q99KB1"
FT                   /protein_id="EDL40117.1"
FT                   /translation="MESMGRQDRRLHQQLKESSSRFQTLMKRLIAKYNQPFEDDPLVEM
FT                   RTLTYETPQGTKPSLPVGTGPEQWA"
FT   gene            2656994..2767732
FT                   /gene="Trpm8"
FT                   /locus_tag="mCG_9358"
FT                   /note="gene_id=mCG9358.2"
FT   mRNA            join(2656994..2657059,2683232..2683351,2684838..2684935,
FT                   2686611..2686740,2687760..2687852,2687960..2688023,
FT                   2698893..2699014,2700790..2700863,2705288..2705444,
FT                   2706311..2706488,2708057..2708229,2710602..2710776,
FT                   2712581..2712648,2717024..2717221,2721226..2721328,
FT                   2723168..2723286,2727926..2728216,2729728..2729823,
FT                   2730741..2730870,2731235..2731380,2734293..2734405,
FT                   2735014..2735230,2739530..2739621,2740459..2740600,
FT                   2741767..2741938,2744909..2745086,2754062..2754252,
FT                   2759545..2759644,2760774..2760807,2764524..2764614,
FT                   2767422..2767732)
FT                   /gene="Trpm8"
FT                   /locus_tag="mCG_9358"
FT                   /product="transient receptor potential cation channel,
FT                   subfamily M, member 8, transcript variant mCT132453"
FT                   /note="gene_id=mCG9358.2 transcript_id=mCT132453.1 created
FT                   on 31-DEC-2002"
FT   mRNA            join(2656994..2657059,2683232..2683351,2684838..2684935,
FT                   2686611..2686740,2687760..2687852,2698893..2699014,
FT                   2700790..2700863,2705288..2705444,2706311..2706488,
FT                   2708057..2708229,2710602..2710776,2712581..2712648,
FT                   2717024..2717221,2721226..2721328,2723168..2723286,
FT                   2727926..2728216,2729728..2729823,2730741..2730870,
FT                   2731235..2731380,2734293..2734405,2735014..2735230,
FT                   2739530..2739621,2740459..2740600,2741767..2741938,
FT                   2744909..2745086,2754062..2754252,2759545..2759644,
FT                   2760774..2760807,2764524..2764614,2767422..2767732)
FT                   /gene="Trpm8"
FT                   /locus_tag="mCG_9358"
FT                   /product="transient receptor potential cation channel,
FT                   subfamily M, member 8, transcript variant mCT8895"
FT                   /note="gene_id=mCG9358.2 transcript_id=mCT8895.2 created on
FT                   31-DEC-2002"
FT   assembly_gap    2662402..2662421
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(2687972..2688023,2698893..2699014,2700790..2700863,
FT                   2705288..2705444,2706311..2706488,2708057..2708229,
FT                   2710602..2710776,2712581..2712648,2717024..2717221,
FT                   2721226..2721328,2723168..2723286,2727926..2728216,
FT                   2729728..2729823,2730741..2730870,2731235..2731380,
FT                   2734293..2734405,2735014..2735230,2739530..2739621,
FT                   2740459..2740600,2741767..2741938,2744909..2745086,
FT                   2754062..2754252,2759545..2759644,2760774..2760807,
FT                   2764524..2764574)
FT                   /codon_start=1
FT                   /gene="Trpm8"
FT                   /locus_tag="mCG_9358"
FT                   /product="transient receptor potential cation channel,
FT                   subfamily M, member 8, isoform CRA_b"
FT                   /note="gene_id=mCG9358.2 transcript_id=mCT132453.1
FT                   protein_id=mCP81884.1 isoform=CRA_b"
FT                   /protein_id="EDL40113.1"
FT                   /translation="MSSTTTATAAKVLVLLHGKMSFEGARLSMRSRRNGTMGSTRTLYS
FT                   SVSRSTDVSYSDSDLVNFIQANFKKRECVFFTRDSKAMENICKCGYAQSQHIEGTQINQ
FT                   NEKWNYKKHTKEFPTDAFGDIQFETLGKKGKYLRLSCDTDSETLYELLTQHWHLKTPNL
FT                   VISVTGGAKNFALKPRMRKIFSRLIYIAQSKGAWILTGGTHYGLMKYIGEVVRDNTISR
FT                   NSEENIVAIGIAAWGMVSNRDTLIRSCDDEGHFSAQYIMDDFTRDPLYILDNNHTHLLL
FT                   VDNGCHGHPTVEAKLRNQLEKYISERTSQDSNYGGKIPIVCFAQGGGRETLKAINTSVK
FT                   SKIPCVVVEGSGQIADVIASLVEVEDVLTSSMVKEKLVRFLPRTVSRLPEEEIESWIKW
FT                   LKEILESSHLLTVIKMEEAGDEIVSNAISYALYKAFSTNEQDKDNWNGQLKLLLEWNQL
FT                   DLASDEIFTNDRRWESADLQEVMFTALIKDRPKFVRLFLENGLNLQKFLTNEVLTELFS
FT                   THFSTLVYRNLQIAKNSYNDALLTFVWKLVANFRRSFWKEDRSSREDLDVELHDASLTT
FT                   RHPLQALFIWAILQNKKELSKVIWEQTKGCTLAALGASKLLKTLAKVKNDINAAGESEE
FT                   LANEYETRAVELFTECYSNDEDLAEQLLVYSCEAWGGSNCLELAVEATDQHFIAQPGVQ
FT                   NFLSKQWYGEISRDTKNWKIILCLFIIPLVGCGLVSFRKKPIDKHKKLLWYYVAFFTSP
FT                   FVVFSWNVVFYIAFLLLFAYVLLMDFHSVPHTPELILYALVFVLFCDEVRQWYMNGVNY
FT                   FTDLWNVMDTLGLFYFIAGIVFRLHSSNKSSLYSGRVIFCLDYIIFTLRLIHIFTVSRN
FT                   LGPKIIMLQRMLIDVFFFLFLFAVWMVAFGVARQGILRQNEQRWRWIFRSVIYEPYLAM
FT                   FGQVPSDVDSTTYDFSHCTFSGNESKPLCVELDEHNLPRFPEWITIPLVCIYMLSTNIL
FT                   LVNLLVAMFGYTVGIVQENNDQVWKFQRYFLVQEYCNRLNIPFPFVVFAYFYMVVKKCF
FT                   KCCCKEKNMESNACCFRNEDNETLAWEGVMKENYLVKINTKANDNSEEMRHRFRQLDSK
FT                   LNDLKSLLKEIANNIK"
FT   CDS             join(2698898..2699014,2700790..2700863,2705288..2705444,
FT                   2706311..2706488,2708057..2708229,2710602..2710776,
FT                   2712581..2712648,2717024..2717221,2721226..2721328,
FT                   2723168..2723286,2727926..2728216,2729728..2729823,
FT                   2730741..2730870,2731235..2731380,2734293..2734405,
FT                   2735014..2735230,2739530..2739621,2740459..2740600,
FT                   2741767..2741938,2744909..2745086,2754062..2754252,
FT                   2759545..2759644,2760774..2760807,2764524..2764574)
FT                   /codon_start=1
FT                   /gene="Trpm8"
FT                   /locus_tag="mCG_9358"
FT                   /product="transient receptor potential cation channel,
FT                   subfamily M, member 8, isoform CRA_a"
FT                   /note="gene_id=mCG9358.2 transcript_id=mCT8895.2
FT                   protein_id=mCP21008.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q8R4D5"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR029603"
FT                   /db_xref="MGI:MGI:2181435"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8R4D5"
FT                   /protein_id="EDL40112.1"
FT                   /translation="MSFEGARLSMRSRRNGTMGSTRTLYSSVSRSTDVSYSDSDLVNFI
FT                   QANFKKRECVFFTRDSKAMENICKCGYAQSQHIEGTQINQNEKWNYKKHTKEFPTDAFG
FT                   DIQFETLGKKGKYLRLSCDTDSETLYELLTQHWHLKTPNLVISVTGGAKNFALKPRMRK
FT                   IFSRLIYIAQSKGAWILTGGTHYGLMKYIGEVVRDNTISRNSEENIVAIGIAAWGMVSN
FT                   RDTLIRSCDDEGHFSAQYIMDDFTRDPLYILDNNHTHLLLVDNGCHGHPTVEAKLRNQL
FT                   EKYISERTSQDSNYGGKIPIVCFAQGGGRETLKAINTSVKSKIPCVVVEGSGQIADVIA
FT                   SLVEVEDVLTSSMVKEKLVRFLPRTVSRLPEEEIESWIKWLKEILESSHLLTVIKMEEA
FT                   GDEIVSNAISYALYKAFSTNEQDKDNWNGQLKLLLEWNQLDLASDEIFTNDRRWESADL
FT                   QEVMFTALIKDRPKFVRLFLENGLNLQKFLTNEVLTELFSTHFSTLVYRNLQIAKNSYN
FT                   DALLTFVWKLVANFRRSFWKEDRSSREDLDVELHDASLTTRHPLQALFIWAILQNKKEL
FT                   SKVIWEQTKGCTLAALGASKLLKTLAKVKNDINAAGESEELANEYETRAVELFTECYSN
FT                   DEDLAEQLLVYSCEAWGGSNCLELAVEATDQHFIAQPGVQNFLSKQWYGEISRDTKNWK
FT                   IILCLFIIPLVGCGLVSFRKKPIDKHKKLLWYYVAFFTSPFVVFSWNVVFYIAFLLLFA
FT                   YVLLMDFHSVPHTPELILYALVFVLFCDEVRQWYMNGVNYFTDLWNVMDTLGLFYFIAG
FT                   IVFRLHSSNKSSLYSGRVIFCLDYIIFTLRLIHIFTVSRNLGPKIIMLQRMLIDVFFFL
FT                   FLFAVWMVAFGVARQGILRQNEQRWRWIFRSVIYEPYLAMFGQVPSDVDSTTYDFSHCT
FT                   FSGNESKPLCVELDEHNLPRFPEWITIPLVCIYMLSTNILLVNLLVAMFGYTVGIVQEN
FT                   NDQVWKFQRYFLVQEYCNRLNIPFPFVVFAYFYMVVKKCFKCCCKEKNMESNACCFRNE
FT                   DNETLAWEGVMKENYLVKINTKANDNSEEMRHRFRQLDSKLNDLKSLLKEIANNIK"
FT   gene            complement(2727377..>2732815)
FT                   /locus_tag="mCG_146135"
FT                   /note="gene_id=mCG146135.0"
FT   mRNA            complement(join(2727377..2728167,2730331..2730442,
FT                   2731222..2731398,2731551..2731606,2732722..>2732815))
FT                   /locus_tag="mCG_146135"
FT                   /product="mCG146135"
FT                   /note="gene_id=mCG146135.0 transcript_id=mCT186238.0
FT                   created on 14-JUL-2003"
FT   CDS             complement(2727551..>2727868)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146135"
FT                   /product="mCG146135"
FT                   /note="gene_id=mCG146135.0 transcript_id=mCT186238.0
FT                   protein_id=mCP107671.0"
FT                   /protein_id="EDL40114.1"
FT                   /translation="VSAFQPQHPSIFSVSLHPALTIEFIFSASRRESSRVEPLNVGTHF
FT                   EYEGTYMVTARPLKHDMGQEPTLAERASGRRSHQWESTVDTVNQLSVLPVHTMGSAALP
FT                   R"
FT   assembly_gap    2750041..2750060
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2764230..2764391
FT                   /estimated_length=162
FT                   /gap_type="unknown"
FT   assembly_gap    2766433..2766452
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2769104..2769581
FT                   /estimated_length=478
FT                   /gap_type="unknown"
FT   assembly_gap    2774029..2774449
FT                   /estimated_length=421
FT                   /gap_type="unknown"
FT   assembly_gap    2777905..2777924
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            2785935..2805789
FT                   /gene="Spp2"
FT                   /locus_tag="mCG_9357"
FT                   /note="gene_id=mCG9357.1"
FT   mRNA            join(2785935..2786133,2786234..2786358,2790026..2790145,
FT                   2791601..2791708,2796594..2796648,2797743..2797793,
FT                   2799939..2800034,2805673..2805789)
FT                   /gene="Spp2"
FT                   /locus_tag="mCG_9357"
FT                   /product="secreted phosphoprotein 2, transcript variant
FT                   mCT8893"
FT                   /note="gene_id=mCG9357.1 transcript_id=mCT8893.1 created on
FT                   31-DEC-2002"
FT   mRNA            join(2785935..2786133,2786234..2786327,2790120..2790145,
FT                   2791601..2791708,2796594..2796648,2797743..2797793,
FT                   2799939..2800013)
FT                   /gene="Spp2"
FT                   /locus_tag="mCG_9357"
FT                   /product="secreted phosphoprotein 2, transcript variant
FT                   mCT178076"
FT                   /note="gene_id=mCG9357.1 transcript_id=mCT178076.0 created
FT                   on 31-DEC-2002"
FT   CDS             join(2786067..2786133,2786234..2786358,2790026..2790145,
FT                   2791601..2791708,2796594..2796648,2797743..2797793,
FT                   2799939..2800024)
FT                   /codon_start=1
FT                   /gene="Spp2"
FT                   /locus_tag="mCG_9357"
FT                   /product="secreted phosphoprotein 2, isoform CRA_b"
FT                   /note="gene_id=mCG9357.1 transcript_id=mCT8893.1
FT                   protein_id=mCP21002.2 isoform=CRA_b"
FT                   /protein_id="EDL40111.1"
FT                   /translation="MEQAMLKTLALLVLGMHYWCATGFPVYDYDPSSLQEALSASVAKV
FT                   NSQSLSPYLFRATRSSLKRVNVLDEDTLVMNLEFSVQETTCLRDSGDPSTCAFQRGYSV
FT                   PTAACRSTVQMSKGQVKDVWAHCRWASSSESNSSEEMMFGDMARSHRRRNDYLLGFLSD
FT                   ESRSEQFRDRSLEIMRRGQPPAHRRFLNLHRRARVNSGFE"
FT   CDS             join(2786067..2786133,2786234..2786327,2790120..2790145,
FT                   2791601..2791689)
FT                   /codon_start=1
FT                   /gene="Spp2"
FT                   /locus_tag="mCG_9357"
FT                   /product="secreted phosphoprotein 2, isoform CRA_a"
FT                   /note="gene_id=mCG9357.1 transcript_id=mCT178076.0
FT                   protein_id=mCP100998.0 isoform=CRA_a"
FT                   /protein_id="EDL40110.1"
FT                   /translation="MEQAMLKTLALLVLGMHYWCATGFPVYDYDPSSLQEALSASVAKV
FT                   NSQSLSPYLCLPKGLLCANSCLQEHCADVQGTGKGCVGSLPLGVLI"
FT   assembly_gap    2791254..2791273
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2809973..2810078
FT                   /estimated_length=106
FT                   /gap_type="unknown"
FT   assembly_gap    2830094..2830285
FT                   /estimated_length=192
FT                   /gap_type="unknown"
FT   assembly_gap    2831461..2831942
FT                   /estimated_length=482
FT                   /gap_type="unknown"
FT   assembly_gap    2834621..2834946
FT                   /estimated_length=326
FT                   /gap_type="unknown"
FT   assembly_gap    2836955..2837213
FT                   /estimated_length=259
FT                   /gap_type="unknown"
FT   assembly_gap    2839909..2839979
FT                   /estimated_length=71
FT                   /gap_type="unknown"
FT   assembly_gap    2873840..2873859
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(2879699..2889882)
FT                   /gene="Glrp1"
FT                   /locus_tag="mCG_9356"
FT                   /note="gene_id=mCG9356.1"
FT   mRNA            complement(join(2879699..2880969,2882969..2883368,
FT                   2889600..2889882))
FT                   /gene="Glrp1"
FT                   /locus_tag="mCG_9356"
FT                   /product="glutamine repeat protein 1"
FT                   /note="gene_id=mCG9356.1 transcript_id=mCT8894.1 created on
FT                   31-DEC-2002"
FT   CDS             complement(join(2880950..2880969,2882969..2883368,
FT                   2889600..2889695))
FT                   /codon_start=1
FT                   /gene="Glrp1"
FT                   /locus_tag="mCG_9356"
FT                   /product="glutamine repeat protein 1"
FT                   /note="gene_id=mCG9356.1 transcript_id=mCT8894.1
FT                   protein_id=mCP21000.1"
FT                   /protein_id="EDL40109.1"
FT                   /translation="MSSICLFRDVAIIKSGERRKRRAYSRLDGAKEQHQQHQQHQQDQH
FT                   QQHQQHQQQQQQQQQHQQHQQHQQHQQHQQHQQQQQHQQHQQHQQHQQHQQHQQHQQQQ
FT                   QHQQHQQHQQQQQQQQHQQHQQHQQHQHQQHQHQQHQQHQQQQQNQMDKIPGMMIFEIP
FT                   ETKNLERI"
FT   assembly_gap    2904239..2904294
FT                   /estimated_length=56
FT                   /gap_type="unknown"
FT   assembly_gap    2909476..2909720
FT                   /estimated_length=245
FT                   /gap_type="unknown"
FT   assembly_gap    2913371..2913390
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2925794..2927912
FT                   /estimated_length=2119
FT                   /gap_type="unknown"
FT   assembly_gap    2932210..2932229
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2935074..2935093
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <2936273..2946674
FT                   /locus_tag="mCG_145606"
FT                   /note="gene_id=mCG145606.0"
FT   mRNA            join(<2936273..2936525,2939909..2940003,2941076..2941526,
FT                   2941960..2942069,2944619..2944741,2945328..2946674)
FT                   /locus_tag="mCG_145606"
FT                   /product="mCG145606"
FT                   /note="gene_id=mCG145606.0 transcript_id=mCT185030.0
FT                   created on 05-JUN-2003"
FT   assembly_gap    2936873..2936892
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2939254..2939497
FT                   /estimated_length=244
FT                   /gap_type="unknown"
FT   CDS             join(<2941396..2941526,2941960..2942069,2944619..2944741,
FT                   2945328..2945356)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145606"
FT                   /product="mCG145606"
FT                   /note="gene_id=mCG145606.0 transcript_id=mCT185030.0
FT                   protein_id=mCP106084.0"
FT                   /protein_id="EDL40108.1"
FT                   /translation="LSQHTVLCSFGSHACVCPSSTANQLPYLWASYLDVVVPCFIIHRV
FT                   HLVTLWTQEHQGSGLEASIWHSENLHVFFTGLFGNDSLIMHSRLSNSGFSCCKLSNAEA
FT                   TGIAGLCHHTRQEQLRVSIQPAFKTK"
FT   assembly_gap    2986971..2987046
FT                   /estimated_length=76
FT                   /gap_type="unknown"
FT   assembly_gap    3025998..3026017
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3055247..3055408
FT                   /estimated_length=162
FT                   /gap_type="unknown"
FT   assembly_gap    3063047..3063066
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3074867..3075109
FT                   /estimated_length=243
FT                   /gap_type="unknown"
FT   gene            complement(3081805..3085109)
FT                   /gene="Arl4c"
FT                   /locus_tag="mCG_49726"
FT                   /note="gene_id=mCG49726.2"
FT   mRNA            complement(3081805..3085109)
FT                   /gene="Arl4c"
FT                   /locus_tag="mCG_49726"
FT                   /product="ADP-ribosylation factor-like 4C"
FT                   /note="gene_id=mCG49726.2 transcript_id=mCT49909.2 created
FT                   on 13-FEB-2003"
FT   CDS             complement(3084292..3084870)
FT                   /codon_start=1
FT                   /gene="Arl4c"
FT                   /locus_tag="mCG_49726"
FT                   /product="ADP-ribosylation factor-like 4C"
FT                   /note="gene_id=mCG49726.2 transcript_id=mCT49909.2
FT                   protein_id=mCP41058.2"
FT                   /protein_id="EDL40107.1"
FT                   /translation="MGNISSNISAFQSLHIVMLGLDSAGKTTVLYRLKFNEFVNTVPTI
FT                   GFNTEKIKLSNGTAKGISCHFWDVGGQEKLRPLWKSYSRCTDGIIYVVDSVDVDRLEEA
FT                   KTELHKVTKFAENQGTPLLVIANKQDLPKSLPVAEIEKQLALHELIPATTYHVQPACAI
FT                   IGEGLTEGMDKLYEMILKRRKSLKQKKKR"
FT   assembly_gap    3085110..3085424
FT                   /estimated_length=315
FT                   /gap_type="unknown"
FT   assembly_gap    3096318..3096396
FT                   /estimated_length=79
FT                   /gap_type="unknown"
FT   assembly_gap    3097924..3097953
FT                   /estimated_length=30
FT                   /gap_type="unknown"
FT   assembly_gap    3105389..3105521
FT                   /estimated_length=133
FT                   /gap_type="unknown"
FT   assembly_gap    3110296..3110315
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3132946..3132965
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <3138466..3139314
FT                   /locus_tag="mCG_146340"
FT                   /note="gene_id=mCG146340.0"
FT   mRNA            join(<3138466..3138537,3138663..3138869,3139113..3139314)
FT                   /locus_tag="mCG_146340"
FT                   /product="mCG146340"
FT                   /note="gene_id=mCG146340.0 transcript_id=mCT186443.0
FT                   created on 14-JUL-2003"
FT   CDS             join(<3138468..3138537,3138663..3138869,3139113..3139198)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146340"
FT                   /product="mCG146340"
FT                   /note="gene_id=mCG146340.0 transcript_id=mCT186443.0
FT                   protein_id=mCP107684.0"
FT                   /protein_id="EDL40106.1"
FT                   /translation="RVGFETLLLATWHPVGSWIPLDEGVALVMVSVHSSGNPNSDSNLA
FT                   ASPDSKQHDGLTDNVFLAGGLGHPQTQLKRELVWSKACEPKVCVLIRGWSLLTEVKSIV
FT                   LPHLQLPARSHYLLSS"
FT   assembly_gap    3148428..3148553
FT                   /estimated_length=126
FT                   /gap_type="unknown"
FT   assembly_gap    3151222..3151383
FT                   /estimated_length=162
FT                   /gap_type="unknown"
FT   assembly_gap    3156193..3156347
FT                   /estimated_length=155
FT                   /gap_type="unknown"
FT   assembly_gap    3158415..3158434
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3168282..3169151
FT                   /estimated_length=870
FT                   /gap_type="unknown"
FT   assembly_gap    3171028..3172776
FT                   /estimated_length=1749
FT                   /gap_type="unknown"
FT   assembly_gap    3174037..3174056
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3180503..3180522
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3181572..3181591
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3186265..3186299
FT                   /estimated_length=35
FT                   /gap_type="unknown"
FT   assembly_gap    3202411..3202430
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3203597..3203616
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3206231..3207065
FT                   /estimated_length=835
FT                   /gap_type="unknown"
FT   assembly_gap    3220070..3220089
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3241399..3241456
FT                   /estimated_length=58
FT                   /gap_type="unknown"
FT   assembly_gap    3251869..3252045
FT                   /estimated_length=177
FT                   /gap_type="unknown"
FT   assembly_gap    3254876..3254953
FT                   /estimated_length=78
FT                   /gap_type="unknown"
FT   assembly_gap    3275146..3275165
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3284407..3284426
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3289030..3289049
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3291043..3293264
FT                   /estimated_length=2222
FT                   /gap_type="unknown"
FT   assembly_gap    3294813..3294832
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3296534..3296553
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3300055..3300074
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3304599..3304618
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            3317299..3318489
FT                   /pseudo
FT                   /locus_tag="mCG_67634"
FT                   /note="gene_id=mCG67634.2"
FT   mRNA            3317299..3318489
FT                   /pseudo
FT                   /locus_tag="mCG_67634"
FT                   /note="gene_id=mCG67634.2 transcript_id=mCT67817.2 created
FT                   on 14-FEB-2003"
FT   assembly_gap    3324241..3324777
FT                   /estimated_length=537
FT                   /gap_type="unknown"
FT   assembly_gap    3327013..3327332
FT                   /estimated_length=320
FT                   /gap_type="unknown"
FT   assembly_gap    3355266..3355285
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3377747..3377766
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            3399346..3405458
FT                   /locus_tag="mCG_148384"
FT                   /note="gene_id=mCG148384.0"
FT   mRNA            join(3399346..3399606,3399780..3399887,3405225..3405458)
FT                   /locus_tag="mCG_148384"
FT                   /product="mCG148384"
FT                   /note="gene_id=mCG148384.0 transcript_id=mCT188647.0
FT                   created on 13-JAN-2004"
FT   CDS             3405237..3405416
FT                   /codon_start=1
FT                   /locus_tag="mCG_148384"
FT                   /product="mCG148384"
FT                   /note="gene_id=mCG148384.0 transcript_id=mCT188647.0
FT                   protein_id=mCP108666.0"
FT                   /protein_id="EDL40105.1"
FT                   /translation="MNPSASGLFQLTGQPPVPSMCVQITSFHSLPMKRPFLYIPLSTVV
FT                   CRLMDVQADSISCL"
FT   gene            3453766..3533968
FT                   /gene="Sh3bp4"
FT                   /locus_tag="mCG_12600"
FT                   /note="gene_id=mCG12600.2"
FT   mRNA            join(3453766..3453910,3484957..3485035,3515172..3515416,
FT                   3521168..3523524,3531666..3531855,3533279..3533951)
FT                   /gene="Sh3bp4"
FT                   /locus_tag="mCG_12600"
FT                   /product="SH3-domain binding protein 4, transcript variant
FT                   mCT177874"
FT                   /note="gene_id=mCG12600.2 transcript_id=mCT177874.0 created
FT                   on 31-DEC-2002"
FT   mRNA            join(3453772..3453910,3484957..3485035,3515172..3515416,
FT                   3521168..3523524,3532357..3532545,3533279..3533968)
FT                   /gene="Sh3bp4"
FT                   /locus_tag="mCG_12600"
FT                   /product="SH3-domain binding protein 4, transcript variant
FT                   mCT13197"
FT                   /note="gene_id=mCG12600.2 transcript_id=mCT13197.2 created
FT                   on 31-DEC-2002"
FT   CDS             join(3515299..3515416,3521168..3523524,3532357..3532545,
FT                   3533279..3533503)
FT                   /codon_start=1
FT                   /gene="Sh3bp4"
FT                   /locus_tag="mCG_12600"
FT                   /product="SH3-domain binding protein 4, isoform CRA_a"
FT                   /note="gene_id=mCG12600.2 transcript_id=mCT13197.2
FT                   protein_id=mCP21022.2 isoform=CRA_a"
FT                   /protein_id="EDL40103.1"
FT                   /translation="MAAQRIRAANASGLPRCKSEGTLIDLSEGFSETSFNDVKVPSPSA
FT                   LLVDNPTPFGNAKEVIAIKDYCPNNFTTLKFSKGDHLYVLDTSGGEWWYAHNTTEMGYI
FT                   PSSYVQPLNYRNSTLSDSGMIDNLPDSPEEVAKELDLLGGGWTDDQKESGRPYSNNPFW
FT                   NGVRTNPFLNGNAQPSTDELNPKSTVDLLLFDTGTSSFTESSSATTNSTGNIFDELPAT
FT                   NGLQVEQPVKRDNPFFRSKRSYSLSELSVLQAKSDAPPTSSFFTGLKSPVPEQFQSRED
FT                   FRTAWLNHRKLARSCHDLDLLGQSPGWGQTQAVETNIVCKLDSSGGSVQLPDTNISIHV
FT                   PEGHVAPGETQQISMKALLDPPLDLNSDRSTSVSPVVEVKLSNLEVSTFIILEMKVSAE
FT                   VKGDIFSKSTVVLQCLRSDSKEGPYVPIPLAYSYGDTIQVQLDNLEPCMYLAIVAQGPN
FT                   ILYPSTVWDFINKRVTVGLYGPKHIHPSFKTVVTIFGHDCAPKTLLVSEVTRQAPSPAP
FT                   VALQLWGKHQFILSRPQDLRVCMFSNMTNYEVKANEQARVVRGFQMKLGKVSRLIFSVI
FT                   SQNPNELSDFTLRVQVKDDQDTILTQFCVQTPQPPPKSAIKPSGQRRFLKKNEVGKIIL
FT                   SPFVVTTKYPTFQDRPVSSLKFGKLLKTVVRQNKSHYLLEYKKGDVVALLSEERIRLKG
FT                   QLWTKEWYIGYYQGKVGLVHTKNVLVVGKARPSLFSGPELSTSVLLEQILRPCKFLTYI
FT                   YASVRTLLMENISSWRAFADALGYGNLPLTFFCRAELDSEPERVASVLEKLKEDCNNPD
FT                   NKDRKSFQKELVMALLKMDCQGLVVRLIQDFVLLTTAVEVAQRWRELAEKLAKVSKQQM
FT                   DAYESPHRDRNGVVDSEAMWKPAYDFLLTWSHQIGDSYRDVIQELHIGLDKMKNPITRR
FT                   WKHLTGTLILVNSLDILRAAAFSPADHDDFVI"
FT   CDS             join(3515299..3515416,3521168..3523524,3531666..3531854)
FT                   /codon_start=1
FT                   /gene="Sh3bp4"
FT                   /locus_tag="mCG_12600"
FT                   /product="SH3-domain binding protein 4, isoform CRA_b"
FT                   /note="gene_id=mCG12600.2 transcript_id=mCT177874.0
FT                   protein_id=mCP100796.0 isoform=CRA_b"
FT                   /protein_id="EDL40104.1"
FT                   /translation="MAAQRIRAANASGLPRCKSEGTLIDLSEGFSETSFNDVKVPSPSA
FT                   LLVDNPTPFGNAKEVIAIKDYCPNNFTTLKFSKGDHLYVLDTSGGEWWYAHNTTEMGYI
FT                   PSSYVQPLNYRNSTLSDSGMIDNLPDSPEEVAKELDLLGGGWTDDQKESGRPYSNNPFW
FT                   NGVRTNPFLNGNAQPSTDELNPKSTVDLLLFDTGTSSFTESSSATTNSTGNIFDELPAT
FT                   NGLQVEQPVKRDNPFFRSKRSYSLSELSVLQAKSDAPPTSSFFTGLKSPVPEQFQSRED
FT                   FRTAWLNHRKLARSCHDLDLLGQSPGWGQTQAVETNIVCKLDSSGGSVQLPDTNISIHV
FT                   PEGHVAPGETQQISMKALLDPPLDLNSDRSTSVSPVVEVKLSNLEVSTFIILEMKVSAE
FT                   VKGDIFSKSTVVLQCLRSDSKEGPYVPIPLAYSYGDTIQVQLDNLEPCMYLAIVAQGPN
FT                   ILYPSTVWDFINKRVTVGLYGPKHIHPSFKTVVTIFGHDCAPKTLLVSEVTRQAPSPAP
FT                   VALQLWGKHQFILSRPQDLRVCMFSNMTNYEVKANEQARVVRGFQMKLGKVSRLIFSVI
FT                   SQNPNELSDFTLRVQVKDDQDTILTQFCVQTPQPPPKSAIKPSGQRRFLKKNEVGKIIL
FT                   SPFVVTTKYPTFQDRPVSSLKFGKLLKTVVRQNKSHYLLEYKKGDVVALLSEERIRLKG
FT                   QLWTKEWYIGYYQGKVGLVHTKNVLVVGKARPSLFSGPELSTSVLLEQILRPCKFLTYI
FT                   YASVRTLLMENISSWRAFADALGYGNLPLTFFCRAELDSEPERVASVLEKLKEDCNNPD
FT                   NKDRKSFQKELVMALLKMDCQGLVVRLIQDFVLLTTAVEVAQRWRELAEKLAKVSKQQM
FT                   DAYESPHRDRNGGSRQ"
FT   assembly_gap    3529024..3529043
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3530110..3530129
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3531945..3531964
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3571240..3571414
FT                   /estimated_length=175
FT                   /gap_type="unknown"
FT   assembly_gap    3576223..3577472
FT                   /estimated_length=1250
FT                   /gap_type="unknown"
FT   assembly_gap    3579975..3580555
FT                   /estimated_length=581
FT                   /gap_type="unknown"
FT   assembly_gap    3584083..3584102
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3585585..3588399
FT                   /estimated_length=2815
FT                   /gap_type="unknown"
FT   assembly_gap    3589615..3589634
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3590671..3590690
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3592197..3592216
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3597967..3597986
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3599422..3599972
FT                   /estimated_length=551
FT                   /gap_type="unknown"
FT   assembly_gap    3607101..3607273
FT                   /estimated_length=173
FT                   /gap_type="unknown"
FT   gene            complement(3624947..3625885)
FT                   /locus_tag="mCG_12602"
FT                   /note="gene_id=mCG12602.2"
FT   mRNA            complement(3624947..3625885)
FT                   /locus_tag="mCG_12602"
FT                   /product="mCG12602"
FT                   /note="gene_id=mCG12602.2 transcript_id=mCT13195.2 created
FT                   on 04-FEB-2003"
FT   CDS             complement(3625019..3625879)
FT                   /codon_start=1
FT                   /locus_tag="mCG_12602"
FT                   /product="mCG12602"
FT                   /note="gene_id=mCG12602.2 transcript_id=mCT13195.2
FT                   protein_id=mCP21031.2"
FT                   /protein_id="EDL40102.1"
FT                   /translation="MPKGKNAKEKKVALARAVIKKQEAKKMVSPLFEKRPKNFGIGQDI
FT                   QPKKNLTRFVKWPHYIRLQWQRAMLYKRLKVPPAINQFTQALDRQTATQLLKLAHKYRP
FT                   ETKQEKKQRLLAHAEKKAAGKGDIPTKRPPVLQAGVNTVTTLVENKKAQLVVMAHDIDP
FT                   LSWWFSCLPCVERWGFPTASSRERPGWGTWSTGRHAPLLPSHRLTRKTRVLWLSWWKLL
FT                   GQITMTDTTRSTATGEATSWVLSLWLALPSWKKQRLKNSPLNWAKCTLSLLYINTIANI
FT                   FLKTK"
FT   assembly_gap    3638405..3639691
FT                   /estimated_length=1287
FT                   /gap_type="unknown"
FT   assembly_gap    3682912..3682931
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3684077..3684096
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3689370..3689389
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3694120..3717158
FT                   /estimated_length=23039
FT                   /gap_type="unknown"
FT   assembly_gap    3790118..3790137
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3796502..3796521
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <3810203..4253565
FT                   /gene="Centg2"
FT                   /locus_tag="mCG_142253"
FT                   /note="gene_id=mCG142253.0"
FT   mRNA            join(<3810203..3810516,3965955..3966013,3970888..3970975,
FT                   3989112..3989197,3991735..3991876,3995448..3995582,
FT                   4024948..4025075,4026321..4026476,4032474..4032566,
FT                   4087350..4087454,4105127..4105297,4128899..4129058,
FT                   4151766..4151927,4197040..4197194,4200318..4200408,
FT                   4205620..4205842,4250121..4250376,4251306..4253565)
FT                   /gene="Centg2"
FT                   /locus_tag="mCG_142253"
FT                   /product="centaurin, gamma 2"
FT                   /note="gene_id=mCG142253.0 transcript_id=mCT179517.0
FT                   created on 04-FEB-2003"
FT   CDS             join(<3810516..3810516,3965955..3966013,3970888..3970975,
FT                   3989112..3989197,3991735..3991876,3995448..3995582,
FT                   4024948..4025075,4026321..4026476,4032474..4032566,
FT                   4087350..4087454,4105127..4105297,4128899..4129058,
FT                   4151766..4151927,4197040..4197194,4200318..4200408,
FT                   4205620..4205842,4250121..4250376,4251306..4251509)
FT                   /codon_start=1
FT                   /gene="Centg2"
FT                   /locus_tag="mCG_142253"
FT                   /product="centaurin, gamma 2"
FT                   /note="gene_id=mCG142253.0 transcript_id=mCT179517.0
FT                   protein_id=mCP102439.0"
FT                   /protein_id="EDL40100.1"
FT                   /translation="DAFVNSQEWTLSRSVPELKVGIVGNLASGKSALVHRYLTGTYVQE
FT                   ESPEGGRFKKEIVVDGQSYLLLIRDEGGPPEAQFAMWVDAVIFVFSLEDEISFQTVYHY
FT                   YSRMANYRNTSEIPLVLVGTQDAISSTNPRVIDDVRARKLSNDLKRCTYYETCATYGLN
FT                   VERVFQDVAQKIVATRKKQQLSIGPCKSLPNSPSHSSVCSAQVSAVHISQTSNGGGSLS
FT                   DYSSSVPSTPSTSQKELRIDVPPTANTPTPVRKQSKRRSNLFTSRKGSDPDKEKKGLES
FT                   RADSIGSGRAIPIKQGMLLKRSGKSLNKEWKKKYVTLCDNGVLTYHPSLHDYMQNVHGK
FT                   EIDLLRTTVKVPGKRPPRATSACAPISSPKTNGLAKDMSSLHISPNSGGNVTSASGSQM
FT                   ASGISLVSFNSRPDGMHQRSYSVSSADQWSDATVIANSAISSDTGLGDSVCSSPSISSS
FT                   TSPKLDPPPSPHANRKKHRRKKSTSNFKADGLSGTAEEQEENLEFIIVSLTGQTWHFEA
FT                   TTYEERDAWVQAIESQILASLQSCESSKNKSRLTSQSEAMALQSIRNMRGNSHCVDCDT
FT                   QNPNWASLNLGALMCIECSGIHRNLGTHLSRVRSLDLDDWPMELIKVMSSIGNELANSV
FT                   WEEGSQGRTKPSLDSTREEKERWIRAKYEQKLFLAPLPCTEFSLGQQLLRATAEEDLRT
FT                   VILLLAHGSRDEVNETCGEGDGRTALHLACRKGNVVLAQLLIWYGVDVMARDAHGNTAL
FT                   AYARQASSQECIDVLLQYGCPDERFVLMATPNLSRKSNSRNNSSGRAPSVI"
FT   assembly_gap    3810517..3810536
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3857189..3857208
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3861016..3861058
FT                   /estimated_length=43
FT                   /gap_type="unknown"
FT   assembly_gap    3865977..3865996
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3868580..3868599
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3870257..3873655
FT                   /estimated_length=3399
FT                   /gap_type="unknown"
FT   assembly_gap    3880379..3880398
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3893283..3893667
FT                   /estimated_length=385
FT                   /gap_type="unknown"
FT   assembly_gap    3922601..3922780
FT                   /estimated_length=180
FT                   /gap_type="unknown"
FT   assembly_gap    3941313..3941823
FT                   /estimated_length=511
FT                   /gap_type="unknown"
FT   assembly_gap    3966527..3966736
FT                   /estimated_length=210
FT                   /gap_type="unknown"
FT   assembly_gap    3982749..3982768
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3992890..3992947
FT                   /estimated_length=58
FT                   /gap_type="unknown"
FT   gene            complement(4011817..>4045313)
FT                   /locus_tag="mCG_145052"
FT                   /note="gene_id=mCG145052.0"
FT   mRNA            complement(join(4011817..4012214,4015685..4015857,
FT                   4016304..4016407,4042474..4042583,4045089..>4045313))
FT                   /locus_tag="mCG_145052"
FT                   /product="mCG145052"
FT                   /note="gene_id=mCG145052.0 transcript_id=mCT184476.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(4012206..4012214,4015685..4015857,
FT                   4016304..>4016403))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145052"
FT                   /product="mCG145052"
FT                   /note="gene_id=mCG145052.0 transcript_id=mCT184476.0
FT                   protein_id=mCP106065.0"
FT                   /protein_id="EDL40101.1"
FT                   /translation="LEMGMCGHPEHHCTSGDGWYCRQATWVLAEEGQASSAQRTLALVR
FT                   KLPFYHTEQQGPSDTLPWAFTGLNSSASTAFLTLPSQWRQDQARRQNT"
FT   assembly_gap    4042319..4042338
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4044932..4045057
FT                   /estimated_length=126
FT                   /gap_type="unknown"
FT   assembly_gap    4108910..4109011
FT                   /estimated_length=102
FT                   /gap_type="unknown"
FT   assembly_gap    4111326..4111345
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4114738..4114757
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4116000..4116019
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4121493..4122164
FT                   /estimated_length=672
FT                   /gap_type="unknown"
FT   gene            complement(4290516..4293795)
FT                   /gene="Gbx2"
FT                   /locus_tag="mCG_4738"
FT                   /note="gene_id=mCG4738.1"
FT   mRNA            complement(join(4290516..4291759,4292851..4293795))
FT                   /gene="Gbx2"
FT                   /locus_tag="mCG_4738"
FT                   /product="gastrulation brain homeobox 2"
FT                   /note="gene_id=mCG4738.1 transcript_id=mCT4029.1 created on
FT                   31-DEC-2002"
FT   CDS             complement(join(4291236..4291759,4292851..4293373))
FT                   /codon_start=1
FT                   /gene="Gbx2"
FT                   /locus_tag="mCG_4738"
FT                   /product="gastrulation brain homeobox 2"
FT                   /note="gene_id=mCG4738.1 transcript_id=mCT4029.1
FT                   protein_id=mCP20993.2"
FT                   /protein_id="EDL40099.1"
FT                   /translation="MSAAFPPSLMMMQRPLGSSTAFSIDSLIGSPPQPSPGHFVYTGYP
FT                   MFMPYRPVVLPPPPPPPPALPQAALQPALPPAHPHHQIPSLPTGFCSSLAQGMALTSTL
FT                   MATLPGGFSASPQHQEAAAARKFAPQPLPGGGNFDKAEALQADAEDGKAFLAKEGSLLA
FT                   FSAAEAVQASLVGAVRGQGKDESKVEDDPKGKEESFSLESDVDYSSDDNLPGQTAHKEE
FT                   DPGHALEETPQSGGAAGSTTSTGKNRRRRTAFTSEQLLELEKEFHCKKYLSLTERSQIA
FT                   HALKLSEVQVKIWFQNRRAKWKRVKAGNANSKTGEPSRNPKIVVPIPVHVSRFAIRSQH
FT                   QQLEQARP"
FT   assembly_gap    4300270..4300320
FT                   /estimated_length=51
FT                   /gap_type="unknown"
FT   gene            complement(<4315306..>4377652)
FT                   /gene="Asb18"
FT                   /locus_tag="mCG_51817"
FT                   /note="gene_id=mCG51817.2"
FT   mRNA            complement(join(<4315306..4315491,4317017..4317130,
FT                   4331282..4331789,4356027..4356294,4359283..4359405,
FT                   4377448..>4377652))
FT                   /gene="Asb18"
FT                   /locus_tag="mCG_51817"
FT                   /product="ankyrin repeat and SOCS box-containing 18"
FT                   /note="gene_id=mCG51817.2 transcript_id=mCT52000.2 created
FT                   on 31-DEC-2002"
FT   CDS             complement(join(4315306..4315491,4317017..4317130,
FT                   4331282..4331789,4356027..4356294,4359283..4359405,
FT                   4377448..4377652))
FT                   /codon_start=1
FT                   /gene="Asb18"
FT                   /locus_tag="mCG_51817"
FT                   /product="ankyrin repeat and SOCS box-containing 18"
FT                   /note="gene_id=mCG51817.2 transcript_id=mCT52000.2
FT                   protein_id=mCP41067.2"
FT                   /protein_id="EDL40098.1"
FT                   /translation="MSSWDSPPDYPLSSDIVRRLKSALATGDEDTVQKLICTEVEPVDA
FT                   VIELANDDWMKEPSAELPTGVLLGDLDHIRLLMDQCFWDANAVFEISNGEMEWQVTSLA
FT                   TFGLSGLWTLEYQRELTTPLCIAAAHGHESCVRHLLSRKADPNASPGGRGALHEACLGN
FT                   HTACARLLLQHGADPDLLNSEGLAPLHLCRTPASLGCARELLEHGATVQLEGGPGRDTP
FT                   LHVAAQRGLDEHAQLYLGFGARVDARNGRGETALSAACGAAARSPDEHARCLRLCALLL
FT                   RGGAAADARDEDERSPLHKACGHARPGLCTLLLRHGADAGALDYGGASPLARALQTATC
FT                   APPTAPQRTVQVLLNHGSRSVWPDAFPKVLRTCAQVPEVIEVLFNSYTQLPVSESWREA
FT                   IPEEVYQMHKPFYRSLFALAHTPRCLQHLCRCTIRKLFGKESVHLVPQLPLPETLQNYL
FT                   LLEPEGVLC"
FT   assembly_gap    4320049..4320118
FT                   /estimated_length=70
FT                   /gap_type="unknown"
FT   assembly_gap    4323134..4323153
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4329481..4329557
FT                   /estimated_length=77
FT                   /gap_type="unknown"
FT   gene            complement(4405211..4453537)
FT                   /locus_tag="mCG_142252"
FT                   /note="gene_id=mCG142252.0"
FT   mRNA            complement(join(4405211..4405819,4408667..4408905,
FT                   4410853..4411045,4415467..4415553,4430044..4430243,
FT                   4433893..4434000,4437128..4437210,4441176..4441243,
FT                   4444196..4444288,4444652..4444758,4452901..4452976,
FT                   4453361..4453537))
FT                   /locus_tag="mCG_142252"
FT                   /product="mCG142252"
FT                   /note="gene_id=mCG142252.0 transcript_id=mCT179514.0
FT                   created on 04-FEB-2003"
FT   CDS             complement(join(4405703..4405819,4408667..4408905,
FT                   4410853..4411045,4415467..4415553,4430044..4430243,
FT                   4433893..4434000,4437128..4437210,4441176..4441243,
FT                   4444196..4444288,4444652..4444758,4452901..4452955))
FT                   /codon_start=1
FT                   /locus_tag="mCG_142252"
FT                   /product="mCG142252"
FT                   /note="gene_id=mCG142252.0 transcript_id=mCT179514.0
FT                   protein_id=mCP102438.0"
FT                   /protein_id="EDL40097.1"
FT                   /translation="MSPSLFLQLMEEGNSLYKDIWLNKDESWNFPQDYDPELIKEEKRK
FT                   ELEMEIRVQVDELMRQELKNLKLAVNREMEIPPRQKKGKKKNKGRKGRRGKRGKKEKDL
FT                   TADRTIESLYQELVEKGLLIQALKVNLSDYIGEYSYLGTTLRQVAIEPMPSLLDVRQLI
FT                   TLYGILPLGSAEVHERAPLVKSLLLAGPSGVGKKMLVHAICTETGANLFNLSALNIAGK
FT                   YPGKTGLQMMIHLVFKVARQLQPSVVWIQDTEKTFYKKVPQAEKRFEPKRLKRYLPKLL
FT                   KLLKPDDRILIVGTTHRPFDAELQPFCRVYQKIILVPRPDYASRYGKFHEVLWKEIILR
FT                   NGGKLTNSLNISCLSKVTDGFTQGQIVQVIKDVLTERRLRQQAHKPLTAIEFITMMTNM
FT                   NPVYREEEESFKNWYAKTPLGKKRVLSLTVGNKEKEKDKGKKGKRGKKKK"
FT   assembly_gap    4421231..4423624
FT                   /estimated_length=2394
FT                   /gap_type="unknown"
FT   assembly_gap    4433407..4433630
FT                   /estimated_length=224
FT                   /gap_type="unknown"
FT   assembly_gap    4444106..4444125
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4445084..4445318
FT                   /estimated_length=235
FT                   /gap_type="unknown"
FT   assembly_gap    4454316..4454459
FT                   /estimated_length=144
FT                   /gap_type="unknown"
FT   assembly_gap    4457793..4457812
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(4461430..4518323)
FT                   /locus_tag="mCG_142251"
FT                   /note="gene_id=mCG142251.0"
FT   mRNA            complement(join(4461430..4461648,4467406..4467490,
FT                   4493505..4493710,4501603..4501674,4503395..4503586,
FT                   4506188..4506304,4508333..4508657,4518085..4518323))
FT                   /locus_tag="mCG_142251"
FT                   /product="mCG142251, transcript variant mCT179515"
FT                   /note="gene_id=mCG142251.0 transcript_id=mCT179515.0
FT                   created on 04-FEB-2003"
FT   CDS             complement(join(4461466..4461648,4467406..4467490,
FT                   4493505..4493710,4501603..4501674,4503395..4503586,
FT                   4506188..4506304,4508333..4508657,4518085..4518095))
FT                   /codon_start=1
FT                   /locus_tag="mCG_142251"
FT                   /product="mCG142251, isoform CRA_a"
FT                   /note="gene_id=mCG142251.0 transcript_id=mCT179515.0
FT                   protein_id=mCP102436.0 isoform=CRA_a"
FT                   /protein_id="EDL40095.1"
FT                   /translation="MSNLMYNKMWHQTQEALNSLLDKEFQKMSEPQANKVLVFQMLATF
FT                   YINYVQIFRNMENVYDQIVHPQKRMLIRKVLDGVMGRILELKNEMVELEMTEFHYFDDI
FT                   LQDLKLSPQQLDVPIPRYFLKERLEVIKGREKILARILTECGLNLPVKYAAKSIALEEA
FT                   VKLIQIAERARQGRLRALFMKQIFLQECRAKEMKLLGHRLLDTKLAALQIQKVWRGFHQ
FT                   CKKTVKEREEEMVFLGMKPSPLFNEVSDAIVQSKQVTNLRDEVQLKHEQDYQEALVNIK
FT                   EDLKMLEGPDIKEHLQDQIRQWFIECRNLTGTFPDYPNEEDGGSALIFSNKTPEQVMGD
FT                   IIATQEEEEKLKKKKKKEDKENKGKKGKKEKKEKKEKKVSLKEKAMKVTRVRILQD"
FT   assembly_gap    4471611..4471630
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4472762..4472800
FT                   /estimated_length=39
FT                   /gap_type="unknown"
FT   assembly_gap    4474645..4474742
FT                   /estimated_length=98
FT                   /gap_type="unknown"
FT   mRNA            complement(join(4490595..4490926,4493505..4493710,
FT                   4501603..4501674,4503395..4503586,4506188..4506304,
FT                   4508333..4508657,4518085..4518322))
FT                   /locus_tag="mCG_142251"
FT                   /product="mCG142251, transcript variant mCT179516"
FT                   /note="gene_id=mCG142251.0 transcript_id=mCT179516.0
FT                   created on 04-FEB-2003"
FT   CDS             complement(join(4490908..4490926,4493505..4493710,
FT                   4501603..4501674,4503395..4503586,4506188..4506304,
FT                   4508333..4508657,4518085..4518095))
FT                   /codon_start=1
FT                   /locus_tag="mCG_142251"
FT                   /product="mCG142251, isoform CRA_b"
FT                   /note="gene_id=mCG142251.0 transcript_id=mCT179516.0
FT                   protein_id=mCP102437.0 isoform=CRA_b"
FT                   /protein_id="EDL40096.1"
FT                   /translation="MSNLMYNKMWHQTQEALNSLLDKEFQKMSEPQANKVLVFQMLATF
FT                   YINYVQIFRNMENVYDQIVHPQKRMLIRKVLDGVMGRILELKNEMVELEMTEFHYFDDI
FT                   LQDLKLSPQQLDVPIPRYFLKERLEVIKGREKILARILTECGLNLPVKYAAKSIALEEA
FT                   VKLIQIAERARQGRLRALFMKQIFLQECRAKEMKLLGHRLLDTKLAALQIQKVWRGFHQ
FT                   CKKTVKEREEEMVFLGMKPSPLFNEVSDAIVQSKQVTNLRDEVQLKHEQDYQEALVNIK
FT                   EDLKMLEGPDIKEHLQDQIRQWFIECRLGCCS"
FT   assembly_gap    4503075..4503316
FT                   /estimated_length=242
FT                   /gap_type="unknown"
FT   assembly_gap    4510119..4513526
FT                   /estimated_length=3408
FT                   /gap_type="unknown"
FT   assembly_gap    4517219..4517238
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4519511..4519716
FT                   /estimated_length=206
FT                   /gap_type="unknown"
FT   assembly_gap    4529761..4529780
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4545731..4545750
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4558333..4558352
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            4568821..4580427
FT                   /gene="Cmkor1"
FT                   /locus_tag="mCG_4737"
FT                   /note="gene_id=mCG4737.1"
FT   mRNA            join(4568821..4568903,4574405..4574687,4578615..4580427)
FT                   /gene="Cmkor1"
FT                   /locus_tag="mCG_4737"
FT                   /product="chemokine orphan receptor 1, transcript variant
FT                   mCT178035"
FT                   /note="gene_id=mCG4737.1 transcript_id=mCT178035.0 created
FT                   on 31-DEC-2002"
FT   mRNA            join(4568842..4568903,4578615..4580427)
FT                   /gene="Cmkor1"
FT                   /locus_tag="mCG_4737"
FT                   /product="chemokine orphan receptor 1, transcript variant
FT                   mCT4028"
FT                   /note="gene_id=mCG4737.1 transcript_id=mCT4028.0 created on
FT                   31-DEC-2002"
FT   CDS             4578641..4579729
FT                   /codon_start=1
FT                   /gene="Cmkor1"
FT                   /locus_tag="mCG_4737"
FT                   /product="chemokine orphan receptor 1, isoform CRA_a"
FT                   /note="gene_id=mCG4737.1 transcript_id=mCT178035.0
FT                   protein_id=mCP100957.0 isoform=CRA_a"
FT                   /protein_id="EDL40093.1"
FT                   /translation="MDVHLFDYAEPGNYSDINWPCNSSDCIVVDTVQCPTMPNKNVLLY
FT                   TLSFIYIFIFVIGMIANSVVVWVNIQAKTTGYDTHCYILNLAIADLWVVITIPVWVVSL
FT                   VQHNQWPMGELTCKITHLIFSINLFGSIFFLACMSVDRYLSITYFTGTSSYKKKMVRRV
FT                   VCILVWLLAFFVSLPDTYYLKTVTSASNNETYCRSFYPEHSIKEWLIGMELVSVILGFA
FT                   VPFTIIAIFYFLLARAMSASGDQEKHSSRKIIFSYVVVFLVCWLPYHFVVLLDIFSILH
FT                   YIPFTCQLENVLFTALHVTQCLSLVHCCVNPVLYSFINRNYRYELMKAFIFKYSAKTGL
FT                   TKLIDASRVSETEYSALEQNTK"
FT   CDS             4578641..4579729
FT                   /codon_start=1
FT                   /gene="Cmkor1"
FT                   /locus_tag="mCG_4737"
FT                   /product="chemokine orphan receptor 1, isoform CRA_a"
FT                   /note="gene_id=mCG4737.1 transcript_id=mCT4028.0
FT                   protein_id=mCP20992.1 isoform=CRA_a"
FT                   /protein_id="EDL40094.1"
FT                   /translation="MDVHLFDYAEPGNYSDINWPCNSSDCIVVDTVQCPTMPNKNVLLY
FT                   TLSFIYIFIFVIGMIANSVVVWVNIQAKTTGYDTHCYILNLAIADLWVVITIPVWVVSL
FT                   VQHNQWPMGELTCKITHLIFSINLFGSIFFLACMSVDRYLSITYFTGTSSYKKKMVRRV
FT                   VCILVWLLAFFVSLPDTYYLKTVTSASNNETYCRSFYPEHSIKEWLIGMELVSVILGFA
FT                   VPFTIIAIFYFLLARAMSASGDQEKHSSRKIIFSYVVVFLVCWLPYHFVVLLDIFSILH
FT                   YIPFTCQLENVLFTALHVTQCLSLVHCCVNPVLYSFINRNYRYELMKAFIFKYSAKTGL
FT                   TKLIDASRVSETEYSALEQNTK"
FT   assembly_gap    4590157..4590176
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4600547..4600636
FT                   /estimated_length=90
FT                   /gap_type="unknown"
FT   assembly_gap    4609126..4609145
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4632636..4632655
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4639165..4639184
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            4645452..4648907
FT                   /locus_tag="mCG_148387"
FT                   /note="gene_id=mCG148387.0"
FT   mRNA            join(4645452..4645601,4648056..4648907)
FT                   /locus_tag="mCG_148387"
FT                   /product="mCG148387"
FT                   /note="gene_id=mCG148387.0 transcript_id=mCT188650.0
FT                   created on 13-JAN-2004"
FT   CDS             4648541..4648690
FT                   /codon_start=1
FT                   /locus_tag="mCG_148387"
FT                   /product="mCG148387"
FT                   /note="gene_id=mCG148387.0 transcript_id=mCT188650.0
FT                   protein_id=mCP108671.0"
FT                   /protein_id="EDL40092.1"
FT                   /translation="MSGRQRVGDHMLRRGGERSSALLNALPGSSPLPLRLPVETSGILL
FT                   QATE"
FT   assembly_gap    4652224..4652402
FT                   /estimated_length=179
FT                   /gap_type="unknown"
FT   assembly_gap    4655667..4655698
FT                   /estimated_length=32
FT                   /gap_type="unknown"
FT   assembly_gap    4664528..4664669
FT                   /estimated_length=142
FT                   /gap_type="unknown"
FT   assembly_gap    4670890..4670928
FT                   /estimated_length=39
FT                   /gap_type="unknown"
FT   assembly_gap    4675237..4675256
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4694729..4695032
FT                   /estimated_length=304
FT                   /gap_type="unknown"
FT   assembly_gap    4721818..4724335
FT                   /estimated_length=2518
FT                   /gap_type="unknown"
FT   assembly_gap    4732834..4733251
FT                   /estimated_length=418
FT                   /gap_type="unknown"
FT   assembly_gap    4745937..4746870
FT                   /estimated_length=934
FT                   /gap_type="unknown"
FT   assembly_gap    4773391..4773417
FT                   /estimated_length=27
FT                   /gap_type="unknown"
FT   assembly_gap    4789989..4790304
FT                   /estimated_length=316
FT                   /gap_type="unknown"
FT   assembly_gap    4808895..4809234
FT                   /estimated_length=340
FT                   /gap_type="unknown"
FT   assembly_gap    4811724..4813879
FT                   /estimated_length=2156
FT                   /gap_type="unknown"
FT   assembly_gap    4815147..4815166
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4851650..4851669
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4858330..4858615
FT                   /estimated_length=286
FT                   /gap_type="unknown"
FT   assembly_gap    4860263..4860326
FT                   /estimated_length=64
FT                   /gap_type="unknown"
FT   assembly_gap    4865558..4865577
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4885927..4886176
FT                   /estimated_length=250
FT                   /gap_type="unknown"
FT   assembly_gap    4893405..4893664
FT                   /estimated_length=260
FT                   /gap_type="unknown"
FT   assembly_gap    4895032..4895165
FT                   /estimated_length=134
FT                   /gap_type="unknown"
FT   assembly_gap    4896595..4896614
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4902305..4902375
FT                   /estimated_length=71
FT                   /gap_type="unknown"
FT   assembly_gap    4903099..4904111
FT                   /estimated_length=1013
FT                   /gap_type="unknown"
FT   assembly_gap    4911992..4912098
FT                   /estimated_length=107
FT                   /gap_type="unknown"
FT   assembly_gap    4918080..4918226
FT                   /estimated_length=147
FT                   /gap_type="unknown"
FT   assembly_gap    4929212..4929231
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4959874..4959996
FT                   /estimated_length=123
FT                   /gap_type="unknown"
FT   gene            4968868..4978735
FT                   /gene="Cops8"
FT                   /locus_tag="mCG_4741"
FT                   /note="gene_id=mCG4741.2"
FT   mRNA            join(4968868..4969023,4969771..4969841,4970860..4970908,
FT                   4971933..4972065,4975489..4975596,4976371..4976823)
FT                   /gene="Cops8"
FT                   /locus_tag="mCG_4741"
FT                   /product="COP9 (constitutive photomorphogenic) homolog,
FT                   subunit 8 (Arabidopsis thaliana), transcript variant
FT                   mCT178037"
FT                   /note="gene_id=mCG4741.2 transcript_id=mCT178037.0 created
FT                   on 31-DEC-2002"
FT   mRNA            join(4968871..4968951,4969799..4969841,4970860..4970908,
FT                   4971933..4972065,4975489..4975596,4976371..4976433,
FT                   4976936..4976983,4977570..4978735)
FT                   /gene="Cops8"
FT                   /locus_tag="mCG_4741"
FT                   /product="COP9 (constitutive photomorphogenic) homolog,
FT                   subunit 8 (Arabidopsis thaliana), transcript variant
FT                   mCT178036"
FT                   /note="gene_id=mCG4741.2 transcript_id=mCT178036.0 created
FT                   on 31-DEC-2002"
FT   mRNA            join(4968881..4969023,4969771..4969841,4971914..4972065,
FT                   4975489..4975596,4976371..4976433,4976936..4976983,
FT                   4977570..4978702)
FT                   /gene="Cops8"
FT                   /locus_tag="mCG_4741"
FT                   /product="COP9 (constitutive photomorphogenic) homolog,
FT                   subunit 8 (Arabidopsis thaliana), transcript variant
FT                   mCT178038"
FT                   /note="gene_id=mCG4741.2 transcript_id=mCT178038.0 created
FT                   on 31-DEC-2002"
FT   mRNA            join(4968887..4969023,4969771..4969841,4970860..4970908,
FT                   4971933..4972065,4975489..4975596,4976371..4976433,
FT                   4976936..4976983,4977570..4978702)
FT                   /gene="Cops8"
FT                   /locus_tag="mCG_4741"
FT                   /product="COP9 (constitutive photomorphogenic) homolog,
FT                   subunit 8 (Arabidopsis thaliana), transcript variant
FT                   mCT4023"
FT                   /note="gene_id=mCG4741.2 transcript_id=mCT4023.2 created on
FT                   31-DEC-2002"
FT   CDS             join(4968946..4969023,4969771..4969841,4970860..4970908,
FT                   4971933..4972065,4975489..4975596,4976371..4976433,
FT                   4976936..4976983,4977570..4977649)
FT                   /codon_start=1
FT                   /gene="Cops8"
FT                   /locus_tag="mCG_4741"
FT                   /product="COP9 (constitutive photomorphogenic) homolog,
FT                   subunit 8 (Arabidopsis thaliana), isoform CRA_d"
FT                   /note="gene_id=mCG4741.2 transcript_id=mCT4023.2
FT                   protein_id=mCP21009.2 isoform=CRA_d"
FT                   /protein_id="EDL40091.1"
FT                   /translation="MPVAVMADNAFSFRKLLDQCENQELEAPGGIATPPVYGQLLALYL
FT                   LQNDMNNARYLWKRIPPAIKSANSELGGIWSVGQRIWQRDFPGIYTTINAHQWSETVQP
FT                   IMEALRDATRRRAFALVSQAYTSIIADDFAAFVGLPVEEAVKGVLEQGWQADSTTRMVL
FT                   PRKPASGTLDVSLNRFIPLSEPAPVPPIPNEQQLARLTDYVAFLEN"
FT   CDS             join(4968946..4969023,4969771..4969841,4971914..4972065,
FT                   4975489..4975596,4976371..4976433,4976936..4976983,
FT                   4977570..4977649)
FT                   /codon_start=1
FT                   /gene="Cops8"
FT                   /locus_tag="mCG_4741"
FT                   /product="COP9 (constitutive photomorphogenic) homolog,
FT                   subunit 8 (Arabidopsis thaliana), isoform CRA_c"
FT                   /note="gene_id=mCG4741.2 transcript_id=mCT178038.0
FT                   protein_id=mCP100959.0 isoform=CRA_c"
FT                   /protein_id="EDL40090.1"
FT                   /translation="MPVAVMADNAFSFRKLLDQCENQELEAPGGIATPPVYGQLLALYL
FT                   LQNDIQQFLFQANSELGGIWSVGQRIWQRDFPGIYTTINAHQWSETVQPIMEALRDATR
FT                   RRAFALVSQAYTSIIADDFAAFVGLPVEEAVKGVLEQGWQADSTTRMVLPRKPASGTLD
FT                   VSLNRFIPLSEPAPVPPIPNEQQLARLTDYVAFLEN"
FT   CDS             join(4968946..4969023,4969771..4969841,4970860..4970908,
FT                   4971933..4972065,4975489..4975596,4976371..4976495)
FT                   /codon_start=1
FT                   /gene="Cops8"
FT                   /locus_tag="mCG_4741"
FT                   /product="COP9 (constitutive photomorphogenic) homolog,
FT                   subunit 8 (Arabidopsis thaliana), isoform CRA_b"
FT                   /note="gene_id=mCG4741.2 transcript_id=mCT178037.0
FT                   protein_id=mCP100958.0 isoform=CRA_b"
FT                   /protein_id="EDL40089.1"
FT                   /translation="MPVAVMADNAFSFRKLLDQCENQELEAPGGIATPPVYGQLLALYL
FT                   LQNDMNNARYLWKRIPPAIKSANSELGGIWSVGQRIWQRDFPGIYTTINAHQWSETVQP
FT                   IMEALRDATRRRAFALVSQAYTSIIADDFAAFVGLPVEEAVKGVLEQGWQADSTTRMVL
FT                   PRKPGRWDLRHMTWKQWTVDKRAE"
FT   CDS             join(4968951,4969799..4969841,4970860..4970908,
FT                   4971933..4972065,4975489..4975596,4976371..4976433,
FT                   4976936..4976983,4977570..4977649)
FT                   /codon_start=1
FT                   /gene="Cops8"
FT                   /locus_tag="mCG_4741"
FT                   /product="COP9 (constitutive photomorphogenic) homolog,
FT                   subunit 8 (Arabidopsis thaliana), isoform CRA_a"
FT                   /note="gene_id=mCG4741.2 transcript_id=mCT178036.0
FT                   protein_id=mCP100960.0 isoform=CRA_a"
FT                   /protein_id="EDL40088.1"
FT                   /translation="MYGQLLALYLLQNDMNNARYLWKRIPPAIKSANSELGGIWSVGQR
FT                   IWQRDFPGIYTTINAHQWSETVQPIMEALRDATRRRAFALVSQAYTSIIADDFAAFVGL
FT                   PVEEAVKGVLEQGWQADSTTRMVLPRKPASGTLDVSLNRFIPLSEPAPVPPIPNEQQLA
FT                   RLTDYVAFLEN"
FT   assembly_gap    4984223..4984348
FT                   /estimated_length=126
FT                   /gap_type="unknown"
FT   assembly_gap    4986243..4986873
FT                   /estimated_length=631
FT                   /gap_type="unknown"
FT   assembly_gap    4988196..4988716
FT                   /estimated_length=521
FT                   /gap_type="unknown"
FT   assembly_gap    4990359..4990378
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4991912..4991931
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4994111..4994130
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4995161..4996423
FT                   /estimated_length=1263
FT                   /gap_type="unknown"
FT   assembly_gap    5010055..5010214
FT                   /estimated_length=160
FT                   /gap_type="unknown"
FT   assembly_gap    5011682..5011701
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            5041981..5046592
FT                   /gene="LOC433332"
FT                   /locus_tag="mCG_145598"
FT                   /note="gene_id=mCG145598.0"
FT   mRNA            join(5041981..5042265,5045692..5046592)
FT                   /gene="LOC433332"
FT                   /locus_tag="mCG_145598"
FT                   /product="hypothetical protein EG433332"
FT                   /note="gene_id=mCG145598.0 transcript_id=mCT185022.0
FT                   created on 24-JUN-2003"
FT   CDS             join(5042133..5042265,5045692..5045903)
FT                   /codon_start=1
FT                   /gene="LOC433332"
FT                   /locus_tag="mCG_145598"
FT                   /product="hypothetical protein EG433332"
FT                   /note="gene_id=mCG145598.0 transcript_id=mCT185022.0
FT                   protein_id=mCP106075.0"
FT                   /db_xref="GOA:Q8CA16"
FT                   /db_xref="MGI:MGI:3643217"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CA16"
FT                   /protein_id="EDL40087.1"
FT                   /translation="MPGSLKYTVTESTLQTLNEILTTVFPEHAWRGATSATQGVQNQED
FT                   LKLTLCIPTEMQIIPKPSRHQGQPKRQHPVLLQTMSSAYMSSCTCHPAQSTNVRVSPEA
FT                   LARCCFQRRF"
FT   assembly_gap    5067823..5068145
FT                   /estimated_length=323
FT                   /gap_type="unknown"
FT   assembly_gap    5075232..5075320
FT                   /estimated_length=89
FT                   /gap_type="unknown"
FT   assembly_gap    5101674..5101744
FT                   /estimated_length=71
FT                   /gap_type="unknown"
FT   assembly_gap    5102670..5102967
FT                   /estimated_length=298
FT                   /gap_type="unknown"
FT   assembly_gap    5126461..5126677
FT                   /estimated_length=217
FT                   /gap_type="unknown"
FT   assembly_gap    5127834..5127853
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(5133886..5210822)
FT                   /locus_tag="mCG_12867"
FT                   /note="gene_id=mCG12867.2"
FT   mRNA            complement(join(5133886..5134631,5135350..5135514,
FT                   5140128..5140226,5140613..5140876,5142707..5143398,
FT                   5144554..5144656,5145863..5146561,5147095..5147191,
FT                   5148743..5149236,5149325..5149336,5149449..5149485,
FT                   5149567..5149599,5151334..5151396,5152315..5152377,
FT                   5152830..5152865,5153004..5153048,5153746..5153808,
FT                   5155031..5155093,5155323..5155385,5156139..5156201,
FT                   5156652..5156687,5159032..5159085,5159518..5159583,
FT                   5160122..5160184,5161118..5161171,5161284..5161328,
FT                   5161432..5161458,5162120..5162191,5162923..5162976,
FT                   5163488..5163580,5165036..5165181,5166979..5167057,
FT                   5168196..5168533,5169078..5169677,5170625..5171239,
FT                   5174335..5174940,5176984..5177586,5178117..5178689,
FT                   5180073..5180672,5182809..5183393,5188660..5189262,
FT                   5194718..5195335,5197038..5197153,5210640..5210822))
FT                   /locus_tag="mCG_12867"
FT                   /product="mCG12867, transcript variant mCT179501"
FT                   /note="gene_id=mCG12867.2 transcript_id=mCT179501.0 created
FT                   on 04-FEB-2003"
FT   mRNA            complement(join(5133886..5134631,5135350..5135514,
FT                   5140128..5140226,5140613..5140876,5142707..5143398,
FT                   5144554..5144656,5145863..5146561,5147095..5147191,
FT                   5148743..5149236,5149325..5149336,5149449..5149485,
FT                   5149567..5149599,5151334..5151396,5152315..5152377,
FT                   5152830..5152865,5152998..5153048,5153746..5153808,
FT                   5155031..5155093,5155323..5155385,5156139..5156201,
FT                   5156652..5156687,5159032..5159085,5159518..5159583,
FT                   5160122..5160184,5161118..5161171,5161284..5161328,
FT                   5161432..5161458,5162120..5162191,5162923..5162976,
FT                   5163488..5163580,5165036..5165181,5166979..5167057,
FT                   5168196..5168533,5169078..5169677,5170625..5171239,
FT                   5174335..5174940,5176984..5177586,5178117..5178689,
FT                   5182809..5183393,5197038..5197153,5210640..5210672))
FT                   /locus_tag="mCG_12867"
FT                   /product="mCG12867, transcript variant mCT13517"
FT                   /note="gene_id=mCG12867.2 transcript_id=mCT13517.2 created
FT                   on 04-FEB-2003"
FT   mRNA            complement(join(5134023..5134631,5135350..5135514,
FT                   5140128..5140180,5142757..5143398,5144554..5144656,
FT                   5145863..5146561,5147095..5147191,5148742..5149236,
FT                   5149325..5149336,5149449..5149485,5149567..5149599,
FT                   5151334..5151396,5152315..5152377,5152830..5152865,
FT                   5152998..5153048,5153746..5153808,5155031..5155093,
FT                   5155323..5155385,5156139..5156201,5156652..5156687,
FT                   5159032..5159085,5159518..5159583,5160122..5160184,
FT                   5161118..5161171,5161284..5161328,5161432..5161458,
FT                   5162120..5162191,5162923..5162976,5163488..5163580,
FT                   5165036..5165181,5166979..5167057,5168196..5168533,
FT                   5169078..5169677,5170625..5171239,5174335..5174940,
FT                   5176984..5177586,5178117..5178689,5180073..5180672,
FT                   5182809..5183393,5188660..5189262,5194718..5195335,
FT                   5197038..5197153,5210640..5210822))
FT                   /locus_tag="mCG_12867"
FT                   /product="mCG12867, transcript variant mCT179504"
FT                   /note="gene_id=mCG12867.2 transcript_id=mCT179504.0 created
FT                   on 04-FEB-2003"
FT   CDS             complement(join(5134618..5134631,5135350..5135514,
FT                   5140128..5140226,5140613..5140876,5142707..5143398,
FT                   5144554..5144656,5145863..5146561,5147095..5147191,
FT                   5148743..5149236,5149325..5149336,5149449..5149485,
FT                   5149567..5149599,5151334..5151396,5152315..5152377,
FT                   5152830..5152865,5152998..5153048,5153746..5153808,
FT                   5155031..5155093,5155323..5155385,5156139..5156201,
FT                   5156652..5156687,5159032..5159085,5159518..5159583,
FT                   5160122..5160184,5161118..5161171,5161284..5161328,
FT                   5161432..5161458,5162120..5162191,5162923..5162976,
FT                   5163488..5163580,5165036..5165181,5166979..5167057,
FT                   5168196..5168533,5169078..5169677,5170625..5171239,
FT                   5174335..5174940,5176984..5177586,5178117..5178689,
FT                   5182809..5183393,5197038..5197125))
FT                   /codon_start=1
FT                   /locus_tag="mCG_12867"
FT                   /product="mCG12867, isoform CRA_a"
FT                   /note="gene_id=mCG12867.2 transcript_id=mCT13517.2
FT                   protein_id=mCP21023.2 isoform=CRA_a"
FT                   /protein_id="EDL40082.1"
FT                   /translation="MRKHRHLPLVAVFSLLLSGIATTHAQQHGVMEVNKRDIVFLVDGS
FT                   SSLGPSNFNAIRDFVTRVIQRLEIGQDLVQVSVAQYADTVKPEFYLNSYTNKRDAITAV
FT                   RKMRALNGSALYTGSSLDFVRNNLFTSSAGHRAAEGVPKLLVLITGGKSLDEVSQPAQE
FT                   LKRGSIMALAVGSKAADEDELKEIAFDSSLVFIPAEFRPAPLQNMLPSLMAPLRTLTGT
FT                   TEESKRDILFLFDGSVNVLGQFPAVRDFLYRIIEELDVKPDGTRVAIAQFSDDVRLESR
FT                   FSEHQTKAEILNLVKKMKLKTGKALNLGYALDYALRNIFVRSAGSRIEDNVQQFLVLLV
FT                   AGRSSDAVAGPASSLKQRGVVPFIFQAKNANPSELEQIVLSPAFILAAESLPKIGDLQS
FT                   QIVSLLKAEQGSGPVSGEKDVVFLIDGSEGVRSGFPLLKDFVQRVVESLDVGPDRVRVA
FT                   LVQYSDRTRPEFYLNSHMDQQGVISAIRRLTLLGGPTPNTGAALEFVLRNILTSSTGSR
FT                   IAEGVPQLLIVLTAEPSGDDVRGPSVVLKQGGAVPIGIGIGNADISEMQTISFIPDFAV
FT                   AIPTFRELGTIQQVISERVIQLNREELSSLKPILTPSTGAGVGSKKDVVFLIDGSRNAG
FT                   PEFQYIRTLIERIVEYLDIGFDTTRVAVIQFSEDSKMEFPLNAHFSKDEVQNAVRRLRP
FT                   KGGSQVYIGNALEYVLKNIFQRPLGSRIEEGVPQFLVLISSGKSDDEVDDSAVELKQFG
FT                   VAPLTIARHTDQEELVKISLSPEYVYSVSTFRELPRLEQKLLTPITTLTSQQIHQILAS
FT                   TRYPPSVVESDAADIVFLIDSSDAVKPDGIAHIRDFVSRIVRRLNIGPSKVRIGVVQFS
FT                   NDVFPEFYLKTHKSQSSVLEAIRRLRFKGGSPLNTGRALEFVARNLFVKSAGSRIEDGV
FT                   PQHLVLFLGGKSQDDVARHAQVISSSGIVSLGIGDRNIDRTDLQTITNDPRLVFTVREF
FT                   RELPNIEERVMLSFGPSGATPQPPGVDLPSPSRPEKKKADIVFLLDGSINFRRDSFQEV
FT                   LRFASEIVDTVYEDGDSIRVGLVQYNSDPTDEFFLRDFSTKRQIIDAINKVVYKGGRHA
FT                   NTRVGIEHLLRNHFVPEAGSRLDERVPQIAFVITGGKSVEDAQDVSLALTQKGVKVFAV
FT                   GVRNIDSEEVGKIASNSATAFRVGSVQELSELSETVLETLHDAMHETLCPGVTDVSKAC
FT                   NLEVILGFDGSRDQNVFVSQKGLESKVDIILNRISQIQRISCSGNQLPTVRVSVMANTP
FT                   SGPVEAFDFAEYQPELFEKFRNMRSQRPYVLTADTLKLYQNKFRQSSPDTVKVVIHFTD
FT                   GADGDMADLYRASEELRQAGAQALILVGLERVANLERLMHLEFGRGFMYDRPLRLNLLD
FT                   LDYELAEQLDNIAEKACCGVPCKCSGERGDRGPIGSIGPKGISGEDGYRGYPGDEGGPG
FT                   ERGPPGVNGTQGFQGCPGQRGVKGSRGFPGEKGELGEIGLDGLDGEEGDKGLPGSSGEK
FT                   GSPGRRGDKGPKGDKGERGDVGIRGDPGDSGRDSQQRGPKGETGDIGPMGLPGRDGIPG
FT                   SPGDPGKDGGSGRRGPAGAKGNRGGPGQPGFEGEQGTRGSQGPPGPIGPPGLIGEQGIP
FT                   GPRGGGGTAGAPGERGRTGPLGRKGEPGEPGPKGSIGNRGPRGETGDDGRDGVGSEGRR
FT                   GKKGERGFPGYPGPKGTPGEPGADGPPGPKGIRGRRGNSGPPGATGQKGDPGYPGPSGH
FT                   KGNRGDSVDQCALIQSIRDKCPCCYGPLECPVFPTELAFALDTSEGVTQDTFSRMREVL
FT                   LGIVGDLTIAESNCPRGARVAVVTYNNEVTTEIRFADSKKKSALLDSIQNLQVALTSKQ
FT                   QSLETAMSFVARNTFKRVRSGFLMRKVAVFFSNKPTRASPQLREAVLKLSDAGITPLFL
FT                   TSQEDRQLINAFAINNTAVGHALVLPARRDLTDFLKNVLTCHVCLDICNIDPSCGFGSW
FT                   RPSFRDRRAAGSDVDIDLAFILDSSEATTLFQFNEMKKYIGYVIRQLDLSPDPKASQHF
FT                   ARVAVVQQSTYESVDNASVPPVKVEFSLTDYGAKEKLLDFLSRRMTQLQGTMGLGNAIE
FT                   YTIENIFESAPNPRDLKIMVLMLTGDMQRQQLEEAQRAILQAKCKGYFFVVLGIGRKVN
FT                   IKEVYSFASEPNDVFFKFVDKSTELNEEPLMRFGRLLPSFVSSENAFYLPPDLRKQCDW
FT                   FQGDQPVKNGVKFGHKQINPPHTANSSLTSKVVTTMKPVTTTKPTAIVNLPPAKPAPAR
FT                   PAPAQPVLAKPDPAKPAQARPAPAKPASAKLVPPQPVHVQPAPAQTASVRPAPAKPAPP
FT                   QPAAAKPVPAKPAVPAQPAPPQPAAAKPVPAKPAVPAQPAAAQPMPAQPVLTKSAAVKP
FT                   ASANKPVAAKPVATNTATATARPALAAKPAAAKPAATRPLAAAIRPVATKPEAPRQQAK
FT                   PAATKPATTKPLARVSREVQVSEVTENSARLHWERPEPSSSFFYDLTVTSAHDQSLVLR
FT                   QNLTVTDRVIGGLLAGQLYHVVVVSYLQSQVRAIYQGSFNTKKTQPPPLQAAHRASSST
FT                   INLMVNTEPLFLTKTDICKLSRDAGTCVDFKLLWHYDLESKSCKRFWYGGCGGNENRFH
FT                   SQEECEKMCSPELTV"
FT   CDS             complement(join(5134618..5134631,5135350..5135514,
FT                   5140128..5140226,5140613..5140876,5142707..5143398,
FT                   5144554..5144656,5145863..5146561,5147095..5147191,
FT                   5148743..5149236,5149325..5149336,5149449..5149485,
FT                   5149567..5149599,5151334..5151396,5152315..5152377,
FT                   5152830..5152865,5153004..5153048,5153746..5153808,
FT                   5155031..5155093,5155323..5155385,5156139..5156201,
FT                   5156652..5156687,5159032..5159085,5159518..5159583,
FT                   5160122..5160184,5161118..5161171,5161284..5161328,
FT                   5161432..5161458,5162120..5162191,5162923..5162976,
FT                   5163488..5163580,5165036..5165181,5166979..5167057,
FT                   5168196..5168533,5169078..5169677,5170625..5171239,
FT                   5174335..5174940,5176984..5177586,5178117..5178689,
FT                   5180073..5180672,5182809..5183393,5188660..5189262,
FT                   5194718..5195335,5197038..5197125))
FT                   /codon_start=1
FT                   /locus_tag="mCG_12867"
FT                   /product="mCG12867, isoform CRA_b"
FT                   /note="gene_id=mCG12867.2 transcript_id=mCT179501.0
FT                   protein_id=mCP102424.0 isoform=CRA_b"
FT                   /protein_id="EDL40083.1"
FT                   /translation="MRKHRHLPLVAVFSLLLSGIATTHAQQHGDVKNGAAADIVFLVDS
FT                   SWSAGKDRFLLVQEFLSDVVESLAVGDNDFHFALVRLNGNPHTEFLLNTYHSKQEVLSH
FT                   IVNMSYIGGSNQTGKGLEYVIHSHLTEASGSRAADGVPQVIIVLTDGQSEDGFALPSAE
FT                   LKSADVNVFAVGVEGADERALGEVASEPLSMHVFNLENVTSLHGLVGNLVSCIHSSVNP
FT                   ERAGDKESLKDITAQDSADIIFLIDGSQNTGNANFDVIRDFLVNVLERLSVGNQQVQVG
FT                   VVQYSEEPITMFSLNSYPSKAAVLDAVKGLSLVGGESANIGQALDFVVENHFTRAGGSR
FT                   VEEGVPQVLVLISAGPSSDEIRDSVVALKQASVFSFGLGAQAASRAELQHIATDDSLVF
FT                   TVPEFRSFGDLQEQILPYLVGVAQRHIVLQPPAIVTQVMEVNKRDIVFLVDGSSSLGPS
FT                   NFNAIRDFVTRVIQRLEIGQDLVQVSVAQYADTVKPEFYLNSYTNKRDAITAVRKMRAL
FT                   NGSALYTGSSLDFVRNNLFTSSAGHRAAEGVPKLLVLITGGKSLDEVSQPAQELKRGSI
FT                   MALAVGSKAADEDELKEIAFDSSLVFIPAEFRPAPLQNMLPSLMAPLRTLTGTTEVHVN
FT                   KRDIIFLLDGSDNVGKNNFPYVRDFVTNLVNSLDVGSDNIRVGLVQFSDTPVTEFSLDT
FT                   YQTKSELLAHLRRLQLKGGSGLNAGSALSYIHANHFTEAGGSRTREHVPQLLLLLMAGP
FT                   SEDAYLQAANALVRSGVLTFCVGTNRADKAELEHIAFNPSLVYLMDDFRSLPSLPQQLI
FT                   QPLTTYVSGGVQEVPLSQPESKRDILFLFDGSVNVLGQFPAVRDFLYRIIEELDVKPDG
FT                   TRVAIAQFSDDVRLESRFSEHQTKAEILNLVKKMKLKTGKALNLGYALDYALRNIFVRS
FT                   AGSRIEDNVQQFLVLLVAGRSSDAVAGPASSLKQRGVVPFIFQAKNANPSELEQIVLSP
FT                   AFILAAESLPKIGDLQSQIVSLLKAEQGSGPVSGEKDVVFLIDGSEGVRSGFPLLKDFV
FT                   QRVVESLDVGPDRVRVALVQYSDRTRPEFYLNSHMDQQGVISAIRRLTLLGGPTPNTGA
FT                   ALEFVLRNILTSSTGSRIAEGVPQLLIVLTAEPSGDDVRGPSVVLKQGGAVPIGIGIGN
FT                   ADISEMQTISFIPDFAVAIPTFRELGTIQQVISERVIQLNREELSSLKPILTPSTGAGV
FT                   GSKKDVVFLIDGSRNAGPEFQYIRTLIERIVEYLDIGFDTTRVAVIQFSEDSKMEFPLN
FT                   AHFSKDEVQNAVRRLRPKGGSQVYIGNALEYVLKNIFQRPLGSRIEEGVPQFLVLISSG
FT                   KSDDEVDDSAVELKQFGVAPLTIARHTDQEELVKISLSPEYVYSVSTFRELPRLEQKLL
FT                   TPITTLTSQQIHQILASTRYPPSVVESDAADIVFLIDSSDAVKPDGIAHIRDFVSRIVR
FT                   RLNIGPSKVRIGVVQFSNDVFPEFYLKTHKSQSSVLEAIRRLRFKGGSPLNTGRALEFV
FT                   ARNLFVKSAGSRIEDGVPQHLVLFLGGKSQDDVARHAQVISSSGIVSLGIGDRNIDRTD
FT                   LQTITNDPRLVFTVREFRELPNIEERVMLSFGPSGATPQPPGVDLPSPSRPEKKKADIV
FT                   FLLDGSINFRRDSFQEVLRFASEIVDTVYEDGDSIRVGLVQYNSDPTDEFFLRDFSTKR
FT                   QIIDAINKVVYKGGRHANTRVGIEHLLRNHFVPEAGSRLDERVPQIAFVITGGKSVEDA
FT                   QDVSLALTQKGVKVFAVGVRNIDSEEVGKIASNSATAFRVGSVQELSELSETVLETLHD
FT                   AMHETLCPGVTDVSKACNLEVILGFDGSRDQNVFVSQKGLESKVDIILNRISQIQRISC
FT                   SGNQLPTVRVSVMANTPSGPVEAFDFAEYQPELFEKFRNMRSQRPYVLTADTLKLYQNK
FT                   FRQSSPDTVKVVIHFTDGADGDMADLYRASEELRQAGAQALILVGLERVANLERLMHLE
FT                   FGRGFMYDRPLRLNLLDLDYELAEQLDNIAEKACCGVPCKCSGERGDRGPIGSIGPKGI
FT                   SGEDGYRGYPGDEGGPGERGPPGVNGTQGFQGCPGQRGVKGSRGFPGEKGELGEIGLDG
FT                   LDGEEGDKGLPGSSGEKGSPGRRGDKGPKGDKGERGDVGIRGDPGDSGRDSQQRGPKGE
FT                   TGDIGPMGLPGRDGIPGSPGDPGKDGGSGRRGPAGAKGNRGGPGQPGFEGEQGTRGSQG
FT                   PPGPIGPPGLIGEQGIPGPRGGGGTAGAPGERGRTGPLGRKGEPGEPGPKGSIGNRGPR
FT                   GETGDDGRDGVGSEGRRGGERGFPGYPGPKGTPGEPGADGPPGPKGIRGRRGNSGPPGA
FT                   TGQKGDPGYPGPSGHKGNRGDSVDQCALIQSIRDKCPCCYGPLECPVFPTELAFALDTS
FT                   EGVTQDTFSRMREVLLGIVGDLTIAESNCPRGARVAVVTYNNEVTTEIRFADSKKKSAL
FT                   LDSIQNLQVALTSKQQSLETAMSFVARNTFKRVRSGFLMRKVAVFFSNKPTRASPQLRE
FT                   AVLKLSDAGITPLFLTSQEDRQLINAFAINNTAVGHALVLPARRDLTDFLKNVLTCHVC
FT                   LDICNIDPSCGFGSWRPSFRDRRAAGSDVDIDLAFILDSSEATTLFQFNEMKKYIGYVI
FT                   RQLDLSPDPKASQHFARVAVVQQSTYESVDNASVPPVKVEFSLTDYGAKEKLLDFLSRR
FT                   MTQLQGTMGLGNAIEYTIENIFESAPNPRDLKIMVLMLTGDMQRQQLEEAQRAILQAKC
FT                   KGYFFVVLGIGRKVNIKEVYSFASEPNDVFFKFVDKSTELNEEPLMRFGRLLPSFVSSE
FT                   NAFYLPPDLRKQCDWFQGDQPVKNGVKFGHKQINPPHTANSSLTSKVVTTMKPVTTTKP
FT                   TAIVNLPPAKPAPARPAPAQPVLAKPDPAKPAQARPAPAKPASAKLVPPQPVHVQPAPA
FT                   QTASVRPAPAKPAPPQPAAAKPVPAKPAVPAQPAPPQPAAAKPVPAKPAVPAQPAAAQP
FT                   MPAQPVLTKSAAVKPASANKPVAAKPVATNTATATARPALAAKPAAAKPAATRPLAAAI
FT                   RPVATKPEAPRQQAKPAATKPATTKPLARVSREVQVSEVTENSARLHWERPEPSSSFFY
FT                   DLTVTSAHDQSLVLRQNLTVTDRVIGGLLAGQLYHVVVVSYLQSQVRAIYQGSFNTKKT
FT                   QPPPLQAAHRASSSTINLMVNTEPLFLTKTDICKLSRDAGTCVDFKLLWHYDLESKSCK
FT                   RFWYGGCGGNENRFHSQEECEKMCSPELTV"
FT   assembly_gap    5137897..5138055
FT                   /estimated_length=159
FT                   /gap_type="unknown"
FT   mRNA            complement(join(5146380..5146561,5147095..5147191,
FT                   5148742..5149194,5161132..5161171,5161284..5161328,
FT                   5161432..5161458,5162120..5162191,5162923..5162976,
FT                   5163488..5163580,5165036..5165181,5166979..5167057,
FT                   5168196..5168533,5169078..5169677,5170625..5171239,
FT                   5174335..5174940,5176984..5177586,5178117..5178689,
FT                   5180073..5180672,5182809..5183393,5188660..5189262,
FT                   5194718..5195335,5197038..5197153,5210640..5210822))
FT                   /locus_tag="mCG_12867"
FT                   /product="mCG12867, transcript variant mCT179503"
FT                   /note="gene_id=mCG12867.2 transcript_id=mCT179503.0 created
FT                   on 04-FEB-2003"
FT   CDS             complement(join(5147184..5147191,5148742..5149194,
FT                   5161132..5161171,5161284..5161328,5161432..5161458,
FT                   5162120..5162191,5162923..5162976,5163488..5163580,
FT                   5165036..5165181,5166979..5167057,5168196..5168533,
FT                   5169078..5169677,5170625..5171239,5174335..5174940,
FT                   5176984..5177586,5178117..5178689,5180073..5180672,
FT                   5182809..5183393,5188660..5189262,5194718..5195335,
FT                   5197038..5197125))
FT                   /codon_start=1
FT                   /locus_tag="mCG_12867"
FT                   /product="mCG12867, isoform CRA_d"
FT                   /note="gene_id=mCG12867.2 transcript_id=mCT179503.0
FT                   protein_id=mCP102423.0 isoform=CRA_d"
FT                   /protein_id="EDL40085.1"
FT                   /translation="MRKHRHLPLVAVFSLLLSGIATTHAQQHGDVKNGAAADIVFLVDS
FT                   SWSAGKDRFLLVQEFLSDVVESLAVGDNDFHFALVRLNGNPHTEFLLNTYHSKQEVLSH
FT                   IVNMSYIGGSNQTGKGLEYVIHSHLTEASGSRAADGVPQVIIVLTDGQSEDGFALPSAE
FT                   LKSADVNVFAVGVEGADERALGEVASEPLSMHVFNLENVTSLHGLVGNLVSCIHSSVNP
FT                   ERAGDKESLKDITAQDSADIIFLIDGSQNTGNANFDVIRDFLVNVLERLSVGNQQVQVG
FT                   VVQYSEEPITMFSLNSYPSKAAVLDAVKGLSLVGGESANIGQALDFVVENHFTRAGGSR
FT                   VEEGVPQVLVLISAGPSSDEIRDSVVALKQASVFSFGLGAQAASRAELQHIATDDSLVF
FT                   TVPEFRSFGDLQEQILPYLVGVAQRHIVLQPPAIVTQVMEVNKRDIVFLVDGSSSLGPS
FT                   NFNAIRDFVTRVIQRLEIGQDLVQVSVAQYADTVKPEFYLNSYTNKRDAITAVRKMRAL
FT                   NGSALYTGSSLDFVRNNLFTSSAGHRAAEGVPKLLVLITGGKSLDEVSQPAQELKRGSI
FT                   MALAVGSKAADEDELKEIAFDSSLVFIPAEFRPAPLQNMLPSLMAPLRTLTGTTEVHVN
FT                   KRDIIFLLDGSDNVGKNNFPYVRDFVTNLVNSLDVGSDNIRVGLVQFSDTPVTEFSLDT
FT                   YQTKSELLAHLRRLQLKGGSGLNAGSALSYIHANHFTEAGGSRTREHVPQLLLLLMAGP
FT                   SEDAYLQAANALVRSGVLTFCVGTNRADKAELEHIAFNPSLVYLMDDFRSLPSLPQQLI
FT                   QPLTTYVSGGVQEVPLSQPESKRDILFLFDGSVNVLGQFPAVRDFLYRIIEELDVKPDG
FT                   TRVAIAQFSDDVRLESRFSEHQTKAEILNLVKKMKLKTGKALNLGYALDYALRNIFVRS
FT                   AGSRIEDNVQQFLVLLVAGRSSDAVAGPASSLKQRGVVPFIFQAKNANPSELEQIVLSP
FT                   AFILAAESLPKIGDLQSQIVSLLKAEQGSGPVSGEKDVVFLIDGSEGVRSGFPLLKDFV
FT                   QRVVESLDVGPDRVRVALVQYSDRTRPEFYLNSHMDQQGVISAIRRLTLLGGPTPNTGA
FT                   ALEFVLRNILTSSTGSRIAEGVPQLLIVLTAEPSGDDVRGPSVVLKQGGAVPIGIGIGN
FT                   ADISEMQTISFIPDFAVAIPTFRELGTIQQVISERVIQLNREELSSLKPILTPSTGAGV
FT                   GSKKDVVFLIDGSRNAGPEFQYIRTLIERIVEYLDIGFDTTRVAVIQFSEDSKMEFPLN
FT                   AHFSKDEVQNAVRRLRPKGGSQVYIGNALEYVLKNIFQRPLGSRIEEGVPQFLVLISSG
FT                   KSDDEVDDSAVELKQFGVAPLTIARHTDQEELVKISLSPEYVYSVSTFRELPRLEQKLL
FT                   TPITTLTSQQIHQILASTRYPPSVVESDAADIVFLIDSSDAVKPDGIAHIRDFVSRIVR
FT                   RLNIGPSKVRIGVVQFSNDVFPEFYLKTHKSQSSVLEAIRRLRFKGGSPLNTGRALEFV
FT                   ARNLFVKSAGSRIEDGVPQHLVLFLGGKSQDDVARHAQVISSSGIVSLGIGDRNIDRTD
FT                   LQTITNDPRLVFTVREFRELPNIEERVMLSFGPSGATPQPPGVDLPSPSRPEKKKADIV
FT                   FLLDGSINFRRDSFQEVLRFASEIVDTVYEDGDSIRVGLVQYNSDPTDEFFLRDFSTKR
FT                   QIIDAINKVVYKGGRHANTRVGIEHLLRNHFVPEAGSRLDERVPQIAFVITGGKSVEDA
FT                   QDVSLALTQKGVKVFAVGVRNIDSEEVGKIASNSATAFRVGSVQELSELSETVLETLHD
FT                   AMHETLCPGVTDVSKACNLEVILGFDGSRDQNVFVSQKGLESKVDIILNRISQIQRISC
FT                   SGNQLPTVRVSVMANTPSGPVEAFDFAEYQPELFEKFRNMRSQRPYVLTADTLKLYQNK
FT                   FRQSSPDTVKVVIHFTDGADGDMADLYRASEELRQAGAQALILVGLERVANLERLMHLE
FT                   FGRGFMYDRPLRLNLLDLDYELAEQLDNIAEKACCGVPCKCSGERGDRGPIGSIGPKGI
FT                   SGEDGYRGYPGDEGGPGERGPPGVNGTQGFQGCPGQRGVKGSRGFPGEKGELGEIGLDG
FT                   LDGEEGDKGLPGSSGEKGTLDTSEGVTQDTFSRMREVLLGIVGDLTIAESNCPRGARVA
FT                   VVTYNNEVTTEIRFADSKKKSALLDSIQNLQVALTSKQQSLETAMSFVARNTFKRVRSG
FT                   FLMRKVAVFFSNKPTRASPQLREAVLKLSDAGITPLFLTSQEDRQLINAFADQ"
FT   CDS             complement(join(5147184..5147191,5148742..5149236,
FT                   5149325..5149336,5149449..5149485,5149567..5149599,
FT                   5151334..5151396,5152315..5152377,5152830..5152865,
FT                   5152998..5153048,5153746..5153808,5155031..5155093,
FT                   5155323..5155385,5156139..5156201,5156652..5156687,
FT                   5159032..5159085,5159518..5159583,5160122..5160184,
FT                   5161118..5161171,5161284..5161328,5161432..5161458,
FT                   5162120..5162191,5162923..5162976,5163488..5163580,
FT                   5165036..5165181,5166979..5167057,5168196..5168533,
FT                   5169078..5169677,5170625..5171239,5174335..5174940,
FT                   5176984..5177586,5178117..5178689,5180073..5180672,
FT                   5182809..5183393,5188660..5189262,5194718..5195335,
FT                   5197038..5197125))
FT                   /codon_start=1
FT                   /locus_tag="mCG_12867"
FT                   /product="mCG12867, isoform CRA_e"
FT                   /note="gene_id=mCG12867.2 transcript_id=mCT179504.0
FT                   protein_id=mCP102426.0 isoform=CRA_e"
FT                   /protein_id="EDL40086.1"
FT                   /translation="MRKHRHLPLVAVFSLLLSGIATTHAQQHGDVKNGAAADIVFLVDS
FT                   SWSAGKDRFLLVQEFLSDVVESLAVGDNDFHFALVRLNGNPHTEFLLNTYHSKQEVLSH
FT                   IVNMSYIGGSNQTGKGLEYVIHSHLTEASGSRAADGVPQVIIVLTDGQSEDGFALPSAE
FT                   LKSADVNVFAVGVEGADERALGEVASEPLSMHVFNLENVTSLHGLVGNLVSCIHSSVNP
FT                   ERAGDKESLKDITAQDSADIIFLIDGSQNTGNANFDVIRDFLVNVLERLSVGNQQVQVG
FT                   VVQYSEEPITMFSLNSYPSKAAVLDAVKGLSLVGGESANIGQALDFVVENHFTRAGGSR
FT                   VEEGVPQVLVLISAGPSSDEIRDSVVALKQASVFSFGLGAQAASRAELQHIATDDSLVF
FT                   TVPEFRSFGDLQEQILPYLVGVAQRHIVLQPPAIVTQVMEVNKRDIVFLVDGSSSLGPS
FT                   NFNAIRDFVTRVIQRLEIGQDLVQVSVAQYADTVKPEFYLNSYTNKRDAITAVRKMRAL
FT                   NGSALYTGSSLDFVRNNLFTSSAGHRAAEGVPKLLVLITGGKSLDEVSQPAQELKRGSI
FT                   MALAVGSKAADEDELKEIAFDSSLVFIPAEFRPAPLQNMLPSLMAPLRTLTGTTEVHVN
FT                   KRDIIFLLDGSDNVGKNNFPYVRDFVTNLVNSLDVGSDNIRVGLVQFSDTPVTEFSLDT
FT                   YQTKSELLAHLRRLQLKGGSGLNAGSALSYIHANHFTEAGGSRTREHVPQLLLLLMAGP
FT                   SEDAYLQAANALVRSGVLTFCVGTNRADKAELEHIAFNPSLVYLMDDFRSLPSLPQQLI
FT                   QPLTTYVSGGVQEVPLSQPESKRDILFLFDGSVNVLGQFPAVRDFLYRIIEELDVKPDG
FT                   TRVAIAQFSDDVRLESRFSEHQTKAEILNLVKKMKLKTGKALNLGYALDYALRNIFVRS
FT                   AGSRIEDNVQQFLVLLVAGRSSDAVAGPASSLKQRGVVPFIFQAKNANPSELEQIVLSP
FT                   AFILAAESLPKIGDLQSQIVSLLKAEQGSGPVSGEKDVVFLIDGSEGVRSGFPLLKDFV
FT                   QRVVESLDVGPDRVRVALVQYSDRTRPEFYLNSHMDQQGVISAIRRLTLLGGPTPNTGA
FT                   ALEFVLRNILTSSTGSRIAEGVPQLLIVLTAEPSGDDVRGPSVVLKQGGAVPIGIGIGN
FT                   ADISEMQTISFIPDFAVAIPTFRELGTIQQVISERVIQLNREELSSLKPILTPSTGAGV
FT                   GSKKDVVFLIDGSRNAGPEFQYIRTLIERIVEYLDIGFDTTRVAVIQFSEDSKMEFPLN
FT                   AHFSKDEVQNAVRRLRPKGGSQVYIGNALEYVLKNIFQRPLGSRIEEGVPQFLVLISSG
FT                   KSDDEVDDSAVELKQFGVAPLTIARHTDQEELVKISLSPEYVYSVSTFRELPRLEQKLL
FT                   TPITTLTSQQIHQILASTRYPPSVVESDAADIVFLIDSSDAVKPDGIAHIRDFVSRIVR
FT                   RLNIGPSKVRIGVVQFSNDVFPEFYLKTHKSQSSVLEAIRRLRFKGGSPLNTGRALEFV
FT                   ARNLFVKSAGSRIEDGVPQHLVLFLGGKSQDDVARHAQVISSSGIVSLGIGDRNIDRTD
FT                   LQTITNDPRLVFTVREFRELPNIEERVMLSFGPSGATPQPPGVDLPSPSRPEKKKADIV
FT                   FLLDGSINFRRDSFQEVLRFASEIVDTVYEDGDSIRVGLVQYNSDPTDEFFLRDFSTKR
FT                   QIIDAINKVVYKGGRHANTRVGIEHLLRNHFVPEAGSRLDERVPQIAFVITGGKSVEDA
FT                   QDVSLALTQKGVKVFAVGVRNIDSEEVGKIASNSATAFRVGSVQELSELSETVLETLHD
FT                   AMHETLCPGVTDVSKACNLEVILGFDGSRDQNVFVSQKGLESKVDIILNRISQIQRISC
FT                   SGNQLPTVRVSVMANTPSGPVEAFDFAEYQPELFEKFRNMRSQRPYVLTADTLKLYQNK
FT                   FRQSSPDTVKVVIHFTDGADGDMADLYRASEELRQAGAQALILVGLERVANLERLMHLE
FT                   FGRGFMYDRPLRLNLLDLDYELAEQLDNIAEKACCGVPCKCSGERGDRGPIGSIGPKGI
FT                   SGEDGYRGYPGDEGGPGERGPPGVNGTQGFQGCPGQRGVKGSRGFPGEKGELGEIGLDG
FT                   LDGEEGDKGLPGSSGEKGSPGRRGDKGPKGDKGERGDVGIRGDPGDSGRDSQQRGPKGE
FT                   TGDIGPMGLPGRDGIPGSPGDPGKDGGSGRRGPAGAKGNRGGPGQPGFEGEQGTRGSQG
FT                   PPGPIGPPGLIGEQGIPGPRGGGGTAGAPGERGRTGPLGRKGEPGEPGPKGSIGNRGPR
FT                   GETGDDGRDGVGSEGRRGKKGERGFPGYPGPKGTPGEPGADGPPGPKGIRGRRGNSGPP
FT                   GATGQKGDPGYPGPSGHKGNRGDSVDQCALIQSIRDKCPCCYGPLECPVFPTELAFALD
FT                   TSEGVTQDTFSRMREVLLGIVGDLTIAESNCPRGARVAVVTYNNEVTTEIRFADSKKKS
FT                   ALLDSIQNLQVALTSKQQSLETAMSFVARNTFKRVRSGFLMRKVAVFFSNKPTRASPQL
FT                   REAVLKLSDAGITPLFLTSQEDRQLINAFADQ"
FT   mRNA            complement(join(5158575..5159085,5159518..5159583,
FT                   5160122..5160184,5161118..5161171,5161284..5161328,
FT                   5161432..5161458,5162120..5162191,5162923..5162976,
FT                   5163488..5163580,5165036..5165181,5166979..5167057,
FT                   5168196..5168533,5169078..5169677,5170625..5171239,
FT                   5174335..5174940,5176984..5177586,5178117..5178689,
FT                   5180073..5180672,5182809..5183393,5188660..5189262,
FT                   5194718..5195335,5197038..5197153,5210640..5210822))
FT                   /locus_tag="mCG_12867"
FT                   /product="mCG12867, transcript variant mCT179502"
FT                   /note="gene_id=mCG12867.2 transcript_id=mCT179502.0 created
FT                   on 04-FEB-2003"
FT   CDS             complement(join(5158990..5159085,5159518..5159583,
FT                   5160122..5160184,5161118..5161171,5161284..5161328,
FT                   5161432..5161458,5162120..5162191,5162923..5162976,
FT                   5163488..5163580,5165036..5165181,5166979..5167057,
FT                   5168196..5168533,5169078..5169677,5170625..5171239,
FT                   5174335..5174940,5176984..5177586,5178117..5178689,
FT                   5180073..5180672,5182809..5183393,5188660..5189262,
FT                   5194718..5195335,5197038..5197125))
FT                   /codon_start=1
FT                   /locus_tag="mCG_12867"
FT                   /product="mCG12867, isoform CRA_c"
FT                   /note="gene_id=mCG12867.2 transcript_id=mCT179502.0
FT                   protein_id=mCP102425.0 isoform=CRA_c"
FT                   /protein_id="EDL40084.1"
FT                   /translation="MRKHRHLPLVAVFSLLLSGIATTHAQQHGDVKNGAAADIVFLVDS
FT                   SWSAGKDRFLLVQEFLSDVVESLAVGDNDFHFALVRLNGNPHTEFLLNTYHSKQEVLSH
FT                   IVNMSYIGGSNQTGKGLEYVIHSHLTEASGSRAADGVPQVIIVLTDGQSEDGFALPSAE
FT                   LKSADVNVFAVGVEGADERALGEVASEPLSMHVFNLENVTSLHGLVGNLVSCIHSSVNP
FT                   ERAGDKESLKDITAQDSADIIFLIDGSQNTGNANFDVIRDFLVNVLERLSVGNQQVQVG
FT                   VVQYSEEPITMFSLNSYPSKAAVLDAVKGLSLVGGESANIGQALDFVVENHFTRAGGSR
FT                   VEEGVPQVLVLISAGPSSDEIRDSVVALKQASVFSFGLGAQAASRAELQHIATDDSLVF
FT                   TVPEFRSFGDLQEQILPYLVGVAQRHIVLQPPAIVTQVMEVNKRDIVFLVDGSSSLGPS
FT                   NFNAIRDFVTRVIQRLEIGQDLVQVSVAQYADTVKPEFYLNSYTNKRDAITAVRKMRAL
FT                   NGSALYTGSSLDFVRNNLFTSSAGHRAAEGVPKLLVLITGGKSLDEVSQPAQELKRGSI
FT                   MALAVGSKAADEDELKEIAFDSSLVFIPAEFRPAPLQNMLPSLMAPLRTLTGTTEVHVN
FT                   KRDIIFLLDGSDNVGKNNFPYVRDFVTNLVNSLDVGSDNIRVGLVQFSDTPVTEFSLDT
FT                   YQTKSELLAHLRRLQLKGGSGLNAGSALSYIHANHFTEAGGSRTREHVPQLLLLLMAGP
FT                   SEDAYLQAANALVRSGVLTFCVGTNRADKAELEHIAFNPSLVYLMDDFRSLPSLPQQLI
FT                   QPLTTYVSGGVQEVPLSQPESKRDILFLFDGSVNVLGQFPAVRDFLYRIIEELDVKPDG
FT                   TRVAIAQFSDDVRLESRFSEHQTKAEILNLVKKMKLKTGKALNLGYALDYALRNIFVRS
FT                   AGSRIEDNVQQFLVLLVAGRSSDAVAGPASSLKQRGVVPFIFQAKNANPSELEQIVLSP
FT                   AFILAAESLPKIGDLQSQIVSLLKAEQGSGPVSGEKDVVFLIDGSEGVRSGFPLLKDFV
FT                   QRVVESLDVGPDRVRVALVQYSDRTRPEFYLNSHMDQQGVISAIRRLTLLGGPTPNTGA
FT                   ALEFVLRNILTSSTGSRIAEGVPQLLIVLTAEPSGDDVRGPSVVLKQGGAVPIGIGIGN
FT                   ADISEMQTISFIPDFAVAIPTFRELGTIQQVISERVIQLNREELSSLKPILTPSTGAGV
FT                   GSKKDVVFLIDGSRNAGPEFQYIRTLIERIVEYLDIGFDTTRVAVIQFSEDSKMEFPLN
FT                   AHFSKDEVQNAVRRLRPKGGSQVYIGNALEYVLKNIFQRPLGSRIEEGVPQFLVLISSG
FT                   KSDDEVDDSAVELKQFGVAPLTIARHTDQEELVKISLSPEYVYSVSTFRELPRLEQKLL
FT                   TPITTLTSQQIHQILASTRYPPSVVESDAADIVFLIDSSDAVKPDGIAHIRDFVSRIVR
FT                   RLNIGPSKVRIGVVQFSNDVFPEFYLKTHKSQSSVLEAIRRLRFKGGSPLNTGRALEFV
FT                   ARNLFVKSAGSRIEDGVPQHLVLFLGGKSQDDVARHAQVISSSGIVSLGIGDRNIDRTD
FT                   LQTITNDPRLVFTVREFRELPNIEERVMLSFGPSGATPQPPGVDLPSPSRPEKKKADIV
FT                   FLLDGSINFRRDSFQEVLRFASEIVDTVYEDGDSIRVGLVQYNSDPTDEFFLRDFSTKR
FT                   QIIDAINKVVYKGGRHANTRVGIEHLLRNHFVPEAGSRLDERVPQIAFVITGGKSVEDA
FT                   QDVSLALTQKGVKVFAVGVRNIDSEEVGKIASNSATAFRVGSVQELSELSETVLETLHD
FT                   AMHETLCPGVTDVSKACNLEVILGFDGSRDQNVFVSQKGLESKVDIILNRISQIQRISC
FT                   SGNQLPTVRVSVMANTPSGPVEAFDFAEYQPELFEKFRNMRSQRPYVLTADTLKLYQNK
FT                   FRQSSPDTVKVVIHFTDGADGDMADLYRASEELRQAGAQALILVGLERVANLERLMHLE
FT                   FGRGFMYDRPLRLNLLDLDYELAEQLDNIAEKACCGVPCKCSGERGDRGPIGSIGPKGI
FT                   SGEDGYRGYPGDEGGPGERGPPGVNGTQGFQGCPGQRGVKGSRGFPGEKGELGEIGLDG
FT                   LDGEEGDKGLPGSSGEKGSPGRRGDKGPKGDKGERGDVGIRGDPGDSGRDSQQRGPKGE
FT                   TGDIGPMGLPGRDGIPGSPGDPGKDVSTLGCWVLLTGK"
FT   assembly_gap    5162275..5162298
FT                   /estimated_length=24
FT                   /gap_type="unknown"
FT   assembly_gap    5174259..5174278
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5175680..5175736
FT                   /estimated_length=57
FT                   /gap_type="unknown"
FT   assembly_gap    5196668..5197014
FT                   /estimated_length=347
FT                   /gap_type="unknown"
FT   assembly_gap    5236897..5236916
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5251421..5251642
FT                   /estimated_length=222
FT                   /gap_type="unknown"
FT   assembly_gap    5253236..5254776
FT                   /estimated_length=1541
FT                   /gap_type="unknown"
FT   assembly_gap    5261082..5261222
FT                   /estimated_length=141
FT                   /gap_type="unknown"
FT   assembly_gap    5270392..5270411
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            5282070..5317790
FT                   /gene="Mlph"
FT                   /locus_tag="mCG_12869"
FT                   /note="gene_id=mCG12869.2"
FT   mRNA            join(5282070..5282241,5288821..5288954,5294964..5295185,
FT                   5295305..5295417,5297068..5297171,5298473..5298595,
FT                   5300296..5300500,5302292..5302431,5304639..5304722,
FT                   5306344..5306496,5306705..5306860,5308674..5308766,
FT                   5309858..5309944,5310681..5310735,5312600..5312700,
FT                   5315585..5317790)
FT                   /gene="Mlph"
FT                   /locus_tag="mCG_12869"
FT                   /product="melanophilin, transcript variant mCT13519"
FT                   /note="gene_id=mCG12869.2 transcript_id=mCT13519.2 created
FT                   on 31-DEC-2002"
FT   CDS             join(5288845..5288954,5294964..5295185,5295305..5295417,
FT                   5297068..5297171,5298473..5298595,5300296..5300500,
FT                   5302292..5302431,5304639..5304722,5306344..5306496,
FT                   5306705..5306860,5308674..5308766,5309858..5309944,
FT                   5310681..5310735,5312600..5312700,5315585..5315611)
FT                   /codon_start=1
FT                   /gene="Mlph"
FT                   /locus_tag="mCG_12869"
FT                   /product="melanophilin, isoform CRA_a"
FT                   /note="gene_id=mCG12869.2 transcript_id=mCT13519.2
FT                   protein_id=mCP20961.2 isoform=CRA_a"
FT                   /protein_id="EDL40079.1"
FT                   /translation="MGKRLDLSTLTDEEAEHVWAVVQRDFDLRRREEERLQGLKGKIQK
FT                   ESSKRELLSDTAHLNETHCARCLQPYRLLLNSRRQCLECSLFVCKSCSHAHPEEQGWLC
FT                   DPCHLARVVKIGSLEWYYQHVRARFKRFGSAKVIRSLCGRLQGGGGSEPSLEEGNGDSE
FT                   QTDEDGDLDTEARDQPLNSKKKKRLLSFRDVDFEEDSDHLVQPCSQTLGLSSVPESAHS
FT                   LQSLSGEPYSEDTTSLEPEGLEETGARALGCRPSPEVQPCSPLPSGEDAHAELDSPAAS
FT                   CKSAFGTTAMPGTDDVRGKHLPSQYLADVDTSDEDSIQGPRAASQHSKRRARTVPETQI
FT                   LELNKRMSAVEHLLVHLENTVLPPSAQEPTVETHPSADTEEETLRRRLEELTSNISGSS
FT                   TSSEDETKPDGTFLGGSPKVCTDTGHMETQERNPRSPGNPARPTKSTDEELSEMEDRVA
FT                   MTASEVQQAESEISDIQSRIAALRAAGLTVKPSGKPRRKSGIPIFLPRVTEKLDRIPKT
FT                   PPADPDDQAKMPKATTAVPSLLRRKYSPSSQGVDSGSFDRKSVYRGSLTQRNPNGRRGT
FT                   ARHIFAKPVMAQQP"
FT   mRNA            join(5294661..5295185,5295305..5295417,5297068..5297171,
FT                   5298473..5298595,5300296..5300500,5302292..5302431,
FT                   5304639..5304722,5306344..5306496,5306705..5306860,
FT                   5308674..5308766,5309858..5309944,5310681..5310735,
FT                   5312600..5312700,5315585..5316891)
FT                   /gene="Mlph"
FT                   /locus_tag="mCG_12869"
FT                   /product="melanophilin, transcript variant mCT177881"
FT                   /note="gene_id=mCG12869.2 transcript_id=mCT177881.0 created
FT                   on 31-DEC-2002"
FT   CDS             join(5294935..5295185,5295305..5295417,5297068..5297171,
FT                   5298473..5298595,5300296..5300500,5302292..5302431,
FT                   5304639..5304722,5306344..5306496,5306705..5306860,
FT                   5308674..5308766,5309858..5309944,5310681..5310735,
FT                   5312600..5312700,5315585..5315611)
FT                   /codon_start=1
FT                   /gene="Mlph"
FT                   /locus_tag="mCG_12869"
FT                   /product="melanophilin, isoform CRA_b"
FT                   /note="gene_id=mCG12869.2 transcript_id=mCT177881.0
FT                   protein_id=mCP100803.0 isoform=CRA_b"
FT                   /protein_id="EDL40080.1"
FT                   /translation="MYFLSHFFPRGLKGKIQKESSKRELLSDTAHLNETHCARCLQPYR
FT                   LLLNSRRQCLECSLFVCKSCSHAHPEEQGWLCDPCHLARVVKIGSLEWYYQHVRARFKR
FT                   FGSAKVIRSLCGRLQGGGGSEPSLEEGNGDSEQTDEDGDLDTEARDQPLNSKKKKRLLS
FT                   FRDVDFEEDSDHLVQPCSQTLGLSSVPESAHSLQSLSGEPYSEDTTSLEPEGLEETGAR
FT                   ALGCRPSPEVQPCSPLPSGEDAHAELDSPAASCKSAFGTTAMPGTDDVRGKHLPSQYLA
FT                   DVDTSDEDSIQGPRAASQHSKRRARTVPETQILELNKRMSAVEHLLVHLENTVLPPSAQ
FT                   EPTVETHPSADTEEETLRRRLEELTSNISGSSTSSEDETKPDGTFLGGSPKVCTDTGHM
FT                   ETQERNPRSPGNPARPTKSTDEELSEMEDRVAMTASEVQQAESEISDIQSRIAALRAAG
FT                   LTVKPSGKPRRKSGIPIFLPRVTEKLDRIPKTPPADPDDQAKMPKATTAVPSLLRRKYS
FT                   PSSQGVDSGSFDRKSVYRGSLTQRNPNGRRGTARHIFAKPVMAQQP"
FT   mRNA            join(5306180..5306496,5306705..5307224)
FT                   /gene="Mlph"
FT                   /locus_tag="mCG_12869"
FT                   /product="melanophilin, transcript variant mCT177882"
FT                   /note="gene_id=mCG12869.2 transcript_id=mCT177882.0 created
FT                   on 31-DEC-2002"
FT   CDS             5306726..5306914
FT                   /codon_start=1
FT                   /gene="Mlph"
FT                   /locus_tag="mCG_12869"
FT                   /product="melanophilin, isoform CRA_c"
FT                   /note="gene_id=mCG12869.2 transcript_id=mCT177882.0
FT                   protein_id=mCP100804.0 isoform=CRA_c"
FT                   /protein_id="EDL40081.1"
FT                   /translation="METQERNPRSPGNPARPTKSTDEELSEMEDRVAMTASEVQQAESE
FT                   VAHPPYSFGMSPMTMSW"
FT   gene            <5319760..>5320664
FT                   /locus_tag="mCG_12871"
FT                   /note="gene_id=mCG12871.1"
FT   mRNA            join(<5319760..5319856,5320501..>5320664)
FT                   /locus_tag="mCG_12871"
FT                   /product="mCG12871"
FT                   /note="gene_id=mCG12871.1 transcript_id=mCT13521.0 created
FT                   on 04-FEB-2003"
FT   CDS             join(5319760..5319856,5320501..5320664)
FT                   /codon_start=1
FT                   /locus_tag="mCG_12871"
FT                   /product="mCG12871"
FT                   /note="gene_id=mCG12871.1 transcript_id=mCT13521.0
FT                   protein_id=mCP20984.0"
FT                   /db_xref="GOA:G3UWC3"
FT                   /db_xref="InterPro:IPR026194"
FT                   /db_xref="MGI:MGI:3644668"
FT                   /db_xref="UniProtKB/TrEMBL:G3UWC3"
FT                   /protein_id="EDL40078.1"
FT                   /translation="MAPRTWLLCLLLLGLVLPGASSRAHQHSMETRTPDINPAWYTGRG
FT                   IRPVGRFGRRRAALRDVTGPGLRCRLSCFPLDGSAKFSHSS"
FT   assembly_gap    5322806..5323002
FT                   /estimated_length=197
FT                   /gap_type="unknown"
FT   assembly_gap    5324859..5324924
FT                   /estimated_length=66
FT                   /gap_type="unknown"
FT   gene            complement(5324925..5335847)
FT                   /gene="Rab17"
FT                   /locus_tag="mCG_12876"
FT                   /note="gene_id=mCG12876.2"
FT   mRNA            complement(join(5324925..5325691,5325860..5325953,
FT                   5326685..5326811,5327795..5327946,5330808..5330967,
FT                   5335431..5335847))
FT                   /gene="Rab17"
FT                   /locus_tag="mCG_12876"
FT                   /product="RAB17, member RAS oncogene family, transcript
FT                   variant mCT13525"
FT                   /note="gene_id=mCG12876.2 transcript_id=mCT13525.1 created
FT                   on 31-DEC-2002"
FT   mRNA            complement(join(5324925..5325691,5325860..5325953,
FT                   5326685..5326811,5327795..5327946,5330808..5330967,
FT                   5335431..5335537,5335781..5335809))
FT                   /gene="Rab17"
FT                   /locus_tag="mCG_12876"
FT                   /product="RAB17, member RAS oncogene family, transcript
FT                   variant mCT177897"
FT                   /note="gene_id=mCG12876.2 transcript_id=mCT177897.0 created
FT                   on 31-DEC-2002"
FT   mRNA            complement(join(5324925..5324987,5325520..5325691,
FT                   5325860..5325953,5326685..5326811,5327795..5327946,
FT                   5330808..5330967,5335431..5335792))
FT                   /gene="Rab17"
FT                   /locus_tag="mCG_12876"
FT                   /product="RAB17, member RAS oncogene family, transcript
FT                   variant mCT177896"
FT                   /note="gene_id=mCG12876.2 transcript_id=mCT177896.0 created
FT                   on 31-DEC-2002"
FT   mRNA            complement(join(5324925..5325691,5325860..5325953,
FT                   5326685..5326811,5327795..5327946,5330808..5330967,
FT                   5333140..5333300))
FT                   /gene="Rab17"
FT                   /locus_tag="mCG_12876"
FT                   /product="RAB17, member RAS oncogene family, transcript
FT                   variant mCT177899"
FT                   /note="gene_id=mCG12876.2 transcript_id=mCT177899.0 created
FT                   on 31-DEC-2002"
FT   CDS             complement(join(5325877..5325953,5326685..5326811,
FT                   5327795..5327946,5330808..5330964))
FT                   /codon_start=1
FT                   /gene="Rab17"
FT                   /locus_tag="mCG_12876"
FT                   /product="RAB17, member RAS oncogene family, isoform CRA_a"
FT                   /note="gene_id=mCG12876.2 transcript_id=mCT13525.1
FT                   protein_id=mCP21027.0 isoform=CRA_a"
FT                   /protein_id="EDL40073.1"
FT                   /translation="MAQAAGLPQASTASGQPYVSKLVLLGSSSVGKTSLALRYMKQDFS
FT                   NVLPTVGCAFFTKVLDLGSSSLKLEIWDTAGQEKYQSVCHLYFRGANAALLVYDITRKD
FT                   SFHKAPAVAGRPGEGIPARRGGGDAGRQQNGSGRGAGSDLPGRKRVCREQKLAVHGNLR
FT                   QAELPGV"
FT   CDS             complement(join(5325877..5325953,5326685..5326811,
FT                   5327795..5327946,5330808..5330964))
FT                   /codon_start=1
FT                   /gene="Rab17"
FT                   /locus_tag="mCG_12876"
FT                   /product="RAB17, member RAS oncogene family, isoform CRA_a"
FT                   /note="gene_id=mCG12876.2 transcript_id=mCT177896.0
FT                   protein_id=mCP100819.0 isoform=CRA_a"
FT                   /protein_id="EDL40074.1"
FT                   /translation="MAQAAGLPQASTASGQPYVSKLVLLGSSSVGKTSLALRYMKQDFS
FT                   NVLPTVGCAFFTKVLDLGSSSLKLEIWDTAGQEKYQSVCHLYFRGANAALLVYDITRKD
FT                   SFHKAPAVAGRPGEGIPARRGGGDAGRQQNGSGRGAGSDLPGRKRVCREQKLAVHGNLR
FT                   QAELPGV"
FT   CDS             complement(join(5325877..5325953,5326685..5326811,
FT                   5327795..5327946,5330808..5330964))
FT                   /codon_start=1
FT                   /gene="Rab17"
FT                   /locus_tag="mCG_12876"
FT                   /product="RAB17, member RAS oncogene family, isoform CRA_a"
FT                   /note="gene_id=mCG12876.2 transcript_id=mCT177899.0
FT                   protein_id=mCP100820.0 isoform=CRA_a"
FT                   /protein_id="EDL40076.1"
FT                   /translation="MAQAAGLPQASTASGQPYVSKLVLLGSSSVGKTSLALRYMKQDFS
FT                   NVLPTVGCAFFTKVLDLGSSSLKLEIWDTAGQEKYQSVCHLYFRGANAALLVYDITRKD
FT                   SFHKAPAVAGRPGEGIPARRGGGDAGRQQNGSGRGAGSDLPGRKRVCREQKLAVHGNLR
FT                   QAELPGV"
FT   CDS             complement(join(5325877..5325953,5326685..5326811,
FT                   5327795..5327946,5330808..5330964))
FT                   /codon_start=1
FT                   /gene="Rab17"
FT                   /locus_tag="mCG_12876"
FT                   /product="RAB17, member RAS oncogene family, isoform CRA_a"
FT                   /note="gene_id=mCG12876.2 transcript_id=mCT177897.0
FT                   protein_id=mCP100818.0 isoform=CRA_a"
FT                   /protein_id="EDL40077.1"
FT                   /translation="MAQAAGLPQASTASGQPYVSKLVLLGSSSVGKTSLALRYMKQDFS
FT                   NVLPTVGCAFFTKVLDLGSSSLKLEIWDTAGQEKYQSVCHLYFRGANAALLVYDITRKD
FT                   SFHKAPAVAGRPGEGIPARRGGGDAGRQQNGSGRGAGSDLPGRKRVCREQKLAVHGNLR
FT                   QAELPGV"
FT   mRNA            complement(join(5329513..5329632,5330804..5330967,
FT                   5335431..5335600))
FT                   /gene="Rab17"
FT                   /locus_tag="mCG_12876"
FT                   /product="RAB17, member RAS oncogene family, transcript
FT                   variant mCT177898"
FT                   /note="gene_id=mCG12876.2 transcript_id=mCT177898.0 created
FT                   on 31-DEC-2002"
FT   CDS             complement(join(5329581..5329632,5330804..5330964))
FT                   /codon_start=1
FT                   /gene="Rab17"
FT                   /locus_tag="mCG_12876"
FT                   /product="RAB17, member RAS oncogene family, isoform CRA_b"
FT                   /note="gene_id=mCG12876.2 transcript_id=mCT177898.0
FT                   protein_id=mCP100821.0 isoform=CRA_b"
FT                   /protein_id="EDL40075.1"
FT                   /translation="MAQAAGLPQASTASGQPYVSKLVLLGSSSVGKTSLALRYMKQDFS
FT                   NVLPTVGCNLYLHKGGGLGLLISEG"
FT   assembly_gap    5331532..5331551
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5333784..5333803
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5354976..5354995
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            5358751..5493095
FT                   /gene="Lrrfip1"
FT                   /locus_tag="mCG_12874"
FT                   /note="gene_id=mCG12874.2"
FT   mRNA            join(5358751..5358889,5432744..5432830,5464693..5464728,
FT                   5465295..5465420,5469213..5469383,5471374..5471466,
FT                   5476260..5476401,5484246..5484295,5486548..5486665,
FT                   5487204..5487283,5489791..5489895,5492238..5493070)
FT                   /gene="Lrrfip1"
FT                   /locus_tag="mCG_12874"
FT                   /product="leucine rich repeat (in FLII) interacting protein
FT                   1, transcript variant mCT177890"
FT                   /note="gene_id=mCG12874.2 transcript_id=mCT177890.0 created
FT                   on 31-DEC-2002"
FT   mRNA            join(5358760..5358889,5432744..5432830,5437505..5437522,
FT                   5441113..5441160,5442561..5442605,5443201..5443251,
FT                   5446312..5446350,5449123..5449182,5452799..5452876,
FT                   5455766..5455831,5457726..5457803,5464693..5464728,
FT                   5465295..5465420,5467355..5467426,5469213..5469383,
FT                   5471374..5471466,5472667..5472759,5474452..5474544,
FT                   5476260..5476401,5484246..5484295,5486548..5486665,
FT                   5487204..5487283,5489791..5489895,5492238..5492850)
FT                   /gene="Lrrfip1"
FT                   /locus_tag="mCG_12874"
FT                   /product="leucine rich repeat (in FLII) interacting protein
FT                   1, transcript variant mCT177892"
FT                   /note="gene_id=mCG12874.2 transcript_id=mCT177892.0 created
FT                   on 31-DEC-2002"
FT   mRNA            join(5358771..5358889,5432744..5432830,5464693..5464728,
FT                   5465295..5465420,5467355..5467426,5469213..5469383,
FT                   5471374..5471466,5476260..5476401,5484246..5484295,
FT                   5486548..5486665,5487204..5487283,5489791..5489895,
FT                   5492238..5493070)
FT                   /gene="Lrrfip1"
FT                   /locus_tag="mCG_12874"
FT                   /product="leucine rich repeat (in FLII) interacting protein
FT                   1, transcript variant mCT177891"
FT                   /note="gene_id=mCG12874.2 transcript_id=mCT177891.0 created
FT                   on 31-DEC-2002"
FT   mRNA            join(5358774..5358889,5432744..5432830,5437505..5437522,
FT                   5443201..5443251,5446312..5446350,5449123..5449182,
FT                   5452799..5452876,5455766..5455831,5457726..5457803,
FT                   5464693..5464728,5465295..5465420,5467355..5467426,
FT                   5469213..5469383,5471374..5471466,5476260..5476401,
FT                   5484246..5484295,5486548..5486665,5487204..5487283,
FT                   5489791..5489895,5492238..5492850)
FT                   /gene="Lrrfip1"
FT                   /locus_tag="mCG_12874"
FT                   /product="leucine rich repeat (in FLII) interacting protein
FT                   1, transcript variant mCT177894"
FT                   /note="gene_id=mCG12874.2 transcript_id=mCT177894.0 created
FT                   on 31-DEC-2002"
FT   CDS             join(5358794..5358889,5432744..5432830,5437505..5437522,
FT                   5441113..5441160,5442561..5442605,5443201..5443251,
FT                   5446312..5446350,5449123..5449182,5452799..5452876,
FT                   5455766..5455831,5457726..5457803,5464693..5464728,
FT                   5465295..5465420,5467355..5467426,5469213..5469383,
FT                   5471374..5471466,5472667..5472759,5474452..5474544,
FT                   5476260..5476401,5484246..5484295,5486548..5486665,
FT                   5487204..5487283,5489791..5489895,5492238..5492348)
FT                   /codon_start=1
FT                   /gene="Lrrfip1"
FT                   /locus_tag="mCG_12874"
FT                   /product="leucine rich repeat (in FLII) interacting protein
FT                   1, isoform CRA_f"
FT                   /note="gene_id=mCG12874.2 transcript_id=mCT177892.0
FT                   protein_id=mCP100811.0 isoform=CRA_f"
FT                   /protein_id="EDL40067.1"
FT                   /translation="MDMGTQGSGRKRLPNRERLTAEDDALNQIAREAEARLAAKRAARA
FT                   EAREIRMKELERQQKEIYQVQKKYYGLDTKWGDIEQWMEDSERYSRRFRRNTSASDEDE
FT                   RLSVGSRGSLRAQPELEYGSPYAWTNGYDGDYCGSQSLSRRSGRGLSCSNLGLPSSGLA
FT                   SKPLSTQNGSRASMLDESSLYGARRGSACGSRAPSEYGSHLNSSSRASSRASSARASPV
FT                   VEERPDKDFAEKGSRNMPSLSAATLASLGGTSSRRGSGDTSISMDTEASIREIKELNEL
FT                   KDQIQDVEGKYMQGLKEMKDSLAEVEEKYKKAMVSNAQLDNEKTNFMYQVDTLKDMLLE
FT                   LEEQLAESQRQYEEKNKEFEREKHAHSILQFQFAEVKEALRQREEMLEEIRQLQQKQAG
FT                   FIREISDLQETIEWKDKKIGALERQKEFFDSIRSERDDLREETVKLKEELKKHGIILNS
FT                   EIATNGETSDTVNDVGYQAPTKITKEELNALKSAGEGTLDVRLKKLIDERECLLEQIKK
FT                   LKGQLEGRQKNNKLDLLRAEDGILENGTDAHVMDLQRDANRQISDLKFKLAKSEQEITA
FT                   LEQNVIRLESQVTRYRSAAENAEKIEDELKAEKRKLQRELRSALDKTEELEVSNGHLVK
FT                   RLEKMKANRSALLSQQ"
FT   CDS             join(5358794..5358889,5432744..5432830,5437505..5437522,
FT                   5443201..5443251,5446312..5446350,5449123..5449182,
FT                   5452799..5452876,5455766..5455831,5457726..5457803,
FT                   5464693..5464728,5465295..5465420,5467355..5467426,
FT                   5469213..5469383,5471374..5471466,5476260..5476401,
FT                   5484246..5484295,5486548..5486665,5487204..5487283,
FT                   5489791..5489895,5492238..5492348)
FT                   /codon_start=1
FT                   /gene="Lrrfip1"
FT                   /locus_tag="mCG_12874"
FT                   /product="leucine rich repeat (in FLII) interacting protein
FT                   1, isoform CRA_g"
FT                   /note="gene_id=mCG12874.2 transcript_id=mCT177894.0
FT                   protein_id=mCP100817.0 isoform=CRA_g"
FT                   /protein_id="EDL40068.1"
FT                   /translation="MDMGTQGSGRKRLPNRERLTAEDDALNQIAREAEARLAAKRAARA
FT                   EAREIRMKELERQQKEIYQVQKASDEDERLSVGSRGSLRAQPELEYGSPYAWTNGYDGD
FT                   YCGSQSLSRRSGRGLSCSNLGLPSSGLASKPLSTQNGSRASMLDESSLYGARRGSACGS
FT                   RAPSEYGSHLNSSSRASSRASSARASPVVEERPDKDFAEKGSRNMPSLSAATLASLGGT
FT                   SSRRGSGDTSISMDTEASIREIKELNELKDQIQDVEGKYMQGLKEMKDSLAEVEEKYKK
FT                   AMVSNAQLDNEKTNFMYQVDTLKDMLLELEEQLAESQRQYEEKNKEFEREKHAHSILQF
FT                   QFAEVKEALRQREEMLEKHGIILNSEIATNGETSDTVNDVGYQAPTKITKEELNALKSA
FT                   GEGTLDVRLKKLIDERECLLEQIKKLKGQLEGRQKNNKLDLLRAEDGILENGTDAHVMD
FT                   LQRDANRQISDLKFKLAKSEQEITALEQNVIRLESQVTRYRSAAENAEKIEDELKAEKR
FT                   KLQRELRSALDKTEELEVSNGHLVKRLEKMKANRSALLSQQ"
FT   CDS             join(5358794..5358889,5432744..5432830,5464693..5464728,
FT                   5465295..5465420,5467355..5467426,5469213..5469383,
FT                   5471374..5471466,5476260..5476401,5484246..5484295,
FT                   5486548..5486665,5487204..5487283,5489791..5489895,
FT                   5492238..5492348)
FT                   /codon_start=1
FT                   /gene="Lrrfip1"
FT                   /locus_tag="mCG_12874"
FT                   /product="leucine rich repeat (in FLII) interacting protein
FT                   1, isoform CRA_e"
FT                   /note="gene_id=mCG12874.2 transcript_id=mCT177891.0
FT                   protein_id=mCP100815.0 isoform=CRA_e"
FT                   /db_xref="GOA:G5E8E1"
FT                   /db_xref="InterPro:IPR019139"
FT                   /db_xref="MGI:MGI:1342770"
FT                   /db_xref="UniProtKB/TrEMBL:G5E8E1"
FT                   /protein_id="EDL40066.1"
FT                   /translation="MDMGTQGSGRKRLPNRERLTAEDDALNQIAREAEARLAAKRAARA
FT                   EAREIRMKELERQQKEVEERPDKDFAEKGSRNMPSLSAATLASLGGTSSRRGSGDTSIS
FT                   MDTEASIREIKELNELKDQIQDVEGKYMQGLKEMKDSLAEVEEKYKKAMVSNAQLDNEK
FT                   TNFMYQVDTLKDMLLELEEQLAESQRQYEEKNKEFEREKHAHSILQFQFAEVKEALRQR
FT                   EEMLEKHGIILNSEIATNGETSDTVNDVGYQAPTKITKEELNALKSAGEGTLDVRLKKL
FT                   IDERECLLEQIKKLKGQLEGRQKNNKLDLLRAEDGILENGTDAHVMDLQRDANRQISDL
FT                   KFKLAKSEQEITALEQNVIRLESQVTRYRSAAENAEKIEDELKAEKRKLQRELRSALDK
FT                   TEELEVSNGHLVKRLEKMKANRSALLSQQ"
FT   CDS             join(5358794..5358889,5432744..5432830,5464693..5464728,
FT                   5465295..5465420,5469213..5469383,5471374..5471466,
FT                   5476260..5476401,5484246..5484295,5486548..5486665,
FT                   5487204..5487283,5489791..5489895,5492238..5492348)
FT                   /codon_start=1
FT                   /gene="Lrrfip1"
FT                   /locus_tag="mCG_12874"
FT                   /product="leucine rich repeat (in FLII) interacting protein
FT                   1, isoform CRA_i"
FT                   /note="gene_id=mCG12874.2 transcript_id=mCT177890.0
FT                   protein_id=mCP100809.0 isoform=CRA_i"
FT                   /protein_id="EDL40070.1"
FT                   /translation="MDMGTQGSGRKRLPNRERLTAEDDALNQIAREAEARLAAKRAARA
FT                   EAREIRMKELERQQKEVEERPDKDFAEKGSRNMPSLSAATLASLGGTSSRRGSGDTSIS
FT                   MDTEASIREIKDSLAEVEEKYKKAMVSNAQLDNEKTNFMYQVDTLKDMLLELEEQLAES
FT                   QRQYEEKNKEFEREKHAHSILQFQFAEVKEALRQREEMLEKHGIILNSEIATNGETSDT
FT                   VNDVGYQAPTKITKEELNALKSAGEGTLDVRLKKLIDERECLLEQIKKLKGQLEGRQKN
FT                   NKLDLLRAEDGILENGTDAHVMDLQRDANRQISDLKFKLAKSEQEITALEQNVIRLESQ
FT                   VTRYRSAAENAEKIEDELKAEKRKLQRELRSALDKTEELEVSNGHLVKRLEKMKANRSA
FT                   LLSQQ"
FT   assembly_gap    5374948..5374967
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5376326..5376423
FT                   /estimated_length=98
FT                   /gap_type="unknown"
FT   assembly_gap    5379648..5379667
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5388006..5388025
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5391873..5391892
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5394010..5394029
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5402363..5402382
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            join(5408592..5408714,5432744..5432830,5464693..5464728,
FT                   5465295..5465420,5469213..5469383,5471374..5471466,
FT                   5476260..5476401,5478701..5480240)
FT                   /gene="Lrrfip1"
FT                   /locus_tag="mCG_12874"
FT                   /product="leucine rich repeat (in FLII) interacting protein
FT                   1, transcript variant mCT177886"
FT                   /note="gene_id=mCG12874.2 transcript_id=mCT177886.0 created
FT                   on 31-DEC-2002"
FT   assembly_gap    5417546..5417565
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            join(5417616..5417906,5432744..5432830,5449123..5449182,
FT                   5464693..5464728,5465295..5465420,5469213..5469383,
FT                   5471374..5471466,5476260..5476401,5484246..5484295,
FT                   5486548..5486665,5487204..5487283,5489791..5489895,
FT                   5492238..5493070)
FT                   /gene="Lrrfip1"
FT                   /locus_tag="mCG_12874"
FT                   /product="leucine rich repeat (in FLII) interacting protein
FT                   1, transcript variant mCT177895"
FT                   /note="gene_id=mCG12874.2 transcript_id=mCT177895.0 created
FT                   on 31-DEC-2002"
FT   mRNA            join(5417627..5417906,5432744..5432830,5464693..5464728,
FT                   5465295..5465420,5469213..5469383,5471374..5471466,
FT                   5476260..5476401,5478701..5480172)
FT                   /gene="Lrrfip1"
FT                   /locus_tag="mCG_12874"
FT                   /product="leucine rich repeat (in FLII) interacting protein
FT                   1, transcript variant mCT177893"
FT                   /note="gene_id=mCG12874.2 transcript_id=mCT177893.0 created
FT                   on 31-DEC-2002"
FT   mRNA            join(5417664..5417906,5432744..5432830,5464693..5464728,
FT                   5465295..5465420,5469213..5469383,5471374..5471466,
FT                   5472667..5472759,5474452..5474544,5476260..5476401,
FT                   5484246..5484295,5486548..5486665,5487204..5487283,
FT                   5489791..5489895,5492238..5493070)
FT                   /gene="Lrrfip1"
FT                   /locus_tag="mCG_12874"
FT                   /product="leucine rich repeat (in FLII) interacting protein
FT                   1, transcript variant mCT177888"
FT                   /note="gene_id=mCG12874.2 transcript_id=mCT177888.0 created
FT                   on 31-DEC-2002"
FT   mRNA            join(5417690..5417906,5432744..5432830,5441096..5441160,
FT                   5442561..5442605,5443201..5443251,5449123..5449182,
FT                   5452799..5452876,5455766..5455831,5457726..5457803,
FT                   5464693..5464728,5465295..5465420,5467355..5467426,
FT                   5469213..5469383,5471374..5471466,5472667..5472759,
FT                   5474452..5474544,5476260..5476401,5484246..5484295,
FT                   5486548..5486665,5487204..5487283,5489791..5489895,
FT                   5492238..5493095)
FT                   /gene="Lrrfip1"
FT                   /locus_tag="mCG_12874"
FT                   /product="leucine rich repeat (in FLII) interacting protein
FT                   1, transcript variant mCT177887"
FT                   /note="gene_id=mCG12874.2 transcript_id=mCT177887.0 created
FT                   on 31-DEC-2002"
FT   mRNA            join(5417690..5417906,5432744..5432830,5437505..5437522,
FT                   5441113..5441160,5442561..5442605,5443201..5443251,
FT                   5449123..5449182,5452799..5452876,5455766..5455831,
FT                   5457726..5457803,5464693..5464728,5465295..5465420,
FT                   5467355..5467426,5469213..5469383,5471374..5471466,
FT                   5472667..5472759,5474452..5474544,5476260..5476401,
FT                   5484246..5484295,5486548..5486665,5487204..5487283,
FT                   5489791..5489895,5492238..5493070)
FT                   /gene="Lrrfip1"
FT                   /locus_tag="mCG_12874"
FT                   /product="leucine rich repeat (in FLII) interacting protein
FT                   1, transcript variant mCT13524"
FT                   /note="gene_id=mCG12874.2 transcript_id=mCT13524.2 created
FT                   on 31-DEC-2002"
FT   mRNA            join(5417690..5417906,5432744..5432830,5437505..5437522,
FT                   5441113..5441160,5442561..5442605,5443201..5443251,
FT                   5449123..5449182,5452799..5452876,5455766..5455831,
FT                   5457726..5457803,5464693..5464728,5465295..5465420,
FT                   5467355..5467426,5469213..5469383,5471374..5471466,
FT                   5476260..5476401,5484246..5484295,5486548..5486665,
FT                   5487204..5487283,5489791..5489895,5492238..5493070)
FT                   /gene="Lrrfip1"
FT                   /locus_tag="mCG_12874"
FT                   /product="leucine rich repeat (in FLII) interacting protein
FT                   1, transcript variant mCT177889"
FT                   /note="gene_id=mCG12874.2 transcript_id=mCT177889.0 created
FT                   on 31-DEC-2002"
FT   CDS             join(5417841..5417906,5432744..5432830,5437505..5437522,
FT                   5441113..5441160,5442561..5442605,5443201..5443251,
FT                   5449123..5449182,5452799..5452876,5455766..5455831,
FT                   5457726..5457803,5464693..5464728,5465295..5465420,
FT                   5467355..5467426,5469213..5469383,5471374..5471466,
FT                   5472667..5472759,5474452..5474544,5476260..5476401,
FT                   5484246..5484295,5486548..5486665,5487204..5487283,
FT                   5489791..5489895,5492238..5492348)
FT                   /codon_start=1
FT                   /gene="Lrrfip1"
FT                   /locus_tag="mCG_12874"
FT                   /product="leucine rich repeat (in FLII) interacting protein
FT                   1, isoform CRA_a"
FT                   /note="gene_id=mCG12874.2 transcript_id=mCT13524.2
FT                   protein_id=mCP21018.1 isoform=CRA_a"
FT                   /protein_id="EDL40062.1"
FT                   /translation="MTSPEGAQNKEIDCLSPEAQRLAEARLAAKRAARAEAREIRMKEL
FT                   ERQQKEIYQVQKKYYGLDTKWGDIEQWMEDSERYSRRFRRNTSASDEDERLSVGSRGSL
FT                   RTNGYDGDYCGSQSLSRRSGRGLSCSNLGLPSSGLASKPLSTQNGSRASMLDESSLYGA
FT                   RRGSACGSRAPSEYGSHLNSSSRASSRASSARASPVVEERPDKDFAEKGSRNMPSLSAA
FT                   TLASLGGTSSRRGSGDTSISMDTEASIREIKELNELKDQIQDVEGKYMQGLKEMKDSLA
FT                   EVEEKYKKAMVSNAQLDNEKTNFMYQVDTLKDMLLELEEQLAESQRQYEEKNKEFEREK
FT                   HAHSILQFQFAEVKEALRQREEMLEEIRQLQQKQAGFIREISDLQETIEWKDKKIGALE
FT                   RQKEFFDSIRSERDDLREETVKLKEELKKHGIILNSEIATNGETSDTVNDVGYQAPTKI
FT                   TKEELNALKSAGEGTLDVRLKKLIDERECLLEQIKKLKGQLEGRQKNNKLDLLRAEDGI
FT                   LENGTDAHVMDLQRDANRQISDLKFKLAKSEQEITALEQNVIRLESQVTRYRSAAENAE
FT                   KIEDELKAEKRKLQRELRSALDKTEELEVSNGHLVKRLEKMKANRSALLSQQ"
FT   CDS             join(5417841..5417906,5432744..5432830,5437505..5437522,
FT                   5441113..5441160,5442561..5442605,5443201..5443251,
FT                   5449123..5449182,5452799..5452876,5455766..5455831,
FT                   5457726..5457803,5464693..5464728,5465295..5465420,
FT                   5467355..5467426,5469213..5469383,5471374..5471466,
FT                   5476260..5476401,5484246..5484295,5486548..5486665,
FT                   5487204..5487283,5489791..5489895,5492238..5492348)
FT                   /codon_start=1
FT                   /gene="Lrrfip1"
FT                   /locus_tag="mCG_12874"
FT                   /product="leucine rich repeat (in FLII) interacting protein
FT                   1, isoform CRA_d"
FT                   /note="gene_id=mCG12874.2 transcript_id=mCT177889.0
FT                   protein_id=mCP100808.0 isoform=CRA_d"
FT                   /protein_id="EDL40065.1"
FT                   /translation="MTSPEGAQNKEIDCLSPEAQRLAEARLAAKRAARAEAREIRMKEL
FT                   ERQQKEIYQVQKKYYGLDTKWGDIEQWMEDSERYSRRFRRNTSASDEDERLSVGSRGSL
FT                   RTNGYDGDYCGSQSLSRRSGRGLSCSNLGLPSSGLASKPLSTQNGSRASMLDESSLYGA
FT                   RRGSACGSRAPSEYGSHLNSSSRASSRASSARASPVVEERPDKDFAEKGSRNMPSLSAA
FT                   TLASLGGTSSRRGSGDTSISMDTEASIREIKELNELKDQIQDVEGKYMQGLKEMKDSLA
FT                   EVEEKYKKAMVSNAQLDNEKTNFMYQVDTLKDMLLELEEQLAESQRQYEEKNKEFEREK
FT                   HAHSILQFQFAEVKEALRQREEMLEKHGIILNSEIATNGETSDTVNDVGYQAPTKITKE
FT                   ELNALKSAGEGTLDVRLKKLIDERECLLEQIKKLKGQLEGRQKNNKLDLLRAEDGILEN
FT                   GTDAHVMDLQRDANRQISDLKFKLAKSEQEITALEQNVIRLESQVTRYRSAAENAEKIE
FT                   DELKAEKRKLQRELRSALDKTEELEVSNGHLVKRLEKMKANRSALLSQQ"
FT   CDS             join(5417841..5417906,5432744..5432830,5449123..5449182,
FT                   5464693..5464728,5465295..5465420,5469213..5469383,
FT                   5471374..5471466,5476260..5476401,5484246..5484295,
FT                   5486548..5486665,5487204..5487283,5489791..5489895,
FT                   5492238..5492348)
FT                   /codon_start=1
FT                   /gene="Lrrfip1"
FT                   /locus_tag="mCG_12874"
FT                   /product="leucine rich repeat (in FLII) interacting protein
FT                   1, isoform CRA_k"
FT                   /note="gene_id=mCG12874.2 transcript_id=mCT177895.0
FT                   protein_id=mCP100810.0 isoform=CRA_k"
FT                   /protein_id="EDL40072.1"
FT                   /translation="MTSPEGAQNKEIDCLSPEAQRLAEARLAAKRAARAEAREIRMKEL
FT                   ERQQKETNGYDGDYCGSQSLSRRSGRVEERPDKDFAEKGSRNMPSLSAATLASLGGTSS
FT                   RRGSGDTSISMDTEASIREIKDSLAEVEEKYKKAMVSNAQLDNEKTNFMYQVDTLKDML
FT                   LELEEQLAESQRQYEEKNKEFEREKHAHSILQFQFAEVKEALRQREEMLEKHGIILNSE
FT                   IATNGETSDTVNDVGYQAPTKITKEELNALKSAGEGTLDVRLKKLIDERECLLEQIKKL
FT                   KGQLEGRQKNNKLDLLRAEDGILENGTDAHVMDLQRDANRQISDLKFKLAKSEQEITAL
FT                   EQNVIRLESQVTRYRSAAENAEKIEDELKAEKRKLQRELRSALDKTEELEVSNGHLVKR
FT                   LEKMKANRSALLSQQ"
FT   CDS             join(5417841..5417906,5432744..5432830,5464693..5464728,
FT                   5465295..5465420,5469213..5469383,5471374..5471466,
FT                   5472667..5472759,5474452..5474544,5476260..5476401,
FT                   5484246..5484295,5486548..5486665,5487204..5487283,
FT                   5489791..5489895,5492238..5492348)
FT                   /codon_start=1
FT                   /gene="Lrrfip1"
FT                   /locus_tag="mCG_12874"
FT                   /product="leucine rich repeat (in FLII) interacting protein
FT                   1, isoform CRA_c"
FT                   /note="gene_id=mCG12874.2 transcript_id=mCT177888.0
FT                   protein_id=mCP100813.0 isoform=CRA_c"
FT                   /protein_id="EDL40064.1"
FT                   /translation="MTSPEGAQNKEIDCLSPEAQRLAEARLAAKRAARAEAREIRMKEL
FT                   ERQQKEVEERPDKDFAEKGSRNMPSLSAATLASLGGTSSRRGSGDTSISMDTEASIREI
FT                   KDSLAEVEEKYKKAMVSNAQLDNEKTNFMYQVDTLKDMLLELEEQLAESQRQYEEKNKE
FT                   FEREKHAHSILQFQFAEVKEALRQREEMLEEIRQLQQKQAGFIREISDLQETIEWKDKK
FT                   IGALERQKEFFDSIRSERDDLREETVKLKEELKKHGIILNSEIATNGETSDTVNDVGYQ
FT                   APTKITKEELNALKSAGEGTLDVRLKKLIDERECLLEQIKKLKGQLEGRQKNNKLDLLR
FT                   AEDGILENGTDAHVMDLQRDANRQISDLKFKLAKSEQEITALEQNVIRLESQVTRYRSA
FT                   AENAEKIEDELKAEKRKLQRELRSALDKTEELEVSNGHLVKRLEKMKANRSALLSQQ"
FT   CDS             join(5417841..5417906,5432744..5432830,5464693..5464728,
FT                   5465295..5465420,5469213..5469383,5471374..5471466,
FT                   5476260..5476401,5478701..5480169)
FT                   /codon_start=1
FT                   /gene="Lrrfip1"
FT                   /locus_tag="mCG_12874"
FT                   /product="leucine rich repeat (in FLII) interacting protein
FT                   1, isoform CRA_j"
FT                   /note="gene_id=mCG12874.2 transcript_id=mCT177893.0
FT                   protein_id=mCP100812.0 isoform=CRA_j"
FT                   /protein_id="EDL40071.1"
FT                   /translation="MTSPEGAQNKEIDCLSPEAQRLAEARLAAKRAARAEAREIRMKEL
FT                   ERQQKEVEERPDKDFAEKGSRNMPSLSAATLASLGGTSSRRGSGDTSISMDTEASIREI
FT                   KDSLAEVEEKYKKAMVSNAQLDNEKTNFMYQVDTLKDMLLELEEQLAESQRQYEEKNKE
FT                   FEREKHAHSILQFQFAEVKEALRQREEMLEKHGIILNSEIATNGETSDTVNDVGYQAPT
FT                   KITKEELNALKSAGEGTLGKAKEVEVKKEIVEKVGQRETLQNSEQEQPKPNTGKDCVDR
FT                   GVSHPGEKAENQRPAEDSALSPGPLAGAKCEQQVQSQDQENTSDLKNSEQIESHKVTNK
FT                   SDSRASNSPEQSSCLEGLDSEVPGPTEDLKTDLGKGSFEPCPDYILGQTAEIDKVTCTD
FT                   SRGTGGNQREDEVQAGDTTVEDQVGTVASGPAKQSKGTENHGESCLKDGLGQSSERELT
FT                   QEVAEPEEAIVQIPQAGGENTITKADDAEGRDEKPIQAEAQASPGAPINQSGHQDTTGP
FT                   GSTDAQRTPPHAKERKKQGKSEQQAEALDSPQKKTKNKKKKNKKKKAATPAETCRDANE
FT                   ELNCQDPDVGDMEEEERLQVTDKKQASGSPEQKIRAGSREPVEDPQSGSSGKQNKVEED
FT                   GPTEGPTDILDQNSPQCEDREISPVGEKGPQCDTSQIGSEEGHVTSQHGGQAVENHNLD
FT                   NSDLSGQLEGFNSESGGQAREEVGNSKNKEDCTMS"
FT   CDS             join(5432801..5432830,5464693..5464728,5465295..5465420,
FT                   5469213..5469383,5471374..5471466,5476260..5476401,
FT                   5478701..5480169)
FT                   /codon_start=1
FT                   /gene="Lrrfip1"
FT                   /locus_tag="mCG_12874"
FT                   /product="leucine rich repeat (in FLII) interacting protein
FT                   1, isoform CRA_b"
FT                   /note="gene_id=mCG12874.2 transcript_id=mCT177886.0
FT                   protein_id=mCP100816.0 isoform=CRA_b"
FT                   /protein_id="EDL40063.1"
FT                   /translation="MKELERQQKEVEERPDKDFAEKGSRNMPSLSAATLASLGGTSSRR
FT                   GSGDTSISMDTEASIREIKDSLAEVEEKYKKAMVSNAQLDNEKTNFMYQVDTLKDMLLE
FT                   LEEQLAESQRQYEEKNKEFEREKHAHSILQFQFAEVKEALRQREEMLEKHGIILNSEIA
FT                   TNGETSDTVNDVGYQAPTKITKEELNALKSAGEGTLGKAKEVEVKKEIVEKVGQRETLQ
FT                   NSEQEQPKPNTGKDCVDRGVSHPGEKAENQRPAEDSALSPGPLAGAKCEQQVQSQDQEN
FT                   TSDLKNSEQIESHKVTNKSDSRASNSPEQSSCLEGLDSEVPGPTEDLKTDLGKGSFEPC
FT                   PDYILGQTAEIDKVTCTDSRGTGGNQREDEVQAGDTTVEDQVGTVASGPAKQSKGTENH
FT                   GESCLKDGLGQSSERELTQEVAEPEEAIVQIPQAGGENTITKADDAEGRDEKPIQAEAQ
FT                   ASPGAPINQSGHQDTTGPGSTDAQRTPPHAKERKKQGKSEQQAEALDSPQKKTKNKKKK
FT                   NKKKKAATPAETCRDANEELNCQDPDVGDMEEEERLQVTDKKQASGSPEQKIRAGSREP
FT                   VEDPQSGSSGKQNKVEEDGPTEGPTDILDQNSPQCEDREISPVGEKGPQCDTSQIGSEE
FT                   GHVTSQHGGQAVENHNLDNSDLSGQLEGFNSESGGQAREEVGNSKNKEDCTMS"
FT   CDS             join(5441158..5441160,5442561..5442605,5443201..5443251,
FT                   5449123..5449182,5452799..5452876,5455766..5455831,
FT                   5457726..5457803,5464693..5464728,5465295..5465420,
FT                   5467355..5467426,5469213..5469383,5471374..5471466,
FT                   5472667..5472759,5474452..5474544,5476260..5476401,
FT                   5484246..5484295,5486548..5486665,5487204..5487283,
FT                   5489791..5489895,5492238..5492348)
FT                   /codon_start=1
FT                   /gene="Lrrfip1"
FT                   /locus_tag="mCG_12874"
FT                   /product="leucine rich repeat (in FLII) interacting protein
FT                   1, isoform CRA_h"
FT                   /note="gene_id=mCG12874.2 transcript_id=mCT177887.0
FT                   protein_id=mCP100814.0 isoform=CRA_h"
FT                   /protein_id="EDL40069.1"
FT                   /translation="MEDSERYSRRFRRNTSASDEDERLSVGSRGSLRTNGYDGDYCGSQ
FT                   SLSRRSGRGLSCSNLGLPSSGLASKPLSTQNGSRASMLDESSLYGARRGSACGSRAPSE
FT                   YGSHLNSSSRASSRASSARASPVVEERPDKDFAEKGSRNMPSLSAATLASLGGTSSRRG
FT                   SGDTSISMDTEASIREIKELNELKDQIQDVEGKYMQGLKEMKDSLAEVEEKYKKAMVSN
FT                   AQLDNEKTNFMYQVDTLKDMLLELEEQLAESQRQYEEKNKEFEREKHAHSILQFQFAEV
FT                   KEALRQREEMLEEIRQLQQKQAGFIREISDLQETIEWKDKKIGALERQKEFFDSIRSER
FT                   DDLREETVKLKEELKKHGIILNSEIATNGETSDTVNDVGYQAPTKITKEELNALKSAGE
FT                   GTLDVRLKKLIDERECLLEQIKKLKGQLEGRQKNNKLDLLRAEDGILENGTDAHVMDLQ
FT                   RDANRQISDLKFKLAKSEQEITALEQNVIRLESQVTRYRSAAENAEKIEDELKAEKRKL
FT                   QRELRSALDKTEELEVSNGHLVKRLEKMKANRSALLSQQ"
FT   assembly_gap    5485751..5485949
FT                   /estimated_length=199
FT                   /gap_type="unknown"
FT   assembly_gap    5496333..5497173
FT                   /estimated_length=841
FT                   /gap_type="unknown"
FT   assembly_gap    5497983..5498751
FT                   /estimated_length=769
FT                   /gap_type="unknown"
FT   assembly_gap    5502017..5502379
FT                   /estimated_length=363
FT                   /gap_type="unknown"
FT   assembly_gap    5502809..5503984
FT                   /estimated_length=1176
FT                   /gap_type="unknown"
FT   assembly_gap    5505541..5505560
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5506789..5506808
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(5530694..5531516)
FT                   /pseudo
FT                   /locus_tag="mCG_50047"
FT                   /note="gene_id=mCG50047.2"
FT   mRNA            complement(5530694..5531516)
FT                   /pseudo
FT                   /locus_tag="mCG_50047"
FT                   /note="gene_id=mCG50047.2 transcript_id=mCT50230.2 created
FT                   on 04-FEB-2003"
FT   gene            5539415..5582728
FT                   /gene="Ramp1"
FT                   /locus_tag="mCG_12872"
FT                   /note="gene_id=mCG12872.2"
FT   mRNA            join(5539415..5539516,5556137..5556275,5582078..5582728)
FT                   /gene="Ramp1"
FT                   /locus_tag="mCG_12872"
FT                   /product="receptor (calcitonin) activity modifying protein
FT                   1, transcript variant mCT13522"
FT                   /note="gene_id=mCG12872.2 transcript_id=mCT13522.2 created
FT                   on 31-DEC-2002"
FT   mRNA            join(5539453..5539516,5556137..5556275,5565729..5566197)
FT                   /gene="Ramp1"
FT                   /locus_tag="mCG_12872"
FT                   /product="receptor (calcitonin) activity modifying protein
FT                   1, transcript variant mCT177885"
FT                   /note="gene_id=mCG12872.2 transcript_id=mCT177885.0 created
FT                   on 31-DEC-2002"
FT   CDS             join(5539465..5539516,5556137..5556275,5582078..5582333)
FT                   /codon_start=1
FT                   /gene="Ramp1"
FT                   /locus_tag="mCG_12872"
FT                   /product="receptor (calcitonin) activity modifying protein
FT                   1, isoform CRA_a"
FT                   /note="gene_id=mCG12872.2 transcript_id=mCT13522.2
FT                   protein_id=mCP21017.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q3TNJ3"
FT                   /db_xref="InterPro:IPR006985"
FT                   /db_xref="MGI:MGI:1858418"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TNJ3"
FT                   /protein_id="EDL40060.1"
FT                   /translation="MAPGLRGLPRCGLWLLLAHHLFMVTACRDPDYGTLIQELCLSRFK
FT                   ENMETIGKTLWCDWGKTIQSYGELTYCTKHVAHTIGCFWPNPEVDRFFIAVHHRYFSKC
FT                   PISGRALRDPPNSILCPFIALPITVTLLMTALVVWRSKRTEGIV"
FT   CDS             join(5556151..5556275,5565729..5565849)
FT                   /codon_start=1
FT                   /gene="Ramp1"
FT                   /locus_tag="mCG_12872"
FT                   /product="receptor (calcitonin) activity modifying protein
FT                   1, isoform CRA_b"
FT                   /note="gene_id=mCG12872.2 transcript_id=mCT177885.0
FT                   protein_id=mCP100807.0 isoform=CRA_b"
FT                   /protein_id="EDL40061.1"
FT                   /translation="MVTACRDPDYGTLIQELCLSRFKENMETIGKTLWCDWGKTIQDLH
FT                   AHSRSVLGLPRCDLVLSRLPPNSHHRISLASASGDA"
FT   assembly_gap    5572371..5572390
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5573491..5573854
FT                   /estimated_length=364
FT                   /gap_type="unknown"
FT   assembly_gap    5588097..5588180
FT                   /estimated_length=84
FT                   /gap_type="unknown"
FT   assembly_gap    5608357..5608376
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            5609205..5645033
FT                   /locus_tag="mCG_12870"
FT                   /note="gene_id=mCG12870.2"
FT   mRNA            join(5609205..5609332,5612654..5612721,5613154..5613287,
FT                   5621117..5621146,5624067..5624132,5633741..5633808,
FT                   5634900..5634970,5636774..5636831,5638018..5638050,
FT                   5642460..5642522,5643818..5645033)
FT                   /locus_tag="mCG_12870"
FT                   /product="mCG12870, transcript variant mCT13520"
FT                   /note="gene_id=mCG12870.2 transcript_id=mCT13520.1 created
FT                   on 31-DEC-2002"
FT   mRNA            join(5609225..5609332,5613157..5613287,5624067..5624132,
FT                   5633741..5633808,5634900..5634970,5636774..5636831,
FT                   5638018..5638050,5642460..5642522,5643818..5645033)
FT                   /locus_tag="mCG_12870"
FT                   /product="mCG12870, transcript variant mCT177883"
FT                   /note="gene_id=mCG12870.2 transcript_id=mCT177883.0 created
FT                   on 31-DEC-2002"
FT   mRNA            join(<5609258..5609332,5613109..5613287,5621117..5621146,
FT                   5624067..5624132,5633741..5633808,5634900..5634970,
FT                   5636774..5636831,5638018..5638050,5642460..5642522,
FT                   5643818..5643961)
FT                   /locus_tag="mCG_12870"
FT                   /product="mCG12870, transcript variant mCT193791"
FT                   /note="gene_id=mCG12870.2 transcript_id=mCT193791.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(<5609266..5609332,5613157..5613287,5621117..5621146,
FT                   5624067..5624132,5633741..5633808,5634900..5634970,
FT                   5636774..5636831,5638018..5638050,5642460..5642522,
FT                   5643818..5644041)
FT                   /locus_tag="mCG_12870"
FT                   /product="mCG12870, transcript variant mCT193790"
FT                   /note="gene_id=mCG12870.2 transcript_id=mCT193790.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<5609319..5609332,5613157..5613287,5621117..5621146,
FT                   5624067..5624132,5633741..5633808,5634900..5634970,
FT                   5636774..5636831,5638018..5638050,5642460..5642522,
FT                   5643818..5643868)
FT                   /codon_start=1
FT                   /locus_tag="mCG_12870"
FT                   /product="mCG12870, isoform CRA_c"
FT                   /note="gene_id=mCG12870.2 transcript_id=mCT193790.0
FT                   protein_id=mCP114734.0 isoform=CRA_c"
FT                   /protein_id="EDL40058.1"
FT                   /translation="LAVLRKVAGMLTLASKLKRDDGLKGSRTSASTSDSTRRVSVRDKL
FT                   LVKEVAELEANLPCTCKVHFPDPNKLHCFQLTVSPDEGYYQGGKFQFETEVPDAYNMVP
FT                   PKVKCLTKIWHPNITETGEICLSLLREHSIDGTGWAPTRTLKDVVWGLNSLFTDLLNFD
FT                   DPLNIEAAEHHLRDKEDFRDKVDEYIKRYAR"
FT   mRNA            join(5609461..5609748,5612654..5612721,5613109..5613287,
FT                   5621117..5621146,5624067..5624132,5633741..5633808,
FT                   5634900..5634970,5636774..5636831,5638018..5638050,
FT                   5642460..5642522,5643818..5644436)
FT                   /locus_tag="mCG_12870"
FT                   /product="mCG12870, transcript variant mCT177884"
FT                   /note="gene_id=mCG12870.2 transcript_id=mCT177884.0 created
FT                   on 31-DEC-2002"
FT   CDS             join(<5613131..5613287,5621117..5621146,5624067..5624132,
FT                   5633741..5633808,5634900..5634970,5636774..5636831,
FT                   5638018..5638050,5642460..5642522,5643818..5643868)
FT                   /codon_start=1
FT                   /locus_tag="mCG_12870"
FT                   /product="mCG12870, isoform CRA_d"
FT                   /note="gene_id=mCG12870.2 transcript_id=mCT193791.0
FT                   protein_id=mCP114735.0 isoform=CRA_d"
FT                   /protein_id="EDL40059.1"
FT                   /translation="PCSCLSSRRKVAGMLTLASKLKRDDGLKGSRTSASTSDSTRRVSV
FT                   RDKLLVKEVAELEANLPCTCKVHFPDPNKLHCFQLTVSPDEGYYQGGKFQFETEVPDAY
FT                   NMVPPKVKCLTKIWHPNITETGEICLSLLREHSIDGTGWAPTRTLKDVVWGLNSLFTDL
FT                   LNFDDPLNIEAAEHHLRDKEDFRDKVDEYIKRYAR"
FT   CDS             join(5613170..5613287,5621117..5621146,5624067..5624132,
FT                   5633741..5633808,5634900..5634970,5636774..5636831,
FT                   5638018..5638050,5642460..5642522,5643818..5643868)
FT                   /codon_start=1
FT                   /locus_tag="mCG_12870"
FT                   /product="mCG12870, isoform CRA_a"
FT                   /note="gene_id=mCG12870.2 transcript_id=mCT13520.1
FT                   protein_id=mCP21015.1 isoform=CRA_a"
FT                   /protein_id="EDL40055.1"
FT                   /translation="MLTLASKLKRDDGLKGSRTSASTSDSTRRVSVRDKLLVKEVAELE
FT                   ANLPCTCKVHFPDPNKLHCFQLTVSPDEGYYQGGKFQFETEVPDAYNMVPPKVKCLTKI
FT                   WHPNITETGEICLSLLREHSIDGTGWAPTRTLKDVVWGLNSLFTDLLNFDDPLNIEAAE
FT                   HHLRDKEDFRDKVDEYIKRYAR"
FT   CDS             join(5613170..5613287,5621117..5621146,5624067..5624132,
FT                   5633741..5633808,5634900..5634970,5636774..5636831,
FT                   5638018..5638050,5642460..5642522,5643818..5643868)
FT                   /codon_start=1
FT                   /locus_tag="mCG_12870"
FT                   /product="mCG12870, isoform CRA_a"
FT                   /note="gene_id=mCG12870.2 transcript_id=mCT177884.0
FT                   protein_id=mCP100806.0 isoform=CRA_a"
FT                   /protein_id="EDL40057.1"
FT                   /translation="MLTLASKLKRDDGLKGSRTSASTSDSTRRVSVRDKLLVKEVAELE
FT                   ANLPCTCKVHFPDPNKLHCFQLTVSPDEGYYQGGKFQFETEVPDAYNMVPPKVKCLTKI
FT                   WHPNITETGEICLSLLREHSIDGTGWAPTRTLKDVVWGLNSLFTDLLNFDDPLNIEAAE
FT                   HHLRDKEDFRDKVDEYIKRYAR"
FT   CDS             join(5613170..5613287,5624067..5624132,5633741..5633808,
FT                   5634900..5634970,5636774..5636831,5638018..5638050,
FT                   5642460..5642522,5643818..5643868)
FT                   /codon_start=1
FT                   /locus_tag="mCG_12870"
FT                   /product="mCG12870, isoform CRA_b"
FT                   /note="gene_id=mCG12870.2 transcript_id=mCT177883.0
FT                   protein_id=mCP100805.0 isoform=CRA_b"
FT                   /protein_id="EDL40056.1"
FT                   /translation="MLTLASKLKRDDGLKGSRTSASTSDSTRRVSVRDKLLVKGTCKVH
FT                   FPDPNKLHCFQLTVSPDEGYYQGGKFQFETEVPDAYNMVPPKVKCLTKIWHPNITETGE
FT                   ICLSLLREHSIDGTGWAPTRTLKDVVWGLNSLFTDLLNFDDPLNIEAAEHHLRDKEDFR
FT                   DKVDEYIKRYAR"
FT   gene            5654527..5656090
FT                   /pseudo
FT                   /locus_tag="mCG_1047360"
FT                   /note="gene_id=mCG1047360.1"
FT   mRNA            5654527..5656090
FT                   /pseudo
FT                   /locus_tag="mCG_1047360"
FT                   /note="gene_id=mCG1047360.1 transcript_id=mCT165064.1
FT                   created on 14-FEB-2003"
FT   gene            5656887..5679602
FT                   /gene="Scly"
FT                   /locus_tag="mCG_12868"
FT                   /note="gene_id=mCG12868.2"
FT   mRNA            join(5656887..5656976,5659051..5659163,5661292..5661392,
FT                   5662960..5662991,5663797..5663977,5666837..5666964,
FT                   5667174..5667338,5668320..5668426,5674014..5674050,
FT                   5675589..5675672,5676125..5676224,5677571..5677646,
FT                   5678610..5679602)
FT                   /gene="Scly"
FT                   /locus_tag="mCG_12868"
FT                   /product="selenocysteine lyase, transcript variant
FT                   mCT177877"
FT                   /note="gene_id=mCG12868.2 transcript_id=mCT177877.0 created
FT                   on 31-DEC-2002"
FT   mRNA            join(5656912..5656976,5657587..5657719,5669843..5670301)
FT                   /gene="Scly"
FT                   /locus_tag="mCG_12868"
FT                   /product="selenocysteine lyase, transcript variant
FT                   mCT177879"
FT                   /note="gene_id=mCG12868.2 transcript_id=mCT177879.0 created
FT                   on 31-DEC-2002"
FT   mRNA            join(5656914..5656976,5659051..5659163,5661292..5661392,
FT                   5663797..5663977,5666837..5666964,5667174..5667338,
FT                   5668320..5668426,5674014..5674050,5675589..5675672,
FT                   5676125..5676224,5677571..5677646,5678610..5679595)
FT                   /gene="Scly"
FT                   /locus_tag="mCG_12868"
FT                   /product="selenocysteine lyase, transcript variant
FT                   mCT13518"
FT                   /note="gene_id=mCG12868.2 transcript_id=mCT13518.1 created
FT                   on 31-DEC-2002"
FT   CDS             join(5656924..5656976,5659051..5659163,5661292..5661392,
FT                   5663797..5663977,5666837..5666964,5667174..5667338,
FT                   5668320..5668426,5674014..5674050,5675589..5675672,
FT                   5676125..5676224,5677571..5677646,5678610..5678763)
FT                   /codon_start=1
FT                   /gene="Scly"
FT                   /locus_tag="mCG_12868"
FT                   /product="selenocysteine lyase, isoform CRA_a"
FT                   /note="gene_id=mCG12868.2 transcript_id=mCT13518.1
FT                   protein_id=mCP21012.2 isoform=CRA_a"
FT                   /protein_id="EDL40050.1"
FT                   /translation="MDAARNGALGSVESLPDRKVYMDYNATTPLEPEVIQAVTEAMKEA
FT                   WGNPSSSYVSGRKAKDIINAARASLAKMIGGKPQDIIFTSGGTESNNLVIHSMVRCFHE
FT                   QQTLKGNMVDQHSPEEGTRPHFITCTVEHDSIRLPLEHLVENQMAEVTFVPVSKVNGQA
FT                   EVEDILAAVRPTTCLVTIMLANNETGVIMPVSEISRRIKALNQIRAASGLPRVLVHTDA
FT                   AQALGKRRVDVEDLGVDFLTIVGHKFYGPRIGALYVRGVGKLTPLYPMLFGGGQERNFR
FT                   PGTENTPMIAGLGKAADLVSENCETYEAHMRDIRDYLEERLEAEFGKRIHLNSRFPGVE
FT                   RLPNTCNFSIQGSQLQGYTVLAQCRTLLASVGASCHSNHEDRPSPVLLSCGIPVDVARN
FT                   AVRLSVGRGTTRADVDLIVQDLKQAVAQLEGRL"
FT   CDS             join(5656924..5656976,5657587..5657713)
FT                   /codon_start=1
FT                   /gene="Scly"
FT                   /locus_tag="mCG_12868"
FT                   /product="selenocysteine lyase, isoform CRA_d"
FT                   /note="gene_id=mCG12868.2 transcript_id=mCT177879.0
FT                   protein_id=mCP100800.0 isoform=CRA_d"
FT                   /protein_id="EDL40054.1"
FT                   /translation="MDAARNGALGSVESLPDSPIRPRYVVQATPAFSDMVELAYNPNTE
FT                   DRRIVIWRPAWITQ"
FT   mRNA            join(5656952..5656976,5657926..5657991,5659051..5659163,
FT                   5661292..5661392,5663797..5663977,5666837..5666964,
FT                   5667174..5667338,5668320..5668426,5674014..5674050,
FT                   5675589..5675672,5676125..5676224,5677571..5677646,
FT                   5678610..5679602)
FT                   /gene="Scly"
FT                   /locus_tag="mCG_12868"
FT                   /product="selenocysteine lyase, transcript variant
FT                   mCT177880"
FT                   /note="gene_id=mCG12868.2 transcript_id=mCT177880.0 created
FT                   on 31-DEC-2002"
FT   mRNA            join(5658447..5658543,5659051..5659163,5661292..5661392,
FT                   5663797..5663977,5666837..5666964,5667174..5667338,
FT                   5668320..5668426,5674014..5674050,5675589..5675672,
FT                   5676125..5676224,5677571..5677646,5678610..5679266)
FT                   /gene="Scly"
FT                   /locus_tag="mCG_12868"
FT                   /product="selenocysteine lyase, transcript variant
FT                   mCT177878"
FT                   /note="gene_id=mCG12868.2 transcript_id=mCT177878.0 created
FT                   on 31-DEC-2002"
FT   CDS             join(5659061..5659163,5661292..5661392,5663797..5663977,
FT                   5666837..5666964,5667174..5667338,5668320..5668426,
FT                   5674014..5674050,5675589..5675672,5676125..5676224,
FT                   5677571..5677646,5678610..5678763)
FT                   /codon_start=1
FT                   /gene="Scly"
FT                   /locus_tag="mCG_12868"
FT                   /product="selenocysteine lyase, isoform CRA_b"
FT                   /note="gene_id=mCG12868.2 transcript_id=mCT177878.0
FT                   protein_id=mCP100802.0 isoform=CRA_b"
FT                   /protein_id="EDL40051.1"
FT                   /translation="MDYNATTPLEPEVIQAVTEAMKEAWGNPSSSYVSGRKAKDIINAA
FT                   RASLAKMIGGKPQDIIFTSGGTESNNLVIHSMVRCFHEQQTLKGNMVDQHSPEEGTRPH
FT                   FITCTVEHDSIRLPLEHLVENQMAEVTFVPVSKVNGQAEVEDILAAVRPTTCLVTIMLA
FT                   NNETGVIMPVSEISRRIKALNQIRAASGLPRVLVHTDAAQALGKRRVDVEDLGVDFLTI
FT                   VGHKFYGPRIGALYVRGVGKLTPLYPMLFGGGQERNFRPGTENTPMIAGLGKAADLVSE
FT                   NCETYEAHMRDIRDYLEERLEAEFGKRIHLNSRFPGVERLPNTCNFSIQGSQLQGYTVL
FT                   AQCRTLLASVGASCHSNHEDRPSPVLLSCGIPVDVARNAVRLSVGRGTTRADVDLIVQD
FT                   LKQAVAQLEGRL"
FT   CDS             join(5659061..5659163,5661292..5661392,5663797..5663977,
FT                   5666837..5666964,5667174..5667338,5668320..5668426,
FT                   5674014..5674050,5675589..5675672,5676125..5676224,
FT                   5677571..5677646,5678610..5678763)
FT                   /codon_start=1
FT                   /gene="Scly"
FT                   /locus_tag="mCG_12868"
FT                   /product="selenocysteine lyase, isoform CRA_b"
FT                   /note="gene_id=mCG12868.2 transcript_id=mCT177880.0
FT                   protein_id=mCP100801.0 isoform=CRA_b"
FT                   /protein_id="EDL40052.1"
FT                   /translation="MDYNATTPLEPEVIQAVTEAMKEAWGNPSSSYVSGRKAKDIINAA
FT                   RASLAKMIGGKPQDIIFTSGGTESNNLVIHSMVRCFHEQQTLKGNMVDQHSPEEGTRPH
FT                   FITCTVEHDSIRLPLEHLVENQMAEVTFVPVSKVNGQAEVEDILAAVRPTTCLVTIMLA
FT                   NNETGVIMPVSEISRRIKALNQIRAASGLPRVLVHTDAAQALGKRRVDVEDLGVDFLTI
FT                   VGHKFYGPRIGALYVRGVGKLTPLYPMLFGGGQERNFRPGTENTPMIAGLGKAADLVSE
FT                   NCETYEAHMRDIRDYLEERLEAEFGKRIHLNSRFPGVERLPNTCNFSIQGSQLQGYTVL
FT                   AQCRTLLASVGASCHSNHEDRPSPVLLSCGIPVDVARNAVRLSVGRGTTRADVDLIVQD
FT                   LKQAVAQLEGRL"
FT   CDS             join(5663821..5663977,5666837..5666964,5667174..5667338,
FT                   5668320..5668426,5674014..5674050,5675589..5675672,
FT                   5676125..5676224,5677571..5677646,5678610..5678763)
FT                   /codon_start=1
FT                   /gene="Scly"
FT                   /locus_tag="mCG_12868"
FT                   /product="selenocysteine lyase, isoform CRA_c"
FT                   /note="gene_id=mCG12868.2 transcript_id=mCT177877.0
FT                   protein_id=mCP100799.0 isoform=CRA_c"
FT                   /protein_id="EDL40053.1"
FT                   /translation="MVRCFHEQQTLKGNMVDQHSPEEGTRPHFITCTVEHDSIRLPLEH
FT                   LVENQMAEVTFVPVSKVNGQAEVEDILAAVRPTTCLVTIMLANNETGVIMPVSEISRRI
FT                   KALNQIRAASGLPRVLVHTDAAQALGKRRVDVEDLGVDFLTIVGHKFYGPRIGALYVRG
FT                   VGKLTPLYPMLFGGGQERNFRPGTENTPMIAGLGKAADLVSENCETYEAHMRDIRDYLE
FT                   ERLEAEFGKRIHLNSRFPGVERLPNTCNFSIQGSQLQGYTVLAQCRTLLASVGASCHSN
FT                   HEDRPSPVLLSCGIPVDVARNAVRLSVGRGTTRADVDLIVQDLKQAVAQLEGRL"
FT   gene            <5680670..5704582
FT                   /locus_tag="mCG_12882"
FT                   /note="gene_id=mCG12882.2"
FT   mRNA            join(<5680670..5680963,5682016..5682206,5683573..5683759,
FT                   5685995..5686177,5693220..5693351,5703597..5704582)
FT                   /locus_tag="mCG_12882"
FT                   /product="mCG12882"
FT                   /note="gene_id=mCG12882.2 transcript_id=mCT13532.2 created
FT                   on 04-FEB-2003"
FT   CDS             join(5680670..5680963,5682016..5682206,5683573..5683759,
FT                   5685995..5686177,5693220..5693351,5703597..5704493)
FT                   /codon_start=1
FT                   /locus_tag="mCG_12882"
FT                   /product="mCG12882"
FT                   /note="gene_id=mCG12882.2 transcript_id=mCT13532.2
FT                   protein_id=mCP20976.2"
FT                   /protein_id="EDL40049.1"
FT                   /translation="MEAQQALVASKDGDMATLERLFEAGALRPDITDDLGAGLVHHATR
FT                   AGHLDCVKFLVQRAKLPGNQQAHNGATPVHDAAATGNLAELCWLVRDAGCGLQDQDASG
FT                   VSPLHLAARFGHPALVEWLLREGHAATLETLEGALPLHHAAVSGDLTCLKLLTAAHSSG
FT                   VNQRTCSGASPLYLACQEGHLHLAQFLVKDCGADVRLRALDGMSSLHAAAAHGHYSLVV
FT                   WLVTFTDIGLTARDNEGATALHFAARGGHTPILDRLLLMGAPIMRDSWGGTPLHDAAEN
FT                   GHMECCQTLLSHHVDPFLRDEDGYTAIDLAEYHGHQDCAQFLREMSRPEASDSGISCEE
FT                   APSEAGAGPGLDLASLRKERIVMLFLGHWKKSAYTPALRTAACRTLEAQRARSRGPEAA
FT                   GSPRPSSPQPSDGPRLGHLWQQRGIITHLLGTWKAIMAHVPARQLRRLSRRERGPLSPE
FT                   QFLPHVDGAPVPYNSLSLDLFMLGYFQLLECDLPAEERKMRHLLCFEVFEHLGAHGWEA
FT                   VRAFHKAVTDEVAAGRRAWTDGFEDIKARFFGSSQGPPWDVEPGRKLGLTPLGSLPHAS
FT                   LPGSGPEPAVPPRLGSDSQGSSFNSGDICGYIDRSFAFWKEKEAEMFNFGE"
FT   assembly_gap    5684278..5684297
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5690481..5690500
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5696863..5697107
FT                   /estimated_length=245
FT                   /gap_type="unknown"
FT   gene            5709646..5720983
FT                   /gene="4631423F02Rik"
FT                   /locus_tag="mCG_12885"
FT                   /note="gene_id=mCG12885.1"
FT   mRNA            join(5709646..5709695,5712180..5713026,5714026..5714161,
FT                   5715908..5715994,5716329..5716484,5717362..5717550,
FT                   5717910..5718055,5719585..5720983)
FT                   /gene="4631423F02Rik"
FT                   /locus_tag="mCG_12885"
FT                   /product="RIKEN cDNA 4631423F02"
FT                   /note="gene_id=mCG12885.1 transcript_id=mCT13535.1 created
FT                   on 04-FEB-2003"
FT   assembly_gap    5710551..5710915
FT                   /estimated_length=365
FT                   /gap_type="unknown"
FT   CDS             join(5712253..5713026,5714026..5714161,5715908..5715994,
FT                   5716329..5716484,5717362..5717550,5717910..5718055,
FT                   5719585..5719842)
FT                   /codon_start=1
FT                   /gene="4631423F02Rik"
FT                   /locus_tag="mCG_12885"
FT                   /product="RIKEN cDNA 4631423F02"
FT                   /note="gene_id=mCG12885.1 transcript_id=mCT13535.1
FT                   protein_id=mCP20980.2"
FT                   /protein_id="EDL40048.1"
FT                   /translation="MVRNLDDLDFHLPSHAQDMLEGLQRLRSLPKLADVTLLVGDQELP
FT                   CHRSLLALNSPYFHAMFAGDFTESFLARVELRDVEPAMVGQLVDFVYTGRLTITQANVE
FT                   ALTRSASRLNFPTVQKVCGRYLQQQLDATNCLGICEFGEQQGLLGVAAKAWAFLRENFE
FT                   AVAQEDEFLQLARDRLATCLASDLLQVQPEQSRLEALLRWVRHDPQDRAAHLPELLSLV
FT                   HLDAVPRPCVQQLLATEPLIQESEACQEALSQGHSEELPGLPQKMQEVLVVVGGRALEE
FT                   DEDGGEEPSHHTGNFAFYNTKARQWMALPDFPDYHKWGFSLAALNSDVYVTGGSRGTKT
FT                   DTWSTTQAWCFPLKEAIWKPVAPMLKARTNHASTALNGEIYAIGGTALDAVEVERYDPY
FT                   TDSWAPVGPAPKYVSNFSAAGCQGRLYLVGSSACKYNMLALQCYSPVTDAWSVIASPFL
FT                   PKYLSSPRCAALNGALYLIGDNTKKVYVYDPGANLWQKVQSQHSLHENGALVPLGDLLY
FT                   VTGGRWQGMDGDYHVEMEAYDTVRDAWARHGSLPRLWLYHGASTIFLDVSKWTQPFIPT
FT                   APQEH"
FT   gene            5725035..5732782
FT                   /gene="BC056923"
FT                   /locus_tag="mCG_52284"
FT                   /note="gene_id=mCG52284.1"
FT   mRNA            join(5725035..5725224,5726941..5727057,5727947..5728049,
FT                   5728662..5728918,5728991..5729099,5729201..5729291,
FT                   5729958..5730036,5730947..5732782)
FT                   /gene="BC056923"
FT                   /locus_tag="mCG_52284"
FT                   /product="cDNA sequence BC056923"
FT                   /note="gene_id=mCG52284.1 transcript_id=mCT52467.2 created
FT                   on 13-FEB-2003"
FT   CDS             join(5725057..5725224,5726941..5727057,5727947..5728049,
FT                   5728662..5728918,5728991..5729099,5729201..5729291,
FT                   5729958..5730036,5730947..5731045)
FT                   /codon_start=1
FT                   /gene="BC056923"
FT                   /locus_tag="mCG_52284"
FT                   /product="cDNA sequence BC056923"
FT                   /note="gene_id=mCG52284.1 transcript_id=mCT52467.2
FT                   protein_id=mCP41048.1"
FT                   /db_xref="GOA:Q6PGN1"
FT                   /db_xref="InterPro:IPR001073"
FT                   /db_xref="InterPro:IPR008983"
FT                   /db_xref="MGI:MGI:3606476"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6PGN1"
FT                   /protein_id="EDL40047.1"
FT                   /translation="MASTRRPVGARTLLACASLLAAMGLGVPESAEPVGTHARPQPPGA
FT                   ELPAPPANSPPEPTIAHAHSVDPRDAWMLFVKQSDKGINSKRRSKARRLKLGLPGPPGP
FT                   PGPQGPPGPFIPSEVLLKEFQLLLKGAVRQRESHLEHCTRDLTTPASGSPSRVPAAQEL
FT                   DSQDPGALLALLAATLAQGPRAPRVEAAFHCRLRRDVQVDRRALHELGIYYLPEVEGAF
FT                   HRGPGLNLTSGQYTAPVAGFYALAATLHVALTEQPRKGPTRPRDRLRLLICIQSLCQHN
FT                   ASLETVMGLENSSELFTISVNGVLYLQAGHYTSVFLDNASGSSLTVRSGSHFSAILLGL
FT                   "
FT   gene            complement(5732431..5757298)
FT                   /gene="Ilkap"
FT                   /locus_tag="mCG_12875"
FT                   /note="gene_id=mCG12875.2"
FT   mRNA            complement(join(5732431..5732585,5734624..5734651,
FT                   5734887..5734968,5737016..5737135,5740429..5740550,
FT                   5741882..5741969,5743143..5743236,5743818..5743924,
FT                   5745793..5745919,5746923..5747042,5749184..5749240,
FT                   5749709..5749774,5757216..5757298))
FT                   /gene="Ilkap"
FT                   /locus_tag="mCG_12875"
FT                   /product="integrin-linked kinase-associated
FT                   serine/threonine phosphatase 2C, transcript variant
FT                   mCT179511"
FT                   /note="gene_id=mCG12875.2 transcript_id=mCT179511.0 created
FT                   on 03-FEB-2003"
FT   mRNA            complement(join(5732431..5734107,5734887..5734968,
FT                   5737016..5737135,5740429..5740550,5741882..5741969,
FT                   5743143..5743236,5743818..5743924,5745793..5745919,
FT                   5746933..5747024,5749184..5749240,5749709..5749774,
FT                   5757216..>5757265))
FT                   /gene="Ilkap"
FT                   /locus_tag="mCG_12875"
FT                   /product="integrin-linked kinase-associated
FT                   serine/threonine phosphatase 2C, transcript variant
FT                   mCT193800"
FT                   /note="gene_id=mCG12875.2 transcript_id=mCT193800.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(5732560..5732585,5734624..5734651,
FT                   5734887..5734968,5737016..5737135,5740429..5740550,
FT                   5741882..5741969,5743143..5743236,5743818..5743924,
FT                   5745793..5745919,5746923..5747042,5749184..5749240,
FT                   5749709..5749774,5757216..5757270))
FT                   /codon_start=1
FT                   /gene="Ilkap"
FT                   /locus_tag="mCG_12875"
FT                   /product="integrin-linked kinase-associated
FT                   serine/threonine phosphatase 2C, isoform CRA_e"
FT                   /note="gene_id=mCG12875.2 transcript_id=mCT179511.0
FT                   protein_id=mCP102432.0 isoform=CRA_e"
FT                   /protein_id="EDL40040.1"
FT                   /translation="MDLFGDLPEPERAPRPSAGKEAQGRPVLFEDLPPASSTDSGSGGP
FT                   LLFDDLPPAASGNSGSLATSGSQVVKTEGKGAKRKAPEEEKNGGEELVEKKVCKASSVI
FT                   FGLKGYVAERKGEREEMQDAHVILNDITQECNPPSSLITRVSYFAVFDGHGGIRASKFA
FT                   AQNLHQNLIRKFPKGDIISVEKTVKRCLLDTFKHTDEEFLKQASSQKPAWKDGSTATCV
FT                   LAVDNILYIANLGDSRAILCRYNEESQKHAALSLSKEHNPTQYEERMRIQKAGGNVRDG
FT                   RVLGVLEVSRSIGDGQYKRCGVTSVPDIRRCQLTPNDRFILLACDGLFKVFTPEEAVNF
FT                   ILSCLEDDKIQTREGKLTPHGLW"
FT   CDS             complement(join(5733976..5734107,5734887..5734968,
FT                   5737016..5737135,5740429..5740550,5741882..5741969,
FT                   5743143..5743236,5743818..5743924,5745793..5745919,
FT                   5746933..>5746951))
FT                   /codon_start=1
FT                   /gene="Ilkap"
FT                   /locus_tag="mCG_12875"
FT                   /product="integrin-linked kinase-associated
FT                   serine/threonine phosphatase 2C, isoform CRA_g"
FT                   /note="gene_id=mCG12875.2 transcript_id=mCT193800.0
FT                   protein_id=mCP114736.0 isoform=CRA_g"
FT                   /protein_id="EDL40042.1"
FT                   /translation="RACGKETSSVIFGLKGYVAERKGEREEMQDAHVILNDITQECNPP
FT                   SSLITRVSYFAVFDGHGGIRASKFAAQNLHQNLIRKFPKGDIISVEKTVKRCLLDTFKH
FT                   TDEEFLKQASSQKPAWKDGSTATCVLAVDNILYIANLGDSRAILCRYNEESQKHAALSL
FT                   SKEHNPTQYEERMRIQKAGGNVRDGRVLGVLEVSRSIGDGQYKRCGVTSVPDIRRCQLT
FT                   PNDRFILLACDGLFKVFTPEEAVNFILSCLEVPRQLHSSRSCFPEVSPERMTVVLAYTQ
FT                   LSISGVLGSLPEWMV"
FT   mRNA            complement(join(5734400..5734651,5734887..5734968,
FT                   5737016..5737135,5740429..5740472,5749709..5749774,
FT                   5757216..5757298))
FT                   /gene="Ilkap"
FT                   /locus_tag="mCG_12875"
FT                   /product="integrin-linked kinase-associated
FT                   serine/threonine phosphatase 2C, transcript variant
FT                   mCT179508"
FT                   /note="gene_id=mCG12875.2 transcript_id=mCT179508.0 created
FT                   on 03-FEB-2003"
FT   mRNA            complement(join(5734400..5734651,5734887..5734968,
FT                   5749184..5749240,5749709..5749774,5757216..5757298))
FT                   /gene="Ilkap"
FT                   /locus_tag="mCG_12875"
FT                   /product="integrin-linked kinase-associated
FT                   serine/threonine phosphatase 2C, transcript variant
FT                   mCT179512"
FT                   /note="gene_id=mCG12875.2 transcript_id=mCT179512.0 created
FT                   on 03-FEB-2003"
FT   mRNA            complement(join(5734401..5734651,5734887..5734968,
FT                   5737016..5737135,5740429..5740550,5741882..5741969,
FT                   5743143..5743236,5743818..5743924,5745793..5745919,
FT                   5746923..5747042,5749184..5749240,5757216..5757298))
FT                   /gene="Ilkap"
FT                   /locus_tag="mCG_12875"
FT                   /product="integrin-linked kinase-associated
FT                   serine/threonine phosphatase 2C, transcript variant
FT                   mCT179509"
FT                   /note="gene_id=mCG12875.2 transcript_id=mCT179509.0 created
FT                   on 03-FEB-2003"
FT   mRNA            complement(join(5734401..5734651,5734887..5734968,
FT                   5737016..5737135,5740429..5740550,5741882..5741969,
FT                   5743143..5743236,5743818..5743924,5745793..5745919,
FT                   5746923..5747042,5749184..5749240,5749709..5749774,
FT                   5757216..5757298))
FT                   /gene="Ilkap"
FT                   /locus_tag="mCG_12875"
FT                   /product="integrin-linked kinase-associated
FT                   serine/threonine phosphatase 2C, transcript variant
FT                   mCT13526"
FT                   /note="gene_id=mCG12875.2 transcript_id=mCT13526.2 created
FT                   on 03-FEB-2003"
FT   mRNA            complement(join(5734401..5734651,5734887..5734968,
FT                   5737016..5737135,5740429..5740550,5741882..5741969,
FT                   5743143..5743236,5743818..5743924,5745793..5747042,
FT                   5749184..5749240,5749709..5749774,5757216..5757298))
FT                   /gene="Ilkap"
FT                   /locus_tag="mCG_12875"
FT                   /product="integrin-linked kinase-associated
FT                   serine/threonine phosphatase 2C, transcript variant
FT                   mCT179505"
FT                   /note="gene_id=mCG12875.2 transcript_id=mCT179505.0 created
FT                   on 03-FEB-2003"
FT   CDS             complement(join(5734511..5734651,5734887..5734968,
FT                   5737016..5737135,5740429..5740550,5741882..5741969,
FT                   5743143..5743236,5743818..5743924,5745793..5745919,
FT                   5746923..5747042,5749184..5749240,5757216..5757270))
FT                   /codon_start=1
FT                   /gene="Ilkap"
FT                   /locus_tag="mCG_12875"
FT                   /product="integrin-linked kinase-associated
FT                   serine/threonine phosphatase 2C, isoform CRA_d"
FT                   /note="gene_id=mCG12875.2 transcript_id=mCT179509.0
FT                   protein_id=mCP102434.0 isoform=CRA_d"
FT                   /protein_id="EDL40039.1"
FT                   /translation="MDLFGDLPEPERAPRPSAGSGGPLLFDDLPPAASGNSGSLATSGS
FT                   QVVKTEGKGAKRKAPEEEKNGGEELVEKKVCKASSVIFGLKGYVAERKGEREEMQDAHV
FT                   ILNDITQECNPPSSLITRVSYFAVFDGHGGIRASKFAAQNLHQNLIRKFPKGDIISVEK
FT                   TVKRCLLDTFKHTDEEFLKQASSQKPAWKDGSTATCVLAVDNILYIANLGDSRAILCRY
FT                   NEESQKHAALSLSKEHNPTQYEERMRIQKAGGNVRDGRVLGVLEVSRSIGDGQYKRCGV
FT                   TSVPDIRRCQLTPNDRFILLACDGLFKVFTPEEAVNFILSCLEDDKIQTREGKPAVDAR
FT                   YEAACNRLANKAVQRGSADNVTVMVVRIGH"
FT   CDS             complement(join(5734511..5734651,5734887..5734968,
FT                   5737016..5737135,5740429..5740550,5741882..5741969,
FT                   5743143..5743236,5743818..5743924,5745793..5745919,
FT                   5746923..5747042,5749184..5749240,5749709..5749774,
FT                   5757216..5757270))
FT                   /codon_start=1
FT                   /gene="Ilkap"
FT                   /locus_tag="mCG_12875"
FT                   /product="integrin-linked kinase-associated
FT                   serine/threonine phosphatase 2C, isoform CRA_a"
FT                   /note="gene_id=mCG12875.2 transcript_id=mCT13526.2
FT                   protein_id=mCP20960.2 isoform=CRA_a"
FT                   /protein_id="EDL40036.1"
FT                   /translation="MDLFGDLPEPERAPRPSAGKEAQGRPVLFEDLPPASSTDSGSGGP
FT                   LLFDDLPPAASGNSGSLATSGSQVVKTEGKGAKRKAPEEEKNGGEELVEKKVCKASSVI
FT                   FGLKGYVAERKGEREEMQDAHVILNDITQECNPPSSLITRVSYFAVFDGHGGIRASKFA
FT                   AQNLHQNLIRKFPKGDIISVEKTVKRCLLDTFKHTDEEFLKQASSQKPAWKDGSTATCV
FT                   LAVDNILYIANLGDSRAILCRYNEESQKHAALSLSKEHNPTQYEERMRIQKAGGNVRDG
FT                   RVLGVLEVSRSIGDGQYKRCGVTSVPDIRRCQLTPNDRFILLACDGLFKVFTPEEAVNF
FT                   ILSCLEDDKIQTREGKPAVDARYEAACNRLANKAVQRGSADNVTVMVVRIGH"
FT   CDS             complement(join(5734511..5734651,5734887..5734968,
FT                   5737016..5737135,5740429..5740550,5741882..5741969,
FT                   5743143..5743236,5743818..5743924,5745793..5745857))
FT                   /codon_start=1
FT                   /gene="Ilkap"
FT                   /locus_tag="mCG_12875"
FT                   /product="integrin-linked kinase-associated
FT                   serine/threonine phosphatase 2C, isoform CRA_b"
FT                   /note="gene_id=mCG12875.2 transcript_id=mCT179505.0
FT                   protein_id=mCP102427.0 isoform=CRA_b"
FT                   /protein_id="EDL40037.1"
FT                   /translation="MQDAHVILNDITQECNPPSSLITRVSYFAVFDGHGGIRASKFAAQ
FT                   NLHQNLIRKFPKGDIISVEKTVKRCLLDTFKHTDEEFLKQASSQKPAWKDGSTATCVLA
FT                   VDNILYIANLGDSRAILCRYNEESQKHAALSLSKEHNPTQYEERMRIQKAGGNVRDGRV
FT                   LGVLEVSRSIGDGQYKRCGVTSVPDIRRCQLTPNDRFILLACDGLFKVFTPEEAVNFIL
FT                   SCLEDDKIQTREGKPAVDARYEAACNRLANKAVQRGSADNVTVMVVRIGH"
FT   CDS             complement(join(5734511..5734651,5734887..5734968,
FT                   5737016..5737135,5740429..5740460))
FT                   /codon_start=1
FT                   /gene="Ilkap"
FT                   /locus_tag="mCG_12875"
FT                   /product="integrin-linked kinase-associated
FT                   serine/threonine phosphatase 2C, isoform CRA_i"
FT                   /note="gene_id=mCG12875.2 transcript_id=mCT179508.0
FT                   protein_id=mCP102430.0 isoform=CRA_i"
FT                   /protein_id="EDL40044.1"
FT                   /translation="MRIQKAGGNVRDGRVLGVLEVSRSIGDGQYKRCGVTSVPDIRRCQ
FT                   LTPNDRFILLACDGLFKVFTPEEAVNFILSCLEDDKIQTREGKPAVDARYEAACNRLAN
FT                   KAVQRGSADNVTVMVVRIGH"
FT   mRNA            complement(join(5734529..5734968,5737016..5737135,
FT                   5740429..5740550,5741882..5741969,5743143..5743236,
FT                   5743818..5743924,5745793..5745919,5746923..5747042,
FT                   5749184..5749240,5749709..5749774,5757216..5757298))
FT                   /gene="Ilkap"
FT                   /locus_tag="mCG_12875"
FT                   /product="integrin-linked kinase-associated
FT                   serine/threonine phosphatase 2C, transcript variant
FT                   mCT179510"
FT                   /note="gene_id=mCG12875.2 transcript_id=mCT179510.0 created
FT                   on 03-FEB-2003"
FT   CDS             complement(join(5734809..5734968,5737016..5737135,
FT                   5740429..5740550,5741882..5741969,5743143..5743236,
FT                   5743818..5743924,5745793..5745919,5746923..5747042,
FT                   5749184..5749240,5749709..5749774,5757216..5757270))
FT                   /codon_start=1
FT                   /gene="Ilkap"
FT                   /locus_tag="mCG_12875"
FT                   /product="integrin-linked kinase-associated
FT                   serine/threonine phosphatase 2C, isoform CRA_j"
FT                   /note="gene_id=mCG12875.2 transcript_id=mCT179510.0
FT                   protein_id=mCP102428.0 isoform=CRA_j"
FT                   /protein_id="EDL40045.1"
FT                   /translation="MDLFGDLPEPERAPRPSAGKEAQGRPVLFEDLPPASSTDSGSGGP
FT                   LLFDDLPPAASGNSGSLATSGSQVVKTEGKGAKRKAPEEEKNGGEELVEKKVCKASSVI
FT                   FGLKGYVAERKGEREEMQDAHVILNDITQECNPPSSLITRVSYFAVFDGHGGIRASKFA
FT                   AQNLHQNLIRKFPKGDIISVEKTVKRCLLDTFKHTDEEFLKQASSQKPAWKDGSTATCV
FT                   LAVDNILYIANLGDSRAILCRYNEESQKHAALSLSKEHNPTQYEERMRIQKAGGNVRDG
FT                   RVLGVLEVSRSIGDGQYKRCGVTSVPDIRRCQLTPNDRFILLACDGLFKVFTPEEAVNF
FT                   ILSCLEVRHLRGCATCLSCFVSIAPQPLCQE"
FT   CDS             complement(join(5734910..5734968,5749184..5749240,
FT                   5749709..5749774,5757216..5757270))
FT                   /codon_start=1
FT                   /gene="Ilkap"
FT                   /locus_tag="mCG_12875"
FT                   /product="integrin-linked kinase-associated
FT                   serine/threonine phosphatase 2C, isoform CRA_k"
FT                   /note="gene_id=mCG12875.2 transcript_id=mCT179512.0
FT                   protein_id=mCP102429.0 isoform=CRA_k"
FT                   /db_xref="GOA:A0A087WPM3"
FT                   /db_xref="MGI:MGI:1914694"
FT                   /db_xref="UniProtKB/TrEMBL:A0A087WPM3"
FT                   /protein_id="EDL40046.1"
FT                   /translation="MDLFGDLPEPERAPRPSAGKEAQGRPVLFEDLPPASSTDSGSGGP
FT                   LLFDDLPPAASGNSGSFCWLATGFSRSLPQKKL"
FT   assembly_gap    5738160..5738179
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            complement(join(5739617..5739811,5740429..5740550,
FT                   5741882..5741969,5743143..5743236,5743818..5743924,
FT                   5745793..5745919,5746933..5747042,5749184..5749240,
FT                   5749709..5749774,5757216..5757298))
FT                   /gene="Ilkap"
FT                   /locus_tag="mCG_12875"
FT                   /product="integrin-linked kinase-associated
FT                   serine/threonine phosphatase 2C, transcript variant
FT                   mCT179506"
FT                   /note="gene_id=mCG12875.2 transcript_id=mCT179506.0 created
FT                   on 03-FEB-2003"
FT   CDS             complement(join(5739748..5739811,5740429..5740550,
FT                   5741882..5741969,5743143..5743236,5743818..5743924,
FT                   5745793..5745857))
FT                   /codon_start=1
FT                   /gene="Ilkap"
FT                   /locus_tag="mCG_12875"
FT                   /product="integrin-linked kinase-associated
FT                   serine/threonine phosphatase 2C, isoform CRA_h"
FT                   /note="gene_id=mCG12875.2 transcript_id=mCT179506.0
FT                   protein_id=mCP102431.0 isoform=CRA_h"
FT                   /protein_id="EDL40043.1"
FT                   /translation="MQDAHVILNDITQECNPPSSLITRVSYFAVFDGHGGIRASKFAAQ
FT                   NLHQNLIRKFPKGDIISVEKTVKRCLLDTFKHTDEEFLKQASSQKPAWKDGSTATCVLA
FT                   VDNILYIANLGDSRAILCRYNEESQKHAALSLSKEHNPTQYEERMRIQKAGGNVSSLTA
FT                   VFKGHVTRVDHLCAQR"
FT   mRNA            complement(join(5746337..5747042,5749184..5749240,
FT                   5749686..5749774,5757216..5757298))
FT                   /gene="Ilkap"
FT                   /locus_tag="mCG_12875"
FT                   /product="integrin-linked kinase-associated
FT                   serine/threonine phosphatase 2C, transcript variant
FT                   mCT179507"
FT                   /note="gene_id=mCG12875.2 transcript_id=mCT179507.0 created
FT                   on 03-FEB-2003"
FT   CDS             complement(join(5747010..5747042,5749184..5749240,
FT                   5749686..5749774,5757216..5757270))
FT                   /codon_start=1
FT                   /gene="Ilkap"
FT                   /locus_tag="mCG_12875"
FT                   /product="integrin-linked kinase-associated
FT                   serine/threonine phosphatase 2C, isoform CRA_c"
FT                   /note="gene_id=mCG12875.2 transcript_id=mCT179507.0
FT                   protein_id=mCP102433.0 isoform=CRA_c"
FT                   /protein_id="EDL40038.1"
FT                   /translation="MDLFGDLPEPERAPRPSAGKEAQGRPVLFEDLPPASSTDSGTVFR
FT                   LSQALGDLYSLMIFRLLPVAIQVLLPHQVPRW"
FT   mRNA            complement(join(5748927..5749240,5749709..5749774,
FT                   5757216..5757298))
FT                   /gene="Ilkap"
FT                   /locus_tag="mCG_12875"
FT                   /product="integrin-linked kinase-associated
FT                   serine/threonine phosphatase 2C, transcript variant
FT                   mCT179513"
FT                   /note="gene_id=mCG12875.2 transcript_id=mCT179513.0 created
FT                   on 03-FEB-2003"
FT   CDS             complement(join(5749098..5749240,5749709..5749774,
FT                   5757216..5757270))
FT                   /codon_start=1
FT                   /gene="Ilkap"
FT                   /locus_tag="mCG_12875"
FT                   /product="integrin-linked kinase-associated
FT                   serine/threonine phosphatase 2C, isoform CRA_f"
FT                   /note="gene_id=mCG12875.2 transcript_id=mCT179513.0
FT                   protein_id=mCP102435.0 isoform=CRA_f"
FT                   /protein_id="EDL40041.1"
FT                   /translation="MDLFGDLPEPERAPRPSAGKEAQGRPVLFEDLPPASSTDSGSGGP
FT                   LLFDDLPPAASGNSGRQTVLRCGWITLIVPLCKLCARVLAGF"
FT   assembly_gap    5757299..5757490
FT                   /estimated_length=192
FT                   /gap_type="unknown"
FT   gene            complement(5763500..5764654)
FT                   /locus_tag="mCG_12883"
FT                   /note="gene_id=mCG12883.1"
FT   mRNA            complement(join(5763500..5763805,5764119..5764237,
FT                   5764529..5764654))
FT                   /locus_tag="mCG_12883"
FT                   /product="mCG12883"
FT                   /note="gene_id=mCG12883.1 transcript_id=mCT13533.1 created
FT                   on 04-FEB-2003"
FT   CDS             complement(join(5764119..5764237,5764529..5764571))
FT                   /codon_start=1
FT                   /locus_tag="mCG_12883"
FT                   /product="mCG12883"
FT                   /note="gene_id=mCG12883.1 transcript_id=mCT13533.1
FT                   protein_id=mCP20977.1"
FT                   /protein_id="EDL40035.1"
FT                   /translation="MALHLRTPWRWFTVGSEQPLTGQHLSCCIHRAEGGCGHPAQRSRM
FT                   SRIVPTFN"
FT   gene            complement(5770127..5771853)
FT                   /gene="Hes6"
FT                   /locus_tag="mCG_12884"
FT                   /note="gene_id=mCG12884.1"
FT   mRNA            complement(join(5770127..5771127,5771366..5771624,
FT                   5771702..5771853))
FT                   /gene="Hes6"
FT                   /locus_tag="mCG_12884"
FT                   /product="hairy and enhancer of split 6 (Drosophila),
FT                   transcript variant mCT177903"
FT                   /note="gene_id=mCG12884.1 transcript_id=mCT177903.0 created
FT                   on 31-DEC-2002"
FT   mRNA            complement(join(5770127..5771127,5771366..5771447,
FT                   5771538..5771624,5771702..5771839))
FT                   /gene="Hes6"
FT                   /locus_tag="mCG_12884"
FT                   /product="hairy and enhancer of split 6 (Drosophila),
FT                   transcript variant mCT13534"
FT                   /note="gene_id=mCG12884.1 transcript_id=mCT13534.2 created
FT                   on 31-DEC-2002"
FT   mRNA            complement(join(5770128..5771447,5771538..5771624,
FT                   5771702..5771847))
FT                   /gene="Hes6"
FT                   /locus_tag="mCG_12884"
FT                   /product="hairy and enhancer of split 6 (Drosophila),
FT                   transcript variant mCT177904"
FT                   /note="gene_id=mCG12884.1 transcript_id=mCT177904.0 created
FT                   on 31-DEC-2002"
FT   mRNA            complement(join(5770684..5771127,5771366..5771441,
FT                   5771538..5771624,5771702..5771853))
FT                   /gene="Hes6"
FT                   /locus_tag="mCG_12884"
FT                   /product="hairy and enhancer of split 6 (Drosophila),
FT                   transcript variant mCT177905"
FT                   /note="gene_id=mCG12884.1 transcript_id=mCT177905.0 created
FT                   on 31-DEC-2002"
FT   CDS             complement(join(5770703..5771127,5771366..5771441,
FT                   5771538..5771624,5771702..5771782))
FT                   /codon_start=1
FT                   /gene="Hes6"
FT                   /locus_tag="mCG_12884"
FT                   /product="hairy and enhancer of split 6 (Drosophila),
FT                   isoform CRA_e"
FT                   /note="gene_id=mCG12884.1 transcript_id=mCT177905.0
FT                   protein_id=mCP100826.0 isoform=CRA_e"
FT                   /protein_id="EDL40034.1"
FT                   /translation="MAPSQAPSRDRAGQEDEDRWEARGDRKARKPLVEKKRRARINESL
FT                   QELRLLLAGTEAKLENAEVLELTVRRVQGALRGRAREREQLQAEASERFAAGYIQCMHE
FT                   VHTFVSTCQAIDATVSAELLNHLLESMPLREGSSFQDLLGDSLAGLPGGSGRSSWPPGG
FT                   SPESPLSSPPGPGDDLCSDLEEIPEAELNRVPAEGPDLVSTSLGSLTAARRAQSVWRPW
FT                   "
FT   CDS             complement(join(5770703..5771127,5771366..5771447,
FT                   5771538..5771624,5771702..5771782))
FT                   /codon_start=1
FT                   /gene="Hes6"
FT                   /locus_tag="mCG_12884"
FT                   /product="hairy and enhancer of split 6 (Drosophila),
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG12884.1 transcript_id=mCT13534.2
FT                   protein_id=mCP21011.1 isoform=CRA_a"
FT                   /protein_id="EDL40030.1"
FT                   /translation="MAPSQAPSRDRAGQEDEDRWEARGDRKARKPLVEKKRRARINESL
FT                   QELRLLLAGTEVQAKLENAEVLELTVRRVQGALRGRAREREQLQAEASERFAAGYIQCM
FT                   HEVHTFVSTCQAIDATVSAELLNHLLESMPLREGSSFQDLLGDSLAGLPGGSGRSSWPP
FT                   GGSPESPLSSPPGPGDDLCSDLEEIPEAELNRVPAEGPDLVSTSLGSLTAARRAQSVWR
FT                   PW"
FT   CDS             complement(join(5770703..5771127,5771366..5771624,
FT                   5771702..5771782))
FT                   /codon_start=1
FT                   /gene="Hes6"
FT                   /locus_tag="mCG_12884"
FT                   /product="hairy and enhancer of split 6 (Drosophila),
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG12884.1 transcript_id=mCT177903.0
FT                   protein_id=mCP100827.0 isoform=CRA_b"
FT                   /protein_id="EDL40031.1"
FT                   /translation="MAPSQAPSRDRAGQEDEDRWEARGDRKARKPLVEKKRRARINESL
FT                   QELRLLLAGTEVRRERCRGEGDLQGAPRSARPDSTPFPSAQVQAKLENAEVLELTVRRV
FT                   QGALRGRAREREQLQAEASERFAAGYIQCMHEVHTFVSTCQAIDATVSAELLNHLLESM
FT                   PLREGSSFQDLLGDSLAGLPGGSGRSSWPPGGSPESPLSSPPGPGDDLCSDLEEIPEAE
FT                   LNRVPAEGPDLVSTSLGSLTAARRAQSVWRPW"
FT   mRNA            complement(join(5770964..5771119,5771362..5771447,
FT                   5771538..5771624,5771702..5771814))
FT                   /gene="Hes6"
FT                   /locus_tag="mCG_12884"
FT                   /product="hairy and enhancer of split 6 (Drosophila),
FT                   transcript variant mCT177906"
FT                   /note="gene_id=mCG12884.1 transcript_id=mCT177906.0 created
FT                   on 31-DEC-2002"
FT   CDS             complement(join(5770999..5771119,5771362..5771447,
FT                   5771538..5771624,5771702..5771782))
FT                   /codon_start=1
FT                   /gene="Hes6"
FT                   /locus_tag="mCG_12884"
FT                   /product="hairy and enhancer of split 6 (Drosophila),
FT                   isoform CRA_d"
FT                   /note="gene_id=mCG12884.1 transcript_id=mCT177906.0
FT                   protein_id=mCP100828.0 isoform=CRA_d"
FT                   /protein_id="EDL40033.1"
FT                   /translation="MAPSQAPSRDRAGQEDEDRWEARGDRKARKPLVEKKRRARINESL
FT                   QELRLLLAGTEVQAKLENAEVLELTVRRVQGALRGRARGDSCRLKQASASLLATSSACM
FT                   RCTRSCPRAKPSMPLSQLNS"
FT   CDS             complement(join(5771106..5771447,5771538..5771624,
FT                   5771702..5771782))
FT                   /codon_start=1
FT                   /gene="Hes6"
FT                   /locus_tag="mCG_12884"
FT                   /product="hairy and enhancer of split 6 (Drosophila),
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG12884.1 transcript_id=mCT177904.0
FT                   protein_id=mCP100825.0 isoform=CRA_c"
FT                   /protein_id="EDL40032.1"
FT                   /translation="MAPSQAPSRDRAGQEDEDRWEARGDRKARKPLVEKKRRARINESL
FT                   QELRLLLAGTEVQAKLENAEVLELTVRRVQGALRGRARGEWRRGSRAGALTGHACHPTA
FT                   GHVGSRSPGPIHGKGFPQNGTRYCVSWVSPEPAERIVRATIVTAHGAGRCSLLPTLLHR
FT                   AGAAAG"
FT   assembly_gap    5773093..5773269
FT                   /estimated_length=177
FT                   /gap_type="unknown"
FT   gene            complement(5774776..5818229)
FT                   /gene="Per2"
FT                   /locus_tag="mCG_131682"
FT                   /note="gene_id=mCG131682.0"
FT   mRNA            complement(join(5774776..5776814,5778168..5778318,
FT                   5779199..5779391,5780161..5780347,5782591..5783387,
FT                   5786646..5786885,5788291..5788455,5789681..5789787,
FT                   5789885..5790047,5791715..5791799,5792303..5792428,
FT                   5793529..5793637,5793924..5794077,5794557..5794663,
FT                   5797279..5797357,5798829..5798971,5799774..5799825,
FT                   5803526..5803727,5804442..5804563,5807641..5807795,
FT                   5808746..5808811,5809538..5809776,5818105..5818229))
FT                   /gene="Per2"
FT                   /locus_tag="mCG_131682"
FT                   /product="period homolog 2 (Drosophila)"
FT                   /note="gene_id=mCG131682.0 transcript_id=mCT133020.0
FT                   created on 17-JUN-2003"
FT   CDS             complement(join(5776665..5776814,5778168..5778318,
FT                   5779199..5779391,5780161..5780347,5782591..5783387,
FT                   5786646..5786885,5788291..5788455,5789681..5789787,
FT                   5789885..5790047,5791715..5791799,5792303..5792428,
FT                   5793529..5793637,5793924..5794077,5794557..5794663,
FT                   5797279..5797357,5798829..5798971,5799774..5799825,
FT                   5803526..5803727,5804442..5804563,5807641..5807795,
FT                   5808746..5808811,5809538..5809758))
FT                   /codon_start=1
FT                   /gene="Per2"
FT                   /locus_tag="mCG_131682"
FT                   /product="period homolog 2 (Drosophila)"
FT                   /note="gene_id=mCG131682.0 transcript_id=mCT133020.0
FT                   protein_id=mCP81597.1"
FT                   /protein_id="EDL40029.1"
FT                   /translation="MNGYVDFSPSPTSPTKEPGAPQPTQAVLQEDVDMSSGSSGNENCS
FT                   TGRDSQGSDCDDNGKELRMLVESSNTHPSPDDAFRLMMTEAEHNPSTSGCSSEQSAKAD
FT                   AHKELIRTLKELKVHLPADKKAKGKASTLATLKYALRSVKQVKANEEYYQLLMSSESQP
FT                   CSVDVPSYTMEQVEGITSEYIVKNADMFAVAVSLVSGKILYISNQVASIFHCKKDAFSD
FT                   AKFVEFLAPHDVSVFHSYTTPYKLPPWSVCSGLDSFTQECMEEKSFFCRVSVGKHHENE
FT                   IRYQPFRMTPYLVKVQEQQGAESQLCCLLLAERVHSGYEAPRIPPEKRIFTTTHTPNCL
FT                   FQAVDERAVPLLGYLPQDLIETPVLVQLHPSDRPLMLAIHKKILQAGGQPFDYSPIRFR
FT                   TRNGEYITLDTSWSSFINPWSRKISFIIGRHKVRVGPLNEDVFAASPCPEEKTPHPSVQ
FT                   ELTEQIHRLLMQPVPHSGSSGYGSLGSNGSHEHLMSQTSSSDSNGQEESHRRRSGIFKT
FT                   SGKIQTKSHVSHESGGQKEASVAEMQSSPPAQVKAVTTIERDSSGASLPKASFPEELAY
FT                   KNQPPCSYQQISCLDSVIRYLESCSEAATLKRKCEFPANIPSRKATVSPGLHSGEAARP
FT                   SKVTSHTEVSAHLSSLTLPGKAESVVSLTSQCSYSSTIVHVGDKKPQPELETVEDMASG
FT                   PESLDGAAGGLSQEKGPLQKLGLTKEVLAAHTQREEQGFLQRFREVSRLSALQAHCQNY
FT                   LQERSRAQASDRGLRNTSGLESSWKKTGKNRKLKSKRVKTRDSSESTGSGGPVSHRPPL
FT                   MGLNATAWSPSDTSQSSCPSAPFPTAVPAYPLPVFQAPGIVSTPGTVVAPPAATHTGFT
FT                   MPVVPMGTQPEFAVQPLPFAAPLAPVMAFMLPSYPFPPATPNLPQAFLPSQPHFPAHPT
FT                   LASEITPASQAEFPSRTSTLRQPCACPVTPPAGTVALGRASPPLFQSRGSSPLQLNLLQ
FT                   LEEAPEGSTGAAGTLGTTGTAASGLDCTSGTSRDRQPKAPPTCNEPSDTQNSDAISTSS
FT                   DLLNLLLGEDLCSATGSALSRSGASATSDSLGSSSLGFGTSQSGAGSSDTSHTSKYFGS
FT                   IDSSENNHKAKMIPDTEESEQFIKYVLQDPIWLLMANTDDSIMMTYQLPSRDLQAVLKE
FT                   DQEKLKLLQRSQPRFTEGQRRELREVHPWVHTGGLPTAIDVTGCVYCESEEKGNICLPY
FT                   EEDSPSPGLCDTSEAKEEEGEQLTGPRIEAQT"
FT   assembly_gap    5834097..5836312
FT                   /estimated_length=2216
FT                   /gap_type="unknown"
FT   assembly_gap    5840319..5840430
FT                   /estimated_length=112
FT                   /gap_type="unknown"
FT   gene            5841077..5842828
FT                   /locus_tag="mCG_148381"
FT                   /note="gene_id=mCG148381.0"
FT   mRNA            join(5841077..5841375,5841458..5842828)
FT                   /locus_tag="mCG_148381"
FT                   /product="mCG148381"
FT                   /note="gene_id=mCG148381.0 transcript_id=mCT188644.0
FT                   created on 13-JAN-2004"
FT   CDS             join(5841311..5841375,5841458..5841578)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148381"
FT                   /product="mCG148381"
FT                   /note="gene_id=mCG148381.0 transcript_id=mCT188644.0
FT                   protein_id=mCP108667.0"
FT                   /protein_id="EDL40028.1"
FT                   /translation="MGDSFSQSKGCIASPLGMWPWSKSLCCHGGPQPLFRHPQQNGKSP
FT                   KSFQLVEMVPPAGKPT"
FT   gene            complement(5845584..5847943)
FT                   /pseudo
FT                   /locus_tag="mCG_131688"
FT                   /note="gene_id=mCG131688.1"
FT   mRNA            complement(join(5845584..5846473,5846704..5847943))
FT                   /pseudo
FT                   /locus_tag="mCG_131688"
FT                   /note="gene_id=mCG131688.1 transcript_id=mCT133026.1
FT                   created on 03-FEB-2003"
FT   gene            5852736..5887438
FT                   /gene="Traf3ip1"
FT                   /locus_tag="mCG_131687"
FT                   /note="gene_id=mCG131687.1"
FT   mRNA            join(5852736..5852947,5856017..5856085,5857566..5857727,
FT                   5858837..5858974,5859069..5859488,5863487..5863558,
FT                   5865553..5865643,5877627..5877716,5878110..5878193,
FT                   5878938..5879061,5879241..5879277,5880885..5880961,
FT                   5883933..5884156,5885672..5887437)
FT                   /gene="Traf3ip1"
FT                   /locus_tag="mCG_131687"
FT                   /product="TNF receptor-associated factor 3 interacting
FT                   protein 1, transcript variant mCT179533"
FT                   /note="gene_id=mCG131687.1 transcript_id=mCT179533.0
FT                   created on 03-FEB-2003"
FT   mRNA            join(5852737..5852947,5856017..5856085,5857566..5857727,
FT                   5858837..5858974,5859069..5859488,5863487..5863558,
FT                   5865553..5865628,5876351..5876371,5877632..5877716,
FT                   5878110..5878193,5878938..5879061,5879241..5879277,
FT                   5880885..5880961,5883933..5884156,5885672..5887438)
FT                   /gene="Traf3ip1"
FT                   /locus_tag="mCG_131687"
FT                   /product="TNF receptor-associated factor 3 interacting
FT                   protein 1, transcript variant mCT133025"
FT                   /note="gene_id=mCG131687.1 transcript_id=mCT133025.1
FT                   created on 03-FEB-2003"
FT   CDS             join(5852825..5852947,5856017..5856085,5857566..5857727,
FT                   5858837..5858974,5859069..5859488,5863487..5863558,
FT                   5865553..5865628,5876351..5876371,5877632..5877716,
FT                   5878110..5878193,5878938..5879061,5879241..5879277,
FT                   5880885..5880961,5883933..5884156,5885672..5885837)
FT                   /codon_start=1
FT                   /gene="Traf3ip1"
FT                   /locus_tag="mCG_131687"
FT                   /product="TNF receptor-associated factor 3 interacting
FT                   protein 1, isoform CRA_a"
FT                   /note="gene_id=mCG131687.1 transcript_id=mCT133025.1
FT                   protein_id=mCP82285.1 isoform=CRA_a"
FT                   /protein_id="EDL40026.1"
FT                   /translation="MNAAVVRRTQEALGKVIRRPPLTEKLLNKPPFRYLHDIITEVIRI
FT                   TGFMKGLYTDAEMKSENVKDKDAKISFLQKAIDVVMMVSGEPLAAKPARIVAGHEPERT
FT                   NELLQLIGKCCLSKLSSDEAVKRVLAGDKGDSRGRAQRTSKAQEPNNKSGKEEESRIHK
FT                   EDKRSSEAKERSASAEHKQKEELKEDSKPREKERDKEKAKEADRDRHRDPDRDRNRDGE
FT                   REKARARAKDRDRNNRDRDREAERDRERDRRSEGGKEKERVKDRDRDRDKGRDRERRKS
FT                   KNGEHTRDPDREKSRDADKPEKKSSSSGEISRKLSDGSFKDVKAEMEADISVGASRSST
FT                   LKPSKRRSKHSLEGDSPSDAEVEAGPAGQDKPEVMENAEVPSELPSSLRRIPRPGSARP
FT                   APPRVKRQESTETLVVDRSGSGKTVSSVIIDSQNSDNEDDEQFVVEAAPQLSEIADIDM
FT                   VPSGELEDEEKHGGLVKKILETKKDYEKLQQSLKPGEKERSLIFESAWKKEKDIVSKEI
FT                   EKLRVSIQTLCKSALPLGKIMDYIQEDVDAMQNELQLWHSENRQHAEALSQEQSITDSA
FT                   VEPLKAELSELEQQIRDQQDKICAVKANILKNEEKIQKMVHSINLSSRR"
FT   CDS             join(5852825..5852947,5856017..5856085,5857566..5857727,
FT                   5858837..5858974,5859069..5859488,5863487..5863558,
FT                   5865553..5865643,5877627..5877637)
FT                   /codon_start=1
FT                   /gene="Traf3ip1"
FT                   /locus_tag="mCG_131687"
FT                   /product="TNF receptor-associated factor 3 interacting
FT                   protein 1, isoform CRA_b"
FT                   /note="gene_id=mCG131687.1 transcript_id=mCT179533.0
FT                   protein_id=mCP102455.0 isoform=CRA_b"
FT                   /protein_id="EDL40027.1"
FT                   /translation="MNAAVVRRTQEALGKVIRRPPLTEKLLNKPPFRYLHDIITEVIRI
FT                   TGFMKGLYTDAEMKSENVKDKDAKISFLQKAIDVVMMVSGEPLAAKPARIVAGHEPERT
FT                   NELLQLIGKCCLSKLSSDEAVKRVLAGDKGDSRGRAQRTSKAQEPNNKSGKEEESRIHK
FT                   EDKRSSEAKERSASAEHKQKEELKEDSKPREKERDKEKAKEADRDRHRDPDRDRNRDGE
FT                   REKARARAKDRDRNNRDRDREAERDRERDRRSEGGKEKERVKDRDRDRDKGRDRERRKS
FT                   KNGEHTRDPDREKSRDADKPEKKSSSSGEISRKLSDGSFKDVKAEMEADISVGASRSST
FT                   LKPSKRRSKHSLEGTAKLLQK"
FT   assembly_gap    5894053..5896195
FT                   /estimated_length=2143
FT                   /gap_type="unknown"
FT   gene            5898468..5917084
FT                   /gene="Asb1"
FT                   /locus_tag="mCG_12877"
FT                   /note="gene_id=mCG12877.3"
FT   mRNA            join(5898468..5898786,5902071..5902217,5909959..5910344,
FT                   5912656..5917084)
FT                   /gene="Asb1"
FT                   /locus_tag="mCG_12877"
FT                   /product="ankyrin repeat and SOCS box-containing protein 1,
FT                   transcript variant mCT177901"
FT                   /note="gene_id=mCG12877.3 transcript_id=mCT177901.1 created
FT                   on 24-JUN-2003"
FT   mRNA            join(5898468..5898786,5902076..5902217,5904833..5905135,
FT                   5909959..5910344,5912656..5917084)
FT                   /gene="Asb1"
FT                   /locus_tag="mCG_12877"
FT                   /product="ankyrin repeat and SOCS box-containing protein 1,
FT                   transcript variant mCT177900"
FT                   /note="gene_id=mCG12877.3 transcript_id=mCT177900.1 created
FT                   on 24-JUN-2003"
FT   mRNA            join(<5898489..5898574,5898676..5898786,5902071..5902217,
FT                   5904833..5905135,5909959..5910344,5912656..5917084)
FT                   /gene="Asb1"
FT                   /locus_tag="mCG_12877"
FT                   /product="ankyrin repeat and SOCS box-containing protein 1,
FT                   transcript variant mCT177902"
FT                   /note="gene_id=mCG12877.3 transcript_id=mCT177902.1 created
FT                   on 24-JUN-2003"
FT   CDS             join(<5898722..5898786,5902071..5902217,5904833..5905135,
FT                   5909959..5910344,5912656..5912783)
FT                   /codon_start=1
FT                   /gene="Asb1"
FT                   /locus_tag="mCG_12877"
FT                   /product="ankyrin repeat and SOCS box-containing protein 1,
FT                   isoform CRA_d"
FT                   /note="gene_id=mCG12877.3 transcript_id=mCT177902.1
FT                   protein_id=mCP100824.1 isoform=CRA_d"
FT                   /db_xref="GOA:Q80TI9"
FT                   /db_xref="InterPro:IPR001496"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="MGI:MGI:1929735"
FT                   /db_xref="UniProtKB/TrEMBL:Q80TI9"
FT                   /protein_id="EDL40024.1"
FT                   /translation="GPSRHGGGRDRPRWTGRPGTRSAGPNLKEWLREQFCDHPLEHCDD
FT                   TRLHDAAYVGDLQTLRNLLQEESYRSRINEKSVWCCGWLPCTPLRIAATAGHGNCVDFL
FT                   IRKGAEVDLVDVKGQTALYVAVVNGHLESTEILLEAGADPNGSRHHRSTPVYHASRVGR
FT                   DDILKALIRYGADVDVNHHLTPDTRPPFSRRLTSLVVCPLYISAAYHNLQCFRLLLQAG
FT                   ANPDFNCNGPVNTQEFYRGSPGCVMDAVLRHGCEAAFVSLLVEFGANLNLVKWESLGPE
FT                   ARGRRKMDPEALQVFKEARSIPRTLLSLCRVAVRRALGKYRLHLVPSLPLPDPIKKFLL
FT                   YE"
FT   CDS             join(5898735..5898786,5902076..5902217,5904833..5905135,
FT                   5909959..5910344,5912656..5912783)
FT                   /codon_start=1
FT                   /gene="Asb1"
FT                   /locus_tag="mCG_12877"
FT                   /product="ankyrin repeat and SOCS box-containing protein 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG12877.3 transcript_id=mCT177900.1
FT                   protein_id=mCP100822.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q3U5A0"
FT                   /db_xref="InterPro:IPR001496"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="MGI:MGI:1929735"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U5A0"
FT                   /protein_id="EDL40021.1"
FT                   /translation="MAEGGTGPDGRAGPGPAGPNLKEWLREQFCDHPLEHCDDTRLHDA
FT                   AYVGDLQTLRNLLQEESYRSRINEKSVWCCGWLPCTPLRIAATAGHGNCVDFLIRKGAE
FT                   VDLVDVKGQTALYVAVVNGHLESTEILLEAGADPNGSRHHRSTPVYHASRVGRDDILKA
FT                   LIRYGADVDVNHHLTPDTRPPFSRRLTSLVVCPLYISAAYHNLQCFRLLLQAGANPDFN
FT                   CNGPVNTQEFYRGSPGCVMDAVLRHGCEAAFVSLLVEFGANLNLVKWESLGPEARGRRK
FT                   MDPEALQVFKEARSIPRTLLSLCRVAVRRALGKYRLHLVPSLPLPDPIKKFLLYE"
FT   mRNA            join(5899001..5899097,5902071..5902217,5904833..5905135,
FT                   5909959..5910344,5912656..5917084)
FT                   /gene="Asb1"
FT                   /locus_tag="mCG_12877"
FT                   /product="ankyrin repeat and SOCS box-containing protein 1,
FT                   transcript variant mCT13527"
FT                   /note="gene_id=mCG12877.3 transcript_id=mCT13527.3 created
FT                   on 24-JUN-2003"
FT   mRNA            join(5899002..5899097,5902071..5902217,5904833..5905135,
FT                   5909959..5910683)
FT                   /gene="Asb1"
FT                   /locus_tag="mCG_12877"
FT                   /product="ankyrin repeat and SOCS box-containing protein 1,
FT                   transcript variant mCT185308"
FT                   /note="gene_id=mCG12877.3 transcript_id=mCT185308.0 created
FT                   on 24-JUN-2003"
FT   CDS             join(5899075..5899097,5902071..5902217,5904833..5905135,
FT                   5909959..5910344,5912656..5912783)
FT                   /codon_start=1
FT                   /gene="Asb1"
FT                   /locus_tag="mCG_12877"
FT                   /product="ankyrin repeat and SOCS box-containing protein 1,
FT                   isoform CRA_e"
FT                   /note="gene_id=mCG12877.3 transcript_id=mCT13527.3
FT                   protein_id=mCP20971.2 isoform=CRA_e"
FT                   /db_xref="GOA:G3X9J5"
FT                   /db_xref="InterPro:IPR001496"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="MGI:MGI:1929735"
FT                   /db_xref="UniProtKB/TrEMBL:G3X9J5"
FT                   /protein_id="EDL40025.1"
FT                   /translation="MGFGSSSSAGPNLKEWLREQFCDHPLEHCDDTRLHDAAYVGDLQT
FT                   LRNLLQEESYRSRINEKSVWCCGWLPCTPLRIAATAGHGNCVDFLIRKGAEVDLVDVKG
FT                   QTALYVAVVNGHLESTEILLEAGADPNGSRHHRSTPVYHASRVGRDDILKALIRYGADV
FT                   DVNHHLTPDTRPPFSRRLTSLVVCPLYISAAYHNLQCFRLLLQAGANPDFNCNGPVNTQ
FT                   EFYRGSPGCVMDAVLRHGCEAAFVSLLVEFGANLNLVKWESLGPEARGRRKMDPEALQV
FT                   FKEARSIPRTLLSLCRVAVRRALGKYRLHLVPSLPLPDPIKKFLLYE"
FT   CDS             join(5899075..5899097,5902071..5902217,5904833..5905135,
FT                   5909959..5910391)
FT                   /codon_start=1
FT                   /gene="Asb1"
FT                   /locus_tag="mCG_12877"
FT                   /product="ankyrin repeat and SOCS box-containing protein 1,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG12877.3 transcript_id=mCT185308.0
FT                   protein_id=mCP106566.0 isoform=CRA_c"
FT                   /db_xref="GOA:A0A087WQE9"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="MGI:MGI:1929735"
FT                   /db_xref="UniProtKB/TrEMBL:A0A087WQE9"
FT                   /protein_id="EDL40023.1"
FT                   /translation="MGFGSSSSAGPNLKEWLREQFCDHPLEHCDDTRLHDAAYVGDLQT
FT                   LRNLLQEESYRSRINEKSVWCCGWLPCTPLRIAATAGHGNCVDFLIRKGAEVDLVDVKG
FT                   QTALYVAVVNGHLESTEILLEAGADPNGSRHHRSTPVYHASRVGRDDILKALIRYGADV
FT                   DVNHHLTPDTRPPFSRRLTSLVVCPLYISAAYHNLQCFRLLLQAGANPDFNCNGPVNTQ
FT                   EFYRGSPGCVMDAVLRHGCEAAFVSLLVEFGANLNLVKWESLGPEARGRRKMDPEALQV
FT                   FKEARSKWPELSSVLWSGVD"
FT   CDS             join(5910182..5910344,5912656..5912783)
FT                   /codon_start=1
FT                   /gene="Asb1"
FT                   /locus_tag="mCG_12877"
FT                   /product="ankyrin repeat and SOCS box-containing protein 1,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG12877.3 transcript_id=mCT177901.1
FT                   protein_id=mCP100823.0 isoform=CRA_b"
FT                   /db_xref="GOA:A0A0A0MQ78"
FT                   /db_xref="InterPro:IPR001496"
FT                   /db_xref="MGI:MGI:1929735"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0A0MQ78"
FT                   /protein_id="EDL40022.1"
FT                   /translation="MDAVLRHGCEAAFVSLLVEFGANLNLVKWESLGPEARGRRKMDPE
FT                   ALQVFKEARSIPRTLLSLCRVAVRRALGKYRLHLVPSLPLPDPIKKFLLYE"
FT   assembly_gap    5918376..5918395
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5931271..5931326
FT                   /estimated_length=56
FT                   /gap_type="unknown"
FT   assembly_gap    5980234..5980253
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5997975..5998187
FT                   /estimated_length=213
FT                   /gap_type="unknown"
FT   assembly_gap    6017034..6017053
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6020318..6020375
FT                   /estimated_length=58
FT                   /gap_type="unknown"
FT   assembly_gap    6022856..6023744
FT                   /estimated_length=889
FT                   /gap_type="unknown"
FT   assembly_gap    6039302..6039338
FT                   /estimated_length=37
FT                   /gap_type="unknown"
FT   assembly_gap    6049580..6049599
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6102295..6102506
FT                   /estimated_length=212
FT                   /gap_type="unknown"
FT   assembly_gap    6110488..6110515
FT                   /estimated_length=28
FT                   /gap_type="unknown"
FT   assembly_gap    6119391..6119575
FT                   /estimated_length=185
FT                   /gap_type="unknown"
FT   assembly_gap    6147883..6148407
FT                   /estimated_length=525
FT                   /gap_type="unknown"
FT   assembly_gap    6150792..6150811
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6159464..6159502
FT                   /estimated_length=39
FT                   /gap_type="unknown"
FT   gene            6159578..6206402
FT                   /gene="Twist2"
FT                   /locus_tag="mCG_20120"
FT                   /note="gene_id=mCG20120.2"
FT   mRNA            join(6159578..6160267,6205764..6206402)
FT                   /gene="Twist2"
FT                   /locus_tag="mCG_20120"
FT                   /product="twist homolog 2 (Drosophila)"
FT                   /note="gene_id=mCG20120.2 transcript_id=mCT19299.2 created
FT                   on 31-DEC-2002"
FT   CDS             6159745..6160227
FT                   /codon_start=1
FT                   /gene="Twist2"
FT                   /locus_tag="mCG_20120"
FT                   /product="twist homolog 2 (Drosophila)"
FT                   /note="gene_id=mCG20120.2 transcript_id=mCT19299.2
FT                   protein_id=mCP21024.2"
FT                   /db_xref="GOA:A5D6P6"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="MGI:MGI:104685"
FT                   /db_xref="UniProtKB/TrEMBL:A5D6P6"
FT                   /protein_id="EDL40020.1"
FT                   /translation="MEEGSSSPVSPVDSLGTSEEELERQPKRFGRKRRYSKKSSEDGSP
FT                   TPGKRGKKGSPSAQSFEELQSQRILANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKI
FT                   QTLKLAARYIDFLYQVLQSDEMDNKMTSCSYVAHERLSYAFSVWRMEGAWSMSASH"
FT   assembly_gap    6183729..6184138
FT                   /estimated_length=410
FT                   /gap_type="unknown"
FT   assembly_gap    6195535..6195723
FT                   /estimated_length=189
FT                   /gap_type="unknown"
FT   assembly_gap    6211505..6211524
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6220798..6221370
FT                   /estimated_length=573
FT                   /gap_type="unknown"
FT   assembly_gap    6261350..6261941
FT                   /estimated_length=592
FT                   /gap_type="unknown"
FT   assembly_gap    6273160..6273179
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(6291200..6540073)
FT                   /gene="Hdac4"
FT                   /locus_tag="mCG_129824"
FT                   /note="gene_id=mCG129824.1"
FT   mRNA            complement(join(6291200..6292726,6292996..6293137,
FT                   6293942..6294026,6305235..6305368,6306753..6306871,
FT                   6314625..6314722,6315377..6315496,6317692..6317779,
FT                   6318748..6318803,6320790..6320897,6324237..6324283,
FT                   6327795..6327915,6330400..6330533,6332157..6332343,
FT                   6334896..6335150,6341465..6341688,6343814..6344009,
FT                   6344097..6344213,6346981..6347093,6350919..6351050,
FT                   6355493..6355614,6361590..6361710,6372120..6372270,
FT                   6389371..6389612,6414316..6414387,6451513..6451599,
FT                   6473008..6473112))
FT                   /gene="Hdac4"
FT                   /locus_tag="mCG_129824"
FT                   /product="histone deacetylase 4, transcript variant
FT                   mCT179519"
FT                   /note="gene_id=mCG129824.1 transcript_id=mCT179519.0
FT                   created on 03-FEB-2003"
FT   mRNA            complement(join(6291211..6292726,6292996..6293137,
FT                   6293942..6294026,6305235..6305368,6306753..6306871,
FT                   6314625..6314722,6315377..6315496,6317692..6317779,
FT                   6318748..6318803,6320790..6320897,6324237..6324283,
FT                   6327795..6327915,6330400..6330533,6332157..6332343,
FT                   6334896..6335150,6341465..6341688,6343814..6344009,
FT                   6344097..6344213,6346981..6347093,6350919..6351050,
FT                   6355493..6355614,6361590..6361710,6372120..6372270,
FT                   6389427..6389612,6414316..6414387,6508048..6508286,
FT                   6540034..6540073))
FT                   /gene="Hdac4"
FT                   /locus_tag="mCG_129824"
FT                   /product="histone deacetylase 4, transcript variant
FT                   mCT131142"
FT                   /note="gene_id=mCG129824.1 transcript_id=mCT131142.1
FT                   created on 03-FEB-2003"
FT   mRNA            complement(join(6291259..6292726,6292996..6293137,
FT                   6293942..6294026,6305235..6305368,6306753..6306871,
FT                   6314625..6314722,6315377..6315496,6317692..6317779,
FT                   6318748..6318803,6320790..6320897,6324237..6324283,
FT                   6327795..6327915,6330400..6330533,6332157..6332343,
FT                   6334896..6335150,6341465..6341688,6343814..6344009,
FT                   6344097..6344213,6346981..6347093,6350919..6351050,
FT                   6355493..6355614,6361590..6361710,6366168..6366307))
FT                   /gene="Hdac4"
FT                   /locus_tag="mCG_129824"
FT                   /product="histone deacetylase 4, transcript variant
FT                   mCT179518"
FT                   /note="gene_id=mCG129824.1 transcript_id=mCT179518.0
FT                   created on 03-FEB-2003"
FT   CDS             complement(join(6292687..6292726,6292996..6293137,
FT                   6293942..6294026,6305235..6305368,6306753..6306871,
FT                   6314625..6314722,6315377..6315496,6317692..6317779,
FT                   6318748..6318803,6320790..6320897,6324237..6324283,
FT                   6327795..6327915,6330400..6330533,6332157..6332343,
FT                   6334896..6335150,6341465..6341688,6343814..6344009,
FT                   6344097..6344213,6346981..6347093,6350919..6351050,
FT                   6355493..6355614,6361590..6361710,6372120..6372270,
FT                   6389371..6389612,6414316..6414328))
FT                   /codon_start=1
FT                   /gene="Hdac4"
FT                   /locus_tag="mCG_129824"
FT                   /product="histone deacetylase 4, isoform CRA_b"
FT                   /note="gene_id=mCG129824.1 transcript_id=mCT179519.0
FT                   protein_id=mCP102441.0 isoform=CRA_b"
FT                   /protein_id="EDL40018.1"
FT                   /translation="MPSTVDVATALPLQVAPTAVPMDLRLDHQFSLPLEPALREQQLQQ
FT                   ELLALKQKQQIQRQILIAEFQRQHEQLSRQHEAQLHEHIKQQQEMLAMKHQQELLEHQR
FT                   KLERHRQEQELEKQHREQKLQQLKNKEKGKESAVASTEVKMKLQEFVLNKKKALAHRNL
FT                   NHCISSDPRYWYGKTQHSSLDQSSPPQSGVSASYNHPVLGMYDAKDDFPLRKTASEPNL
FT                   KLRSRLKQKVAERRSSPLLRRKDGPVATALKKRPLDVTDSACSSAPGSGPSSPNSSSGN
FT                   VSTENGIAPTVPSAPAETSLAHRLVTREGSVAPLPLYTSPSLPNITLGLPATGPAAGAA
FT                   GQQDAERLALPALQQRILFPGTHLTPYLSTSPLERDGAAAHNPLLQHMVLLEQPPTQTP
FT                   LVTGLGALPLHSQSLVGADRVSPSIHKLRQHRPLGRTQSAPLPQNAQALQHLVIQQQHQ
FT                   QFLEKHKQQFQQQQLHLSKIISKPSEPPRQPESHPEETEEELREHQALLDEPYLDRLPG
FT                   QKEPSLAGVQVKQEPIESEEEEAEATRETEPGQRPATEQELLFRQQALLLEQQRIHQLR
FT                   NYQASMEAAGIPVSFGSHRPLSRAQSSPASATFPMSVQEPPTKPRFTTGLVYDTLMLKH
FT                   QCTCGNTNSHPEHAGRIQSIWSRLQETGLRGKCECIRGRKATLEELQTVHSEAHTLLYG
FT                   TNPLNRQKLDSKKLLGSLTSVFVRLPCGGVGVDSDTIWNEVHSSGAARLAVGCVVELVF
FT                   KVATGELKNGFAVVRPPGHHAEESTPMGFCYFNSVAVAAKLLQQRLNVSKILIVDWDVH
FT                   HGNGTQQAFYNDPNVLYMSLHRYDDGNFFPGSGAPDEVGTGPGVGFNVNMAFTGGLEPP
FT                   MGDAEYLAAFRTVVMPIANEFAPDVVLVSSGFDAVEGHPTPLGGYNLSAKCFGYLTKQL
FT                   MGLAGGRLVLALEGGHDLTAICDASEACVSALLGNELEPLPEKVLHQRPNANAVHSMEK
FT                   VMDIHSKYWRCLQRLSSTVGHSLIEAQKCEKEEAETVTAMASLSVGVKPAEKRSEEEPM
FT                   EEEPPL"
FT   CDS             complement(join(6292687..6292726,6292996..6293137,
FT                   6293942..6294026,6305235..6305368,6306753..6306871,
FT                   6314625..6314722,6315377..6315496,6317692..6317779,
FT                   6318748..6318803,6320790..6320897,6324237..6324283,
FT                   6327795..6327915,6330400..6330533,6332157..6332343,
FT                   6334896..6335150,6341465..6341688,6343814..6344009,
FT                   6344097..6344213,6346981..6347093,6350919..6351050,
FT                   6355493..6355614,6361590..6361710,6372120..6372258))
FT                   /codon_start=1
FT                   /gene="Hdac4"
FT                   /locus_tag="mCG_129824"
FT                   /product="histone deacetylase 4, isoform CRA_a"
FT                   /note="gene_id=mCG129824.1 transcript_id=mCT131142.1
FT                   protein_id=mCP82240.1 isoform=CRA_a"
FT                   /protein_id="EDL40017.1"
FT                   /translation="MLAMKHQQELLEHQRKLERHRQEQELEKQHREQKLQQLKNKEKGK
FT                   ESAVASTEVKMKLQEFVLNKKKALAHRNLNHCISSDPRYWYGKTQHSSLDQSSPPQSGV
FT                   SASYNHPVLGMYDAKDDFPLRKTASEPNLKLRSRLKQKVAERRSSPLLRRKDGPVATAL
FT                   KKRPLDVTDSACSSAPGSGPSSPNSSSGNVSTENGIAPTVPSAPAETSLAHRLVTREGS
FT                   VAPLPLYTSPSLPNITLGLPATGPAAGAAGQQDAERLALPALQQRILFPGTHLTPYLST
FT                   SPLERDGAAAHNPLLQHMVLLEQPPTQTPLVTGLGALPLHSQSLVGADRVSPSIHKLRQ
FT                   HRPLGRTQSAPLPQNAQALQHLVIQQQHQQFLEKHKQQFQQQQLHLSKIISKPSEPPRQ
FT                   PESHPEETEEELREHQALLDEPYLDRLPGQKEPSLAGVQVKQEPIESEEEEAEATRETE
FT                   PGQRPATEQELLFRQQALLLEQQRIHQLRNYQASMEAAGIPVSFGSHRPLSRAQSSPAS
FT                   ATFPMSVQEPPTKPRFTTGLVYDTLMLKHQCTCGNTNSHPEHAGRIQSIWSRLQETGLR
FT                   GKCECIRGRKATLEELQTVHSEAHTLLYGTNPLNRQKLDSKKLLGSLTSVFVRLPCGGV
FT                   GVDSDTIWNEVHSSGAARLAVGCVVELVFKVATGELKNGFAVVRPPGHHAEESTPMGFC
FT                   YFNSVAVAAKLLQQRLNVSKILIVDWDVHHGNGTQQAFYNDPNVLYMSLHRYDDGNFFP
FT                   GSGAPDEVGTGPGVGFNVNMAFTGGLEPPMGDAEYLAAFRTVVMPIANEFAPDVVLVSS
FT                   GFDAVEGHPTPLGGYNLSAKCFGYLTKQLMGLAGGRLVLALEGGHDLTAICDASEACVS
FT                   ALLGNELEPLPEKVLHQRPNANAVHSMEKVMDIHSKYWRCLQRLSSTVGHSLIEAQKCE
FT                   KEEAETVTAMASLSVGVKPAEKRSEEEPMEEEPPL"
FT   CDS             complement(join(6292687..6292726,6292996..6293137,
FT                   6293942..6294026,6305235..6305368,6306753..6306871,
FT                   6314625..6314722,6315377..6315496,6317692..6317779,
FT                   6318748..6318803,6320790..6320897,6324237..6324283,
FT                   6327795..6327915,6330400..6330533,6332157..6332343,
FT                   6334896..6335150,6341465..6341688,6343814..6344009,
FT                   6344097..6344213,6346981..6347093,6350919..6351050,
FT                   6355493..6355614,6361590..6361684))
FT                   /codon_start=1
FT                   /gene="Hdac4"
FT                   /locus_tag="mCG_129824"
FT                   /product="histone deacetylase 4, isoform CRA_c"
FT                   /note="gene_id=mCG129824.1 transcript_id=mCT179518.0
FT                   protein_id=mCP102440.0 isoform=CRA_c"
FT                   /protein_id="EDL40019.1"
FT                   /translation="MKLQEFVLNKKKALAHRNLNHCISSDPRYWYGKTQHSSLDQSSPP
FT                   QSGVSASYNHPVLGMYDAKDDFPLRKTASEPNLKLRSRLKQKVAERRSSPLLRRKDGPV
FT                   ATALKKRPLDVTDSACSSAPGSGPSSPNSSSGNVSTENGIAPTVPSAPAETSLAHRLVT
FT                   REGSVAPLPLYTSPSLPNITLGLPATGPAAGAAGQQDAERLALPALQQRILFPGTHLTP
FT                   YLSTSPLERDGAAAHNPLLQHMVLLEQPPTQTPLVTGLGALPLHSQSLVGADRVSPSIH
FT                   KLRQHRPLGRTQSAPLPQNAQALQHLVIQQQHQQFLEKHKQQFQQQQLHLSKIISKPSE
FT                   PPRQPESHPEETEEELREHQALLDEPYLDRLPGQKEPSLAGVQVKQEPIESEEEEAEAT
FT                   RETEPGQRPATEQELLFRQQALLLEQQRIHQLRNYQASMEAAGIPVSFGSHRPLSRAQS
FT                   SPASATFPMSVQEPPTKPRFTTGLVYDTLMLKHQCTCGNTNSHPEHAGRIQSIWSRLQE
FT                   TGLRGKCECIRGRKATLEELQTVHSEAHTLLYGTNPLNRQKLDSKKLLGSLTSVFVRLP
FT                   CGGVGVDSDTIWNEVHSSGAARLAVGCVVELVFKVATGELKNGFAVVRPPGHHAEESTP
FT                   MGFCYFNSVAVAAKLLQQRLNVSKILIVDWDVHHGNGTQQAFYNDPNVLYMSLHRYDDG
FT                   NFFPGSGAPDEVGTGPGVGFNVNMAFTGGLEPPMGDAEYLAAFRTVVMPIANEFAPDVV
FT                   LVSSGFDAVEGHPTPLGGYNLSAKCFGYLTKQLMGLAGGRLVLALEGGHDLTAICDASE
FT                   ACVSALLGNELEPLPEKVLHQRPNANAVHSMEKVMDIHSKYWRCLQRLSSTVGHSLIEA
FT                   QKCEKEEAETVTAMASLSVGVKPAEKRSEEEPMEEEPPL"
FT   assembly_gap    6323323..6323547
FT                   /estimated_length=225
FT                   /gap_type="unknown"
FT   assembly_gap    6432620..6432639
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6446849..6447150
FT                   /estimated_length=302
FT                   /gap_type="unknown"
FT   assembly_gap    6512431..6512586
FT                   /estimated_length=156
FT                   /gap_type="unknown"
FT   assembly_gap    6539772..6539941
FT                   /estimated_length=170
FT                   /gap_type="unknown"
FT   assembly_gap    6549700..6549870
FT                   /estimated_length=171
FT                   /gap_type="unknown"
FT   assembly_gap    6599721..6599937
FT                   /estimated_length=217
FT                   /gap_type="unknown"
FT   assembly_gap    6602057..6602585
FT                   /estimated_length=529
FT                   /gap_type="unknown"
FT   assembly_gap    6620521..6620600
FT                   /estimated_length=80
FT                   /gap_type="unknown"
FT   assembly_gap    6633620..6633758
FT                   /estimated_length=139
FT                   /gap_type="unknown"
FT   assembly_gap    6644268..6644287
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6648158..6648362
FT                   /estimated_length=205
FT                   /gap_type="unknown"
FT   assembly_gap    6665215..6665234
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6667650..6667669
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6669096..6669115
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6672484..6672655
FT                   /estimated_length=172
FT                   /gap_type="unknown"
FT   assembly_gap    6678256..6678275
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6692942..6692961
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6746990..6747075
FT                   /estimated_length=86
FT                   /gap_type="unknown"
FT   assembly_gap    6777735..6778137
FT                   /estimated_length=403
FT                   /gap_type="unknown"
FT   assembly_gap    6788613..6788632
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6793850..6794133
FT                   /estimated_length=284
FT                   /gap_type="unknown"
FT   gene            complement(6799803..6834592)
FT                   /gene="Ndufa10"
FT                   /locus_tag="mCG_20119"
FT                   /note="gene_id=mCG20119.2"
FT   mRNA            complement(join(6799803..6800698,6812802..6812910,
FT                   6821171..6821256,6823082..6823136,6823869..6823948,
FT                   6825152..6825273,6828172..6828258,6830654..6830869,
FT                   6831608..6831776,6834453..6834592))
FT                   /gene="Ndufa10"
FT                   /locus_tag="mCG_20119"
FT                   /product="NADH dehydrogenase (ubiquinone) 1 alpha
FT                   subcomplex 10, transcript variant mCT19298"
FT                   /note="gene_id=mCG20119.2 transcript_id=mCT19298.2 created
FT                   on 31-DEC-2002"
FT   mRNA            complement(join(6799803..6800698,6812802..6812910,
FT                   6821171..6821256,6823082..6823136,6823869..6823948,
FT                   6825152..6825273,6828172..6828258,6830654..6830869,
FT                   6834453..6834548))
FT                   /gene="Ndufa10"
FT                   /locus_tag="mCG_20119"
FT                   /product="NADH dehydrogenase (ubiquinone) 1 alpha
FT                   subcomplex 10, transcript variant mCT177992"
FT                   /note="gene_id=mCG20119.2 transcript_id=mCT177992.0 created
FT                   on 31-DEC-2002"
FT   mRNA            complement(join(6799803..6800698,6812802..6812910,
FT                   6821171..6821256,6823082..6823136,6823869..6823948,
FT                   6825152..6825273,6828172..6828258,6830654..6830869,
FT                   6831608..6831842))
FT                   /gene="Ndufa10"
FT                   /locus_tag="mCG_20119"
FT                   /product="NADH dehydrogenase (ubiquinone) 1 alpha
FT                   subcomplex 10, transcript variant mCT177994"
FT                   /note="gene_id=mCG20119.2 transcript_id=mCT177994.0 created
FT                   on 31-DEC-2002"
FT   mRNA            complement(join(6799803..6800698,6812802..6812910,
FT                   6821171..6821256,6823082..6823136,6823869..6823948,
FT                   6824243..6824264,6825154..6825273))
FT                   /gene="Ndufa10"
FT                   /locus_tag="mCG_20119"
FT                   /product="NADH dehydrogenase (ubiquinone) 1 alpha
FT                   subcomplex 10, transcript variant mCT177995"
FT                   /note="gene_id=mCG20119.2 transcript_id=mCT177995.0 created
FT                   on 31-DEC-2002"
FT   mRNA            complement(join(6799803..6800698,6812802..6812910,
FT                   6821171..6821508))
FT                   /gene="Ndufa10"
FT                   /locus_tag="mCG_20119"
FT                   /product="NADH dehydrogenase (ubiquinone) 1 alpha
FT                   subcomplex 10, transcript variant mCT177996"
FT                   /note="gene_id=mCG20119.2 transcript_id=mCT177996.0 created
FT                   on 31-DEC-2002"
FT   CDS             complement(join(6800630..6800698,6812802..6812910,
FT                   6821171..6821256,6823082..6823136,6823869..6823948,
FT                   6825152..6825273,6828172..6828258,6830654..6830869,
FT                   6831608..6831776,6834453..6834527))
FT                   /codon_start=1
FT                   /gene="Ndufa10"
FT                   /locus_tag="mCG_20119"
FT                   /product="NADH dehydrogenase (ubiquinone) 1 alpha
FT                   subcomplex 10, isoform CRA_e"
FT                   /note="gene_id=mCG20119.2 transcript_id=mCT19298.2
FT                   protein_id=mCP21020.1 isoform=CRA_e"
FT                   /protein_id="EDL40015.1"
FT                   /translation="MALRLLRLVPASAPARGLAAGAQRVGRIHTSVHCKLRYGLLAAIL
FT                   GDKTTKKLHEYSRVITVDGNICSGKNKLAKEIAQQLGMKHYPEAGIQYSSTTTGDGRPL
FT                   DIEFSGSCSLEKFYDDPKSNDGNSYRLQSWLYASRLLQYADALEHLLSTGQGVVLERSI
FT                   YSDFVFLEAMYNQGYIRKQCVDHYNEIKRLTLPEYLPPHAVIYIDVPVPEVQSRIQKKG
FT                   DPHEMKVTSAYLQDIENAYKKTFLPKMSEMCEVLVYDSWEAEDPTKVVEDIEYLKYNKG
FT                   PWLKQDDWTFHYLRMLVQDKTEVLNYTTIPVYLPEITIGAHQGSRIYNSFRELPGRKYA
FT                   PGYNAEVGDKWIWLK"
FT   CDS             complement(join(6800630..6800698,6812802..6812910,
FT                   6821171..6821256,6823082..6823136,6823869..6823948,
FT                   6825152..6825273,6828172..6828258,6830654..6830869,
FT                   6831608..6831821))
FT                   /codon_start=1
FT                   /gene="Ndufa10"
FT                   /locus_tag="mCG_20119"
FT                   /product="NADH dehydrogenase (ubiquinone) 1 alpha
FT                   subcomplex 10, isoform CRA_f"
FT                   /note="gene_id=mCG20119.2 transcript_id=mCT177994.0
FT                   protein_id=mCP100917.0 isoform=CRA_f"
FT                   /protein_id="EDL40016.1"
FT                   /translation="MPAVTTVVMCCCVFQGRIHTSVHCKLRYGLLAAILGDKTTKKLHE
FT                   YSRVITVDGNICSGKNKLAKEIAQQLGMKHYPEAGIQYSSTTTGDGRPLDIEFSGSCSL
FT                   EKFYDDPKSNDGNSYRLQSWLYASRLLQYADALEHLLSTGQGVVLERSIYSDFVFLEAM
FT                   YNQGYIRKQCVDHYNEIKRLTLPEYLPPHAVIYIDVPVPEVQSRIQKKGDPHEMKVTSA
FT                   YLQDIENAYKKTFLPKMSEMCEVLVYDSWEAEDPTKVVEDIEYLKYNKGPWLKQDDWTF
FT                   HYLRMLVQDKTEVLNYTTIPVYLPEITIGAHQGSRIYNSFRELPGRKYAPGYNAEVGDK
FT                   WIWLK"
FT   CDS             complement(join(6800630..6800698,6812802..6812910,
FT                   6821171..6821256,6823082..6823136,6823869..6823948,
FT                   6825152..6825273,6828172..6828258,6830654..6830867))
FT                   /codon_start=1
FT                   /gene="Ndufa10"
FT                   /locus_tag="mCG_20119"
FT                   /product="NADH dehydrogenase (ubiquinone) 1 alpha
FT                   subcomplex 10, isoform CRA_a"
FT                   /note="gene_id=mCG20119.2 transcript_id=mCT177992.0
FT                   protein_id=mCP100916.0 isoform=CRA_a"
FT                   /protein_id="EDL40011.1"
FT                   /translation="MKHYPEAGIQYSSTTTGDGRPLDIEFSGSCSLEKFYDDPKSNDGN
FT                   SYRLQSWLYASRLLQYADALEHLLSTGQGVVLERSIYSDFVFLEAMYNQGYIRKQCVDH
FT                   YNEIKRLTLPEYLPPHAVIYIDVPVPEVQSRIQKKGDPHEMKVTSAYLQDIENAYKKTF
FT                   LPKMSEMCEVLVYDSWEAEDPTKVVEDIEYLKYNKGPWLKQDDWTFHYLRMLVQDKTEV
FT                   LNYTTIPVYLPEITIGAHQGSRIYNSFRELPGRKYAPGYNAEVGDKWIWLK"
FT   CDS             complement(join(6800630..6800698,6812802..6812910,
FT                   6821171..6821256,6823082..6823136,6823869..6823939))
FT                   /codon_start=1
FT                   /gene="Ndufa10"
FT                   /locus_tag="mCG_20119"
FT                   /product="NADH dehydrogenase (ubiquinone) 1 alpha
FT                   subcomplex 10, isoform CRA_c"
FT                   /note="gene_id=mCG20119.2 transcript_id=mCT177995.0
FT                   protein_id=mCP100918.0 isoform=CRA_c"
FT                   /protein_id="EDL40013.1"
FT                   /translation="MKVTSAYLQDIENAYKKTFLPKMSEMCEVLVYDSWEAEDPTKVVE
FT                   DIEYLKYNKGPWLKQDDWTFHYLRMLVQDKTEVLNYTTIPVYLPEITIGAHQGSRIYNS
FT                   FRELPGRKYAPGYNAEVGDKWIWLK"
FT   CDS             complement(join(6800630..6800698,6812802..6812910,
FT                   6821171..6821175))
FT                   /codon_start=1
FT                   /gene="Ndufa10"
FT                   /locus_tag="mCG_20119"
FT                   /product="NADH dehydrogenase (ubiquinone) 1 alpha
FT                   subcomplex 10, isoform CRA_d"
FT                   /note="gene_id=mCG20119.2 transcript_id=mCT177996.0
FT                   protein_id=mCP100915.0 isoform=CRA_d"
FT                   /protein_id="EDL40014.1"
FT                   /translation="MLVQDKTEVLNYTTIPVYLPEITIGAHQGSRIYNSFRELPGRKYA
FT                   PGYNAEVGDKWIWLK"
FT   mRNA            complement(join(6810241..6810552,6812802..6812910,
FT                   6821171..6821256,6823082..6823136,6823869..6823948,
FT                   6825152..6825273,6828172..6828258,6830654..6830869,
FT                   6831608..6831776,6834453..6834546))
FT                   /gene="Ndufa10"
FT                   /locus_tag="mCG_20119"
FT                   /product="NADH dehydrogenase (ubiquinone) 1 alpha
FT                   subcomplex 10, transcript variant mCT177993"
FT                   /note="gene_id=mCG20119.2 transcript_id=mCT177993.0 created
FT                   on 31-DEC-2002"
FT   CDS             complement(join(6810448..6810552,6812802..6812910,
FT                   6821171..6821256,6823082..6823136,6823869..6823948,
FT                   6825152..6825273,6828172..6828258,6830654..6830869,
FT                   6831608..6831776,6834453..6834527))
FT                   /codon_start=1
FT                   /gene="Ndufa10"
FT                   /locus_tag="mCG_20119"
FT                   /product="NADH dehydrogenase (ubiquinone) 1 alpha
FT                   subcomplex 10, isoform CRA_b"
FT                   /note="gene_id=mCG20119.2 transcript_id=mCT177993.0
FT                   protein_id=mCP100914.0 isoform=CRA_b"
FT                   /protein_id="EDL40012.1"
FT                   /translation="MALRLLRLVPASAPARGLAAGAQRVGRIHTSVHCKLRYGLLAAIL
FT                   GDKTTKKLHEYSRVITVDGNICSGKNKLAKEIAQQLGMKHYPEAGIQYSSTTTGDGRPL
FT                   DIEFSGSCSLEKFYDDPKSNDGNSYRLQSWLYASRLLQYADALEHLLSTGQGVVLERSI
FT                   YSDFVFLEAMYNQGYIRKQCVDHYNEIKRLTLPEYLPPHAVIYIDVPVPEVQSRIQKKG
FT                   DPHEMKVTSAYLQDIENAYKKTFLPKMSEMCEVLVYDSWEAEDPTKVVEDIEYLKYNKG
FT                   PWLKQDDWTFHYLRMLVQDKTEVLNYTTIPVYLPEITIGAHQGSRIYNSFREMVSCQLD
FT                   TSFGKKESRLKNEPTRMLVGQACGAFS"
FT   gene            complement(<6840467..>6841405)
FT                   /locus_tag="mCG_1047359"
FT                   /note="gene_id=mCG1047359.0"
FT   mRNA            complement(<6840467..>6841405)
FT                   /locus_tag="mCG_1047359"
FT                   /product="mCG1047359"
FT                   /note="gene_id=mCG1047359.0 transcript_id=mCT165063.0
FT                   created on 03-JAN-2003"
FT   CDS             complement(6840467..6841405)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1047359"
FT                   /product="mCG1047359"
FT                   /note="gene_id=mCG1047359.0 transcript_id=mCT165063.0
FT                   protein_id=mCP82538.0"
FT                   /db_xref="GOA:Q8VGU4"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3031250"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VGU4"
FT                   /protein_id="EDL40010.1"
FT                   /translation="MRGENITKVSTFILLGFPTAPELQYLLFLLFLLAYLFVLVENLTI
FT                   ILTVWSSASLHRPMYYFLGSLSFLEIWYVSDIIPKMLDGFLLQRKRISFIGCMTQLYFF
FT                   SSLVCTECVLLASMAYDRYVAICHPLRYQVIMTTGLCVQLVAFSFASGFTISVIKVYFI
FT                   SSATFCGSNVLNHFFCDISPILKLACTDFSTAELVDFILAFIILVFPLLATILSYGHIT
FT                   LAVLRIPSATGRWRAFSTCASHLTVVTFFYMAMIFMYVRPQAIDTRSSNKLISAVYTVL
FT                   TPMMNPLIYCLRNTEFKDAVRRTLGLGNTPQ"
FT   gene            complement(<6851604..>6852539)
FT                   /locus_tag="mCG_1047358"
FT                   /note="gene_id=mCG1047358.0"
FT   mRNA            complement(<6851604..>6852539)
FT                   /locus_tag="mCG_1047358"
FT                   /product="mCG1047358"
FT                   /note="gene_id=mCG1047358.0 transcript_id=mCT165062.0
FT                   created on 14-FEB-2003"
FT   CDS             complement(6851604..6852539)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1047358"
FT                   /product="mCG1047358"
FT                   /note="gene_id=mCG1047358.0 transcript_id=mCT165062.0
FT                   protein_id=mCP82517.0"
FT                   /db_xref="GOA:Q7TQS4"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3031249"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TQS4"
FT                   /protein_id="EDL40009.1"
FT                   /translation="MRGENITKVSTFILLGFPTAPELQYLLFLLFLLAYLFVLVENLTI
FT                   ILTVWSSASLHRPMYYFLGSLSFLEIWYVSDIIPKMLDGFLLQRKRISFTGCMTQLYFF
FT                   ISLVCTECVLLASMAYDRYVAICHPLRYQVIMTTGLCVQLVAFSFASAFTVSVIKVYFI
FT                   SSATFCGSNVLNHFFCDISPILKLACTDFSTAELVDFILAFIILVFPLLATILSYGYIT
FT                   LAVLRIPSATGRWRAFSTCASHLTVVTFFYVAMLFIYVRPQAIDTRSSNKLISAVYTVL
FT                   TPILNPLIYCLRNKEFKDAVKRTLGLGHTL"
FT   assembly_gap    6869016..6869035
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<6873199..6880632)
FT                   /locus_tag="mCG_55840"
FT                   /note="gene_id=mCG55840.2"
FT   mRNA            complement(join(<6873199..6874147,6880433..6880632))
FT                   /locus_tag="mCG_55840"
FT                   /product="mCG55840"
FT                   /note="gene_id=mCG55840.2 transcript_id=mCT56023.3 created
FT                   on 28-JUN-2004"
FT   CDS             complement(6873199..6874137)
FT                   /codon_start=1
FT                   /locus_tag="mCG_55840"
FT                   /product="mCG55840"
FT                   /note="gene_id=mCG55840.2 transcript_id=mCT56023.3
FT                   protein_id=mCP41054.2"
FT                   /db_xref="GOA:Q8VGU5"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3031248"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VGU5"
FT                   /protein_id="EDL40008.1"
FT                   /translation="MRGENITKVSTFILLGFPTAPELQYLLFLLFLLAYLFVLVENLAI
FT                   ILTVWSSASLHRPMYYFLGIMSTLEIWYVCDIIPKMLDGFLLQRKRISFIGCMTQLYFF
FT                   SSLVCTECVLLASMAYDRYVAICHPLRYQVIMTTGLCVQLVAFSFASGFSISVIKVYFI
FT                   SSATFCGSNVLNHFFCDISPILKLACTDFSTAELVDFILAFIILVFPLLATVLSYGHIT
FT                   LAVLRIPSATGRWRAFSTCASHLTVVTIFYTALLFMYVRPQAIDTRSSNKLISVLYTVL
FT                   TPILNPLIYCLRNKEFKDALRKALGLGQAPL"
FT   assembly_gap    6884793..6886425
FT                   /estimated_length=1633
FT                   /gap_type="unknown"
FT   assembly_gap    6888476..6888495
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6889609..6889628
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6891917..6891936
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6893143..6894830
FT                   /estimated_length=1688
FT                   /gap_type="unknown"
FT   assembly_gap    6900863..6900882
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6905581..6905716
FT                   /estimated_length=136
FT                   /gap_type="unknown"
FT   gene            <6938531..>6939502
FT                   /gene="Olfr1413"
FT                   /locus_tag="mCG_55295"
FT                   /note="gene_id=mCG55295.2"
FT   mRNA            <6938531..>6939502
FT                   /gene="Olfr1413"
FT                   /locus_tag="mCG_55295"
FT                   /product="olfactory receptor 1413"
FT                   /note="gene_id=mCG55295.2 transcript_id=mCT55478.2 created
FT                   on 03-JAN-2003"
FT   CDS             6938531..6939502
FT                   /codon_start=1
FT                   /gene="Olfr1413"
FT                   /locus_tag="mCG_55295"
FT                   /product="olfactory receptor 1413"
FT                   /note="gene_id=mCG55295.2 transcript_id=mCT55478.2
FT                   protein_id=mCP41036.2"
FT                   /db_xref="GOA:Q8VGU3"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3031247"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VGU3"
FT                   /protein_id="EDL40007.1"
FT                   /translation="MATQVHRNGSLSAVSLQGFVLVGFGGGAKTQALLFAVFLTLYVVT
FT                   VLGNLTMIVVITLDARLHSPMYFFLKNLSFVDFCYSSVIAPKAMTIFLSSSKVISFAGC
FT                   ATQFFFFSLLVTTEGFLLAVMAYDRFMAICSPLRYPVTMCPMACARLVLGTYCGGCLNS
FT                   IVQTSLTFQLPFCSSNRIDHFYCDVPPLLQLACADTTLNEFVMFGICGLIIVSTTLVVL
FT                   ISYGYITMTILRMRSGSGRHKVFSTCGSHMTAVSLFYGTVFVMYAQPGALTSMEQGKVV
FT                   SVFYTLVIPMLNPLIYSLRNKDVKDAPRRLGQRHSLVKEDVQ"
FT   gene            <6953694..>6954659
FT                   /gene="Olfr1412"
FT                   /locus_tag="mCG_59267"
FT                   /note="gene_id=mCG59267.1"
FT   mRNA            <6953694..>6954659
FT                   /gene="Olfr1412"
FT                   /locus_tag="mCG_59267"
FT                   /product="olfactory receptor 1412"
FT                   /note="gene_id=mCG59267.1 transcript_id=mCT59450.1 created
FT                   on 03-JAN-2003"
FT   CDS             6953694..6954659
FT                   /codon_start=1
FT                   /gene="Olfr1412"
FT                   /locus_tag="mCG_59267"
FT                   /product="olfactory receptor 1412"
FT                   /note="gene_id=mCG59267.1 transcript_id=mCT59450.1
FT                   protein_id=mCP41073.1"
FT                   /db_xref="GOA:Q8VET3"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3031246"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VET3"
FT                   /protein_id="EDL40006.1"
FT                   /translation="MATAVHRNGSLTPVSLQAFVLVGFGGGAETQALLFAVFLVLYMVT
FT                   VLGNLTMIVVITLDARLHSPMYFFLKNLSFVDFCYSSVIAPKAMANFYSSKVIGVAGCA
FT                   AQLFFFSFLGTSEALLLAVMAYDRFMAICSPLHYPVTMSSTVCACLVLAAYFGGCLNSI
FT                   VETSLTFQLPFCGSNHIDHFFCDVPPLLQIACANTSVNELVMFAICGFILMGATLVILI
FT                   SYGYITVTILSMHSGSRRHKVFSTCGSHLTAVSLFYGTGIAIYGQPGGLASKEQGKVVS
FT                   IFYTLVIPLLNPLIYSLRNKDVKDALERLRQRQRQKHAAI"
FT   gene            <6961883..>6962854
FT                   /locus_tag="mCG_53743"
FT                   /note="gene_id=mCG53743.0"
FT   mRNA            <6961883..>6962854
FT                   /locus_tag="mCG_53743"
FT                   /product="mCG53743"
FT                   /note="gene_id=mCG53743.0 transcript_id=mCT53926.0 created
FT                   on 14-FEB-2003"
FT   CDS             6961883..6962854
FT                   /codon_start=1
FT                   /locus_tag="mCG_53743"
FT                   /product="mCG53743"
FT                   /note="gene_id=mCG53743.0 transcript_id=mCT53926.0
FT                   protein_id=mCP41079.0"
FT                   /db_xref="GOA:Q8VFC4"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3031245"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VFC4"
FT                   /protein_id="EDL40005.1"
FT                   /translation="MAIAVYRNGSLSAVSLQGFVLVGFGGGAETQALLFAVFLVLYVVT
FT                   ILGNLTMIVVITLDARLHSPMYFFLKNLSFVDLCYSSAIAPNALANFLSTSKVISFEAC
FT                   ATQLFFFSLLATTEAFLLAVMAYDRFMAICSPLRYPVTMCPTTCTRLVLGTYCGGCLNS
FT                   IVQTSLTFQLPFCSSNRIDHFYCDVPPLLQLACASTALNELFLFGLCGFIIVSTTLAVL
FT                   VSYGYITVTILRMHSGSGRHKVFSTCGSHMMAVSLFYGTVFVMYAQPGAVASMAQGKVI
FT                   SVFYTLVIPMLNPLIYSLRNKDVKDALRRLGQRHSLVKKGGK"
FT   gene            <6973201..>6974169
FT                   /gene="Olfr1410"
FT                   /locus_tag="mCG_56569"
FT                   /note="gene_id=mCG56569.0"
FT   mRNA            <6973201..>6974169
FT                   /gene="Olfr1410"
FT                   /locus_tag="mCG_56569"
FT                   /product="olfactory receptor 1410"
FT                   /note="gene_id=mCG56569.0 transcript_id=mCT56752.0 created
FT                   on 14-FEB-2003"
FT   CDS             6973201..6974169
FT                   /codon_start=1
FT                   /gene="Olfr1410"
FT                   /locus_tag="mCG_56569"
FT                   /product="olfactory receptor 1410"
FT                   /note="gene_id=mCG56569.0 transcript_id=mCT56752.0
FT                   protein_id=mCP41085.0"
FT                   /db_xref="GOA:Q8VFC5"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3031244"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VFC5"
FT                   /protein_id="EDL40004.1"
FT                   /translation="MATSVHRNGSLTPVSLQGFVLVGFGGSAETQALLFAVFLVLYVVT
FT                   ILGNLTMIMVITLDARLHSPMYFFLKNLSFVDLCLSSVIIPNALANIFSSSKTISFAGC
FT                   ATQFFFFSLLAATEAVLLAVMAYDRFMAICSPLRYPVTMCPMTCARLVLGTFCVACLNS
FT                   IVQTSLTFQLPFCSSNYIDYFFCDVPPLLQLACASTAINELVMFGICGFIIVCAVFVVI
FT                   ISYGYITVTILRMRSGSGRHKVFSTCGSHMTAVSLFYGTGFVIYGQPGGVASMEQGKVV
FT                   STIYTLVIPMLNPLIYSLRNKDVKDALRRLGQRHSLVKESG"
FT   gene            <6985284..>6986285
FT                   /locus_tag="mCG_59268"
FT                   /note="gene_id=mCG59268.0"
FT   mRNA            <6985284..>6986285
FT                   /locus_tag="mCG_59268"
FT                   /product="mCG59268"
FT                   /note="gene_id=mCG59268.0 transcript_id=mCT59451.0 created
FT                   on 14-FEB-2003"
FT   CDS             6985284..6986285
FT                   /codon_start=1
FT                   /locus_tag="mCG_59268"
FT                   /product="mCG59268"
FT                   /note="gene_id=mCG59268.0 transcript_id=mCT59451.0
FT                   protein_id=mCP41077.0"
FT                   /db_xref="GOA:Q0VBN7"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:107863"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VBN7"
FT                   /protein_id="EDL40003.1"
FT                   /translation="MATAVHRNGSLTPVSLRVFVLVGFGGGALTQALLFAVFLVLYVVT
FT                   VLGNLTMIVVITLDARLHSPMYFFLKNLSFVDLCYSSAIAPNALANFLSTSKVISFEAC
FT                   ATQFFFFSLLATTETFLLAVMAYDRFMAICSPLRYPVTMCPTTCTRLVLGTFCVGCLNS
FT                   IVQTSLTFQLPFCSSNRIDHFYCDVPPLLQLACASTALNELFLFGLCGFIIVSTTLAVL
FT                   VSYGYITVTILRMHSGSGRHKVFSTCGSHLTAVSLFYGTLFVMYAQPGALTSMEQGKVV
FT                   SIFYTLVIPMLNPLIYSLRNKDVKDALQRLGQRHSLVKAVRGCPAAGGNASV"
FT   assembly_gap    6999915..6999967
FT                   /estimated_length=53
FT                   /gap_type="unknown"
FT   gene            complement(7002480..7007300)
FT                   /locus_tag="mCG_20113"
FT                   /note="gene_id=mCG20113.1"
FT   mRNA            complement(join(7002480..7002736,7005019..7005091,
FT                   7007212..7007300))
FT                   /locus_tag="mCG_20113"
FT                   /product="mCG20113, transcript variant mCT19100"
FT                   /note="gene_id=mCG20113.1 transcript_id=mCT19100.1 created
FT                   on 03-FEB-2003"
FT   mRNA            complement(join(7002491..7002736,7005019..7005091,
FT                   7006939..7007299))
FT                   /locus_tag="mCG_20113"
FT                   /product="mCG20113, transcript variant mCT179581"
FT                   /note="gene_id=mCG20113.1 transcript_id=mCT179581.0 created
FT                   on 03-FEB-2003"
FT   mRNA            complement(join(7002498..7002736,7007212..7007299))
FT                   /locus_tag="mCG_20113"
FT                   /product="mCG20113, transcript variant mCT179582"
FT                   /note="gene_id=mCG20113.1 transcript_id=mCT179582.0 created
FT                   on 03-FEB-2003"
FT   mRNA            complement(join(7002513..7002736,7005019..7005091,
FT                   7005576..7005905))
FT                   /locus_tag="mCG_20113"
FT                   /product="mCG20113, transcript variant mCT179585"
FT                   /note="gene_id=mCG20113.1 transcript_id=mCT179585.0 created
FT                   on 03-FEB-2003"
FT   mRNA            complement(join(7002529..7002736,7005019..7005246))
FT                   /locus_tag="mCG_20113"
FT                   /product="mCG20113, transcript variant mCT179584"
FT                   /note="gene_id=mCG20113.1 transcript_id=mCT179584.0 created
FT                   on 03-FEB-2003"
FT   CDS             complement(join(7002632..7002736,7007212..7007274))
FT                   /codon_start=1
FT                   /locus_tag="mCG_20113"
FT                   /product="mCG20113, isoform CRA_b"
FT                   /note="gene_id=mCG20113.1 transcript_id=mCT179582.0
FT                   protein_id=mCP102505.0 isoform=CRA_b"
FT                   /protein_id="EDL39998.1"
FT                   /translation="MKPAVDEMFPEGAGPYVDLDEILKTFLMMMMSSEAARSYVLHVCD
FT                   VSGVSRDTTS"
FT   CDS             complement(join(7002699..7002736,7005019..7005091,
FT                   7007212..7007274))
FT                   /codon_start=1
FT                   /locus_tag="mCG_20113"
FT                   /product="mCG20113, isoform CRA_e"
FT                   /note="gene_id=mCG20113.1 transcript_id=mCT19100.1
FT                   protein_id=mCP21025.2 isoform=CRA_e"
FT                   /db_xref="GOA:B2RVT1"
FT                   /db_xref="InterPro:IPR029391"
FT                   /db_xref="MGI:MGI:1914165"
FT                   /db_xref="UniProtKB/TrEMBL:B2RVT1"
FT                   /protein_id="EDL40001.1"
FT                   /translation="MKPAVDEMFPEGAGPYVDLDEAGGSTGLLMDLAANEKAVHADFFN
FT                   DFEDLFDDDDVQ"
FT   CDS             complement(join(7002699..7002736,7005019..7005091,
FT                   7005576..7005767))
FT                   /codon_start=1
FT                   /locus_tag="mCG_20113"
FT                   /product="mCG20113, isoform CRA_d"
FT                   /note="gene_id=mCG20113.1 transcript_id=mCT179585.0
FT                   protein_id=mCP102506.0 isoform=CRA_d"
FT                   /db_xref="GOA:D3Z159"
FT                   /db_xref="InterPro:IPR029391"
FT                   /db_xref="MGI:MGI:1914165"
FT                   /db_xref="UniProtKB/TrEMBL:D3Z159"
FT                   /protein_id="EDL40000.1"
FT                   /translation="MASCGGGGVCRGRDRGRGRRKIQKRVQDMLMYLTLQGNLNQQPSS
FT                   DGAQEGGGQSQLYCETHPQAGGSTGLLMDLAANEKAVHADFFNDFEDLFDDDDVQ"
FT   CDS             complement(join(7002699..7002736,7005019..7005166))
FT                   /codon_start=1
FT                   /locus_tag="mCG_20113"
FT                   /product="mCG20113, isoform CRA_f"
FT                   /note="gene_id=mCG20113.1 transcript_id=mCT179584.0
FT                   protein_id=mCP102504.0 isoform=CRA_f"
FT                   /protein_id="EDL40002.1"
FT                   /translation="MGFVTKPPLTFGKQIHWMTLPLILQAGGSTGLLMDLAANEKAVHA
FT                   DFFNDFEDLFDDDDVQ"
FT   mRNA            complement(join(7004702..7005091,7007212..7007299))
FT                   /locus_tag="mCG_20113"
FT                   /product="mCG20113, transcript variant mCT179583"
FT                   /note="gene_id=mCG20113.1 transcript_id=mCT179583.0 created
FT                   on 03-FEB-2003"
FT   CDS             complement(join(7004885..7005091,7007212..7007274))
FT                   /codon_start=1
FT                   /locus_tag="mCG_20113"
FT                   /product="mCG20113, isoform CRA_c"
FT                   /note="gene_id=mCG20113.1 transcript_id=mCT179583.0
FT                   protein_id=mCP102507.0 isoform=CRA_c"
FT                   /protein_id="EDL39999.1"
FT                   /translation="MKPAVDEMFPEGAGPYVDLDEAGGSTGLLMDLAANEKAVHADFFN
FT                   GKWVPGLVRTFLCRGQLCAVGNLDHGTVWPGPCSWQLALPVSPV"
FT   CDS             complement(7007068..7007274)
FT                   /codon_start=1
FT                   /locus_tag="mCG_20113"
FT                   /product="mCG20113, isoform CRA_a"
FT                   /note="gene_id=mCG20113.1 transcript_id=mCT179581.0
FT                   protein_id=mCP102503.0 isoform=CRA_a"
FT                   /protein_id="EDL39997.1"
FT                   /translation="MKPAVDEMFPEGAGPYVDLDEVGWWRRGAMRGGGSTPANLRGSPG
FT                   LWGFRGWGSGSCRGQSQGPRLLT"
FT   gene            complement(7009551..7013587)
FT                   /gene="Otos"
FT                   /locus_tag="mCG_20116"
FT                   /note="gene_id=mCG20116.2"
FT   mRNA            complement(join(7009551..7009849,7010514..7010540,
FT                   7010666..7010758,7011016..7013587))
FT                   /gene="Otos"
FT                   /locus_tag="mCG_20116"
FT                   /product="otospiralin"
FT                   /note="gene_id=mCG20116.2 transcript_id=mCT19103.2 created
FT                   on 14-FEB-2003"
FT   CDS             complement(join(7009665..7009849,7010514..7010540,
FT                   7010666..7010723))
FT                   /codon_start=1
FT                   /gene="Otos"
FT                   /locus_tag="mCG_20116"
FT                   /product="otospiralin"
FT                   /note="gene_id=mCG20116.2 transcript_id=mCT19103.2
FT                   protein_id=mCP20965.2"
FT                   /db_xref="GOA:Q497Y7"
FT                   /db_xref="InterPro:IPR028224"
FT                   /db_xref="MGI:MGI:2672814"
FT                   /db_xref="UniProtKB/TrEMBL:Q497Y7"
FT                   /protein_id="EDL39996.1"
FT                   /translation="MQACVLWWLALGMLLGIPAGAKPMPEEADPHTQPPAMPYWPFSTS
FT                   DFWNYVQYFQTQGAYPQIEDMARTFFAHFPLGSTLGFHVPYQED"
FT   assembly_gap    7085747..7085795
FT                   /estimated_length=49
FT                   /gap_type="unknown"
FT   assembly_gap    7103652..7103671
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7125330..7125349
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7145153..7145545
FT                   /estimated_length=393
FT                   /gap_type="unknown"
FT   assembly_gap    7146992..7147338
FT                   /estimated_length=347
FT                   /gap_type="unknown"
FT   gene            complement(7186554..7203593)
FT                   /locus_tag="mCG_148390"
FT                   /note="gene_id=mCG148390.0"
FT   mRNA            complement(join(7186554..7187320,7203311..7203593))
FT                   /locus_tag="mCG_148390"
FT                   /product="mCG148390"
FT                   /note="gene_id=mCG148390.0 transcript_id=mCT188653.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(join(7187042..7187320,7203311..7203334))
FT                   /codon_start=1
FT                   /locus_tag="mCG_148390"
FT                   /product="mCG148390"
FT                   /note="gene_id=mCG148390.0 transcript_id=mCT188653.0
FT                   protein_id=mCP108674.0"
FT                   /protein_id="EDL39995.1"
FT                   /translation="MRGLQVGKSMDSSPSWWGRQGSWSRKQLSQHIHQQEKEKCSTLLL
FT                   SGPSPRPQPMVPARESYPHGLTIPPQLIQSRWSPKACPGADLLLSFHCILRFLMV"
FT   assembly_gap    7196864..7197429
FT                   /estimated_length=566
FT                   /gap_type="unknown"
FT   gene            7197430..7226563
FT                   /gene="Gpc1"
FT                   /locus_tag="mCG_16588"
FT                   /note="gene_id=mCG16588.2"
FT   mRNA            join(7197430..7197797,7219135..7219288,7220641..7221029,
FT                   7221690..7221855,7222770..7222900,7223031..7223150,
FT                   7223255..7223388,7223638..7223813,7224115..7226563)
FT                   /gene="Gpc1"
FT                   /locus_tag="mCG_16588"
FT                   /product="glypican 1, transcript variant mCT177985"
FT                   /note="gene_id=mCG16588.2 transcript_id=mCT177985.0 created
FT                   on 31-DEC-2002"
FT   mRNA            join(7197430..7197793,7219130..7219288,7220641..7221029,
FT                   7221690..7221855,7222770..7222900,7223031..7223150,
FT                   7223255..7223388,7223638..7223813,7224115..7226563)
FT                   /gene="Gpc1"
FT                   /locus_tag="mCG_16588"
FT                   /product="glypican 1, transcript variant mCT19274"
FT                   /note="gene_id=mCG16588.2 transcript_id=mCT19274.2 created
FT                   on 31-DEC-2002"
FT   CDS             join(7197628..7197793,7219130..7219288,7220641..7221029,
FT                   7221690..7221855,7222770..7222900,7223031..7223150,
FT                   7223255..7223388,7223638..7223813,7224115..7224347)
FT                   /codon_start=1
FT                   /gene="Gpc1"
FT                   /locus_tag="mCG_16588"
FT                   /product="glypican 1, isoform CRA_c"
FT                   /note="gene_id=mCG16588.2 transcript_id=mCT19274.2
FT                   protein_id=mCP20969.1 isoform=CRA_c"
FT                   /db_xref="GOA:Q3U379"
FT                   /db_xref="InterPro:IPR001863"
FT                   /db_xref="InterPro:IPR015502"
FT                   /db_xref="InterPro:IPR019803"
FT                   /db_xref="MGI:MGI:1194891"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U379"
FT                   /protein_id="EDL39994.1"
FT                   /translation="MELRTRGWWLLCAAAALVVCARGDPASKSRSCSEVRQIYGAKGFS
FT                   LSDVPQAEISGEHLRICPQGYTCCTSEMEENLANHSRMELESALHDSSRALQATLATQL
FT                   HGIDDHFQRLLNDSERTLQEAFPGAFGDLYTQNTRAFRDLYAELRLYYRGANLHLEETL
FT                   AEFWARLLERLFKQLHPQLLPDDYLDCLGKQAEALRPFGDAPRELRLRATRAFVAARSF
FT                   VQGLGVASDVVRKVAQVPLAPECSRAIMKLVYCAHCRGVPGARPCPDYCRNVLKGCLAN
FT                   QADLDAEWRNLLDSMVLITDKFWGPSGAESVIGGVHVWLAEAINALQDNKDTLTAKVIQ
FT                   ACGNPKVNPHGSGPEEKRRRGKLALQEKPSTGTLEKLVSEAKAQLRDIQDFWISLPGTL
FT                   CSEKMAMSPASDDRCWNGISKGRYLPEVMGDGLANQINNPEVEVDITKPDMTIRQQIMQ
FT                   LKIMTNRLRGAYGGNDVDFQDASDDGSGSGSGGGCPDDTCGRRVSKKSSSSRTPLTHAL
FT                   PGLSEQEGQKTSAATCPEPHSFFLLFLVTLVLAAARPRWR"
FT   assembly_gap    7213435..7213580
FT                   /estimated_length=146
FT                   /gap_type="unknown"
FT   mRNA            join(7218981..7219288,7220641..7221029,7221690..7221855,
FT                   7222770..7222900,7223031..7223150,7223255..7223388,
FT                   7223638..7223813,7224115..7226563)
FT                   /gene="Gpc1"
FT                   /locus_tag="mCG_16588"
FT                   /product="glypican 1, transcript variant mCT177984"
FT                   /note="gene_id=mCG16588.2 transcript_id=mCT177984.0 created
FT                   on 31-DEC-2002"
FT   CDS             join(7219180..7219288,7220641..7221029,7221690..7221855,
FT                   7222770..7222900,7223031..7223150,7223255..7223388,
FT                   7223638..7223813,7224115..7224347)
FT                   /codon_start=1
FT                   /gene="Gpc1"
FT                   /locus_tag="mCG_16588"
FT                   /product="glypican 1, isoform CRA_b"
FT                   /note="gene_id=mCG16588.2 transcript_id=mCT177984.0
FT                   protein_id=mCP100907.0 isoform=CRA_b"
FT                   /protein_id="EDL39992.1"
FT                   /translation="MEENLANHSRMELESALHDSSRALQATLATQLHGIDDHFQRLLND
FT                   SERTLQEAFPGAFGDLYTQNTRAFRDLYAELRLYYRGANLHLEETLAEFWARLLERLFK
FT                   QLHPQLLPDDYLDCLGKQAEALRPFGDAPRELRLRATRAFVAARSFVQGLGVASDVVRK
FT                   VAQVPLAPECSRAIMKLVYCAHCRGVPGARPCPDYCRNVLKGCLANQADLDAEWRNLLD
FT                   SMVLITDKFWGPSGAESVIGGVHVWLAEAINALQDNKDTLTAKVIQACGNPKVNPHGSG
FT                   PEEKRRRGKLALQEKPSTGTLEKLVSEAKAQLRDIQDFWISLPGTLCSEKMAMSPASDD
FT                   RCWNGISKGRYLPEVMGDGLANQINNPEVEVDITKPDMTIRQQIMQLKIMTNRLRGAYG
FT                   GNDVDFQDASDDGSGSGSGGGCPDDTCGRRVSKKSSSSRTPLTHALPGLSEQEGQKTSA
FT                   ATCPEPHSFFLLFLVTLVLAAARPRWR"
FT   CDS             join(7219180..7219288,7220641..7221029,7221690..7221855,
FT                   7222770..7222900,7223031..7223150,7223255..7223388,
FT                   7223638..7223813,7224115..7224347)
FT                   /codon_start=1
FT                   /gene="Gpc1"
FT                   /locus_tag="mCG_16588"
FT                   /product="glypican 1, isoform CRA_b"
FT                   /note="gene_id=mCG16588.2 transcript_id=mCT177985.0
FT                   protein_id=mCP100905.0 isoform=CRA_b"
FT                   /protein_id="EDL39993.1"
FT                   /translation="MEENLANHSRMELESALHDSSRALQATLATQLHGIDDHFQRLLND
FT                   SERTLQEAFPGAFGDLYTQNTRAFRDLYAELRLYYRGANLHLEETLAEFWARLLERLFK
FT                   QLHPQLLPDDYLDCLGKQAEALRPFGDAPRELRLRATRAFVAARSFVQGLGVASDVVRK
FT                   VAQVPLAPECSRAIMKLVYCAHCRGVPGARPCPDYCRNVLKGCLANQADLDAEWRNLLD
FT                   SMVLITDKFWGPSGAESVIGGVHVWLAEAINALQDNKDTLTAKVIQACGNPKVNPHGSG
FT                   PEEKRRRGKLALQEKPSTGTLEKLVSEAKAQLRDIQDFWISLPGTLCSEKMAMSPASDD
FT                   RCWNGISKGRYLPEVMGDGLANQINNPEVEVDITKPDMTIRQQIMQLKIMTNRLRGAYG
FT                   GNDVDFQDASDDGSGSGSGGGCPDDTCGRRVSKKSSSSRTPLTHALPGLSEQEGQKTSA
FT                   ATCPEPHSFFLLFLVTLVLAAARPRWR"
FT   mRNA            join(7222345..7222900,7223031..7223150,7223255..7223388,
FT                   7223638..7223813,7224115..7226563)
FT                   /gene="Gpc1"
FT                   /locus_tag="mCG_16588"
FT                   /product="glypican 1, transcript variant mCT177983"
FT                   /note="gene_id=mCG16588.2 transcript_id=mCT177983.0 created
FT                   on 31-DEC-2002"
FT   CDS             join(7222751..7222900,7223031..7223150,7223255..7223388,
FT                   7223638..7223813,7224115..7224347)
FT                   /codon_start=1
FT                   /gene="Gpc1"
FT                   /locus_tag="mCG_16588"
FT                   /product="glypican 1, isoform CRA_a"
FT                   /note="gene_id=mCG16588.2 transcript_id=mCT177983.0
FT                   protein_id=mCP100906.0 isoform=CRA_a"
FT                   /protein_id="EDL39991.1"
FT                   /translation="MLTPLPDSMVLITDKFWGPSGAESVIGGVHVWLAEAINALQDNKD
FT                   TLTAKVIQACGNPKVNPHGSGPEEKRRRGKLALQEKPSTGTLEKLVSEAKAQLRDIQDF
FT                   WISLPGTLCSEKMAMSPASDDRCWNGISKGRYLPEVMGDGLANQINNPEVEVDITKPDM
FT                   TIRQQIMQLKIMTNRLRGAYGGNDVDFQDASDDGSGSGSGGGCPDDTCGRRVSKKSSSS
FT                   RTPLTHALPGLSEQEGQKTSAATCPEPHSFFLLFLVTLVLAAARPRWR"
FT   gene            complement(7235913..7268616)
FT                   /gene="Ankmy1"
FT                   /locus_tag="mCG_16572"
FT                   /note="gene_id=mCG16572.2"
FT   mRNA            complement(join(7235913..7236102,7236593..7236753,
FT                   7237457..7237532,7242321..7242486,7242797..7242910,
FT                   7244117..7244248,7245101..7245208,7246766..7246906,
FT                   7247537..7247677,7249528..7249699,7250621..7251051,
FT                   7251922..7252080,7252409..7252625,7254233..7254702,
FT                   7261777..7261920,7265207..7265396,7268152..7268308,
FT                   7268538..7268616))
FT                   /gene="Ankmy1"
FT                   /locus_tag="mCG_16572"
FT                   /product="ankyrin repeat and MYND domain containing 1"
FT                   /note="gene_id=mCG16572.2 transcript_id=mCT19259.2 created
FT                   on 03-FEB-2003"
FT   CDS             complement(join(7236056..7236102,7236593..7236753,
FT                   7237457..7237532,7242321..7242486,7242797..7242910,
FT                   7244117..7244248,7245101..7245208,7246766..7246906,
FT                   7247537..7247677,7249528..7249699,7250621..7251051,
FT                   7251922..7252080,7252409..7252625,7254233..7254702,
FT                   7261777..7261920,7265207..7265396,7268152..7268291))
FT                   /codon_start=1
FT                   /gene="Ankmy1"
FT                   /locus_tag="mCG_16572"
FT                   /product="ankyrin repeat and MYND domain containing 1"
FT                   /note="gene_id=mCG16572.2 transcript_id=mCT19259.2
FT                   protein_id=mCP20999.2"
FT                   /db_xref="GOA:E0CYY3"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR002893"
FT                   /db_xref="InterPro:IPR003409"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="MGI:MGI:3045261"
FT                   /db_xref="UniProtKB/TrEMBL:E0CYY3"
FT                   /protein_id="EDL39990.1"
FT                   /translation="MEEIRSVVTTDSQGSKTLSSRGLEGQNGRSLDTESQDSVKSYTFF
FT                   RRSRPGDLGEDEEESEGTVGEQDLKGTYKQLVQGVQEWQDGCVYKGEFGLNMKLGYGEF
FT                   SWPTGEAYHGQFYRDHFHGLGTYTWPDGSSFTGTFYLSQREGYGTMHTKTMLFQGLYKE
FT                   DQRFGPGIETYPDGSQDVGLWFREYLLKLCTRVPSGFSLVNYPEFLAFLTKSRRRLDLS
FT                   DEKVELGLSEEQDPFFYDYKQYLLNDELKLPPEMHVYSTDNSHLPMTDSLRQELDDHIF
FT                   MNEIPPFIEDEEPWLITNETPLLVKIQKQTYKFRNKDAHTSWNIPAILEGNRSRFGPSG
FT                   PKEQISKKMIMKAEEGDYNWIFGILRDNLACADVADSKGYTVLAAAAMHSHLDIVNLLL
FT                   DFGADVNKRSDEGITPLSMCFLQYYPCKSFHPNIAERTLLQESPKSLVTPKISFLLADA
FT                   NIDYLYDVGMPIAGGDELKTSSLDDSLASMQTPESSNMLHKEEVSPVKTVSTDVEKESE
FT                   GAAENVDASTLYSVDTNFESTKCLRNYTINVSRDIMEKSAQAYSSLPQHPCFPYKGTVR
FT                   KMAQSMVERRNRWMTITLLLRRGADPNLCQVPMQALFLAVKAGDVEGVRLLLMSGAQTD
FT                   IQFPPQLQSLTPLHIAVSLPGEEGVKITELLLHVITNVDAKAADEDYVYKGGKADLLPS
FT                   SLKLNNEPGPPKSFYSTHTFIPEEGGRTALHVACEREDNKKCARDIVRLLLSHRANPNV
FT                   LWSGHSPLSLAIASGNDLVVKELLSQGADPNLPLTKGLGTALCVVCDLVYEQQRSVENK
FT                   IALIDRLISYGADVLNPVTLVQGDRTAVGTAVDYGYFKFFQDRKIAHCPFHALMPAERE
FT                   VFMARKRLLEYLGLQLRLAVLSKESRLDTKALYLSKRAELAPCHRLKKKGSSSVRTQSS
FT                   EKQSIPFYKFCYQCGRSIGVRLSPCPRCYGILTCSKYCKTKAWIEFHKKDCNDIMAMIP
FT                   HLEGSAWRVAESP"
FT   assembly_gap    7260158..7260558
FT                   /estimated_length=401
FT                   /gap_type="unknown"
FT   gene            7272694..7274134
FT                   /gene="0710001B24Rik"
FT                   /locus_tag="mCG_16581"
FT                   /note="gene_id=mCG16581.2"
FT   mRNA            join(7272694..7273129,7273271..7274134)
FT                   /gene="0710001B24Rik"
FT                   /locus_tag="mCG_16581"
FT                   /product="RIKEN cDNA 0710001B24"
FT                   /note="gene_id=mCG16581.2 transcript_id=mCT19268.2 created
FT                   on 13-MAR-2003"
FT   CDS             join(7272761..7273129,7273271..7273393)
FT                   /codon_start=1
FT                   /gene="0710001B24Rik"
FT                   /locus_tag="mCG_16581"
FT                   /product="RIKEN cDNA 0710001B24"
FT                   /note="gene_id=mCG16581.2 transcript_id=mCT19268.2
FT                   protein_id=mCP20968.2"
FT                   /protein_id="EDL39989.1"
FT                   /translation="MGTSEAAPPPFARVAPALFIGNARAAGATELLVRAGITLCVNVSR
FT                   QQPGPRAPGVAELRVPVFDDPAEDLLTHLEPTCAAMEAAVRDGGSCLVYCKNGRSRSAA
FT                   VCTAYLMRHRGHSLDRAFQMVKSARPVAEPNLGFWAQLQKYEQTLQAQAILPREPIDPE
FT                   "
FT   gene            complement(7274086..>7276473)
FT                   /locus_tag="mCG_142590"
FT                   /note="gene_id=mCG142590.0"
FT   mRNA            complement(join(7274086..7275684,7276285..>7276473))
FT                   /locus_tag="mCG_142590"
FT                   /product="mCG142590, transcript variant mCT181055"
FT                   /note="gene_id=mCG142590.0 transcript_id=mCT181055.0
FT                   created on 13-MAR-2003"
FT   mRNA            complement(join(7274782..7275684,7276128..7276397))
FT                   /locus_tag="mCG_142590"
FT                   /product="mCG142590, transcript variant mCT181056"
FT                   /note="gene_id=mCG142590.0 transcript_id=mCT181056.0
FT                   created on 13-MAR-2003"
FT   CDS             complement(join(7275289..7275684,7276285..>7276473))
FT                   /codon_start=1
FT                   /locus_tag="mCG_142590"
FT                   /product="mCG142590, isoform CRA_a"
FT                   /note="gene_id=mCG142590.0 transcript_id=mCT181055.0
FT                   protein_id=mCP103977.0 isoform=CRA_a"
FT                   /protein_id="EDL39987.1"
FT                   /translation="GWARQPPGALCAAPGLCTETRRERRSRTRGRTLGKAGHLQPARCN
FT                   YGLRGSLGGGTVAFAGTQVRGTAKSPCALLAGSTWDHSWSPHFRFCRNSRAHAVIQRQG
FT                   QEGGRPGSMETPQNSSTWEAETKASIVPSHPWLYTEWVQPAGLKRVKGPRVKVITTFRC
FT                   PVACPQDYLRRDSQILNSIGLSCWPGFLLSK"
FT   CDS             complement(7275289..7275537)
FT                   /codon_start=1
FT                   /locus_tag="mCG_142590"
FT                   /product="mCG142590, isoform CRA_b"
FT                   /note="gene_id=mCG142590.0 transcript_id=mCT181056.0
FT                   protein_id=mCP103978.0 isoform=CRA_b"
FT                   /protein_id="EDL39988.1"
FT                   /translation="METPQNSSTWEAETKASIVPSHPWLYTEWVQPAGLKRVKGPRVKV
FT                   ITTFRCPVACPQDYLRRDSQILNSIGLSCWPGFLLSK"
FT   assembly_gap    7276483..7277074
FT                   /estimated_length=592
FT                   /gap_type="unknown"
FT   gene            7277075..7286862
FT                   /gene="Rnpepl1"
FT                   /locus_tag="mCG_16590"
FT                   /note="gene_id=mCG16590.2"
FT   mRNA            join(7277075..7277490,7281081..7281221,7281836..7281987,
FT                   7282377..7282493,7282733..7282968,7283169..7283768,
FT                   7284040..7284148,7284960..7285125,7285206..7285348,
FT                   7285584..7286594)
FT                   /gene="Rnpepl1"
FT                   /locus_tag="mCG_16590"
FT                   /product="arginyl aminopeptidase (aminopeptidase B)-like 1,
FT                   transcript variant mCT179574"
FT                   /note="gene_id=mCG16590.2 transcript_id=mCT179574.0 created
FT                   on 03-FEB-2003"
FT   mRNA            join(7277076..7277490,7281081..7281221,7281836..7281987,
FT                   7282377..7282493,7282733..7282968,7283169..7283282,
FT                   7283656..7283768,7284040..7284148,7284895..7285125,
FT                   7285206..7285348,7285584..7286861)
FT                   /gene="Rnpepl1"
FT                   /locus_tag="mCG_16590"
FT                   /product="arginyl aminopeptidase (aminopeptidase B)-like 1,
FT                   transcript variant mCT19277"
FT                   /note="gene_id=mCG16590.2 transcript_id=mCT19277.2 created
FT                   on 03-FEB-2003"
FT   mRNA            join(7277128..7277490,7281081..7281221,7281846..7281987,
FT                   7282377..7282493,7282733..7282968,7283169..7283282,
FT                   7283656..7283768,7284040..7284148,7284895..7285125,
FT                   7285206..7285348,7285584..7286601)
FT                   /gene="Rnpepl1"
FT                   /locus_tag="mCG_16590"
FT                   /product="arginyl aminopeptidase (aminopeptidase B)-like 1,
FT                   transcript variant mCT179573"
FT                   /note="gene_id=mCG16590.2 transcript_id=mCT179573.0 created
FT                   on 03-FEB-2003"
FT   CDS             join(7281860..7281987,7282377..7282493,7282733..7282968,
FT                   7283169..7283282,7283656..7283768,7284040..7284148,
FT                   7284895..7285125,7285206..7285348,7285584..7285877)
FT                   /codon_start=1
FT                   /gene="Rnpepl1"
FT                   /locus_tag="mCG_16590"
FT                   /product="arginyl aminopeptidase (aminopeptidase B)-like 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG16590.2 transcript_id=mCT179573.0
FT                   protein_id=mCP102496.0 isoform=CRA_a"
FT                   /protein_id="EDL39982.1"
FT                   /translation="MSATQSVYVEEEGLYHFHMEHPVPAYLVALVAGDLKPADIGPRSR
FT                   VWAEPCLLPTATSKLSGAVEQWLSAAERLYGPYMWGRYDIVFLPPSFPIVAMENPCLTF
FT                   IISSILESDEFLVIDVIHEVAHSWFGNAVTNATWEEMWLSEGLATYAQRRITTETYGAA
FT                   FTCLETAFRLDALHRQMRLLGEDSPVSKLQVKLEPGVNPSHLMNLFTYEKGYCFVYYLS
FT                   QLCGGPQRFDDFLRAYVEKYKFTSVVAQDLLDSFLSFFPELKEQSVDCRAGLEFERWLN
FT                   ATGPPLAEPDLSQGSSLTRPVEALFQLWTAEPLEQAAASASAIDISKWRTFQTALFLDR
FT                   LLDGSPLPQEVVMSLSKCYSSLLDSMNAEIRIRWLQIVVRNDYYPDLHRVRRFLESQMS
FT                   RMYTIPLYEDLCTGALKSFALEVFYQTQGRLHPNLRRTIQQILSQGLGPSAEPSTEPST
FT                   DLGGAEADTNPDSPALLLGDEAPSSTISLRDVNVSA"
FT   CDS             join(7281860..7281987,7282377..7282493,7282733..7282968,
FT                   7283169..7283282,7283656..7283768,7284040..7284148,
FT                   7284895..7285125,7285206..7285348,7285584..7285877)
FT                   /codon_start=1
FT                   /gene="Rnpepl1"
FT                   /locus_tag="mCG_16590"
FT                   /product="arginyl aminopeptidase (aminopeptidase B)-like 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG16590.2 transcript_id=mCT19277.2
FT                   protein_id=mCP20982.2 isoform=CRA_a"
FT                   /protein_id="EDL39985.1"
FT                   /translation="MSATQSVYVEEEGLYHFHMEHPVPAYLVALVAGDLKPADIGPRSR
FT                   VWAEPCLLPTATSKLSGAVEQWLSAAERLYGPYMWGRYDIVFLPPSFPIVAMENPCLTF
FT                   IISSILESDEFLVIDVIHEVAHSWFGNAVTNATWEEMWLSEGLATYAQRRITTETYGAA
FT                   FTCLETAFRLDALHRQMRLLGEDSPVSKLQVKLEPGVNPSHLMNLFTYEKGYCFVYYLS
FT                   QLCGGPQRFDDFLRAYVEKYKFTSVVAQDLLDSFLSFFPELKEQSVDCRAGLEFERWLN
FT                   ATGPPLAEPDLSQGSSLTRPVEALFQLWTAEPLEQAAASASAIDISKWRTFQTALFLDR
FT                   LLDGSPLPQEVVMSLSKCYSSLLDSMNAEIRIRWLQIVVRNDYYPDLHRVRRFLESQMS
FT                   RMYTIPLYEDLCTGALKSFALEVFYQTQGRLHPNLRRTIQQILSQGLGPSAEPSTEPST
FT                   DLGGAEADTNPDSPALLLGDEAPSSTISLRDVNVSA"
FT   CDS             join(7281860..7281987,7282377..7282493,7282733..7282968,
FT                   7283169..7283422)
FT                   /codon_start=1
FT                   /gene="Rnpepl1"
FT                   /locus_tag="mCG_16590"
FT                   /product="arginyl aminopeptidase (aminopeptidase B)-like 1,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG16590.2 transcript_id=mCT179574.0
FT                   protein_id=mCP102497.0 isoform=CRA_b"
FT                   /protein_id="EDL39983.1"
FT                   /translation="MSATQSVYVEEEGLYHFHMEHPVPAYLVALVAGDLKPADIGPRSR
FT                   VWAEPCLLPTATSKLSGAVEQWLSAAERLYGPYMWGRYDIVFLPPSFPIVAMENPCLTF
FT                   IISSILESDEFLVIDVIHEVAHSWFGNAVTNATWEEMWLSEGLATYAQRRITTETYGAA
FT                   FTCLETAFRLDALHRQMRLLGEDSPVSKLQVKLEPGTLHSRISLGTHAWHPQALLSCCS
FT                   LPCQGFSTSPCQNSFQGQPGCP"
FT   mRNA            join(7283034..7283282,7283656..7283768,7284040..7284148,
FT                   7284895..7285125,7285206..7285348,7285584..7286862)
FT                   /gene="Rnpepl1"
FT                   /locus_tag="mCG_16590"
FT                   /product="arginyl aminopeptidase (aminopeptidase B)-like 1,
FT                   transcript variant mCT179572"
FT                   /note="gene_id=mCG16590.2 transcript_id=mCT179572.0 created
FT                   on 03-FEB-2003"
FT   CDS             join(7283225..7283282,7283656..7283768,7284040..7284148,
FT                   7284895..7285125,7285206..7285348,7285584..7285877)
FT                   /codon_start=1
FT                   /gene="Rnpepl1"
FT                   /locus_tag="mCG_16590"
FT                   /product="arginyl aminopeptidase (aminopeptidase B)-like 1,
FT                   isoform CRA_d"
FT                   /note="gene_id=mCG16590.2 transcript_id=mCT179572.0
FT                   protein_id=mCP102495.0 isoform=CRA_d"
FT                   /protein_id="EDL39986.1"
FT                   /translation="MRLLGEDSPVSKLQVKLEPGVNPSHLMNLFTYEKGYCFVYYLSQL
FT                   CGGPQRFDDFLRAYVEKYKFTSVVAQDLLDSFLSFFPELKEQSVDCRAGLEFERWLNAT
FT                   GPPLAEPDLSQGSSLTRPVEALFQLWTAEPLEQAAASASAIDISKWRTFQTALFLDRLL
FT                   DGSPLPQEVVMSLSKCYSSLLDSMNAEIRIRWLQIVVRNDYYPDLHRVRRFLESQMSRM
FT                   YTIPLYEDLCTGALKSFALEVFYQTQGRLHPNLRRTIQQILSQGLGPSAEPSTEPSTDL
FT                   GGAEADTNPDSPALLLGDEAPSSTISLRDVNVSA"
FT   mRNA            join(7283438..7283768,7284040..7284148,7284895..7285125,
FT                   7285206..7285348,7285584..7286862)
FT                   /gene="Rnpepl1"
FT                   /locus_tag="mCG_16590"
FT                   /product="arginyl aminopeptidase (aminopeptidase B)-like 1,
FT                   transcript variant mCT179575"
FT                   /note="gene_id=mCG16590.2 transcript_id=mCT179575.0 created
FT                   on 03-FEB-2003"
FT   CDS             join(7283676..7283768,7284040..7284148,7284895..7285125,
FT                   7285206..7285348,7285584..7285877)
FT                   /codon_start=1
FT                   /gene="Rnpepl1"
FT                   /locus_tag="mCG_16590"
FT                   /product="arginyl aminopeptidase (aminopeptidase B)-like 1,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG16590.2 transcript_id=mCT179575.0
FT                   protein_id=mCP102494.0 isoform=CRA_c"
FT                   /protein_id="EDL39984.1"
FT                   /translation="MNLFTYEKGYCFVYYLSQLCGGPQRFDDFLRAYVEKYKFTSVVAQ
FT                   DLLDSFLSFFPELKEQSVDCRAGLEFERWLNATGPPLAEPDLSQGSSLTRPVEALFQLW
FT                   TAEPLEQAAASASAIDISKWRTFQTALFLDRLLDGSPLPQEVVMSLSKCYSSLLDSMNA
FT                   EIRIRWLQIVVRNDYYPDLHRVRRFLESQMSRMYTIPLYEDLCTGALKSFALEVFYQTQ
FT                   GRLHPNLRRTIQQILSQGLGPSAEPSTEPSTDLGGAEADTNPDSPALLLGDEAPSSTIS
FT                   LRDVNVSA"
FT   gene            7300398..7313961
FT                   /gene="Capn10"
FT                   /locus_tag="mCG_16575"
FT                   /note="gene_id=mCG16575.2"
FT   mRNA            join(7300398..7301036,7303966..7304097,7305344..7305540,
FT                   7306304..7306521,7308503..7308644,7309321..7309487,
FT                   7309700..7309962,7310716..7310918,7311038..7311299,
FT                   7312795..7312994,7313236..7313281,7313530..7313961)
FT                   /gene="Capn10"
FT                   /locus_tag="mCG_16575"
FT                   /product="calpain 10, transcript variant mCT19261"
FT                   /note="gene_id=mCG16575.2 transcript_id=mCT19261.2 created
FT                   on 31-DEC-2002"
FT   mRNA            join(7300398..7301036,7303966..7304097,7305344..7305540,
FT                   7306304..7306993)
FT                   /gene="Capn10"
FT                   /locus_tag="mCG_16575"
FT                   /product="calpain 10, transcript variant mCT177966"
FT                   /note="gene_id=mCG16575.2 transcript_id=mCT177966.0 created
FT                   on 31-DEC-2002"
FT   CDS             join(7300896..7301036,7303966..7304097,7305344..7305540,
FT                   7306304..7306521,7308503..7308644,7309321..7309487,
FT                   7309700..7309962,7310716..7310918,7311038..7311299,
FT                   7312795..7312994,7313236..7313281,7313530..7313559)
FT                   /codon_start=1
FT                   /gene="Capn10"
FT                   /locus_tag="mCG_16575"
FT                   /product="calpain 10, isoform CRA_b"
FT                   /note="gene_id=mCG16575.2 transcript_id=mCT19261.2
FT                   protein_id=mCP21030.1 isoform=CRA_b"
FT                   /protein_id="EDL39981.1"
FT                   /translation="MRAVRAETPARELFRDAAFPASDSSLFYNLSTPLAQFREDITWRR
FT                   PQEICATPQLFPDNPWEGQVKQGLLGDCWFLCACAALQKSQHLLDQVFPPGQPGWSDQK
FT                   YQGFFTCRIWQFGHWEEVTIDDRLPCLAGRLCFSRCQREDVFWLPLLEKAYAKVHGSYE
FT                   HLWAGQVADALVDLTGSLAERWSLKDVTKASGQQDRPSGGEHRTCRQLLHLKDRCLISC
FT                   SVLSPRAGARELGEFHAFIISDLQELRSQTGQGILLLRIHNPWGRRCWQGLWREGGEGW
FT                   NQVEPAKESELLAQLQEGEFWVEEEEFLREFDEVTIGYPVTEAGHLQSLHTERVLCHTR
FT                   TLPGAWVTGQSAGGCRNNSCFPCNPKFWLRLLEPSEVCVAVLQRPRRRLVGQTRALAGA
FT                   SPAPVNLPGKDYQAVGLHIWKVEKRKISLPRVLSAPPVAGTACHAYDREIHLRCELSPG
FT                   YYLAVPSTFLKDVPGQFLLRVFSTGKISLSAVRLATKGASPGTALPAGEWETVQLQGCW
FT                   RAGQTAGGSRNFASYPCNPCLPFSVPEGAGPRYIRITLQQHCRLSDSQLHPIGFHVFQV
FT                   PADGENQDACSLLLQEPLLSCVPHRYAQEVSRLCLLSVGNYRIVPSTYLPDTEGTFTVT
FT                   IATRIDRQSIHSQEMLGQLLQEVSFMAVMKA"
FT   CDS             join(7300896..7301036,7303966..7304097,7305344..7305540,
FT                   7306304..7306628)
FT                   /codon_start=1
FT                   /gene="Capn10"
FT                   /locus_tag="mCG_16575"
FT                   /product="calpain 10, isoform CRA_a"
FT                   /note="gene_id=mCG16575.2 transcript_id=mCT177966.0
FT                   protein_id=mCP100888.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q9CPY2"
FT                   /db_xref="InterPro:IPR000169"
FT                   /db_xref="InterPro:IPR001300"
FT                   /db_xref="InterPro:IPR022684"
FT                   /db_xref="InterPro:IPR028791"
FT                   /db_xref="MGI:MGI:1344392"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CPY2"
FT                   /protein_id="EDL39980.1"
FT                   /translation="MRAVRAETPARELFRDAAFPASDSSLFYNLSTPLAQFREDITWRR
FT                   PQEICATPQLFPDNPWEGQVKQGLLGDCWFLCACAALQKSQHLLDQVFPPGQPGWSDQK
FT                   YQGFFTCRIWQFGHWEEVTIDDRLPCLAGRLCFSRCQREDVFWLPLLEKAYAKVHGSYE
FT                   HLWAGQVADALVDLTGSLAERWSLKDVTKASGQQDRPSGGEHRTCRQLLHLKDRCLISC
FT                   SVLSPRAGTAMATTPSTISLLQRRKSVLERLSWLGVLLLPLL"
FT   assembly_gap    7332820..7333079
FT                   /estimated_length=260
FT                   /gap_type="unknown"
FT   assembly_gap    7334630..7334649
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7338644..7338663
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7339740..7339759
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7341148..7341167
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            7342817..7354891
FT                   /gene="Gpr35"
FT                   /locus_tag="mCG_133024"
FT                   /note="gene_id=mCG133024.1"
FT   mRNA            join(7342817..7342978,7352406..7354891)
FT                   /gene="Gpr35"
FT                   /locus_tag="mCG_133024"
FT                   /product="G protein-coupled receptor 35, transcript variant
FT                   mCT134388"
FT                   /note="gene_id=mCG133024.1 transcript_id=mCT134388.1
FT                   created on 31-DEC-2002"
FT   mRNA            join(7342817..7342978,7352992..7354891)
FT                   /gene="Gpr35"
FT                   /locus_tag="mCG_133024"
FT                   /product="G protein-coupled receptor 35, transcript variant
FT                   mCT177917"
FT                   /note="gene_id=mCG133024.1 transcript_id=mCT177917.0
FT                   created on 31-DEC-2002"
FT   mRNA            join(7345047..7345145,7352406..7354891)
FT                   /gene="Gpr35"
FT                   /locus_tag="mCG_133024"
FT                   /product="G protein-coupled receptor 35, transcript variant
FT                   mCT177916"
FT                   /note="gene_id=mCG133024.1 transcript_id=mCT177916.0
FT                   created on 31-DEC-2002"
FT   assembly_gap    7346870..7347193
FT                   /estimated_length=324
FT                   /gap_type="unknown"
FT   mRNA            join(7349117..7349142,7352406..7354891)
FT                   /gene="Gpr35"
FT                   /locus_tag="mCG_133024"
FT                   /product="G protein-coupled receptor 35, transcript variant
FT                   mCT177915"
FT                   /note="gene_id=mCG133024.1 transcript_id=mCT177915.0
FT                   created on 31-DEC-2002"
FT   CDS             7352416..7353339
FT                   /codon_start=1
FT                   /gene="Gpr35"
FT                   /locus_tag="mCG_133024"
FT                   /product="G protein-coupled receptor 35, isoform CRA_a"
FT                   /note="gene_id=mCG133024.1 transcript_id=mCT177915.0
FT                   protein_id=mCP100838.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q3TBY9"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:1929509"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TBY9"
FT                   /protein_id="EDL39976.1"
FT                   /translation="MNSTTCNSTLTWPASVNNFFIIYSALLLVLGLLLNSVALWVFCYR
FT                   MHQWTETRIYMTNLAVADLCLLCSLPFVLYSLKYSSSDTPVCQLSQGIYLANRYMSISL
FT                   VTAIAVDRYVAVRHPLRARELRSPRQAAAVCVALWVIVVTSLVVRWRLGMQEGGFCFSS
FT                   QTRRNFSTTAFSLLGFYLPLAIVVFCSLQVVTVLSRRPAADVGQAEATQKATHMVWANL
FT                   AVFVICFLPLHVVLTVQVSLNLNTCAARDTFSRALSITGKLSDTNCCLDAICYYYMARE
FT                   FQEASKPATSSNTPHKSQDSQILSLT"
FT   CDS             7352416..7353339
FT                   /codon_start=1
FT                   /gene="Gpr35"
FT                   /locus_tag="mCG_133024"
FT                   /product="G protein-coupled receptor 35, isoform CRA_a"
FT                   /note="gene_id=mCG133024.1 transcript_id=mCT177916.0
FT                   protein_id=mCP100839.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q3TBY9"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:1929509"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TBY9"
FT                   /protein_id="EDL39977.1"
FT                   /translation="MNSTTCNSTLTWPASVNNFFIIYSALLLVLGLLLNSVALWVFCYR
FT                   MHQWTETRIYMTNLAVADLCLLCSLPFVLYSLKYSSSDTPVCQLSQGIYLANRYMSISL
FT                   VTAIAVDRYVAVRHPLRARELRSPRQAAAVCVALWVIVVTSLVVRWRLGMQEGGFCFSS
FT                   QTRRNFSTTAFSLLGFYLPLAIVVFCSLQVVTVLSRRPAADVGQAEATQKATHMVWANL
FT                   AVFVICFLPLHVVLTVQVSLNLNTCAARDTFSRALSITGKLSDTNCCLDAICYYYMARE
FT                   FQEASKPATSSNTPHKSQDSQILSLT"
FT   CDS             7352416..7353339
FT                   /codon_start=1
FT                   /gene="Gpr35"
FT                   /locus_tag="mCG_133024"
FT                   /product="G protein-coupled receptor 35, isoform CRA_a"
FT                   /note="gene_id=mCG133024.1 transcript_id=mCT134388.1
FT                   protein_id=mCP81926.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q3TBY9"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:1929509"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TBY9"
FT                   /protein_id="EDL39978.1"
FT                   /translation="MNSTTCNSTLTWPASVNNFFIIYSALLLVLGLLLNSVALWVFCYR
FT                   MHQWTETRIYMTNLAVADLCLLCSLPFVLYSLKYSSSDTPVCQLSQGIYLANRYMSISL
FT                   VTAIAVDRYVAVRHPLRARELRSPRQAAAVCVALWVIVVTSLVVRWRLGMQEGGFCFSS
FT                   QTRRNFSTTAFSLLGFYLPLAIVVFCSLQVVTVLSRRPAADVGQAEATQKATHMVWANL
FT                   AVFVICFLPLHVVLTVQVSLNLNTCAARDTFSRALSITGKLSDTNCCLDAICYYYMARE
FT                   FQEASKPATSSNTPHKSQDSQILSLT"
FT   CDS             7353064..7353339
FT                   /codon_start=1
FT                   /gene="Gpr35"
FT                   /locus_tag="mCG_133024"
FT                   /product="G protein-coupled receptor 35, isoform CRA_b"
FT                   /note="gene_id=mCG133024.1 transcript_id=mCT177917.0
FT                   protein_id=mCP100837.0 isoform=CRA_b"
FT                   /db_xref="GOA:A0A0A0MQ77"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:1929509"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0A0MQ77"
FT                   /protein_id="EDL39979.1"
FT                   /translation="MVWANLAVFVICFLPLHVVLTVQVSLNLNTCAARDTFSRALSITG
FT                   KLSDTNCCLDAICYYYMAREFQEASKPATSSNTPHKSQDSQILSLT"
FT   assembly_gap    7364510..7364529
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            7376628..7382699
FT                   /gene="Aqp12"
FT                   /locus_tag="mCG_55296"
FT                   /note="gene_id=mCG55296.2"
FT   mRNA            join(7376628..7377303,7378861..7378974,7382403..7382698)
FT                   /gene="Aqp12"
FT                   /locus_tag="mCG_55296"
FT                   /product="aquaporin 12, transcript variant mCT179604"
FT                   /note="gene_id=mCG55296.2 transcript_id=mCT179604.0 created
FT                   on 03-FEB-2003"
FT   mRNA            join(7376630..7377303,7378858..7378974,7382403..7382699)
FT                   /gene="Aqp12"
FT                   /locus_tag="mCG_55296"
FT                   /product="aquaporin 12, transcript variant mCT55479"
FT                   /note="gene_id=mCG55296.2 transcript_id=mCT55479.1 created
FT                   on 03-FEB-2003"
FT   CDS             join(7376697..7377303,7378858..7378974,7382403..7382551)
FT                   /codon_start=1
FT                   /gene="Aqp12"
FT                   /locus_tag="mCG_55296"
FT                   /product="aquaporin 12, isoform CRA_b"
FT                   /note="gene_id=mCG55296.2 transcript_id=mCT55479.1
FT                   protein_id=mCP41041.2 isoform=CRA_b"
FT                   /protein_id="EDL39975.1"
FT                   /translation="MASLNVSLCFFFATCAICEVARRASKALLPAGTYASFAREAVGAA
FT                   QLAACCLEMRVLVELGPWAGGFGPDLLLTLVFLLFLVHGVTFDGASANPTVALQEFLMV
FT                   EASLPNTLLKLSAQVLGAQAACALTQRCWAWELSELHLLQSLMAAHCSSTLRTSVLQGM
FT                   LVEGACTFFFHLSLLHLQHSLLVYRVPALALLVTLMAYTAGPYTSAFFNPALAASVTFH
FT                   CPGNTLLEYAHVYCLGPVAGMILAVLLHQGHLPRLFQRNLFYRQKSKYRTPRGKLSPGS
FT                   VDTKMHKGE"
FT   CDS             join(7376697..7377303,7378861..7378974,7382403..7382551)
FT                   /codon_start=1
FT                   /gene="Aqp12"
FT                   /locus_tag="mCG_55296"
FT                   /product="aquaporin 12, isoform CRA_a"
FT                   /note="gene_id=mCG55296.2 transcript_id=mCT179604.0
FT                   protein_id=mCP102526.0 isoform=CRA_a"
FT                   /protein_id="EDL39974.1"
FT                   /translation="MASLNVSLCFFFATCAICEVARRASKALLPAGTYASFAREAVGAA
FT                   QLAACCLEMRVLVELGPWAGGFGPDLLLTLVFLLFLVHGVTFDGASANPTVALQEFLMV
FT                   EASLPNTLLKLSAQVLGAQAACALTQRCWAWELSELHLLQSLMAAHCSSTLRTSVLQGM
FT                   LVEGACTFFFHLSLLHLQHSLLVYRVPALALLVTLMAYTGPYTSAFFNPALAASVTFHC
FT                   PGNTLLEYAHVYCLGPVAGMILAVLLHQGHLPRLFQRNLFYRQKSKYRTPRGKLSPGSV
FT                   DTKMHKGE"
FT   assembly_gap    7380872..7381221
FT                   /estimated_length=350
FT                   /gap_type="unknown"
FT   gene            complement(7387817..7472332)
FT                   /gene="Kif1a"
FT                   /locus_tag="mCG_133020"
FT                   /note="gene_id=mCG133020.1"
FT   mRNA            complement(join(7387817..7389014,7389467..7389585,
FT                   7390322..7390514,7390973..7391125,7391728..7391852,
FT                   7392241..7392318,7392840..7393040,7393445..7393590,
FT                   7393978..7394039,7395098..7395231,7396140..7396254,
FT                   7397351..7397374,7407328..7407433,7409517..7409601,
FT                   7409699..7409765,7410227..7410335,7411101..7411156,
FT                   7412056..7412174,7412567..7412657,7412825..7412993,
FT                   7413098..7413236,7414071..7414156,7417122..7417240,
FT                   7422887..7423024,7424723..7424901,7425476..7425624,
FT                   7426345..7426438,7426617..7426689,7426760..7426940,
FT                   7429462..7429545,7430845..7430951,7431386..7431465,
FT                   7433148..7433223,7433515..7433594,7434797..7434930,
FT                   7436695..7436837,7437704..7437782,7439133..7439208,
FT                   7442958..7442975,7443689..7443754,7444458..7444535,
FT                   7445606..7445717,7446801..7446979,7447692..7447757,
FT                   7448338..7448517,7449411..7449487,7452966..7453134,
FT                   7472275..7472332))
FT                   /gene="Kif1a"
FT                   /locus_tag="mCG_133020"
FT                   /product="kinesin family member 1A"
FT                   /note="gene_id=mCG133020.1 transcript_id=mCT134384.1
FT                   created on 11-APR-2003"
FT   CDS             complement(join(7388972..7389014,7389467..7389585,
FT                   7390322..7390514,7390973..7391125,7391728..7391852,
FT                   7392241..7392318,7392840..7393040,7393445..7393590,
FT                   7393978..7394039,7395098..7395231,7396140..7396254,
FT                   7397351..7397374,7407328..7407433,7409517..7409601,
FT                   7409699..7409765,7410227..7410335,7411101..7411156,
FT                   7412056..7412174,7412567..7412657,7412825..7412993,
FT                   7413098..7413236,7414071..7414156,7417122..7417240,
FT                   7422887..7423024,7424723..7424901,7425476..7425624,
FT                   7426345..7426438,7426617..7426689,7426760..7426940,
FT                   7429462..7429545,7430845..7430951,7431386..7431465,
FT                   7433148..7433223,7433515..7433594,7434797..7434930,
FT                   7436695..7436837,7437704..7437782,7439133..7439208,
FT                   7442958..7442975,7443689..7443754,7444458..7444535,
FT                   7445606..7445717,7446801..7446979,7447692..7447757,
FT                   7448338..7448517,7449411..7449487,7452966..7453071))
FT                   /codon_start=1
FT                   /gene="Kif1a"
FT                   /locus_tag="mCG_133020"
FT                   /product="kinesin family member 1A"
FT                   /note="gene_id=mCG133020.1 transcript_id=mCT134384.1
FT                   protein_id=mCP81231.1"
FT                   /db_xref="GOA:G3UW47"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR001752"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR019821"
FT                   /db_xref="InterPro:IPR022140"
FT                   /db_xref="InterPro:IPR022164"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027640"
FT                   /db_xref="MGI:MGI:108391"
FT                   /db_xref="UniProtKB/TrEMBL:G3UW47"
FT                   /protein_id="EDL39973.1"
FT                   /translation="MAGASVKVAVRVRPFNSREMSRDSKCIIQMSGSTTTIVNPKQPKE
FT                   TPKSFSFDYSYWSHTSPEDINYASQKQVYRDIGEEMLQHAFEGYNVCIFAYGQTGAGKS
FT                   YTMMGKQEKDQQGIIPQLCEDLFSRINDTTNDNMSYSVEVSYMEIYCERVRDLLNPKNK
FT                   GNLRVREHPLLGPYVEDLSKLAVTSYNDIQDLMDSGNKARTVAATNMNETSSRSHAVFN
FT                   IIFTQKRHDAETNITTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKV
FT                   ISALAEMDSGPNKNKKKKKTDFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDE
FT                   TLSTLRYADRAKQIRCNAIINEDPNNKLIRELKDEVTRLRDLLYAQGLGDITDMTNALV
FT                   GMSPSSSLSALSSRAASVSSLHERILFAPGSEEAIERLKETEKIIAELNETWEEKLRRT
FT                   EAIRMEREALLAEMGVAMREDGGTLGVFSPKKTPHLVNLNEDPLMSECLLYYIKDGVTR
FT                   VGREDAERRQDIVLSGHFIKEEHCIFRSDSRGGGEAVVTLEPCEGADTYVNGKKVTEPS
FT                   ILRSGNRIIMGKSHVFRFNHPEQARQERERTPCAETPAEPVDWAFAQRELLEKQGIDMK
FT                   QEMEQRLQELEDQYRREREEATYLLEQQRLDYESKLEALQKQMDSRYYPEVNEEEEEPE
FT                   DEVQWTERECELALWAFRKWKWYQFTSLRDLLWGNAIFLKEANAISVELKKKVQFQFVL
FT                   LTDTLYSPLPPDLLPPEAAKDRETRPFPRTIVAVEVQDQKNGATHYWTLEKLRQRLDLM
FT                   REMYDRAAEVPSSVVEDCDNVVTGGDPFYDRFPWFRLVGRAFVYLSNLLYPVPLVHRVA
FT                   IVSEKGEVKGFLRVAVQAISADEEAPDYGSGVRQSGTAKISFDDQHFEKFQSESCPVVG
FT                   MSRSGTSQEELRIVEGQGQGADAGPSADEVNNNTCSAVPPEGLMDSPEKAALDGPLDTA
FT                   LDHLRLGSTFTFRVTVLQASSISAEYADIFCQFNFIHRHDEAFSTEPLKNTGRGPPLGF
FT                   YHVQNIAVEVTKSFIEYIKSQPIVFEVFGHYQQHPFPPLCKDVLSPLRPSRRHFPRVMP
FT                   LSKPVPATKLSTMTRPSPGPCHCKYDLLVYFEICELEANGDYIPAVVDHRGGMPCMGTF
FT                   LLHQGIQRRITVTLLHETGSHIRWKEVRELVVGRIRNTPETDEALIDPNILSLNILSSG
FT                   YVHPAQDDRVSFGNDTRTFYQFEAAWDSSMHNSLLLNRVTPYREKIYMTLSAYIEMENC
FT                   TQPAVITKDFCMVFYSRDAKLPASRSIRNLFGSGSLRATEGNRVTGVYELSLCHVADAG
FT                   SPGMQRRRRRVLDTSVAYVRGEENLAGWRPRSDSLILDHQWELEKLSLLQEVEKTRHYL
FT                   LLREKLETTQRPGPEVLSPASSEDSESRSSSGASSPLSAEGQPSPLEAPNERQRELAVK
FT                   CLRLLMHTFNREYTHSHVCISASESKLSEMSVTLMRDPSMSPLGAATLTPSSTCPSLIE
FT                   GRYGATDVRTPQPCSRPASPEPELLPELDSKKTPSPVRATETEKEPQRLLVPDIQEIRV
FT                   SPIVSKKGYLHFLEPHTAGWAKRFVVVRRPYAYMYNSDKDTVERFVLNLSTAQVEYSED
FT                   QQAMLKTPNTFAVCTEHRGILLQANSDKDMHDWLYAFNPLLAGTIRSKLSRRRSAQMRV
FT                   "
FT   assembly_gap    7415770..7415874
FT                   /estimated_length=105
FT                   /gap_type="unknown"
FT   assembly_gap    7425037..7425056
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7470510..7470553
FT                   /estimated_length=44
FT                   /gap_type="unknown"
FT   assembly_gap    7481660..7481679
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7485530..7485569
FT                   /estimated_length=40
FT                   /gap_type="unknown"
FT   gene            7501335..7511493
FT                   /gene="Agxt"
FT                   /locus_tag="mCG_16569"
FT                   /note="gene_id=mCG16569.0"
FT   mRNA            join(7501335..7501614,7501699..7501891,7503387..7503451,
FT                   7503992..7504092,7505373..7505443,7506409..7506493,
FT                   7507401..7507496,7508155..7508224,7510142..7510237,
FT                   7510598..7510726,7511147..7511493)
FT                   /gene="Agxt"
FT                   /locus_tag="mCG_16569"
FT                   /product="alanine-glyoxylate aminotransferase, transcript
FT                   variant mCT19255"
FT                   /note="gene_id=mCG16569.0 transcript_id=mCT19255.0 created
FT                   on 30-DEC-2002"
FT   CDS             join(7501384..7501614,7501699..7501891,7503387..7503451,
FT                   7503992..7504092,7505373..7505443,7506409..7506493,
FT                   7507401..7507496,7508155..7508224,7510142..7510237,
FT                   7510598..7510726,7511147..7511254)
FT                   /codon_start=1
FT                   /gene="Agxt"
FT                   /locus_tag="mCG_16569"
FT                   /product="alanine-glyoxylate aminotransferase, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG16569.0 transcript_id=mCT19255.0
FT                   protein_id=mCP20974.1 isoform=CRA_b"
FT                   /db_xref="GOA:O35423"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="MGI:MGI:1329033"
FT                   /db_xref="PDB:3KGW"
FT                   /db_xref="PDB:3KGX"
FT                   /db_xref="UniProtKB/Swiss-Prot:O35423"
FT                   /protein_id="EDL39972.1"
FT                   /translation="MFRMLAKASVTLGSRAAGWVRTMGSYQLLVPPPEALSKPLSVPTR
FT                   LLLGPGPSNLAPRVLAAGSLRMIGHMQKEMLQIMEEIKQGIQYVFQTRNPLTLVVSGSG
FT                   HCAMETALFNLLEPGDSFLTGTNGIWGMRAAEIADRIGARVHQMIKKPGEHYTLQEVEE
FT                   GLAQHKPVLLFLVHGESSTGVVQPLDGFGELCHRYQCLLLVDSVASLGGVPIYMDQQGI
FT                   DIMYSSSQKVLNAPPGISLISFNDKAKYKVYSRKTKPVSFYTDITYLAKLWGCEGETRV
FT                   IHHTTPVTSLYCLRESLALIAEQGLENCWRRHREATAHLHKHLQEMGLKFFVKDPEIRL
FT                   PTITTVTVPAGYNWRDIVSYVLDHFSIEISGGLGPTEERVLRIGLLGYNATTENVDRVA
FT                   EALREALQHCPKNKL"
FT   mRNA            join(7501422..7501605,7501876..7501891,7503387..7503451,
FT                   7503992..7504092,7505373..7505443,7506409..7506493,
FT                   7507401..7507496,7508155..7508224,7510142..7510237,
FT                   7510598..7510726,7511147..7511493)
FT                   /gene="Agxt"
FT                   /locus_tag="mCG_16569"
FT                   /product="alanine-glyoxylate aminotransferase, transcript
FT                   variant mCT177964"
FT                   /note="gene_id=mCG16569.0 transcript_id=mCT177964.0 created
FT                   on 30-DEC-2002"
FT   CDS             join(7501450..7501605,7501876..7501891,7503387..7503451,
FT                   7503992..7504092,7505373..7505443,7506409..7506493,
FT                   7507401..7507496,7508155..7508224,7510142..7510237,
FT                   7510598..7510726,7511147..7511254)
FT                   /codon_start=1
FT                   /gene="Agxt"
FT                   /locus_tag="mCG_16569"
FT                   /product="alanine-glyoxylate aminotransferase, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG16569.0 transcript_id=mCT177964.0
FT                   protein_id=mCP100886.0 isoform=CRA_a"
FT                   /protein_id="EDL39971.1"
FT                   /translation="MGSYQLLVPPPEALSKPLSVPTRLLLGPGPSNLAPRVLAAGSLRM
FT                   IGHMQKEIADRIGARVHQMIKKPGEHYTLQEVEEGLAQHKPVLLFLVHGESSTGVVQPL
FT                   DGFGELCHRYQCLLLVDSVASLGGVPIYMDQQGIDIMYSSSQKVLNAPPGISLISFNDK
FT                   AKYKVYSRKTKPVSFYTDITYLAKLWGCEGETRVIHHTTPVTSLYCLRESLALIAEQGL
FT                   ENCWRRHREATAHLHKHLQEMGLKFFVKDPEIRLPTITTVTVPAGYNWRDIVSYVLDHF
FT                   SIEISGGLGPTEERVLRIGLLGYNATTENVDRVAEALREALQHCPKNKL"
FT   gene            complement(7517435..7526952)
FT                   /gene="2310007B03Rik"
FT                   /locus_tag="mCG_16578"
FT                   /note="gene_id=mCG16578.1"
FT   mRNA            complement(join(7517435..7518180,7518997..7519353,
FT                   7520567..7520720,7522059..7522284,7525682..7526431,
FT                   7526883..7526952))
FT                   /gene="2310007B03Rik"
FT                   /locus_tag="mCG_16578"
FT                   /product="RIKEN cDNA 2310007B03"
FT                   /note="gene_id=mCG16578.1 transcript_id=mCT19264.1 created
FT                   on 03-FEB-2003"
FT   CDS             complement(join(7518088..7518180,7518997..7519353,
FT                   7520567..7520720,7522059..7522284,7525682..7526210))
FT                   /codon_start=1
FT                   /gene="2310007B03Rik"
FT                   /locus_tag="mCG_16578"
FT                   /product="RIKEN cDNA 2310007B03"
FT                   /note="gene_id=mCG16578.1 transcript_id=mCT19264.1
FT                   protein_id=mCP20966.1"
FT                   /protein_id="EDL39970.1"
FT                   /translation="MPGSEMPAPCVFAPDMAEQVPLWHHYLLAIQSRESPRVQDYQRAE
FT                   NILLTVLERVHALDSRFIVDYSRDLEAFQFALRSSEDPLDVEVLLGVDSEALLIEESEA
FT                   TEPGDGPAICRLGVLKEASGLEPWMTADIFSVSSEDRDKCCGHLVPSKVLCVLKDLLVA
FT                   AIVHCKHHRLIPPGSLNAANLKEGQMRLSLLVSSGWRKIRFNVVPVVRKKHRVPALEGA
FT                   QLKLGFPEGILRRIASHGVDLVPANAQHWRISTGYLLSRLLDALGSLPGHRLDSLSILD
FT                   RVNLESWQGGSQNHGLTFDHLKTVLLWASTLFPAPEDWADLQGSVYRQLVVLLCCLATR
FT                   KLPHFLYPEHNLLQDGGLDLGAIYQRVEHFASQPEESLRIHVTHLGPSRPPRIDNGVKA
FT                   LLQLPASDPTYWATAYFDFLLDKFQVFNIQDKDRISAMQNIFQKTKTMGSENS"
FT   gene            <7546115..7597195
FT                   /locus_tag="mCG_133041"
FT                   /note="gene_id=mCG133041.1"
FT   mRNA            join(<7546115..7546238,7547153..7547301,7549445..7549551,
FT                   7551040..7551181,7554968..7555071,7555597..7555794,
FT                   7556136..7556403,7556545..7556751,7556962..7557161,
FT                   7559106..7559343,7559586..7559789,7560053..7560199,
FT                   7560456..7560686,7564538..7564731,7567469..7567596,
FT                   7567851..7568020,7568785..7568961,7571976..7572089,
FT                   7575314..7575457,7578866..7579083,7579581..7579740,
FT                   7580099..7580266,7581460..7581814,7582038..7582216,
FT                   7583054..7583174,7583839..7583972,7589643..7589741,
FT                   7590168..7590293,7592684..7592815,7593615..7593794,
FT                   7594910..7597195)
FT                   /locus_tag="mCG_133041"
FT                   /product="mCG133041"
FT                   /note="gene_id=mCG133041.1 transcript_id=mCT134405.1
FT                   created on 03-FEB-2003"
FT   CDS             join(7546115..7546238,7547153..7547301,7549445..7549551,
FT                   7551040..7551181,7554968..7555071,7555597..7555794,
FT                   7556136..7556403,7556545..7556751,7556962..7557161,
FT                   7559106..7559343,7559586..7559789,7560053..7560199,
FT                   7560456..7560686,7564538..7564731,7567469..7567596,
FT                   7567851..7568020,7568785..7568961,7571976..7572089,
FT                   7575314..7575457,7578866..7579083,7579581..7579740,
FT                   7580099..7580266,7581460..7581814,7582038..7582216,
FT                   7583054..7583174,7583839..7583972,7589643..7589741,
FT                   7590168..7590293,7592684..7592815,7593615..7593794,
FT                   7594910..7594978)
FT                   /codon_start=1
FT                   /locus_tag="mCG_133041"
FT                   /product="mCG133041"
FT                   /note="gene_id=mCG133041.1 transcript_id=mCT134405.1
FT                   protein_id=mCP81248.1"
FT                   /protein_id="EDL39969.1"
FT                   /translation="MARREDRALTVRGEGQRASPTPVPARIREIVSSSLGEEPLSGLRE
FT                   PPATTSHAREESELLQEELTRLEDLLAQADAEREELASRCHMVSQRLQARLDTTEARLR
FT                   KSELEHSMDLEEALSRLEASQQRSMGLSQVNTLLRQQLEHMQKANDTLARELTRATHSL
FT                   VHLQRKLELQESQRLSLRQPRDILPLWRQAKALQTHLAELRASTERGLTDVQADMTRTA
FT                   QRLHMACLNLDSHLRLTASSMTSDLEQRLREQAREMLQLQGQWAAEKVALQARLSEQTL
FT                   LVEKLSVQKEQGERAILTLKSDIQRLVCGAGNEELGAGALPCVSARLRGLCPQKSRRSG
FT                   GQLAVDELRDEVESLHHVLASIKEVAQSDAMCPELAWSSSIEVREAQARLRSPPRSVSP
FT                   HQRMSPARTSSPTSLHPALQAVQAAIERRQQREQELRLRLESSQEEAAGLREQLSGYRQ
FT                   ELRTSQRLLQDRAQEHEDLLGQLEAQRQEAQLSQASVHLLEREKEALETTMEELRAKAD
FT                   IREAETQKLEVTNAELRRSLLLRAEQKAELAQQSERSLRELEARWVVRGCRPAGVPQTV
FT                   RLQFAMASLKRPVNFAFWPRGLSQGRVEQLEEKVSGLRKELATSREALSSMQLQRDILE
FT                   TEKESLHGALAQAESGNADLELLVTRLKAEGMEQQDSLAKMAALLEGLSQDKGTLNHLA
FT                   LQLEQERDQLREQQKMLQQEQAGMREQLTQTGQQLGLIRAERRSLKETCGHLEQKQDHL
FT                   EKQVVLLGQENAQLREQVGQVTNKKQALEKQLAQSLQDQEAQMDILQEALHEKNTLSEE
FT                   RAQLLAKQEALERHSELVTKEAADLRAERNSLENSLFEAQRLTTQLQTQQEQLEGKAEA
FT                   AQLARRALQVEIERLKSDWEVRETKLQLHLGQLQQQAAQQEQEAQLALERQELAHTEDL
FT                   ARLHREKDTLSLSLAEEKEAAARWMEQQKELLTRSAADREALQGEIQNLKQERDESLLQ
FT                   LEHEMQQALSLKDAEKSLLSKELSGAHRELERARQEAQNQQVQAEATVTTMTKELRTLQ
FT                   VQFEEAISTHQREADTLREKLREIAAERSSVRREAEELQAQLNVAHERLAELRQELQAS
FT                   EESREGLQREALGARRALEDEVQEKDVLQHSNTELRASIHRAEQEKASLKRSKEEQEQK
FT                   LLLLQEAQVAAQKEAYELRTRLQELERAQRDTRRKLQERHRQVRTLEAENQRKRQEVSD
FT                   LQAQVSRDAQHRQKNLQESLELQRQVAEAQAAHDGVQKEVLGLRQKLAEVEASGETRAK
FT                   QLEGHLCESQRAEQTLQAELCRITRKLQEASNQADSLQRSLDNACSRVHVLEQELAKAE
FT                   GARCNAEAQLGRLWSTLCSGLGQSRNLLASPKRPHSPTTGSSQTRPGRQRTSPPTRSYS
FT                   PARWPSPVPVDPKSEVIDVAFVRDALRDLVQGLLEAQQERDNSGIQVANLSSQLSEAER
FT                   ERLRLQSRVEQLQRDLADAEEGQRRAESALQSAQAARALQKEALQRLETEHLASARAAG
FT                   QERRRLQEQVDTLRQALEESSRPSQSLADKGRLLEQPLQQVLPHSRRDRAERRALREQT
FT                   TSLRTERARLQGELAALRTRLIQTEQETLRKEEDRAMLGAKKELLLQSLSHLHQEVDGA
FT                   LRQSQQLQAQMAELEQAHTQRLQELAAQHQRDLAAEAQRLHEAQLQATQALESREQIHQ
FT                   QRVKVLERQVASLKKRLDKEVWQRQQQAHSD"
FT   assembly_gap    7568363..7568382
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7593886..7594077
FT                   /estimated_length=192
FT                   /gap_type="unknown"
FT   gene            7601952..7663668
FT                   /gene="Sned1"
FT                   /locus_tag="mCG_16584"
FT                   /note="gene_id=mCG16584.2"
FT   mRNA            join(7601952..7602315,7622307..7622594,7625005..7625145,
FT                   7625684..7625846,7627687..7627812,7628142..7628255,
FT                   7631076..7631189,7631317..7631430,7636968..7637093,
FT                   7637415..7637519,7637663..7637776,7638300..7638416,
FT                   7639837..7639953,7640132..7640248,7640393..7640506,
FT                   7641085..7641258,7646523..7646636,7647279..7647392,
FT                   7647694..7647807,7648311..7648424,7648752..7649030,
FT                   7649244..7649427,7649617..7649729,7650428..7650709,
FT                   7651840..7651984,7652056..7652138,7652972..7653067,
FT                   7655350..7655466,7656100..7656187,7661817..7661898,
FT                   7662364..7663668)
FT                   /gene="Sned1"
FT                   /locus_tag="mCG_16584"
FT                   /product="sushi, nidogen and EGF-like domains 1, transcript
FT                   variant mCT165639"
FT                   /note="gene_id=mCG16584.2 transcript_id=mCT165639.1 created
FT                   on 21-FEB-2003"
FT   mRNA            join(7601952..7602315,7622307..7622594,7625005..7625145,
FT                   7625684..7625846,7627687..7627812,7628142..7628255,
FT                   7631076..7631189,7631317..7631430,7636968..7637093,
FT                   7637415..7637519,7637663..7637776,7638300..7638416,
FT                   7639837..7639953,7640132..7640248,7640393..7640506,
FT                   7641085..7643263)
FT                   /gene="Sned1"
FT                   /locus_tag="mCG_16584"
FT                   /product="sushi, nidogen and EGF-like domains 1, transcript
FT                   variant mCT19270"
FT                   /note="gene_id=mCG16584.2 transcript_id=mCT19270.2 created
FT                   on 21-FEB-2003"
FT   CDS             join(7602103..7602315,7622307..7622594,7625005..7625145,
FT                   7625684..7625846,7627687..7627812,7628142..7628255,
FT                   7631076..7631189,7631317..7631430,7636968..7637093,
FT                   7637415..7637519,7637663..7637776,7638300..7638416,
FT                   7639837..7639953,7640132..7640248,7640393..7640506,
FT                   7641085..7641258,7646523..7646636,7647279..7647392,
FT                   7647694..7647807,7648311..7648424,7648752..7649030,
FT                   7649244..7649427,7649617..7649729,7650428..7650709,
FT                   7651840..7651984,7652056..7652138,7652972..7653067,
FT                   7655350..7655466,7656100..7656187,7661817..7661898,
FT                   7662364..7662375)
FT                   /codon_start=1
FT                   /gene="Sned1"
FT                   /locus_tag="mCG_16584"
FT                   /product="sushi, nidogen and EGF-like domains 1, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG16584.2 transcript_id=mCT165639.1
FT                   protein_id=mCP81416.1 isoform=CRA_b"
FT                   /protein_id="EDL39968.1"
FT                   /translation="MRLGAAWALLLAAALGLGTRGVRAAVALADFYPFGTKRGDTVTPK
FT                   QDDGGSGLQPLSVPFPFFGAEHSGLYVNNNGIISFLKEVSQFTPVAFPIAKDRCVVAAF
FT                   WADVDNRRAGDVYYREATDPAMLNRATEDIRRYFPELPDFSATWVFVATWYRVTFFGGS
FT                   SSSPVNTFQTVLITDGRFSFTIFNYESILWTTGTHASSGGDTDGLGGIAAQAGFNAGDG
FT                   HRYFNIPGSRTADMAEVETTTNVGVPGRWAFRIDDAQVRVGGCGHTTSVCLVLRPCLNG
FT                   GKCIDDCVTGNPSYTCSCLAGFTGRRCHLDVNECASHPCQNGGTCTHGVNSFSCQCPAG
FT                   FKGPTCESAQSPCDNKVCQNGGQCQAESSSAVCVCQAGYTGATCETDVDECSSDPCQNG
FT                   GSCVDLVGNYSCICVEPFEGPQCETGSYLVPSPCLSNPCQNGGTCVDADEGYVCECPEG
FT                   FMGLDCRERILNDCDCRNGGRCLGANTTLCQCPPGFFGLLCEFEVTATPCNMNTQCPDG
FT                   GYCMEYGGSYLCVCHTDHNISHSLPSPCDSDPCFNGGSCDAHEDSYTCECPRGFHGRHC
FT                   EKARPHLCSSGPCRNGGTCKEMGDEYRCTCPYRFTGRHCEIGKPDSCASGPCHNGGTCF
FT                   HYIGKYKCDCPPGFSGRHCEIAPSPCFRSPCMNGGTCEDLGTDFSCYCQPGYTGHRCQA
FT                   EVDCGHPEEVEHATMRFNGTHVGSVALYTCEPGFSLSALSHIRVCQPQGVWSQPPQCIE
FT                   VDECRSQPCLHGGSCQDLIADYQCLCSPGYEGVHCELETDECQAQPCRNGGSCRDLPRA
FT                   FICQCPEGFVGIHCETEVDACASSPCQHGGRCEDGGGAYLCVCPEGFFGYNCETVSDPC
FT                   FSSPCGSRGYCLASNGSHSCTCKVGYTGKDCTKALRVERVEESGVSISWSPPEGTTARQ
FT                   VLDGYAVTYASSDGSSRRTDFVDRSRSSHQLRALAAGRAYNISVFSVKRNTNNKNDISR
FT                   PAALLTRTRPRPIEDFEVTNISANAISVQWALHRIQHATVSRVRVSILYPEASAVQSTE
FT                   VDRSVDRLTFGDLLPGRRYTVRLTTLSGPGGAEYPTESLASAPLNVWTRPLPPANLTAS
FT                   RVTATSAHMIWDTPAPGISLEAYVINVTTSQSTKSRYIPNGKLVSYTVRDLMPGRRYQL
FT                   SVTAVQSTEQGQLHSEPAHLYIITSPRDGTDRRWHHGGHHSRMLRNRPAPVRLPELRLL
FT                   NDHSAPETPTQSPRFSELVDGRGRVSARFGGLPSRAVTVRSQPTTPVPLKNTEAPEQVH
FT                   LALQLPKNSSKDTESTPGSCSEDACQNGGTCVPGADAHSCDCRPGFKGRHCELACEKVP
FT                   RPCTRLFSETKSFPVWEGDICHHVYKKVYKVHQDVCFKERCQSTSLRKPKQETK"
FT   CDS             join(7602103..7602315,7622307..7622594,7625005..7625145,
FT                   7625684..7625846,7627687..7627812,7628142..7628255,
FT                   7631076..7631189,7631317..7631430,7636968..7637093,
FT                   7637415..7637519,7637663..7637776,7638300..7638416,
FT                   7639837..7639953,7640132..7640248,7640393..7640506,
FT                   7641085..7641347)
FT                   /codon_start=1
FT                   /gene="Sned1"
FT                   /locus_tag="mCG_16584"
FT                   /product="sushi, nidogen and EGF-like domains 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG16584.2 transcript_id=mCT19270.2
FT                   protein_id=mCP20963.2 isoform=CRA_a"
FT                   /protein_id="EDL39967.1"
FT                   /translation="MRLGAAWALLLAAALGLGTRGVRAAVALADFYPFGTKRGDTVTPK
FT                   QDDGGSGLQPLSVPFPFFGAEHSGLYVNNNGIISFLKEVSQFTPVAFPIAKDRCVVAAF
FT                   WADVDNRRAGDVYYREATDPAMLNRATEDIRRYFPELPDFSATWVFVATWYRVTFFGGS
FT                   SSSPVNTFQTVLITDGRFSFTIFNYESILWTTGTHASSGGDTDGLGGIAAQAGFNAGDG
FT                   HRYFNIPGSRTADMAEVETTTNVGVPGRWAFRIDDAQVRVGGCGHTTSVCLVLRPCLNG
FT                   GKCIDDCVTGNPSYTCSCLAGFTGRRCHLDVNECASHPCQNGGTCTHGVNSFSCQCPAG
FT                   FKGPTCESAQSPCDNKVCQNGGQCQAESSSAVCVCQAGYTGATCETDVDECSSDPCQNG
FT                   GSCVDLVGNYSCICVEPFEGPQCETGSYLVPSPCLSNPCQNGGTCVDADEGYVCECPEG
FT                   FMGLDCRERILNDCDCRNGGRCLGANTTLCQCPPGFFGLLCEFEVTATPCNMNTQCPDG
FT                   GYCMEYGGSYLCVCHTDHNISHSLPSPCDSDPCFNGGSCDAHEDSYTCECPRGFHGRHC
FT                   EKARPHLCSSGPCRNGGTCKEMGDEYRCTCPYRFTGRHCEIGKPDSCASGPCHNGGTCF
FT                   HYIGKYKCDCPPGFSGRHCEIAPSPCFRSPCMNGGTCEDLGTDFSCYCQPGYTGHRCQA
FT                   EVDCGHPEEVEHATMRFNGTHVGSVALYTCEPGFSLSALSHIRVCQPQGVWSQPPQCIG
FT                   DSVGPQGWVGGQAGPTSSSHNHMKLHST"
FT   assembly_gap    7615362..7615506
FT                   /estimated_length=145
FT                   /gap_type="unknown"
FT   assembly_gap    7619454..7619473
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7645338..7645654
FT                   /estimated_length=317
FT                   /gap_type="unknown"
FT   gene            complement(7667309..7671973)
FT                   /gene="Mterfd2"
FT                   /locus_tag="mCG_16586"
FT                   /note="gene_id=mCG16586.2"
FT   mRNA            complement(join(7667309..7667764,7668753..7668997,
FT                   7670703..7671201,7671919..7671964))
FT                   /gene="Mterfd2"
FT                   /locus_tag="mCG_16586"
FT                   /product="MTERF domain containing 2, transcript variant
FT                   mCT177982"
FT                   /note="gene_id=mCG16586.2 transcript_id=mCT177982.0 created
FT                   on 30-DEC-2002"
FT   mRNA            complement(join(7667310..7667899,7668813..7668997,
FT                   7670703..7671201,7671919..7671973))
FT                   /gene="Mterfd2"
FT                   /locus_tag="mCG_16586"
FT                   /product="MTERF domain containing 2, transcript variant
FT                   mCT19272"
FT                   /note="gene_id=mCG16586.2 transcript_id=mCT19272.1 created
FT                   on 30-DEC-2002"
FT   CDS             complement(join(7667564..7667899,7668813..7668997,
FT                   7670703..7671201,7671919..7671939))
FT                   /codon_start=1
FT                   /gene="Mterfd2"
FT                   /locus_tag="mCG_16586"
FT                   /product="MTERF domain containing 2, isoform CRA_a"
FT                   /note="gene_id=mCG16586.2 transcript_id=mCT19272.1
FT                   protein_id=mCP21003.2 isoform=CRA_a"
FT                   /protein_id="EDL39965.1"
FT                   /translation="MASLGRQVPEWHRLLALSWACLVRQTPHLREQKQMSPSLSCKLTT
FT                   VPGRGSFQEFSSITPQKCMQEPENRTRLVQCLHEEQKPCVDPESLEPEKVIRSLQDMGF
FT                   AEAHIHSLFSIQPSVHPQQLLGIVSELLLLGLNPEPVFNALKKNPQLLKLSNMQMKRRS
FT                   SYLRKLGLGEGKLKRVLSVCPEVFTMHQRDIDRVVKVLREKCLFTAQHITDVLHRCPTV
FT                   LQEDPNELEYKFQYAYFRMGLTHLDIVRTNFLQYSITKIKQRHIYLERLGRYQTPDKKG
FT                   QTQIPNPSLRNILRVSEAEFLARTACSSVEEFQVFKKLLDQEEEEESESHASEEEEEEE
FT                   EEEELL"
FT   CDS             complement(join(7668795..7668997,7670703..7671201,
FT                   7671919..7671939))
FT                   /codon_start=1
FT                   /gene="Mterfd2"
FT                   /locus_tag="mCG_16586"
FT                   /product="MTERF domain containing 2, isoform CRA_b"
FT                   /note="gene_id=mCG16586.2 transcript_id=mCT177982.0
FT                   protein_id=mCP100904.0 isoform=CRA_b"
FT                   /protein_id="EDL39966.1"
FT                   /translation="MASLGRQVPEWHRLLALSWACLVRQTPHLREQKQMSPSLSCKLTT
FT                   VPGRGSFQEFSSITPQKCMQEPENRTRLVQCLHEEQKPCVDPESLEPEKVIRSLQDMGF
FT                   AEAHIHSLFSIQPSVHPQQLLGIVSELLLLGLNPEPVFNALKKNPQLLKLSNMQMKRRS
FT                   SYLRKLGLGEGKLKRVLSVCPEVFTMHQRDIDRVVKVLREKCLFTAQHITDVLHRCPTV
FT                   LQEDPNELEYKFQVRVSD"
FT   gene            complement(7675529..7709524)
FT                   /gene="Pask"
FT                   /locus_tag="mCG_133030"
FT                   /note="gene_id=mCG133030.1"
FT   mRNA            complement(join(7675529..7676341,7676860..7677006,
FT                   7678889..7679022,7680374..7680573,7682869..7683003,
FT                   7683105..7683230,7686045..7686212,7686579..7686760,
FT                   7686860..7688307,7690287..7690440,7691449..7691617,
FT                   7693301..7693561,7696819..7696953,7697623..7697763,
FT                   7700607..7700777,7701675..7701910,7703410..7703645,
FT                   7709307..7709524))
FT                   /gene="Pask"
FT                   /locus_tag="mCG_133030"
FT                   /product="PAS domain containing serine/threonine kinase,
FT                   transcript variant mCT177918"
FT                   /note="gene_id=mCG133030.1 transcript_id=mCT177918.0
FT                   created on 30-DEC-2002"
FT   mRNA            complement(join(7675529..7676341,7676860..7677006,
FT                   7678889..7679022,7680374..7680573,7682869..7683003,
FT                   7683105..7683230,7686045..7686212,7686579..7686760,
FT                   7686860..7688307,7690287..7690440,7691449..7691617,
FT                   7693301..7693561,7696819..7696953,7697623..7697763,
FT                   7700607..7700777,7701675..7701910,7703410..7703645,
FT                   7708567..7708795))
FT                   /gene="Pask"
FT                   /locus_tag="mCG_133030"
FT                   /product="PAS domain containing serine/threonine kinase,
FT                   transcript variant mCT134394"
FT                   /note="gene_id=mCG133030.1 transcript_id=mCT134394.1
FT                   created on 30-DEC-2002"
FT   CDS             complement(join(7676184..7676341,7676860..7677006,
FT                   7678889..7679022,7680374..7680573,7682869..7683003,
FT                   7683105..7683230,7686045..7686212,7686579..7686760,
FT                   7686860..7688307,7690287..7690440,7691449..7691617,
FT                   7693301..7693561,7696819..7696953,7697623..7697763,
FT                   7700607..7700777,7701675..7701910,7703410..7703596))
FT                   /codon_start=1
FT                   /gene="Pask"
FT                   /locus_tag="mCG_133030"
FT                   /product="PAS domain containing serine/threonine kinase,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG133030.1 transcript_id=mCT134394.1
FT                   protein_id=mCP82093.1 isoform=CRA_a"
FT                   /protein_id="EDL39963.1"
FT                   /translation="MEDRGPPVFAEDWKCLSESPPVQEGPAAQATFEPSKPLSIAHKHL
FT                   SRKNGLSRLCQSRMALSEDRWSSYCLSSLAAQNICTSKLHCAAAPEYADPTAGPLGSTS
FT                   CCSLLRGLASGCSGSLLSTPVCNPNKAVFTVDAKTTEILVANDKACSLLGYSSHDLIGQ
FT                   KLAQFFLKSDSEVVEALSEEHVEADGHAAVVFGTVVDIVSRIGEKIPVSVWIKRLQQDR
FT                   GLCCVVVLEPVERVSAWVAFQSDGTITSCDSLFAHLHGFTSPKDVVGQCVIDLIPSMQL
FT                   PPPGQHIPKSLKIQRSVGRARDGTTFPLSLKLKSKPSGRAVADSEAASEPGYQASVWVF
FT                   CTISGLITLLPDGTIYGVNHSFALMLFGYGKTELLGKNITFLIPGFYHYMDLTYDSSVQ
FT                   LPDLVNCLDIGRKSGPGEMNSDAQHNWELASGAQGPRIDVVLARDHMPSQDETLKLVGG
FT                   QVSSRTQTRLETGYKILPSSACQPSLGVDSNPEDGEQSLLTDQQSIPKRNLPAHGGQNQ
FT                   LDTSEISLPVLKEHLLSEIQKNISEESPLTHRKWLSKVQQNPTKGSLPIHEEQLLFAGQ
FT                   HIHVLGKEDPSAAESYRESLLEESKSKPVDAKLFASCEDSEPLVSVKDRGSSVDTCNLH
FT                   QEAQLELMGVSSPNPWADATMPEPHTTGQIAGGSLTYCPQYRSEWASQQRGQDSAPSPS
FT                   GMACVLLGTPTLDEPWPGVRNDREELQTCLIKEQLSKSSCEGNLGISRVELVPEEHPPF
FT                   TAPVSFCDLGGRDLHASRSGSSSACYALATDLPGVLEAVEAQEADVNSYSWNLKELFLK
FT                   DQTDRTPSHCSCTTSELSEVPSLSVVGSDLDVGILHRQTSDILVDREMLLLTGTYFDLS
FT                   EGQRFQEMGAGHDRAELSNISLVSSEHYETSDIESPGCDPPLPDPGPNDMCLSAEKPRP
FT                   SAQITSTPVARGATSLQQEIQEGIYSGSCYHRDGLQLSIQFEVKRVELQGSATLFCCWL
FT                   VKDLFHSHRDSATRTRLFLASLPSSTHSMPELSGSSFGEVLRAKPWFEESPTPAELEGL
FT                   AACEGEYDYKYNTISPLGSGAFGFVWTAVEKECNKEVVVKFIKKEKVLEDCWIEDPKLG
FT                   RVTLEIAILSKVDHANIIKVLDIFENQEFFQLVMEKHGSGMDLFAFIDHHPCLDEPLAS
FT                   FIFRQLVSAVGYLHSQGIIHRDIKDENIVIAEDFTIKLIDFGSAAYLERGKLFYTFCGT
FT                   IEYCAPEVLIGNPYRGPELEMWSLGVTLYTLIFEENPFCEVEETMEAVIHPPFLVSQEL
FT                   MSLLSGLLQPCPEQRTTLEKLIRDPWVTQPVNLASYTWEEVCRTNQPESGLLSAASLEI
FT                   GSRSPSEMAQREGLCGPPAPRETRGDQHCLHLKDPSLPVS"
FT   CDS             complement(join(7676184..7676341,7676860..7677006,
FT                   7678889..7679022,7680374..7680573,7682869..7683003,
FT                   7683105..7683230,7686045..7686212,7686579..7686760,
FT                   7686860..7688307,7690287..7690440,7691449..7691617,
FT                   7693301..7693561,7696819..7696953,7697623..7697763,
FT                   7700607..7700777,7701675..7701910,7703410..7703596))
FT                   /codon_start=1
FT                   /gene="Pask"
FT                   /locus_tag="mCG_133030"
FT                   /product="PAS domain containing serine/threonine kinase,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG133030.1 transcript_id=mCT177918.0
FT                   protein_id=mCP100840.0 isoform=CRA_a"
FT                   /protein_id="EDL39964.1"
FT                   /translation="MEDRGPPVFAEDWKCLSESPPVQEGPAAQATFEPSKPLSIAHKHL
FT                   SRKNGLSRLCQSRMALSEDRWSSYCLSSLAAQNICTSKLHCAAAPEYADPTAGPLGSTS
FT                   CCSLLRGLASGCSGSLLSTPVCNPNKAVFTVDAKTTEILVANDKACSLLGYSSHDLIGQ
FT                   KLAQFFLKSDSEVVEALSEEHVEADGHAAVVFGTVVDIVSRIGEKIPVSVWIKRLQQDR
FT                   GLCCVVVLEPVERVSAWVAFQSDGTITSCDSLFAHLHGFTSPKDVVGQCVIDLIPSMQL
FT                   PPPGQHIPKSLKIQRSVGRARDGTTFPLSLKLKSKPSGRAVADSEAASEPGYQASVWVF
FT                   CTISGLITLLPDGTIYGVNHSFALMLFGYGKTELLGKNITFLIPGFYHYMDLTYDSSVQ
FT                   LPDLVNCLDIGRKSGPGEMNSDAQHNWELASGAQGPRIDVVLARDHMPSQDETLKLVGG
FT                   QVSSRTQTRLETGYKILPSSACQPSLGVDSNPEDGEQSLLTDQQSIPKRNLPAHGGQNQ
FT                   LDTSEISLPVLKEHLLSEIQKNISEESPLTHRKWLSKVQQNPTKGSLPIHEEQLLFAGQ
FT                   HIHVLGKEDPSAAESYRESLLEESKSKPVDAKLFASCEDSEPLVSVKDRGSSVDTCNLH
FT                   QEAQLELMGVSSPNPWADATMPEPHTTGQIAGGSLTYCPQYRSEWASQQRGQDSAPSPS
FT                   GMACVLLGTPTLDEPWPGVRNDREELQTCLIKEQLSKSSCEGNLGISRVELVPEEHPPF
FT                   TAPVSFCDLGGRDLHASRSGSSSACYALATDLPGVLEAVEAQEADVNSYSWNLKELFLK
FT                   DQTDRTPSHCSCTTSELSEVPSLSVVGSDLDVGILHRQTSDILVDREMLLLTGTYFDLS
FT                   EGQRFQEMGAGHDRAELSNISLVSSEHYETSDIESPGCDPPLPDPGPNDMCLSAEKPRP
FT                   SAQITSTPVARGATSLQQEIQEGIYSGSCYHRDGLQLSIQFEVKRVELQGSATLFCCWL
FT                   VKDLFHSHRDSATRTRLFLASLPSSTHSMPELSGSSFGEVLRAKPWFEESPTPAELEGL
FT                   AACEGEYDYKYNTISPLGSGAFGFVWTAVEKECNKEVVVKFIKKEKVLEDCWIEDPKLG
FT                   RVTLEIAILSKVDHANIIKVLDIFENQEFFQLVMEKHGSGMDLFAFIDHHPCLDEPLAS
FT                   FIFRQLVSAVGYLHSQGIIHRDIKDENIVIAEDFTIKLIDFGSAAYLERGKLFYTFCGT
FT                   IEYCAPEVLIGNPYRGPELEMWSLGVTLYTLIFEENPFCEVEETMEAVIHPPFLVSQEL
FT                   MSLLSGLLQPCPEQRTTLEKLIRDPWVTQPVNLASYTWEEVCRTNQPESGLLSAASLEI
FT                   GSRSPSEMAQREGLCGPPAPRETRGDQHCLHLKDPSLPVS"
FT   gene            7709686..7733639
FT                   /gene="Ppp1r7"
FT                   /locus_tag="mCG_16585"
FT                   /note="gene_id=mCG16585.1"
FT   mRNA            join(7709686..7709752,7712184..7712315,7716349..7716404,
FT                   7716973..7717038,7717530..7717660,7718541..7718703,
FT                   7720353..7720469,7723764..7723868,7726733..7726819,
FT                   7730911..7733639)
FT                   /gene="Ppp1r7"
FT                   /locus_tag="mCG_16585"
FT                   /product="protein phosphatase 1, regulatory (inhibitor)
FT                   subunit 7, transcript variant mCT19271"
FT                   /note="gene_id=mCG16585.1 transcript_id=mCT19271.1 created
FT                   on 30-DEC-2002"
FT   mRNA            join(7709692..7709752,7716349..7716404,7716973..7717038,
FT                   7717530..7717660,7718541..7718703,7720353..7720469,
FT                   7723764..7723868,7726733..7726819,7730911..7733639)
FT                   /gene="Ppp1r7"
FT                   /locus_tag="mCG_16585"
FT                   /product="protein phosphatase 1, regulatory (inhibitor)
FT                   subunit 7, transcript variant mCT177981"
FT                   /note="gene_id=mCG16585.1 transcript_id=mCT177981.0 created
FT                   on 30-DEC-2002"
FT   CDS             join(7709701..7709752,7712184..7712315,7716349..7716404,
FT                   7716973..7717038,7717530..7717660,7718541..7718703,
FT                   7720353..7720469,7723764..7723868,7726733..7726819,
FT                   7730911..7731087)
FT                   /codon_start=1
FT                   /gene="Ppp1r7"
FT                   /locus_tag="mCG_16585"
FT                   /product="protein phosphatase 1, regulatory (inhibitor)
FT                   subunit 7, isoform CRA_b"
FT                   /note="gene_id=mCG16585.1 transcript_id=mCT19271.1
FT                   protein_id=mCP20959.1 isoform=CRA_b"
FT                   /protein_id="EDL39962.1"
FT                   /translation="MAAERGAGQQQSQEMMEVDRRVESEESGDEEGKKHGGGGIVANLS
FT                   EQSLKDGVDRGAEDPEEEHELAVDMETINLDRDAEDVDLTHYRIGKIEGLEVLKKVKSL
FT                   CLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEVLDISFNMLRNIEGIDK
FT                   LTQLKKLFLVNNKINKIENISNLHQLQMLELGSNRIRAIENIDTLTNLESLFLGKNKIT
FT                   KLQNLDALTNLTVLSVQSNRLAKIEGLQSLVNLRELYLSNNGIEVIEGLENNNKLTMLD
FT                   IASNRIKKIENISHLTELQEFWMNDNLLESWSDLDELKGARSLETVYLERNPLQKDPQY
FT                   RRKVMLALPSVRQIDATYVRF"
FT   CDS             join(7709701..7709752,7716349..7716404,7716973..7717038,
FT                   7717530..7717660,7718541..7718703,7720353..7720469,
FT                   7723764..7723868,7726733..7726819,7730911..7731087)
FT                   /codon_start=1
FT                   /gene="Ppp1r7"
FT                   /locus_tag="mCG_16585"
FT                   /product="protein phosphatase 1, regulatory (inhibitor)
FT                   subunit 7, isoform CRA_a"
FT                   /note="gene_id=mCG16585.1 transcript_id=mCT177981.0
FT                   protein_id=mCP100903.0 isoform=CRA_a"
FT                   /protein_id="EDL39961.1"
FT                   /translation="MAAERGAGQQQSQEMMEEEHELAVDMETINLDRDAEDVDLTHYRI
FT                   GKIEGLEVLKKVKSLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEVL
FT                   DISFNMLRNIEGIDKLTQLKKLFLVNNKINKIENISNLHQLQMLELGSNRIRAIENIDT
FT                   LTNLESLFLGKNKITKLQNLDALTNLTVLSVQSNRLAKIEGLQSLVNLRELYLSNNGIE
FT                   VIEGLENNNKLTMLDIASNRIKKIENISHLTELQEFWMNDNLLESWSDLDELKGARSLE
FT                   TVYLERNPLQKDPQYRRKVMLALPSVRQIDATYVRF"
FT   assembly_gap    7738178..7738339
FT                   /estimated_length=162
FT                   /gap_type="unknown"
FT   gene            7740046..>7754874
FT                   /locus_tag="mCG_133042"
FT                   /note="gene_id=mCG133042.1"
FT   mRNA            join(7740046..7740197,7741284..7741398,7743424..7743481,
FT                   7746562..7746692,7750980..7751087,7751716..7751852,
FT                   7753404..7753461,7754764..>7754874)
FT                   /locus_tag="mCG_133042"
FT                   /product="mCG133042"
FT                   /note="gene_id=mCG133042.1 transcript_id=mCT134406.1
FT                   created on 03-FEB-2003"
FT   CDS             join(7741291..7741398,7743424..7743481,7746562..7746692,
FT                   7750980..7751087,7751716..7751852,7753404..7753461,
FT                   7754764..>7754874)
FT                   /codon_start=1
FT                   /locus_tag="mCG_133042"
FT                   /product="mCG133042"
FT                   /note="gene_id=mCG133042.1 transcript_id=mCT134406.1
FT                   protein_id=mCP81253.1"
FT                   /protein_id="EDL39960.1"
FT                   /translation="MLRGQAREEDSVVLIDMASPEAGNGCSYGSTAQASEAGKQQVAPS
FT                   RVGSSAKPPIDFVLVWEEDLRNQENPTKDKTDTHEVWRETFLENLCLAGLKIDQHDVQD
FT                   EAAAVHYILLRAPWAVLCYYAEDLRLKLPLQELPNQASNWSATLLEWLGIPNILLEHVP
FT                   DTPPEYYSCQFKASKLQWFLGSDNQDTFFTSTKRHQILFEILAKTPYGHEKKGLFGIDQ
FT                   LLAEGVFSAAFPLHD"
FT   assembly_gap    7746463..7746482
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7755299..7755318
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            7756163..7768830
FT                   /locus_tag="mCG_133033"
FT                   /note="gene_id=mCG133033.1"
FT   mRNA            join(7756163..7756312,7757270..7757360,7758072..7758168,
FT                   7760212..7760355,7760423..7760563,7766411..7766483,
FT                   7767341..7767546,7767683..7767825,7768059..7768149,
FT                   7768563..7768830)
FT                   /locus_tag="mCG_133033"
FT                   /product="mCG133033"
FT                   /note="gene_id=mCG133033.1 transcript_id=mCT134397.1
FT                   created on 03-FEB-2003"
FT   CDS             join(7758106..7758168,7760212..7760355,7760423..7760563,
FT                   7766411..7766483,7767341..7767546,7767683..7767825,
FT                   7768059..7768149,7768563..7768748)
FT                   /codon_start=1
FT                   /locus_tag="mCG_133033"
FT                   /product="mCG133033"
FT                   /note="gene_id=mCG133033.1 transcript_id=mCT134397.1
FT                   protein_id=mCP82453.1"
FT                   /protein_id="EDL39959.1"
FT                   /translation="MCPLCSDCSFWLLSSACTLAQAGRLFDHGGTVFFSLFMALWAVLL
FT                   LEYWKRKNATLAYRWDCSDYEDIEERPRPQFAATAPMTALNPITGEDEPYFPEKNRVRR
FT                   MLAGSVVLLMMVHPAPWEADYELLPCEGLFHEYLEMVLQFGFVTIFVAACPLAPLFALL
FT                   NNWVEIRLDARKFVCEYRRPVAERAQDIGIWFHILTGLTHLAVISNAFLLAFSSDFLPR
FT                   VYYSWTHAPDLHGFLNFTLARAPPTFTSAHNRTCRYRAFRDDDGHYSPTYWTLLAIRLA
FT                   FVIVFEHVVFSIGRVLDLLVPDIPESVEIKVKREYYLAKQALAENEVSTQAQPVGLTAL
FT                   SCTLRSHD"
FT   assembly_gap    7765663..7765682
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(7771865..7845889)
FT                   /gene="Hdlbp"
FT                   /locus_tag="mCG_16583"
FT                   /note="gene_id=mCG16583.2"
FT   mRNA            complement(join(7771865..7774185,7774295..7774423,
FT                   7774615..7774731,7774877..7775062,7778289..7778432,
FT                   7779417..7779551,7779753..7779857,7780738..7780892,
FT                   7782427..7782565,7783098..7783316,7783394..7783615,
FT                   7786007..7786225,7787022..7787153,7787281..7787367,
FT                   7789202..7789315,7789708..7789812,7791205..7791344,
FT                   7793495..7793573,7794085..7794189,7795315..7795422,
FT                   7796035..7796241,7796892..7797107,7797249..7797455,
FT                   7804283..7804498,7805415..7805572,7807868..7807980,
FT                   7809370..7809434,7817996..7818100,7845786..7845889))
FT                   /gene="Hdlbp"
FT                   /locus_tag="mCG_16583"
FT                   /product="high density lipoprotein (HDL) binding protein,
FT                   transcript variant mCT177975"
FT                   /note="gene_id=mCG16583.2 transcript_id=mCT177975.0 created
FT                   on 30-DEC-2002"
FT   mRNA            complement(join(7771865..7774185,7774295..7774423,
FT                   7774615..7774731,7774877..7775062,7778289..7778432,
FT                   7779417..7779551,7779753..7779857,7780738..7780892,
FT                   7782427..7782565,7783098..7783316,7783394..7783615,
FT                   7786007..7786225,7787022..7787153,7787281..7787367,
FT                   7789202..7789315,7789708..7789812,7791205..7791344,
FT                   7793495..7793573,7794085..7794189,7795315..7795422,
FT                   7796035..7796241,7796892..7797107,7797249..7797455,
FT                   7804283..7804498,7805415..7805572,7807868..7807980,
FT                   7809370..7809434,7845786..7845886))
FT                   /gene="Hdlbp"
FT                   /locus_tag="mCG_16583"
FT                   /product="high density lipoprotein (HDL) binding protein,
FT                   transcript variant mCT19269"
FT                   /note="gene_id=mCG16583.2 transcript_id=mCT19269.2 created
FT                   on 30-DEC-2002"
FT   mRNA            complement(join(7771865..7774185,7774295..7774423,
FT                   7774615..7774731,7774877..7775062,7778289..7778432,
FT                   7779417..7779551,7779753..7779857,7780738..7780892,
FT                   7782427..7782565,7783098..7783316,7783394..7783615,
FT                   7786007..7786225,7787022..7787153,7787281..7787367,
FT                   7789202..7789315,7789708..7789812,7791205..7791344,
FT                   7793495..7793573,7794085..7794189,7795315..7795422,
FT                   7796035..7796241,7796892..7797107,7797249..7797455,
FT                   7804283..7804498,7805415..7805572,7807868..7807969,
FT                   7845278..7845449))
FT                   /gene="Hdlbp"
FT                   /locus_tag="mCG_16583"
FT                   /product="high density lipoprotein (HDL) binding protein,
FT                   transcript variant mCT177980"
FT                   /note="gene_id=mCG16583.2 transcript_id=mCT177980.0 created
FT                   on 30-DEC-2002"
FT   mRNA            complement(join(7771865..7774185,7774295..7774423,
FT                   7774615..7774731,7774877..7775062,7778289..7778432,
FT                   7779417..7779551,7779753..7779857,7780738..7780892,
FT                   7782427..7782565,7783098..7783316,7783394..7783615,
FT                   7786007..7786225,7787022..7787153,7787281..7787367,
FT                   7789151..7789315,7789708..7789812,7791205..7791344,
FT                   7793495..7793573,7794085..7794189,7795315..7795422,
FT                   7796035..7796241,7796892..7797107,7797249..7797455,
FT                   7804283..7804498,7805415..7805572,7807868..7807980,
FT                   7809370..7809434,7812607..7812710))
FT                   /gene="Hdlbp"
FT                   /locus_tag="mCG_16583"
FT                   /product="high density lipoprotein (HDL) binding protein,
FT                   transcript variant mCT177972"
FT                   /note="gene_id=mCG16583.2 transcript_id=mCT177972.0 created
FT                   on 30-DEC-2002"
FT   mRNA            complement(join(7771865..7774185,7774295..7774423,
FT                   7774615..7774731,7774877..7775062,7778289..7778432,
FT                   7779417..7779551,7779753..7779857,7780738..7780892,
FT                   7782427..7782565,7783098..7783316,7783394..7783615,
FT                   7786007..7786225,7787022..7787153,7787281..7787367,
FT                   7789202..7789315,7789708..7789812,7791205..7791344,
FT                   7793495..7793573,7794085..7794189,7795315..7795422,
FT                   7796035..7796241,7796892..7797107,7797249..7797455,
FT                   7809370..7809434,7812607..7812709))
FT                   /gene="Hdlbp"
FT                   /locus_tag="mCG_16583"
FT                   /product="high density lipoprotein (HDL) binding protein,
FT                   transcript variant mCT177973"
FT                   /note="gene_id=mCG16583.2 transcript_id=mCT177973.0 created
FT                   on 30-DEC-2002"
FT   mRNA            complement(join(7771976..7773797,7783390..7783615,
FT                   7786007..7786225,7787022..7787153,7787281..7787367,
FT                   7789202..7789315,7789708..7789812,7791205..7791344,
FT                   7793495..7793573,7794085..7794189,7795315..7795422,
FT                   7796035..7796241,7796892..7797107,7797249..7797455,
FT                   7804283..7804498,7805415..7805572,7807868..7807980,
FT                   7809370..7809434,7845786..7845859))
FT                   /gene="Hdlbp"
FT                   /locus_tag="mCG_16583"
FT                   /product="high density lipoprotein (HDL) binding protein,
FT                   transcript variant mCT177979"
FT                   /note="gene_id=mCG16583.2 transcript_id=mCT177979.0 created
FT                   on 30-DEC-2002"
FT   mRNA            complement(join(7773692..7773797,7789292..7789315,
FT                   7789708..7789812,7791205..7791344,7793495..7793573,
FT                   7794085..7794189,7795315..7795422,7796035..7796241,
FT                   7796892..7797107,7797249..7797455,7809374..7809434,
FT                   7812607..7812709))
FT                   /gene="Hdlbp"
FT                   /locus_tag="mCG_16583"
FT                   /product="high density lipoprotein (HDL) binding protein,
FT                   transcript variant mCT177977"
FT                   /note="gene_id=mCG16583.2 transcript_id=mCT177977.0 created
FT                   on 30-DEC-2002"
FT   mRNA            complement(join(7773694..7774185,7774295..7774423,
FT                   7774615..7774731,7774877..7775062,7778289..7778432,
FT                   7779417..7779551,7779753..7779857,7780738..7780892,
FT                   7782427..7782565,7783098..7783316,7783394..7783615,
FT                   7786007..7786225,7787022..7787153,7787281..7787367,
FT                   7789202..7789315,7789708..7789812,7791205..7791344,
FT                   7793495..7793573,7794085..7794189,7795315..7795422,
FT                   7796035..7796241,7796892..7797107,7797249..7797455,
FT                   7804283..7804498,7805415..7805572,7807868..7807980,
FT                   7809370..7809428,7828418..7828674,7845786..7845886))
FT                   /gene="Hdlbp"
FT                   /locus_tag="mCG_16583"
FT                   /product="high density lipoprotein (HDL) binding protein,
FT                   transcript variant mCT177976"
FT                   /note="gene_id=mCG16583.2 transcript_id=mCT177976.0 created
FT                   on 30-DEC-2002"
FT   mRNA            complement(join(7773694..7773906,7783493..7783615,
FT                   7786007..7786225,7787022..7787153,7787281..7787367,
FT                   7789202..7789315,7789708..7789812,7791205..7791344,
FT                   7793495..7793573,7794085..7794189,7795315..7795422,
FT                   7796035..7796241,7796892..7797107,7797249..7797455,
FT                   7804283..7804498,7805415..7805572,7807868..7807980,
FT                   7809370..7809434,7812607..7812638))
FT                   /gene="Hdlbp"
FT                   /locus_tag="mCG_16583"
FT                   /product="high density lipoprotein (HDL) binding protein,
FT                   transcript variant mCT177978"
FT                   /note="gene_id=mCG16583.2 transcript_id=mCT177978.0 created
FT                   on 30-DEC-2002"
FT   CDS             complement(join(7773715..7773906,7783493..7783615,
FT                   7786007..7786225,7787022..7787153,7787281..7787367,
FT                   7789202..7789315,7789708..7789812,7791205..7791344,
FT                   7793495..7793573,7794085..7794189,7795315..7795422,
FT                   7796035..7796241,7796892..7797107,7797249..7797455,
FT                   7804283..7804498,7805415..7805572,7807868..7807943))
FT                   /codon_start=1
FT                   /gene="Hdlbp"
FT                   /locus_tag="mCG_16583"
FT                   /product="high density lipoprotein (HDL) binding protein,
FT                   isoform CRA_f"
FT                   /note="gene_id=mCG16583.2 transcript_id=mCT177978.0
FT                   protein_id=mCP100898.0 isoform=CRA_f"
FT                   /protein_id="EDL39955.1"
FT                   /translation="MSSVAVLTQESFAEHRSGLVPQQIKVATLNSEEENDPPTYKDAFP
FT                   PLPEKAACLESAQEPAGAWSNKIRPIKASVITQVFHVPLEERKYKDMNQFGEGEQAKIC
FT                   LEIMQRTGAHLELSLAKDQGLSIMVSGKLDAVMKARKDIVARLQTQASATVPIPKEHHR
FT                   FVIGKNGEKLQDLELKTATKIQIPRPDDPSNQIKITGTKEGIEKARHEVLLISAEQDKR
FT                   AVERLEVEKAFHPFIAGPYNRLVGEIMQETGTRINIPPPSVNRTEIVFTGEKEQLAQAV
FT                   ARIKKIYEEKKKKTTTIAVEVKKSQHKYVIGPKGNSLQEILERTGVSVEIPPSDSISET
FT                   VILRGEPEKLGQALTEVYAKANSFTVSSVSAPSWLHRFIIGKKGQNLAKITQQMPKVHI
FT                   EFTEGEDKITLEGPTEDVNVAQEQIEGMVKDLINRMDYVEINIDHKFHRHLIGKSGANI
FT                   NRIKDQYKVSVRIPPDSEKSNLIRIEGDPQGVQQAKRELLELASRMENERTKDLIIEQR
FT                   FHRTIIGQKGERIREIRDKFPEVIINFPDPAQKSDIVQLRGPKNEVEKCTKYMQKMVAD
FT                   LVENSYSISVPIFKQFHKNIIGKGGANIKKIREESNTKIDLPAENSNSETIIITGKRAN
FT                   CEAARSRILSIQKDLANIAEVEVSIPAKLHNSLIGTKGRLIRSIMEECGGVHIHFPVEG
FT                   SGSDTVVIRGPSSDVEKAKKQLLHLAEEKQTKSFTVDIRAKPEYHKFLIGKGGGKIRKV
FT                   RDSTGARIIFPGLLLMLCSGTGTPLCETLSKVIEHFVITDSSFLVHPACSQHSDLHTRA
FT                   PQRLGVDFLCHDLRK"
FT   CDS             complement(join(7773715..7773797,7783390..7783615,
FT                   7786007..7786225,7787022..7787153,7787281..7787367,
FT                   7789202..7789315,7789708..7789812,7791205..7791344,
FT                   7793495..7793573,7794085..7794189,7795315..7795422,
FT                   7796035..7796241,7796892..7797107,7797249..7797455,
FT                   7804283..7804498,7805415..7805572,7807868..7807943))
FT                   /codon_start=1
FT                   /gene="Hdlbp"
FT                   /locus_tag="mCG_16583"
FT                   /product="high density lipoprotein (HDL) binding protein,
FT                   isoform CRA_g"
FT                   /note="gene_id=mCG16583.2 transcript_id=mCT177979.0
FT                   protein_id=mCP100896.0 isoform=CRA_g"
FT                   /protein_id="EDL39956.1"
FT                   /translation="MSSVAVLTQESFAEHRSGLVPQQIKVATLNSEEENDPPTYKDAFP
FT                   PLPEKAACLESAQEPAGAWSNKIRPIKASVITQVFHVPLEERKYKDMNQFGEGEQAKIC
FT                   LEIMQRTGAHLELSLAKDQGLSIMVSGKLDAVMKARKDIVARLQTQASATVPIPKEHHR
FT                   FVIGKNGEKLQDLELKTATKIQIPRPDDPSNQIKITGTKEGIEKARHEVLLISAEQDKR
FT                   AVERLEVEKAFHPFIAGPYNRLVGEIMQETGTRINIPPPSVNRTEIVFTGEKEQLAQAV
FT                   ARIKKIYEEKKKKTTTIAVEVKKSQHKYVIGPKGNSLQEILERTGVSVEIPPSDSISET
FT                   VILRGEPEKLGQALTEVYAKANSFTVSSVSAPSWLHRFIIGKKGQNLAKITQQMPKVHI
FT                   EFTEGEDKITLEGPTEDVNVAQEQIEGMVKDLINRMDYVEINIDHKFHRHLIGKSGANI
FT                   NRIKDQYKVSVRIPPDSEKSNLIRIEGDPQGVQQAKRELLELASRMENERTKDLIIEQR
FT                   FHRTIIGQKGERIREIRDKFPEVIINFPDPAQKSDIVQLRGPKNEVEKCTKYMQKMVAD
FT                   LVENSYSISVPIFKQFHKNIIGKGGANIKKIREESNTKIDLPAENSNSETIIITGKRAN
FT                   CEAARSRILSIQKDLANIAEVEVSIPAKLHNSLIGTKGRLIRSIMEECGGVHIHFPVEG
FT                   SGSDTVVIRGPSSDVEKAKKQLLHLAEEKQTKSFTVDIRAKPEYHKFLIGKGGGKIRKV
FT                   RDSTGARIIFPAAEDKDQDLITIIGKEDAVREAQKELEALIQNLVACSQHSDLHTRAPQ
FT                   RLGVDFLCHDLRK"
FT   CDS             complement(join(7773750..7773797,7789292..7789315,
FT                   7789708..7789812,7791205..7791344,7793495..7793573,
FT                   7794085..7794189,7795315..7795422,7796035..7796241,
FT                   7796892..7797020))
FT                   /codon_start=1
FT                   /gene="Hdlbp"
FT                   /locus_tag="mCG_16583"
FT                   /product="high density lipoprotein (HDL) binding protein,
FT                   isoform CRA_e"
FT                   /note="gene_id=mCG16583.2 transcript_id=mCT177977.0
FT                   protein_id=mCP100902.0 isoform=CRA_e"
FT                   /protein_id="EDL39954.1"
FT                   /translation="MQETGTRINIPPPSVNRTEIVFTGEKEQLAQAVARIKKIYEEKKK
FT                   KTTTIAVEVKKSQHKYVIGPKGNSLQEILERTGVSVEIPPSDSISETVILRGEPEKLGQ
FT                   ALTEVYAKANSFTVSSVSAPSWLHRFIIGKKGQNLAKITQQMPKVHIEFTEGEDKITLE
FT                   GPTEDVNVAQEQIEGMVKDLINRMDYVEINIDHKFHRHLIGKSGANINRIKDQYKVSVR
FT                   IPPDSEKSNLIRIEGDPQGVQQAKRELLELASRMENERTKDLIIEQRFHRTIIGQKGER
FT                   IREIRDKFPEVIINFPDPHVVSTLTFTPELHSG"
FT   CDS             complement(join(7774099..7774185,7774295..7774423,
FT                   7774615..7774731,7774877..7775062,7778289..7778432,
FT                   7779417..7779551,7779753..7779857,7780738..7780892,
FT                   7782427..7782565,7783098..7783316,7783394..7783615,
FT                   7786007..7786225,7787022..7787153,7787281..7787367,
FT                   7789202..7789315,7789708..7789812,7791205..7791344,
FT                   7793495..7793573,7794085..7794189,7795315..7795422,
FT                   7796035..7796241,7796892..7797107,7797249..7797455,
FT                   7804283..7804498,7805415..7805572,7807868..7807969,
FT                   7845278..7845395))
FT                   /codon_start=1
FT                   /gene="Hdlbp"
FT                   /locus_tag="mCG_16583"
FT                   /product="high density lipoprotein (HDL) binding protein,
FT                   isoform CRA_h"
FT                   /note="gene_id=mCG16583.2 transcript_id=mCT177980.0
FT                   protein_id=mCP100899.0 isoform=CRA_h"
FT                   /protein_id="EDL39958.1"
FT                   /translation="MPRGGGRSRHGPLPSFRLGRAERSAACPALCDRLEAGWEGSCVDV
FT                   RSTMSSVAVLTQESFAEHRSGLVPQQIKVATLNSEEENDPPTYKDAFPPLPEKAACLES
FT                   AQEPAGAWSNKIRPIKASVITQVFHVPLEERKYKDMNQFGEGEQAKICLEIMQRTGAHL
FT                   ELSLAKDQGLSIMVSGKLDAVMKARKDIVARLQTQASATVPIPKEHHRFVIGKNGEKLQ
FT                   DLELKTATKIQIPRPDDPSNQIKITGTKEGIEKARHEVLLISAEQDKRAVERLEVEKAF
FT                   HPFIAGPYNRLVGEIMQETGTRINIPPPSVNRTEIVFTGEKEQLAQAVARIKKIYEEKK
FT                   KKTTTIAVEVKKSQHKYVIGPKGNSLQEILERTGVSVEIPPSDSISETVILRGEPEKLG
FT                   QALTEVYAKANSFTVSSVSAPSWLHRFIIGKKGQNLAKITQQMPKVHIEFTEGEDKITL
FT                   EGPTEDVNVAQEQIEGMVKDLINRMDYVEINIDHKFHRHLIGKSGANINRIKDQYKVSV
FT                   RIPPDSEKSNLIRIEGDPQGVQQAKRELLELASRMENERTKDLIIEQRFHRTIIGQKGE
FT                   RIREIRDKFPEVIINFPDPAQKSDIVQLRGPKNEVEKCTKYMQKMVADLVENSYSISVP
FT                   IFKQFHKNIIGKGGANIKKIREESNTKIDLPAENSNSETIIITGKRANCEAARSRILSI
FT                   QKDLANIAEVEVSIPAKLHNSLIGTKGRLIRSIMEECGGVHIHFPVEGSGSDTVVIRGP
FT                   SSDVEKAKKQLLHLAEEKQTKSFTVDIRAKPEYHKFLIGKGGGKIRKVRDSTGARIIFP
FT                   AAEDKDQDLITIIGKEDAVREAQKELEALIQNLENVVEDYMLVDPKHHRHFVIRRGQVL
FT                   REIAEEYGGVMVSFPRSGTQSDKVTLKGAKDCVEAAKKRIQEIIEDLEAQVTVECAIPQ
FT                   KFHRSVMGPKGSRIQQITRDYNVQIKFPDREENPVHSVEPSIQENGDEAGEGREAKETD
FT                   PGSPRRCDIIIISGRKEKCEAAKEALEALVPVTIEVEVPFDLHRYIIGQKGSGIRKMMD
FT                   EFEVNIHVPAPELQSDTIAITGLAANLDRAKAGLLDRVKELQAEQEDRALRSFKLSVTV
FT                   DPKYHPKIIGRKGAVITQIRLEHEVNIQFPDKDDGNQPQDQITITGYEKNTEAARDAIL
FT                   KIVGELEQMVSEDVPLDHRVHARIIGARGKAIRKIMDEFKVDIRFPQSGAPDPNCVTVT
FT                   GLPENVEEAIDHILNLEEEYLADVVDSEALQVYMKPPAHEESRAPSKGFVVRDAPWTSN
FT                   SSEKAPDMSSSEEFPSFGAQVAPKTLPWGPKR"
FT   CDS             complement(join(7774099..7774185,7774295..7774423,
FT                   7774615..7774731,7774877..7775062,7778289..7778432,
FT                   7779417..7779551,7779753..7779857,7780738..7780892,
FT                   7782427..7782565,7783098..7783316,7783394..7783615,
FT                   7786007..7786225,7787022..7787153,7787281..7787367,
FT                   7789202..7789315,7789708..7789812,7791205..7791344,
FT                   7793495..7793573,7794085..7794189,7795315..7795422,
FT                   7796035..7796241,7796892..7797107,7797249..7797455,
FT                   7804283..7804498,7805415..7805572,7807868..7807943))
FT                   /codon_start=1
FT                   /gene="Hdlbp"
FT                   /locus_tag="mCG_16583"
FT                   /product="high density lipoprotein (HDL) binding protein,
FT                   isoform CRA_d"
FT                   /note="gene_id=mCG16583.2 transcript_id=mCT177975.0
FT                   protein_id=mCP100897.0 isoform=CRA_d"
FT                   /db_xref="GOA:Q3U4Z7"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="MGI:MGI:99256"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U4Z7"
FT                   /protein_id="EDL39952.1"
FT                   /translation="MSSVAVLTQESFAEHRSGLVPQQIKVATLNSEEENDPPTYKDAFP
FT                   PLPEKAACLESAQEPAGAWSNKIRPIKASVITQVFHVPLEERKYKDMNQFGEGEQAKIC
FT                   LEIMQRTGAHLELSLAKDQGLSIMVSGKLDAVMKARKDIVARLQTQASATVPIPKEHHR
FT                   FVIGKNGEKLQDLELKTATKIQIPRPDDPSNQIKITGTKEGIEKARHEVLLISAEQDKR
FT                   AVERLEVEKAFHPFIAGPYNRLVGEIMQETGTRINIPPPSVNRTEIVFTGEKEQLAQAV
FT                   ARIKKIYEEKKKKTTTIAVEVKKSQHKYVIGPKGNSLQEILERTGVSVEIPPSDSISET
FT                   VILRGEPEKLGQALTEVYAKANSFTVSSVSAPSWLHRFIIGKKGQNLAKITQQMPKVHI
FT                   EFTEGEDKITLEGPTEDVNVAQEQIEGMVKDLINRMDYVEINIDHKFHRHLIGKSGANI
FT                   NRIKDQYKVSVRIPPDSEKSNLIRIEGDPQGVQQAKRELLELASRMENERTKDLIIEQR
FT                   FHRTIIGQKGERIREIRDKFPEVIINFPDPAQKSDIVQLRGPKNEVEKCTKYMQKMVAD
FT                   LVENSYSISVPIFKQFHKNIIGKGGANIKKIREESNTKIDLPAENSNSETIIITGKRAN
FT                   CEAARSRILSIQKDLANIAEVEVSIPAKLHNSLIGTKGRLIRSIMEECGGVHIHFPVEG
FT                   SGSDTVVIRGPSSDVEKAKKQLLHLAEEKQTKSFTVDIRAKPEYHKFLIGKGGGKIRKV
FT                   RDSTGARIIFPAAEDKDQDLITIIGKEDAVREAQKELEALIQNLENVVEDYMLVDPKHH
FT                   RHFVIRRGQVLREIAEEYGGVMVSFPRSGTQSDKVTLKGAKDCVEAAKKRIQEIIEDLE
FT                   AQVTVECAIPQKFHRSVMGPKGSRIQQITRDYNVQIKFPDREENPVHSVEPSIQENGDE
FT                   AGEGREAKETDPGSPRRCDIIIISGRKEKCEAAKEALEALVPVTIEVEVPFDLHRYIIG
FT                   QKGSGIRKMMDEFEVNIHVPAPELQSDTIAITGLAANLDRAKAGLLDRVKELQAEQEDR
FT                   ALRSFKLSVTVDPKYHPKIIGRKGAVITQIRLEHEVNIQFPDKDDGNQPQDQITITGYE
FT                   KNTEAARDAILKIVGELEQMVSEDVPLDHRVHARIIGARGKAIRKIMDEFKVDIRFPQS
FT                   GAPDPNCVTVTGLPENVEEAIDHILNLEEEYLADVVDSEALQVYMKPPAHEESRAPSKG
FT                   FVVRDAPWTSNSSEKAPDMSSSEEFPSFGAQVAPKTLPWGPKR"
FT   CDS             complement(join(7774099..7774185,7774295..7774423,
FT                   7774615..7774731,7774877..7775062,7778289..7778432,
FT                   7779417..7779551,7779753..7779857,7780738..7780892,
FT                   7782427..7782565,7783098..7783316,7783394..7783615,
FT                   7786007..7786225,7787022..7787153,7787281..7787367,
FT                   7789202..7789315,7789708..7789812,7791205..7791344,
FT                   7793495..7793573,7794085..7794189,7795315..7795422,
FT                   7796035..7796241,7796892..7797107,7797249..7797455,
FT                   7804283..7804498,7805415..7805572,7807868..7807943))
FT                   /codon_start=1
FT                   /gene="Hdlbp"
FT                   /locus_tag="mCG_16583"
FT                   /product="high density lipoprotein (HDL) binding protein,
FT                   isoform CRA_d"
FT                   /note="gene_id=mCG16583.2 transcript_id=mCT177976.0
FT                   protein_id=mCP100894.0 isoform=CRA_d"
FT                   /db_xref="GOA:Q3U4Z7"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="MGI:MGI:99256"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U4Z7"
FT                   /protein_id="EDL39953.1"
FT                   /translation="MSSVAVLTQESFAEHRSGLVPQQIKVATLNSEEENDPPTYKDAFP
FT                   PLPEKAACLESAQEPAGAWSNKIRPIKASVITQVFHVPLEERKYKDMNQFGEGEQAKIC
FT                   LEIMQRTGAHLELSLAKDQGLSIMVSGKLDAVMKARKDIVARLQTQASATVPIPKEHHR
FT                   FVIGKNGEKLQDLELKTATKIQIPRPDDPSNQIKITGTKEGIEKARHEVLLISAEQDKR
FT                   AVERLEVEKAFHPFIAGPYNRLVGEIMQETGTRINIPPPSVNRTEIVFTGEKEQLAQAV
FT                   ARIKKIYEEKKKKTTTIAVEVKKSQHKYVIGPKGNSLQEILERTGVSVEIPPSDSISET
FT                   VILRGEPEKLGQALTEVYAKANSFTVSSVSAPSWLHRFIIGKKGQNLAKITQQMPKVHI
FT                   EFTEGEDKITLEGPTEDVNVAQEQIEGMVKDLINRMDYVEINIDHKFHRHLIGKSGANI
FT                   NRIKDQYKVSVRIPPDSEKSNLIRIEGDPQGVQQAKRELLELASRMENERTKDLIIEQR
FT                   FHRTIIGQKGERIREIRDKFPEVIINFPDPAQKSDIVQLRGPKNEVEKCTKYMQKMVAD
FT                   LVENSYSISVPIFKQFHKNIIGKGGANIKKIREESNTKIDLPAENSNSETIIITGKRAN
FT                   CEAARSRILSIQKDLANIAEVEVSIPAKLHNSLIGTKGRLIRSIMEECGGVHIHFPVEG
FT                   SGSDTVVIRGPSSDVEKAKKQLLHLAEEKQTKSFTVDIRAKPEYHKFLIGKGGGKIRKV
FT                   RDSTGARIIFPAAEDKDQDLITIIGKEDAVREAQKELEALIQNLENVVEDYMLVDPKHH
FT                   RHFVIRRGQVLREIAEEYGGVMVSFPRSGTQSDKVTLKGAKDCVEAAKKRIQEIIEDLE
FT                   AQVTVECAIPQKFHRSVMGPKGSRIQQITRDYNVQIKFPDREENPVHSVEPSIQENGDE
FT                   AGEGREAKETDPGSPRRCDIIIISGRKEKCEAAKEALEALVPVTIEVEVPFDLHRYIIG
FT                   QKGSGIRKMMDEFEVNIHVPAPELQSDTIAITGLAANLDRAKAGLLDRVKELQAEQEDR
FT                   ALRSFKLSVTVDPKYHPKIIGRKGAVITQIRLEHEVNIQFPDKDDGNQPQDQITITGYE
FT                   KNTEAARDAILKIVGELEQMVSEDVPLDHRVHARIIGARGKAIRKIMDEFKVDIRFPQS
FT                   GAPDPNCVTVTGLPENVEEAIDHILNLEEEYLADVVDSEALQVYMKPPAHEESRAPSKG
FT                   FVVRDAPWTSNSSEKAPDMSSSEEFPSFGAQVAPKTLPWGPKR"
FT   CDS             complement(join(7774099..7774185,7774295..7774423,
FT                   7774615..7774731,7774877..7775062,7778289..7778432,
FT                   7779417..7779551,7779753..7779857,7780738..7780892,
FT                   7782427..7782565,7783098..7783316,7783394..7783615,
FT                   7786007..7786225,7787022..7787153,7787281..7787367,
FT                   7789202..7789315,7789708..7789812,7791205..7791344,
FT                   7793495..7793573,7794085..7794189,7795315..7795422,
FT                   7796035..7796241,7796892..7797107,7797249..7797455,
FT                   7804283..7804498,7805415..7805572,7807868..7807943))
FT                   /codon_start=1
FT                   /gene="Hdlbp"
FT                   /locus_tag="mCG_16583"
FT                   /product="high density lipoprotein (HDL) binding protein,
FT                   isoform CRA_d"
FT                   /note="gene_id=mCG16583.2 transcript_id=mCT19269.2
FT                   protein_id=mCP20990.1 isoform=CRA_d"
FT                   /db_xref="GOA:Q3U4Z7"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="MGI:MGI:99256"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U4Z7"
FT                   /protein_id="EDL39957.1"
FT                   /translation="MSSVAVLTQESFAEHRSGLVPQQIKVATLNSEEENDPPTYKDAFP
FT                   PLPEKAACLESAQEPAGAWSNKIRPIKASVITQVFHVPLEERKYKDMNQFGEGEQAKIC
FT                   LEIMQRTGAHLELSLAKDQGLSIMVSGKLDAVMKARKDIVARLQTQASATVPIPKEHHR
FT                   FVIGKNGEKLQDLELKTATKIQIPRPDDPSNQIKITGTKEGIEKARHEVLLISAEQDKR
FT                   AVERLEVEKAFHPFIAGPYNRLVGEIMQETGTRINIPPPSVNRTEIVFTGEKEQLAQAV
FT                   ARIKKIYEEKKKKTTTIAVEVKKSQHKYVIGPKGNSLQEILERTGVSVEIPPSDSISET
FT                   VILRGEPEKLGQALTEVYAKANSFTVSSVSAPSWLHRFIIGKKGQNLAKITQQMPKVHI
FT                   EFTEGEDKITLEGPTEDVNVAQEQIEGMVKDLINRMDYVEINIDHKFHRHLIGKSGANI
FT                   NRIKDQYKVSVRIPPDSEKSNLIRIEGDPQGVQQAKRELLELASRMENERTKDLIIEQR
FT                   FHRTIIGQKGERIREIRDKFPEVIINFPDPAQKSDIVQLRGPKNEVEKCTKYMQKMVAD
FT                   LVENSYSISVPIFKQFHKNIIGKGGANIKKIREESNTKIDLPAENSNSETIIITGKRAN
FT                   CEAARSRILSIQKDLANIAEVEVSIPAKLHNSLIGTKGRLIRSIMEECGGVHIHFPVEG
FT                   SGSDTVVIRGPSSDVEKAKKQLLHLAEEKQTKSFTVDIRAKPEYHKFLIGKGGGKIRKV
FT                   RDSTGARIIFPAAEDKDQDLITIIGKEDAVREAQKELEALIQNLENVVEDYMLVDPKHH
FT                   RHFVIRRGQVLREIAEEYGGVMVSFPRSGTQSDKVTLKGAKDCVEAAKKRIQEIIEDLE
FT                   AQVTVECAIPQKFHRSVMGPKGSRIQQITRDYNVQIKFPDREENPVHSVEPSIQENGDE
FT                   AGEGREAKETDPGSPRRCDIIIISGRKEKCEAAKEALEALVPVTIEVEVPFDLHRYIIG
FT                   QKGSGIRKMMDEFEVNIHVPAPELQSDTIAITGLAANLDRAKAGLLDRVKELQAEQEDR
FT                   ALRSFKLSVTVDPKYHPKIIGRKGAVITQIRLEHEVNIQFPDKDDGNQPQDQITITGYE
FT                   KNTEAARDAILKIVGELEQMVSEDVPLDHRVHARIIGARGKAIRKIMDEFKVDIRFPQS
FT                   GAPDPNCVTVTGLPENVEEAIDHILNLEEEYLADVVDSEALQVYMKPPAHEESRAPSKG
FT                   FVVRDAPWTSNSSEKAPDMSSSEEFPSFGAQVAPKTLPWGPKR"
FT   CDS             complement(join(7774099..7774185,7774295..7774423,
FT                   7774615..7774731,7774877..7775062,7778289..7778432,
FT                   7779417..7779551,7779753..7779857,7780738..7780892,
FT                   7782427..7782565,7783098..7783316,7783394..7783615,
FT                   7786007..7786225,7787022..7787153,7787281..7787367,
FT                   7789151..7789315,7789708..7789812,7791205..7791344,
FT                   7793495..7793573,7794085..7794189,7795315..7795422,
FT                   7796035..7796241,7796892..7797107,7797249..7797455,
FT                   7804283..7804498,7805415..7805572,7807868..7807943))
FT                   /codon_start=1
FT                   /gene="Hdlbp"
FT                   /locus_tag="mCG_16583"
FT                   /product="high density lipoprotein (HDL) binding protein,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG16583.2 transcript_id=mCT177972.0
FT                   protein_id=mCP100895.0 isoform=CRA_a"
FT                   /protein_id="EDL39949.1"
FT                   /translation="MSSVAVLTQESFAEHRSGLVPQQIKVATLNSEEENDPPTYKDAFP
FT                   PLPEKAACLESAQEPAGAWSNKIRPIKASVITQVFHVPLEERKYKDMNQFGEGEQAKIC
FT                   LEIMQRTGAHLELSLAKDQGLSIMVSGKLDAVMKARKDIVARLQTQASATVPIPKEHHR
FT                   FVIGKNGEKLQDLELKTATKIQIPRPDDPSNQIKITGTKEGIEKARHEVLLISAEQDKR
FT                   AVERLEVEKAFHPFIAGPYNRLVGEIMQETGTRINIPPPSVNRTEIVFTGEKEQLAQAV
FT                   ARIKKIYEEKKKKTTTIAVEVKKSQHKYVIGPKGNSLQEILERTGVSVEIPPSDSISET
FT                   VILRGEPEKLGQALTEVYAKANSFTVSSVSAPSWLHRFIIGKKGQNLAKITQQMPKVHI
FT                   EFTEGEDKITLEGPTEDVNVAQEQIEGMVKDLINRMDYVEINIDHKFHRHLIGKSGANI
FT                   NRIKDQYKVSVRIPPDSEKSNLIRIEGDPQGVQQAKRELLELASRMENERTKDLIIEQR
FT                   FHRTIIGQKGERIREIRDKFPEVIINFPDPAQKSDIVQLRGPKNEVEKCTKYMQKMVAD
FT                   LVGDFVHPLEMGSGSHGFVENSYSISVPIFKQFHKNIIGKGGANIKKIREESNTKIDLP
FT                   AENSNSETIIITGKRANCEAARSRILSIQKDLANIAEVEVSIPAKLHNSLIGTKGRLIR
FT                   SIMEECGGVHIHFPVEGSGSDTVVIRGPSSDVEKAKKQLLHLAEEKQTKSFTVDIRAKP
FT                   EYHKFLIGKGGGKIRKVRDSTGARIIFPAAEDKDQDLITIIGKEDAVREAQKELEALIQ
FT                   NLENVVEDYMLVDPKHHRHFVIRRGQVLREIAEEYGGVMVSFPRSGTQSDKVTLKGAKD
FT                   CVEAAKKRIQEIIEDLEAQVTVECAIPQKFHRSVMGPKGSRIQQITRDYNVQIKFPDRE
FT                   ENPVHSVEPSIQENGDEAGEGREAKETDPGSPRRCDIIIISGRKEKCEAAKEALEALVP
FT                   VTIEVEVPFDLHRYIIGQKGSGIRKMMDEFEVNIHVPAPELQSDTIAITGLAANLDRAK
FT                   AGLLDRVKELQAEQEDRALRSFKLSVTVDPKYHPKIIGRKGAVITQIRLEHEVNIQFPD
FT                   KDDGNQPQDQITITGYEKNTEAARDAILKIVGELEQMVSEDVPLDHRVHARIIGARGKA
FT                   IRKIMDEFKVDIRFPQSGAPDPNCVTVTGLPENVEEAIDHILNLEEEYLADVVDSEALQ
FT                   VYMKPPAHEESRAPSKGFVVRDAPWTSNSSEKAPDMSSSEEFPSFGAQVAPKTLPWGPK
FT                   R"
FT   CDS             complement(join(7774099..7774185,7774295..7774423,
FT                   7774615..7774731,7774877..7775062,7778289..7778432,
FT                   7779417..7779551,7779753..7779857,7780738..7780892,
FT                   7782427..7782565,7783098..7783316,7783394..7783615,
FT                   7786007..7786225,7787022..7787153,7787281..7787367,
FT                   7789202..7789315,7789708..7789812,7791205..7791344,
FT                   7793495..7793573,7794085..7794189,7795315..7795422,
FT                   7796035..7796241,7796892..7797020))
FT                   /codon_start=1
FT                   /gene="Hdlbp"
FT                   /locus_tag="mCG_16583"
FT                   /product="high density lipoprotein (HDL) binding protein,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG16583.2 transcript_id=mCT177973.0
FT                   protein_id=mCP100901.0 isoform=CRA_b"
FT                   /protein_id="EDL39950.1"
FT                   /translation="MQETGTRINIPPPSVNRTEIVFTGEKEQLAQAVARIKKIYEEKKK
FT                   KTTTIAVEVKKSQHKYVIGPKGNSLQEILERTGVSVEIPPSDSISETVILRGEPEKLGQ
FT                   ALTEVYAKANSFTVSSVSAPSWLHRFIIGKKGQNLAKITQQMPKVHIEFTEGEDKITLE
FT                   GPTEDVNVAQEQIEGMVKDLINRMDYVEINIDHKFHRHLIGKSGANINRIKDQYKVSVR
FT                   IPPDSEKSNLIRIEGDPQGVQQAKRELLELASRMENERTKDLIIEQRFHRTIIGQKGER
FT                   IREIRDKFPEVIINFPDPAQKSDIVQLRGPKNEVEKCTKYMQKMVADLVENSYSISVPI
FT                   FKQFHKNIIGKGGANIKKIREESNTKIDLPAENSNSETIIITGKRANCEAARSRILSIQ
FT                   KDLANIAEVEVSIPAKLHNSLIGTKGRLIRSIMEECGGVHIHFPVEGSGSDTVVIRGPS
FT                   SDVEKAKKQLLHLAEEKQTKSFTVDIRAKPEYHKFLIGKGGGKIRKVRDSTGARIIFPA
FT                   AEDKDQDLITIIGKEDAVREAQKELEALIQNLENVVEDYMLVDPKHHRHFVIRRGQVLR
FT                   EIAEEYGGVMVSFPRSGTQSDKVTLKGAKDCVEAAKKRIQEIIEDLEAQVTVECAIPQK
FT                   FHRSVMGPKGSRIQQITRDYNVQIKFPDREENPVHSVEPSIQENGDEAGEGREAKETDP
FT                   GSPRRCDIIIISGRKEKCEAAKEALEALVPVTIEVEVPFDLHRYIIGQKGSGIRKMMDE
FT                   FEVNIHVPAPELQSDTIAITGLAANLDRAKAGLLDRVKELQAEQEDRALRSFKLSVTVD
FT                   PKYHPKIIGRKGAVITQIRLEHEVNIQFPDKDDGNQPQDQITITGYEKNTEAARDAILK
FT                   IVGELEQMVSEDVPLDHRVHARIIGARGKAIRKIMDEFKVDIRFPQSGAPDPNCVTVTG
FT                   LPENVEEAIDHILNLEEEYLADVVDSEALQVYMKPPAHEESRAPSKGFVVRDAPWTSNS
FT                   SEKAPDMSSSEEFPSFGAQVAPKTLPWGPKR"
FT   gene            7787618..7788468
FT                   /pseudo
FT                   /locus_tag="mCG_16582"
FT                   /note="gene_id=mCG16582.1"
FT   mRNA            7787618..7788468
FT                   /pseudo
FT                   /locus_tag="mCG_16582"
FT                   /note="gene_id=mCG16582.1 transcript_id=mCT19267.1 created
FT                   on 03-FEB-2003"
FT   assembly_gap    7802281..7802300
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            complement(join(7807487..7807980,7809370..7809434,
FT                   7812607..7812676))
FT                   /gene="Hdlbp"
FT                   /locus_tag="mCG_16583"
FT                   /product="high density lipoprotein (HDL) binding protein,
FT                   transcript variant mCT177974"
FT                   /note="gene_id=mCG16583.2 transcript_id=mCT177974.0 created
FT                   on 30-DEC-2002"
FT   CDS             complement(7807788..7807943)
FT                   /codon_start=1
FT                   /gene="Hdlbp"
FT                   /locus_tag="mCG_16583"
FT                   /product="high density lipoprotein (HDL) binding protein,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG16583.2 transcript_id=mCT177974.0
FT                   protein_id=mCP100900.0 isoform=CRA_c"
FT                   /protein_id="EDL39951.1"
FT                   /translation="MSSVAVLTQESFAEHRSGLVPQQIKGDRPLSKSLLTSETGLLCSF
FT                   VLVGCK"
FT   assembly_gap    7812051..7812323
FT                   /estimated_length=273
FT                   /gap_type="unknown"
FT   assembly_gap    7816619..7816731
FT                   /estimated_length=113
FT                   /gap_type="unknown"
FT   gene            7846079..7876784
FT                   /gene="Sept2"
FT                   /locus_tag="mCG_16579"
FT                   /note="gene_id=mCG16579.2"
FT   mRNA            join(7846079..7846141,7856174..7856204,7858209..7858329,
FT                   7862630..7862716,7864403..7864526,7866074..7866208,
FT                   7866335..7866452,7867520..7867621,7868564..7868709,
FT                   7870491..7870574,7872600..7872657,7874019..7874402)
FT                   /gene="Sept2"
FT                   /locus_tag="mCG_16579"
FT                   /product="septin 2, transcript variant mCT177970"
FT                   /note="gene_id=mCG16579.2 transcript_id=mCT177970.0 created
FT                   on 30-DEC-2002"
FT   mRNA            join(7846111..7846141,7856174..7856204,7858209..7858329,
FT                   7862630..7862716,7864403..7864526,7866074..7866208,
FT                   7866335..7866452,7867520..7867621,7868564..7868709,
FT                   7870491..7870574,7872600..7872657,7874019..7874138,
FT                   7874769..7876784)
FT                   /gene="Sept2"
FT                   /locus_tag="mCG_16579"
FT                   /product="septin 2, transcript variant mCT19265"
FT                   /note="gene_id=mCG16579.2 transcript_id=mCT19265.1 created
FT                   on 30-DEC-2002"
FT   CDS             join(7856196..7856204,7858209..7858329,7862630..7862716,
FT                   7864403..7864526,7866074..7866208,7866335..7866452,
FT                   7867520..7867621,7868564..7868709,7870491..7870574,
FT                   7872600..7872657,7874019..7874120)
FT                   /codon_start=1
FT                   /gene="Sept2"
FT                   /locus_tag="mCG_16579"
FT                   /product="septin 2, isoform CRA_a"
FT                   /note="gene_id=mCG16579.2 transcript_id=mCT177970.0
FT                   protein_id=mCP100893.0 isoform=CRA_a"
FT                   /db_xref="GOA:P42208"
FT                   /db_xref="InterPro:IPR008113"
FT                   /db_xref="InterPro:IPR016491"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030379"
FT                   /db_xref="MGI:MGI:97298"
FT                   /db_xref="PDB:3FTQ"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42208"
FT                   /protein_id="EDL39946.1"
FT                   /translation="MSKQQPTQFINPETPGYVGFANLPNQVHRKSVKKGFEFTLMVVGE
FT                   SGLGKSTLINSLFLTDLYPERIIPGAAEKIERTVQIEASTVEIEERGVKLRLTVVDTPG
FT                   YGDAINCRDCFKTIISYIDEQFERYLHDESGLNRRHIIDNRVHCCFYFISPFGHGLKPL
FT                   DVAFMKAIHNKVNIVPVIAKADTLTLKERERLKKRILDEIEEHSIKIYHLPDAESDEDE
FT                   DFKEQTRLLKASIPFSVVGSNQLIEAKGKKVRGRLYPWGVVEVENPEHNDFLKLRTMLI
FT                   THMQDLQEVTQDLHYENFRSERLKRGGRKVENEDMNKDQILLEKEAELRRMQEMIARMQ
FT                   AQMQMQMQGGDSDSGALGQHV"
FT   CDS             join(7856196..7856204,7858209..7858329,7862630..7862716,
FT                   7864403..7864526,7866074..7866208,7866335..7866452,
FT                   7867520..7867621,7868564..7868709,7870491..7870574,
FT                   7872600..7872657,7874019..7874120)
FT                   /codon_start=1
FT                   /gene="Sept2"
FT                   /locus_tag="mCG_16579"
FT                   /product="septin 2, isoform CRA_a"
FT                   /note="gene_id=mCG16579.2 transcript_id=mCT19265.1
FT                   protein_id=mCP21028.1 isoform=CRA_a"
FT                   /db_xref="GOA:P42208"
FT                   /db_xref="InterPro:IPR008113"
FT                   /db_xref="InterPro:IPR016491"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030379"
FT                   /db_xref="MGI:MGI:97298"
FT                   /db_xref="PDB:3FTQ"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42208"
FT                   /protein_id="EDL39948.1"
FT                   /translation="MSKQQPTQFINPETPGYVGFANLPNQVHRKSVKKGFEFTLMVVGE
FT                   SGLGKSTLINSLFLTDLYPERIIPGAAEKIERTVQIEASTVEIEERGVKLRLTVVDTPG
FT                   YGDAINCRDCFKTIISYIDEQFERYLHDESGLNRRHIIDNRVHCCFYFISPFGHGLKPL
FT                   DVAFMKAIHNKVNIVPVIAKADTLTLKERERLKKRILDEIEEHSIKIYHLPDAESDEDE
FT                   DFKEQTRLLKASIPFSVVGSNQLIEAKGKKVRGRLYPWGVVEVENPEHNDFLKLRTMLI
FT                   THMQDLQEVTQDLHYENFRSERLKRGGRKVENEDMNKDQILLEKEAELRRMQEMIARMQ
FT                   AQMQMQMQGGDSDSGALGQHV"
FT   mRNA            join(7872249..7872657,7874019..7874138)
FT                   /gene="Sept2"
FT                   /locus_tag="mCG_16579"
FT                   /product="septin 2, transcript variant mCT177971"
FT                   /note="gene_id=mCG16579.2 transcript_id=mCT177971.0 created
FT                   on 30-DEC-2002"
FT   CDS             join(7872619..7872657,7874019..7874120)
FT                   /codon_start=1
FT                   /gene="Sept2"
FT                   /locus_tag="mCG_16579"
FT                   /product="septin 2, isoform CRA_b"
FT                   /note="gene_id=mCG16579.2 transcript_id=mCT177971.0
FT                   protein_id=mCP100892.0 isoform=CRA_b"
FT                   /protein_id="EDL39947.1"
FT                   /translation="MNKDQILLEKEAELRRMQEMIARMQAQMQMQMQGGDSDSGALGQH
FT                   V"
FT   gene            7879166..7989399
FT                   /gene="Farp2"
FT                   /locus_tag="mCG_16571"
FT                   /note="gene_id=mCG16571.2"
FT   mRNA            join(7879166..7879234,7895605..7895829,7927274..7927378,
FT                   7928182..7928224,7930347..7930425,7934455..7934552,
FT                   7936119..7936233,7936911..7937058,7941497..7941592,
FT                   7943496..7943659,7943949..7944017,7944774..7944831,
FT                   7946862..7947120,7967052..7967230,7970507..7970596,
FT                   7971340..7971473,7972472..7972553,7974551..7974788,
FT                   7977096..7977226,7979485..7979553,7980211..7980300,
FT                   7984645..7984727,7985641..7985759,7986031..7986188,
FT                   7987292..7987399,7987631..7987782,7988362..7989399)
FT                   /gene="Farp2"
FT                   /locus_tag="mCG_16571"
FT                   /product="FERM, RhoGEF and pleckstrin domain protein 2,
FT                   transcript variant mCT177965"
FT                   /note="gene_id=mCG16571.2 transcript_id=mCT177965.0 created
FT                   on 30-DEC-2002"
FT   mRNA            join(7879169..7879234,7895619..7895829,7927274..7927378,
FT                   7928182..7928224,7930347..7930425,7934455..7934552,
FT                   7936119..7936233,7936911..7937058,7941497..7941592,
FT                   7943496..7943659,7943949..7944017,7944774..7944831,
FT                   7946862..7947120,7967052..7967230,7970507..7970596,
FT                   7971340..7971473,7972472..7972553,7974551..7974788,
FT                   7977096..7977226,7979485..7979553,7980211..7980300,
FT                   7984645..7984727,7985641..7985759,7986031..7986188,
FT                   7987292..7987399,7987631..7987782,7988362..7989399)
FT                   /gene="Farp2"
FT                   /locus_tag="mCG_16571"
FT                   /product="FERM, RhoGEF and pleckstrin domain protein 2,
FT                   transcript variant mCT19257"
FT                   /note="gene_id=mCG16571.2 transcript_id=mCT19257.2 created
FT                   on 30-DEC-2002"
FT   CDS             join(7895647..7895829,7927274..7927378,7928182..7928224,
FT                   7930347..7930425,7934455..7934552,7936119..7936233,
FT                   7936911..7937058,7941497..7941592,7943496..7943659,
FT                   7943949..7944017,7944774..7944831,7946862..7947120,
FT                   7967052..7967230,7970507..7970596,7971340..7971473,
FT                   7972472..7972553,7974551..7974788,7977096..7977226,
FT                   7979485..7979553,7980211..7980300,7984645..7984727,
FT                   7985641..7985759,7986031..7986188,7987292..7987399,
FT                   7987631..7987782,7988362..7988509)
FT                   /codon_start=1
FT                   /gene="Farp2"
FT                   /locus_tag="mCG_16571"
FT                   /product="FERM, RhoGEF and pleckstrin domain protein 2,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG16571.2 transcript_id=mCT177965.0
FT                   protein_id=mCP100887.0 isoform=CRA_a"
FT                   /protein_id="EDL39944.1"
FT                   /translation="MGEIEGTYRALPTSGTRLGGQTAIGVSTLEPEQSLSPRMQEKHMR
FT                   IRVKLLDSTVELFDIEPKCDGQVLLTQVWKHLNLIECDYFGLEFKNVQSYWIWLEPMKP
FT                   IIRQVRKPKNAVLRLAVKFFPPDPGQLQEEYTRYLFALQLKRDLLEERLTCTANTAALL
FT                   ISHLLQSEIGDYDETLDREHLKANEYLPNQEKSLEKILDFHQRHTGQTPAESDFQVLEI
FT                   ARKLEMYGIRFHMASDREGTKINLAVSHMGVLVFQGTTKINTFNWSKVRKLSFKRKRFL
FT                   IKLHPEVHGPYQDTLEFLLGSRDECKNFWKICVEYHTFFRLSDQPKPKAKAVFFSRGSS
FT                   FRYSGRTQKQLVDYVKDGGMKRIPYERRHSKTRTSLHALTVDLPKQSVSFTDGLRTSAS
FT                   LSSANVSFYPPPSSSLSPPGLPNLKDSSSSLVDPQAPVIKSTAAERSSGPSSSDGPSTQ
FT                   SAHLPGPPVLRPGPGFSMDSPQPSPSSLKSHLSLCPELQAALSTAEQGASPVLSPVLSG
FT                   AGTARMDNQEEQKHKHMPEDEAYFIAKEILATERTYLKDLEVITVWFRSVLIKEEAMPA
FT                   ALMALLFSNIDPVYEFHRGFLHEVEQRLALWEGPSSAHLKGDHQRIGDILLRNMRQLKE
FT                   FTSYFQRHDEVLTELEKATKHCKKLEAVYKEFELQKVCYLPLNTFLLKPVQRLVHYRLL
FT                   LSRLCAHYSPGHRDYADCHEALKAITEVTTELQQSLTRLENLQKLTELQRDLVGVENLI
FT                   APGREFIREGCLHKLTKKGLQQRMFFLFSDMLLYTSKSVTGASHFRIRGFLPLRGMLVE
FT                   ESENEWSVLHCFTIYAAQKTIVVAASTRLEKEKWMQDLNAAIQAAKTIGDSPPVLLGGP
FT                   VYTRTPRSSDEVSLEESEDGRGNRGSLEGNSQHRANTTMHVCWYRNTSVSRADHSAAVE
FT                   NQLSGYLLRKFKNSNGWQKLWVVFTNFCLFFYKTHQDDYPLASLPLLGYSVSLPREADS
FT                   IHKDYVFKLQFKSHVYFFRAESKYTFERWMDVIKRASSSPGRPPSFTQDCSHHSPGLEA
FT                   EIREKEACPSPCLDKNL"
FT   CDS             join(7895647..7895829,7927274..7927378,7928182..7928224,
FT                   7930347..7930425,7934455..7934552,7936119..7936233,
FT                   7936911..7937058,7941497..7941592,7943496..7943659,
FT                   7943949..7944017,7944774..7944831,7946862..7947120,
FT                   7967052..7967230,7970507..7970596,7971340..7971473,
FT                   7972472..7972553,7974551..7974788,7977096..7977226,
FT                   7979485..7979553,7980211..7980300,7984645..7984727,
FT                   7985641..7985759,7986031..7986188,7987292..7987399,
FT                   7987631..7987782,7988362..7988509)
FT                   /codon_start=1
FT                   /gene="Farp2"
FT                   /locus_tag="mCG_16571"
FT                   /product="FERM, RhoGEF and pleckstrin domain protein 2,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG16571.2 transcript_id=mCT19257.2
FT                   protein_id=mCP21007.2 isoform=CRA_a"
FT                   /protein_id="EDL39945.1"
FT                   /translation="MGEIEGTYRALPTSGTRLGGQTAIGVSTLEPEQSLSPRMQEKHMR
FT                   IRVKLLDSTVELFDIEPKCDGQVLLTQVWKHLNLIECDYFGLEFKNVQSYWIWLEPMKP
FT                   IIRQVRKPKNAVLRLAVKFFPPDPGQLQEEYTRYLFALQLKRDLLEERLTCTANTAALL
FT                   ISHLLQSEIGDYDETLDREHLKANEYLPNQEKSLEKILDFHQRHTGQTPAESDFQVLEI
FT                   ARKLEMYGIRFHMASDREGTKINLAVSHMGVLVFQGTTKINTFNWSKVRKLSFKRKRFL
FT                   IKLHPEVHGPYQDTLEFLLGSRDECKNFWKICVEYHTFFRLSDQPKPKAKAVFFSRGSS
FT                   FRYSGRTQKQLVDYVKDGGMKRIPYERRHSKTRTSLHALTVDLPKQSVSFTDGLRTSAS
FT                   LSSANVSFYPPPSSSLSPPGLPNLKDSSSSLVDPQAPVIKSTAAERSSGPSSSDGPSTQ
FT                   SAHLPGPPVLRPGPGFSMDSPQPSPSSLKSHLSLCPELQAALSTAEQGASPVLSPVLSG
FT                   AGTARMDNQEEQKHKHMPEDEAYFIAKEILATERTYLKDLEVITVWFRSVLIKEEAMPA
FT                   ALMALLFSNIDPVYEFHRGFLHEVEQRLALWEGPSSAHLKGDHQRIGDILLRNMRQLKE
FT                   FTSYFQRHDEVLTELEKATKHCKKLEAVYKEFELQKVCYLPLNTFLLKPVQRLVHYRLL
FT                   LSRLCAHYSPGHRDYADCHEALKAITEVTTELQQSLTRLENLQKLTELQRDLVGVENLI
FT                   APGREFIREGCLHKLTKKGLQQRMFFLFSDMLLYTSKSVTGASHFRIRGFLPLRGMLVE
FT                   ESENEWSVLHCFTIYAAQKTIVVAASTRLEKEKWMQDLNAAIQAAKTIGDSPPVLLGGP
FT                   VYTRTPRSSDEVSLEESEDGRGNRGSLEGNSQHRANTTMHVCWYRNTSVSRADHSAAVE
FT                   NQLSGYLLRKFKNSNGWQKLWVVFTNFCLFFYKTHQDDYPLASLPLLGYSVSLPREADS
FT                   IHKDYVFKLQFKSHVYFFRAESKYTFERWMDVIKRASSSPGRPPSFTQDCSHHSPGLEA
FT                   EIREKEACPSPCLDKNL"
FT   assembly_gap    7905978..7906229
FT                   /estimated_length=252
FT                   /gap_type="unknown"
FT   assembly_gap    7937263..7937282
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7985179..7985198
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(7989040..8003976)
FT                   /gene="Stk25"
FT                   /locus_tag="mCG_145749"
FT                   /note="gene_id=mCG145749.0"
FT   mRNA            complement(join(7989040..7989667,7990537..7990673,
FT                   7991694..7991765,7992175..7992289,7992602..7992747,
FT                   7992922..7993107,7993192..7994273,7994794..7994850,
FT                   7996174..7996404,8003511..8003596,8003760..8003842))
FT                   /gene="Stk25"
FT                   /locus_tag="mCG_145749"
FT                   /product="serine/threonine kinase 25 (yeast), transcript
FT                   variant mCT185735"
FT                   /note="gene_id=mCG145749.0 transcript_id=mCT185735.0
FT                   created on 10-JUN-2003"
FT   mRNA            complement(join(7989046..7989667,7990537..7990673,
FT                   7991694..7991765,7992175..7992289,7992602..7992747,
FT                   7992922..7993107,7993192..7993349,7994165..7994273,
FT                   7994794..7994850,7996174..7996404,8003511..8003596,
FT                   8003760..8003976))
FT                   /gene="Stk25"
FT                   /locus_tag="mCG_145749"
FT                   /product="serine/threonine kinase 25 (yeast), transcript
FT                   variant mCT185736"
FT                   /note="gene_id=mCG145749.0 transcript_id=mCT185736.0
FT                   created on 10-JUN-2003"
FT   mRNA            complement(join(7989046..7989667,7990537..7990673,
FT                   7991694..7991765,7992175..7992289,7992602..7992747,
FT                   7992922..7993107,7993192..7993349,7994165..7994273,
FT                   7994794..7994850,7996174..7996404,8003511..8003664))
FT                   /gene="Stk25"
FT                   /locus_tag="mCG_145749"
FT                   /product="serine/threonine kinase 25 (yeast), transcript
FT                   variant mCT185737"
FT                   /note="gene_id=mCG145749.0 transcript_id=mCT185737.0
FT                   created on 10-JUN-2003"
FT   CDS             complement(join(7989628..7989667,7990537..7990673,
FT                   7991694..7991765,7992175..7992289,7992602..7992747,
FT                   7992922..7993107,7993192..7993349,7994165..7994273,
FT                   7994794..7994850,7996174..7996404,8003511..8003540))
FT                   /codon_start=1
FT                   /gene="Stk25"
FT                   /locus_tag="mCG_145749"
FT                   /product="serine/threonine kinase 25 (yeast), isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG145749.0 transcript_id=mCT185737.0
FT                   protein_id=mCP106994.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q9Z2W1"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="MGI:MGI:1891699"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z2W1"
FT                   /protein_id="EDL39941.1"
FT                   /translation="MAHLRGFAHQHSRVDPEELFTKLDRIGKGSFGEVYKGIDNHTKEV
FT                   VAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYITRYFGSYLKSTKLWIIMEYLGGGSAL
FT                   DLLKPGPLEETYIATILREILKGLDYLHSERKIHRDIKAANVLLSEQGDVKLADFGVAG
FT                   QLTDTQIKRNTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPNSDLHPMR
FT                   VLFLIPKNNPPTLEGHHSKPFKEFVEACLNKDPRFRPTAKELLKHKFITRYTKKTSFLT
FT                   ELIDRYKRWKSEGHGEESSSEDSDIDGEAEDGEQGPIWTFPPTIRPSPHSKLHKGTALH
FT                   SSQKPAEPIKRQPRSQCLSTLVRPVFGELKEKHKQSGGSVGALEELENAFSLAEESCPG
FT                   ISDKLMVHLVERVQRFSHSRNHLTSTR"
FT   CDS             complement(join(7989628..7989667,7990537..7990673,
FT                   7991694..7991765,7992175..7992289,7992602..7992747,
FT                   7992922..7993107,7993192..7993349,7994165..7994273,
FT                   7994794..7994850,7996174..7996404,8003511..8003540))
FT                   /codon_start=1
FT                   /gene="Stk25"
FT                   /locus_tag="mCG_145749"
FT                   /product="serine/threonine kinase 25 (yeast), isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG145749.0 transcript_id=mCT185736.0
FT                   protein_id=mCP106995.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q9Z2W1"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="MGI:MGI:1891699"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z2W1"
FT                   /protein_id="EDL39942.1"
FT                   /translation="MAHLRGFAHQHSRVDPEELFTKLDRIGKGSFGEVYKGIDNHTKEV
FT                   VAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYITRYFGSYLKSTKLWIIMEYLGGGSAL
FT                   DLLKPGPLEETYIATILREILKGLDYLHSERKIHRDIKAANVLLSEQGDVKLADFGVAG
FT                   QLTDTQIKRNTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPNSDLHPMR
FT                   VLFLIPKNNPPTLEGHHSKPFKEFVEACLNKDPRFRPTAKELLKHKFITRYTKKTSFLT
FT                   ELIDRYKRWKSEGHGEESSSEDSDIDGEAEDGEQGPIWTFPPTIRPSPHSKLHKGTALH
FT                   SSQKPAEPIKRQPRSQCLSTLVRPVFGELKEKHKQSGGSVGALEELENAFSLAEESCPG
FT                   ISDKLMVHLVERVQRFSHSRNHLTSTR"
FT   CDS             complement(join(7989628..7989667,7990537..7990673,
FT                   7991694..7991765,7992175..7992289,7992602..7992747,
FT                   7992922..7993107,7993192..7993233))
FT                   /codon_start=1
FT                   /gene="Stk25"
FT                   /locus_tag="mCG_145749"
FT                   /product="serine/threonine kinase 25 (yeast), isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG145749.0 transcript_id=mCT185735.0
FT                   protein_id=mCP106993.0 isoform=CRA_b"
FT                   /protein_id="EDL39943.1"
FT                   /translation="MAPEVIKQSAYDFKADIWSLGITAIELAKGEPPNSDLHPMRVLFL
FT                   IPKNNPPTLEGHHSKPFKEFVEACLNKDPRFRPTAKELLKHKFITRYTKKTSFLTELID
FT                   RYKRWKSEGHGEESSSEDSDIDGEAEDGEQGPIWTFPPTIRPSPHSKLHKGTALHSSQK
FT                   PAEPIKRQPRSQCLSTLVRPVFGELKEKHKQSGGSVGALEELENAFSLAEESCPGISDK
FT                   LMVHLVERVQRFSHSRNHLTSTR"
FT   assembly_gap    7998061..7998080
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8005991..8006010
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8017553..8017955
FT                   /estimated_length=403
FT                   /gap_type="unknown"
FT   assembly_gap    8021064..8021083
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8023690..8023850
FT                   /estimated_length=161
FT                   /gap_type="unknown"
FT   assembly_gap    8037409..8037428
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8046804..8047066
FT                   /estimated_length=263
FT                   /gap_type="unknown"
FT   assembly_gap    8049876..8049895
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            8052162..8062306
FT                   /gene="Bok"
FT                   /locus_tag="mCG_12635"
FT                   /note="gene_id=mCG12635.1"
FT   mRNA            join(8052162..8052324,8052888..8053139,8055627..8055755,
FT                   8060614..8060777,8061581..8062306)
FT                   /gene="Bok"
FT                   /locus_tag="mCG_12635"
FT                   /product="Bcl-2-related ovarian killer protein, transcript
FT                   variant mCT13321"
FT                   /note="gene_id=mCG12635.1 transcript_id=mCT13321.0 created
FT                   on 30-DEC-2002"
FT   mRNA            join(8052733..8053139,8055627..8055755,8060614..8060777,
FT                   8061581..8062008)
FT                   /gene="Bok"
FT                   /locus_tag="mCG_12635"
FT                   /product="Bcl-2-related ovarian killer protein, transcript
FT                   variant mCT177875"
FT                   /note="gene_id=mCG12635.1 transcript_id=mCT177875.0 created
FT                   on 30-DEC-2002"
FT   CDS             join(8052917..8053139,8055627..8055755,8060614..8060777,
FT                   8061581..8061706)
FT                   /codon_start=1
FT                   /gene="Bok"
FT                   /locus_tag="mCG_12635"
FT                   /product="Bcl-2-related ovarian killer protein, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG12635.1 transcript_id=mCT13321.0
FT                   protein_id=mCP20987.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q3TH93"
FT                   /db_xref="InterPro:IPR002475"
FT                   /db_xref="InterPro:IPR026298"
FT                   /db_xref="InterPro:IPR026309"
FT                   /db_xref="MGI:MGI:1858494"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TH93"
FT                   /protein_id="EDL39939.1"
FT                   /translation="MEVLRRSSVFAAEIMDAFDRSPTDKELVAQAKALGREYVHARLLR
FT                   AGLSWSAPERASPAPGGRLAEVCTVLLRLGDELEQIRPSVYRNVARQLHIPLQSEPVVT
FT                   DAFLAVAGHIFSAGITWGKVVSLYSVAAGLAVDCVRQAQPAMVHALVDCLGEFVRKTLA
FT                   TWLRRRGGWTDVLKCVVSTDPGFRSHWLVATLCSFGRFLKAAFFLLLPER"
FT   CDS             join(8052917..8053139,8055627..8055755,8060614..8060777,
FT                   8061581..8061706)
FT                   /codon_start=1
FT                   /gene="Bok"
FT                   /locus_tag="mCG_12635"
FT                   /product="Bcl-2-related ovarian killer protein, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG12635.1 transcript_id=mCT177875.0
FT                   protein_id=mCP100797.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q3TH93"
FT                   /db_xref="InterPro:IPR002475"
FT                   /db_xref="InterPro:IPR026298"
FT                   /db_xref="InterPro:IPR026309"
FT                   /db_xref="MGI:MGI:1858494"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TH93"
FT                   /protein_id="EDL39940.1"
FT                   /translation="MEVLRRSSVFAAEIMDAFDRSPTDKELVAQAKALGREYVHARLLR
FT                   AGLSWSAPERASPAPGGRLAEVCTVLLRLGDELEQIRPSVYRNVARQLHIPLQSEPVVT
FT                   DAFLAVAGHIFSAGITWGKVVSLYSVAAGLAVDCVRQAQPAMVHALVDCLGEFVRKTLA
FT                   TWLRRRGGWTDVLKCVVSTDPGFRSHWLVATLCSFGRFLKAAFFLLLPER"
FT   gene            complement(8071956..8120434)
FT                   /gene="Thap4"
FT                   /locus_tag="mCG_12632"
FT                   /note="gene_id=mCG12632.2"
FT   mRNA            complement(join(8071956..8072220,8081294..8081397,
FT                   8082644..8082753,8091164..8091323,8115673..8116811,
FT                   8120290..8120434))
FT                   /gene="Thap4"
FT                   /locus_tag="mCG_12632"
FT                   /product="THAP domain containing 4, transcript variant
FT                   mCT13318"
FT                   /note="gene_id=mCG12632.2 transcript_id=mCT13318.2 created
FT                   on 03-FEB-2003"
FT   mRNA            complement(join(8071967..8072220,8081294..8081397,
FT                   8082644..8082753,8091164..8091323,8097893..8097949))
FT                   /gene="Thap4"
FT                   /locus_tag="mCG_12632"
FT                   /product="THAP domain containing 4, transcript variant
FT                   mCT179496"
FT                   /note="gene_id=mCG12632.2 transcript_id=mCT179496.0 created
FT                   on 03-FEB-2003"
FT   CDS             complement(join(8072101..8072220,8081294..8081397,
FT                   8082644..8082753,8091164..8091323,8115673..8116811,
FT                   8120290..8120366))
FT                   /codon_start=1
FT                   /gene="Thap4"
FT                   /locus_tag="mCG_12632"
FT                   /product="THAP domain containing 4, isoform CRA_a"
FT                   /note="gene_id=mCG12632.2 transcript_id=mCT13318.2
FT                   protein_id=mCP20973.2 isoform=CRA_a"
FT                   /protein_id="EDL39937.1"
FT                   /translation="MVICCAAVNCSNRQGKGEKRAVSFHRFPLKDSKRLIQWLKAVQRD
FT                   NWTPTKYSFLCSEHFTKDSFSKRLEDQHRLLKPTAVPSIFHLSEKKRGAGGHGHARRKT
FT                   TAAMRGHTSAETGKGTIGSSLSSSDNLMAKPESRKLKRASLQDDAAPKVTPGAVSQEQG
FT                   QSLEKTPGDDPAAPLARGQEEAQASATEADHQKASSSTDAEGADKSGISMDDFTPPGSG
FT                   ACKFIGSLHSYSFSSKHTRERPSVPREPMDRKRLKREMEPRCSGNSVAQSPPSSSLTAT
FT                   PQKASQSPSAPPTDVTPKPAAEAVQSEHSDASPMSINEVILSASGACKLIDSLHSYCFS
FT                   ARQNKSQVCCLREQVEKKNGELKSLRQKVSRSDSQVRKLREKLDELRRASLPYLPYLSG
FT                   LLPPSHEPPKLNPVVEPLSWMLGTWLSDPPGVGTFPTLQPFQYLEEVHISHVGQPMLNF
FT                   SFNSFHPETHKPMHRECGFIRLKPDTNKVAFVSAQNTGIVEVEEGEVNGQELCVSSHSV
FT                   SRISFAKEPHVEQITRKFRLNSEGKLEQTVSMATTTQPMTQHLHITYKKVTP"
FT   CDS             complement(join(8072101..8072220,8081294..8081397,
FT                   8082644..8082753,8091164..8091323,8097893..8097896))
FT                   /codon_start=1
FT                   /gene="Thap4"
FT                   /locus_tag="mCG_12632"
FT                   /product="THAP domain containing 4, isoform CRA_b"
FT                   /note="gene_id=mCG12632.2 transcript_id=mCT179496.0
FT                   protein_id=mCP102418.0 isoform=CRA_b"
FT                   /protein_id="EDL39938.1"
FT                   /translation="MEPPKLNPVVEPLSWMLGTWLSDPPGVGTFPTLQPFQYLEEVHIS
FT                   HVGQPMLNFSFNSFHPETHKPMHRECGFIRLKPDTNKVAFVSAQNTGIVEVEEGEVNGQ
FT                   ELCVSSHSVSRISFAKEPHVEQITRKFRLNSEGKLEQTVSMATTTQPMTQHLHITYKKV
FT                   TP"
FT   assembly_gap    8101199..8101336
FT                   /estimated_length=138
FT                   /gap_type="unknown"
FT   assembly_gap    8113707..8113726
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8120435..8121408
FT                   /estimated_length=974
FT                   /gap_type="unknown"
FT   assembly_gap    8130221..8130573
FT                   /estimated_length=353
FT                   /gap_type="unknown"
FT   gene            <8133725..8154950
FT                   /gene="Atg4b"
FT                   /locus_tag="mCG_12631"
FT                   /note="gene_id=mCG12631.2"
FT   mRNA            join(<8133725..8133829,8133928..8133999,8139181..8139279,
FT                   8140544..8140645,8141039..8141111,8143696..8143775,
FT                   8146137..8146330,8149832..8149910,8150173..8150318,
FT                   8151331..8151387,8151932..8152025,8153107..8154852)
FT                   /gene="Atg4b"
FT                   /locus_tag="mCG_12631"
FT                   /product="autophagy-related 4B (yeast), transcript variant
FT                   mCT13317"
FT                   /note="gene_id=mCG12631.2 transcript_id=mCT13317.2 created
FT                   on 03-FEB-2003"
FT   mRNA            join(<8133725..8133829,8133928..8133999,8139181..8139279,
FT                   8140544..8140645,8141039..8143775,8146137..8146330,
FT                   8149832..8149910,8150173..8150318,8151331..8151387,
FT                   8151932..8152025,8153107..8153599)
FT                   /gene="Atg4b"
FT                   /locus_tag="mCG_12631"
FT                   /product="autophagy-related 4B (yeast), transcript variant
FT                   mCT193850"
FT                   /note="gene_id=mCG12631.2 transcript_id=mCT193850.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(<8133725..8133829,8133928..8133999,8139181..8139279,
FT                   8140544..8140859)
FT                   /gene="Atg4b"
FT                   /locus_tag="mCG_12631"
FT                   /product="autophagy-related 4B (yeast), transcript variant
FT                   mCT179494"
FT                   /note="gene_id=mCG12631.2 transcript_id=mCT179494.0 created
FT                   on 03-FEB-2003"
FT   CDS             join(<8133727..8133829,8133928..8133999,8139181..8139279,
FT                   8140544..8140645,8141039..8141111,8143696..8143775,
FT                   8146137..8146330,8149832..8149910,8150173..8150318,
FT                   8151331..8151387,8151932..8152025,8153107..8153180)
FT                   /codon_start=1
FT                   /gene="Atg4b"
FT                   /locus_tag="mCG_12631"
FT                   /product="autophagy-related 4B (yeast), isoform CRA_a"
FT                   /note="gene_id=mCG12631.2 transcript_id=mCT13317.2
FT                   protein_id=mCP20964.2 isoform=CRA_a"
FT                   /protein_id="EDL39932.1"
FT                   /translation="ATLTYDTLRFAEFEDFPETSEPVWILGRKYSIFTEKDEILSDVAS
FT                   RLWFTYRRNFPAIGGTGPTSDTGWGCMLRCGQMIFAQALVCRHLGRDWRWTQRKRQPDS
FT                   YFNVLNAFLDRKDSYYSIHQIAQMGVGEGKSIGQWYGPNTVAQVLKKLAVFDTWSSLAV
FT                   HIAMDNTVVMEEIRRLCRANLPCAGAAALPTDSERHCNGFPAGAEVTNRPSAWRPLVLL
FT                   IPLRLGLTDINEAYVETLKHCFMMPQSLGVIGGKPNSAHYFIGYVGEELIYLDPHTTQP
FT                   AVELTDSCFIPDESFHCQHPPSRMGIGELDPSIAVGFFCKKEEDFNDWCQQVKKLSQLG
FT                   GALPMFELVEQQPSHLACQDVLNLSLDSSDVERLERFFDSEDEDFEILSL"
FT   CDS             join(<8133727..8133829,8133928..8133999,8139181..8139279,
FT                   8140544..8140656)
FT                   /codon_start=1
FT                   /gene="Atg4b"
FT                   /locus_tag="mCG_12631"
FT                   /product="autophagy-related 4B (yeast), isoform CRA_c"
FT                   /note="gene_id=mCG12631.2 transcript_id=mCT179494.0
FT                   protein_id=mCP102417.0 isoform=CRA_c"
FT                   /protein_id="EDL39934.1"
FT                   /translation="ATLTYDTLRFAEFEDFPETSEPVWILGRKYSIFTEKDEILSDVAS
FT                   RLWFTYRRNFPAIGGTGPTSDTGWGCMLRCGQMIFAQALVCRHLGRDWRWTQRKRQPDS
FT                   YFNVLNAFLDRKDSYYSIHQIGGD"
FT   assembly_gap    8137122..8137269
FT                   /estimated_length=148
FT                   /gap_type="unknown"
FT   CDS             join(<8143619..8143775,8146137..8146330,8149832..8149910,
FT                   8150173..8150318,8151331..8151387,8151932..8152025,
FT                   8153107..8153180)
FT                   /codon_start=1
FT                   /gene="Atg4b"
FT                   /locus_tag="mCG_12631"
FT                   /product="autophagy-related 4B (yeast), isoform CRA_d"
FT                   /note="gene_id=mCG12631.2 transcript_id=mCT193850.0
FT                   protein_id=mCP114803.0 isoform=CRA_d"
FT                   /protein_id="EDL39936.1"
FT                   /translation="NCLNCHCCGVMLMLYKAHGSVLAFCRKLAVFDTWSSLAVHIAMDN
FT                   TVVMEEIRRLCRANLPCAGAAALPTDSERHCNGFPAGAEVTNRPSAWRPLVLLIPLRLG
FT                   LTDINEAYVETLKHCFMMPQSLGVIGGKPNSAHYFIGYVGEELIYLDPHTTQPAVELTD
FT                   SCFIPDESFHCQHPPSRMGIGELDPSIAVGFFCKKEEDFNDWCQQVKKLSQLGGALPMF
FT                   ELVEQQPSHLACQDVLNLSLDSSDVERLERFFDSEDEDFEILSL"
FT   mRNA            join(8151045..8151387,8151932..8152025,8153107..8154852)
FT                   /gene="Atg4b"
FT                   /locus_tag="mCG_12631"
FT                   /product="autophagy-related 4B (yeast), transcript variant
FT                   mCT179493"
FT                   /note="gene_id=mCG12631.2 transcript_id=mCT179493.0 created
FT                   on 03-FEB-2003"
FT   mRNA            join(8151194..8152025,8153107..8154950)
FT                   /gene="Atg4b"
FT                   /locus_tag="mCG_12631"
FT                   /product="autophagy-related 4B (yeast), transcript variant
FT                   mCT179495"
FT                   /note="gene_id=mCG12631.2 transcript_id=mCT179495.0 created
FT                   on 03-FEB-2003"
FT   CDS             join(8151959..8152025,8153107..8153180)
FT                   /codon_start=1
FT                   /gene="Atg4b"
FT                   /locus_tag="mCG_12631"
FT                   /product="autophagy-related 4B (yeast), isoform CRA_b"
FT                   /note="gene_id=mCG12631.2 transcript_id=mCT179493.0
FT                   protein_id=mCP102415.0 isoform=CRA_b"
FT                   /protein_id="EDL39933.1"
FT                   /translation="MFELVEQQPSHLACQDVLNLSLDSSDVERLERFFDSEDEDFEILS
FT                   L"
FT   CDS             join(8151959..8152025,8153107..8153180)
FT                   /codon_start=1
FT                   /gene="Atg4b"
FT                   /locus_tag="mCG_12631"
FT                   /product="autophagy-related 4B (yeast), isoform CRA_b"
FT                   /note="gene_id=mCG12631.2 transcript_id=mCT179495.0
FT                   protein_id=mCP102416.0 isoform=CRA_b"
FT                   /protein_id="EDL39935.1"
FT                   /translation="MFELVEQQPSHLACQDVLNLSLDSSDVERLERFFDSEDEDFEILS
FT                   L"
FT   gene            complement(8157833..8167443)
FT                   /gene="Dtymk"
FT                   /locus_tag="mCG_12637"
FT                   /note="gene_id=mCG12637.1"
FT   mRNA            complement(join(8157833..8158366,8160094..8160291,
FT                   8163886..8163976,8166308..8166416,8167205..8167443))
FT                   /gene="Dtymk"
FT                   /locus_tag="mCG_12637"
FT                   /product="deoxythymidylate kinase, transcript variant
FT                   mCT13323"
FT                   /note="gene_id=mCG12637.1 transcript_id=mCT13323.1 created
FT                   on 30-DEC-2002"
FT   CDS             complement(join(8158256..8158366,8160094..8160291,
FT                   8163886..8163976,8166308..8166416,8167205..8167334))
FT                   /codon_start=1
FT                   /gene="Dtymk"
FT                   /locus_tag="mCG_12637"
FT                   /product="deoxythymidylate kinase, isoform CRA_a"
FT                   /note="gene_id=mCG12637.1 transcript_id=mCT13323.1
FT                   protein_id=mCP20996.1 isoform=CRA_a"
FT                   /protein_id="EDL39930.1"
FT                   /translation="MASRRGALIVLEGVDRAGKTTQGLKLVTALCASGHRAELLRFPER
FT                   STEIGKLLNSYLEKKTELEDHSVHLLFSANRWEQVPLIKAKLNQGVTLVLDRYAFSGVA
FT                   FTGAKENFSLDWCKQPDVGLPKPDLILFLQLQLLDAAARGEFGLERYETGTFQKQVLLC
FT                   FQQLMEEKNLNWKVVDASKSIEEVHKEIRAHSEDAIRNAAQRPLGELWK"
FT   assembly_gap    8158837..8159533
FT                   /estimated_length=697
FT                   /gap_type="unknown"
FT   mRNA            complement(join(8166002..8166416,8167205..8167443))
FT                   /gene="Dtymk"
FT                   /locus_tag="mCG_12637"
FT                   /product="deoxythymidylate kinase, transcript variant
FT                   mCT177876"
FT                   /note="gene_id=mCG12637.1 transcript_id=mCT177876.0 created
FT                   on 30-DEC-2002"
FT   CDS             complement(join(8166304..8166416,8167205..8167334))
FT                   /codon_start=1
FT                   /gene="Dtymk"
FT                   /locus_tag="mCG_12637"
FT                   /product="deoxythymidylate kinase, isoform CRA_b"
FT                   /note="gene_id=mCG12637.1 transcript_id=mCT177876.0
FT                   protein_id=mCP100798.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q6GRA7"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:108396"
FT                   /db_xref="UniProtKB/TrEMBL:Q6GRA7"
FT                   /protein_id="EDL39931.1"
FT                   /translation="MASRRGALIVLEGVDRAGKTTQGLKLVTALCASGHRAELLRFPER
FT                   STEIGKLLNSYLEKKTELEDHSVHLLFSANRWEQV"
FT   assembly_gap    8169466..8169780
FT                   /estimated_length=315
FT                   /gap_type="unknown"
FT   gene            <8169800..8184950
FT                   /gene="Ing5"
FT                   /locus_tag="mCG_12636"
FT                   /note="gene_id=mCG12636.2"
FT   mRNA            join(8169800..8169974,8171502..8171573,8177277..8177443,
FT                   8177902..8178017,8178164..8178254,8181870..8182005,
FT                   8182133..8182194,8183774..8184950)
FT                   /gene="Ing5"
FT                   /locus_tag="mCG_12636"
FT                   /product="inhibitor of growth family, member 5, transcript
FT                   variant mCT13322"
FT                   /note="gene_id=mCG12636.2 transcript_id=mCT13322.2 created
FT                   on 30-DEC-2002"
FT   mRNA            join(<8169800..8169974,8171502..8171573,8177277..8177443,
FT                   8177902..8178013,8178161..8178254,8181870..8182005,
FT                   8182133..8182194,8183774..8183875)
FT                   /gene="Ing5"
FT                   /locus_tag="mCG_12636"
FT                   /product="inhibitor of growth family, member 5, transcript
FT                   variant mCT193853"
FT                   /note="gene_id=mCG12636.2 transcript_id=mCT193853.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<8169929..8169974,8171502..8171573,8177277..8177443,
FT                   8177902..8178013,8178161..8178254,8181870..8182005,
FT                   8182133..8182194,8183774..8183816)
FT                   /codon_start=1
FT                   /gene="Ing5"
FT                   /locus_tag="mCG_12636"
FT                   /product="inhibitor of growth family, member 5, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG12636.2 transcript_id=mCT193853.0
FT                   protein_id=mCP114829.0 isoform=CRA_a"
FT                   /protein_id="EDL39928.1"
FT                   /translation="WGAFFEGTRAITSQPGIENLPCELQRNFQLMRELDQRTEDKKAEI
FT                   DILAAEYISTVKTLSSAQRVEHLQKIQSAYSKCKEYSDDKVQLAMQTYEMVDKHIRRLD
FT                   ADLARFEADLKDRMDGSDFESTGARSLKKGRSQKEKRSSRGRGRRTSEEDTPKKKKHKS
FT                   GSEFTDSILSVHPSDVLDMPVDPNEPTYCLCHQVSYGEMIGCDNPDCPIEWFHFACVDL
FT                   TTKPKGKWFCPRCVQEKRKKK"
FT   CDS             join(8171546..8171573,8177277..8177443,8177902..8178017,
FT                   8178164..8178248)
FT                   /codon_start=1
FT                   /gene="Ing5"
FT                   /locus_tag="mCG_12636"
FT                   /product="inhibitor of growth family, member 5, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG12636.2 transcript_id=mCT13322.2
FT                   protein_id=mCP20991.2 isoform=CRA_b"
FT                   /protein_id="EDL39929.1"
FT                   /translation="MRELDQRTEDKKAEIDILAAEYISTVKTLSSAQRVEHLQKIQSAY
FT                   SKCKEYSDDKVQLAMQTYEMVDKHIRRLDADLARFEADLKDRMDGSDFESTGARSLKSK
FT                   PESERKKKLPGPRPADVRRGYPKEEET"
FT   assembly_gap    8176461..8176480
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            8190735..8209510
FT                   /locus_tag="mCG_12639"
FT                   /note="gene_id=mCG12639.2"
FT   mRNA            join(8190735..8190815,8191798..8192136,8194712..8194769,
FT                   8195275..8195414,8203823..8203965,8206842..8207008,
FT                   8208540..8209510)
FT                   /locus_tag="mCG_12639"
FT                   /product="mCG12639, transcript variant mCT179498"
FT                   /note="gene_id=mCG12639.2 transcript_id=mCT179498.0 created
FT                   on 03-FEB-2003"
FT   mRNA            join(8190736..8191076,8191781..8192136,8194712..8194769,
FT                   8195275..8195414,8197667..8197860,8200343..8200511,
FT                   8202942..8203085,8203823..8203965,8206842..8207008,
FT                   8208540..8209510)
FT                   /locus_tag="mCG_12639"
FT                   /product="mCG12639, transcript variant mCT179499"
FT                   /note="gene_id=mCG12639.2 transcript_id=mCT179499.0 created
FT                   on 03-FEB-2003"
FT   mRNA            join(8190763..8190815,8191798..8192136,8194712..8194769,
FT                   8195275..8195414,8197667..8197860,8200343..8200511,
FT                   8202942..8203085,8203823..8203965,8206842..8207007,
FT                   8208540..8209510)
FT                   /locus_tag="mCG_12639"
FT                   /product="mCG12639, transcript variant mCT13325"
FT                   /note="gene_id=mCG12639.2 transcript_id=mCT13325.2 created
FT                   on 03-FEB-2003"
FT   CDS             join(8191033..8191076,8191781..8192136,8194712..8194769,
FT                   8195275..8195414,8197667..8197860,8200343..8200511,
FT                   8202942..8203085,8203823..8203965,8206842..8207008,
FT                   8208540..8208624)
FT                   /codon_start=1
FT                   /locus_tag="mCG_12639"
FT                   /product="mCG12639, isoform CRA_b"
FT                   /note="gene_id=mCG12639.2 transcript_id=mCT179499.0
FT                   protein_id=mCP102420.0 isoform=CRA_b"
FT                   /protein_id="EDL39925.1"
FT                   /translation="MRMLCACRVVFFRLSPLSRAGTMVLPLVSRWSARVLWASPGWRRT
FT                   YTQRACVGLKRLGCPRGVYSPLAHRAYSVVAGGPEVTLTPERYPVQRLPFSTVSEEDLA
FT                   AFECIIPGRVITDPEQLQTCNVDWLKTVRGCSKVLLRPQTSEEVSQILRHCYKRNLAVN
FT                   PQGGNTGMVGGSVPVFDEVILSTALMNQVISFHDVSGILVCQAGCVLEELSRYVQERDF
FT                   IMPLDLGAKGSCHIGGNVATNAGGLRFLRYGSLRGTVLGLEVVLADGTILNCLTSLRKD
FT                   NTGYDLKQMFIGSEGTLGVITAVSIVCPPRPKAVNVAFLGCPGFAEVLQTFRTCRGMLG
FT                   EILSAFEFMDTECMQLVGQHLQLTNPVQESPFYVLVETSGSSAGHDAEKLTNVLEQVLN
FT                   SGLVTDGTMATDQRKVQMLWALRERITEALSRDGYVFKYDLSLPVERLYDLVIDLRTRL
FT                   GPRAKHVVGYGHLGLLPNRPDLTSSGVGGLWRPALLHLYSA"
FT   mRNA            join(8191777..8192367,8194712..8194769,8195275..8195414,
FT                   8200343..8200384)
FT                   /locus_tag="mCG_12639"
FT                   /product="mCG12639, transcript variant mCT179497"
FT                   /note="gene_id=mCG12639.2 transcript_id=mCT179497.0 created
FT                   on 03-FEB-2003"
FT   CDS             join(8191803..8192136,8194712..8194769,8195275..8195414,
FT                   8197667..8197860,8200343..8200511,8202942..8203085,
FT                   8203823..8203965,8206842..8207007,8208540..8208652)
FT                   /codon_start=1
FT                   /locus_tag="mCG_12639"
FT                   /product="mCG12639, isoform CRA_c"
FT                   /note="gene_id=mCG12639.2 transcript_id=mCT13325.2
FT                   protein_id=mCP21001.2 isoform=CRA_c"
FT                   /protein_id="EDL39926.1"
FT                   /translation="MVLPLVSRWSARVLWASPGWRRTYTQRACVGLKRLGCPRGVYSPL
FT                   AHRAYSVVAGGPEVTLTPERYPVQRLPFSTVSEEDLAAFECIIPGRVITDPEQLQTCNV
FT                   DWLKTVRGCSKVLLRPQTSEEVSQILRHCYKRNLAVNPQGGNTGMVGGSVPVFDEVILS
FT                   TALMNQVISFHDVSGILVCQAGCVLEELSRYVQERDFIMPLDLGAKGSCHIGGNVATNA
FT                   GGLRFLRYGSLRGTVLGLEVVLADGTILNCLTSLRKDNTGYDLKQMFIGSEGTLGVITA
FT                   VSIVCPPRPKAVNVAFLGCPGFAEVLQTFRTCRGMLGEILSAFEFMDTECMQLVGQHLQ
FT                   LTNPVQESPFYVLVETSGSSAGHDAEKLTNVLEQVLNSGLVTDGTMATDQRKVQMLWAL
FT                   RERITEALSRDGYVFKYDLSLPVERLYDLVIDLRTRLGPRAKHVVGYGHLAYSQTGQIS
FT                   PALGWVACGDLLCCISIARNFKRSLLAW"
FT   CDS             join(8191803..8192136,8194712..8194769,8195275..8195414,
FT                   8203823..8203965,8206842..8207008,8208540..8208624)
FT                   /codon_start=1
FT                   /locus_tag="mCG_12639"
FT                   /product="mCG12639, isoform CRA_a"
FT                   /note="gene_id=mCG12639.2 transcript_id=mCT179498.0
FT                   protein_id=mCP102421.0 isoform=CRA_a"
FT                   /protein_id="EDL39924.1"
FT                   /translation="MVLPLVSRWSARVLWASPGWRRTYTQRACVGLKRLGCPRGVYSPL
FT                   AHRAYSVVAGGPEVTLTPERYPVQRLPFSTVSEEDLAAFECIIPGRVITDPEQLQTCNV
FT                   DWLKTVRGCSKVLLRPQTSEEVSQILRHCYKRNLAVNPQGGNTGMVGGSVPVFDEVILS
FT                   TALMNQVISFHDVSESPFYVLVETSGSSAGHDAEKLTNVLEQVLNSGLVTDGTMATDQR
FT                   KVQMLWALRERITEALSRDGYVFKYDLSLPVERLYDLVIDLRTRLGPRAKHVVGYGHLG
FT                   LLPNRPDLTSSGVGGLWRPALLHLYSA"
FT   CDS             8191803..8192219
FT                   /codon_start=1
FT                   /locus_tag="mCG_12639"
FT                   /product="mCG12639, isoform CRA_d"
FT                   /note="gene_id=mCG12639.2 transcript_id=mCT179497.0
FT                   protein_id=mCP102419.0 isoform=CRA_d"
FT                   /protein_id="EDL39927.1"
FT                   /translation="MVLPLVSRWSARVLWASPGWRRTYTQRACVGLKRLGCPRGVYSPL
FT                   AHRAYSVVAGGPEVTLTPERYPVQRLPFSTVSEEDLAAFECIIPGRVITDPEQLQTCNV
FT                   DWLKTVRGEPGRGRGEQIPRPLASYPFDDTTKVF"
FT   assembly_gap    8201531..8201553
FT                   /estimated_length=23
FT                   /gap_type="unknown"
FT   assembly_gap    8204508..8206249
FT                   /estimated_length=1742
FT                   /gap_type="unknown"
FT   assembly_gap    8208297..8208539
FT                   /estimated_length=243
FT                   /gap_type="unknown"
FT   assembly_gap    8210340..8211524
FT                   /estimated_length=1185
FT                   /gap_type="unknown"
FT   assembly_gap    8212805..8233591
FT                   /estimated_length=20787
FT                   /gap_type="unknown"
FT   assembly_gap    8235943..8235962
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8248820..8248962
FT                   /estimated_length=143
FT                   /gap_type="unknown"
FT   assembly_gap    8252317..8253663
FT                   /estimated_length=1347
FT                   /gap_type="unknown"
FT   gene            8263276..8270548
FT                   /pseudo
FT                   /locus_tag="mCG_129187"
FT                   /note="gene_id=mCG129187.1"
FT   mRNA            join(8263276..8263340,8263850..8263989,8267973..8268115,
FT                   8270492..8270548)
FT                   /pseudo
FT                   /locus_tag="mCG_129187"
FT                   /note="gene_id=mCG129187.1 transcript_id=mCT130494.1
FT                   created on 03-FEB-2003"
FT   assembly_gap    8266083..8267135
FT                   /estimated_length=1053
FT                   /gap_type="unknown"
FT   assembly_gap    8268355..8268914
FT                   /estimated_length=560
FT                   /gap_type="unknown"
FT   assembly_gap    8270549..8273764
FT                   /estimated_length=3216
FT                   /gap_type="unknown"
FT   assembly_gap    8280903..8280922
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8284800..8284819
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8288876..8288895
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8291162..8291181
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8292720..8294990
FT                   /estimated_length=2271
FT                   /gap_type="unknown"
FT   gene            8306845..8312601
FT                   /gene="Neu4"
FT                   /locus_tag="mCG_49567"
FT                   /note="gene_id=mCG49567.2"
FT   mRNA            join(8306845..8306984,8308725..8308957,8309060..8309315,
FT                   8310804..8312601)
FT                   /gene="Neu4"
FT                   /locus_tag="mCG_49567"
FT                   /product="sialidase 4"
FT                   /note="gene_id=mCG49567.2 transcript_id=mCT49750.2 created
FT                   on 03-FEB-2003"
FT   CDS             join(8308757..8308957,8309060..8309315,8310804..8311783)
FT                   /codon_start=1
FT                   /gene="Neu4"
FT                   /locus_tag="mCG_49567"
FT                   /product="sialidase 4"
FT                   /note="gene_id=mCG49567.2 transcript_id=mCT49750.2
FT                   protein_id=mCP41060.2"
FT                   /protein_id="EDL39923.1"
FT                   /translation="MGPTRVPRRTVLFQRERTGLTYRVPALLCVPPRPTLLAFAEQRLS
FT                   PDDSHAHRLVLRRGTLTRGSVRWGTLSVLETAVLEEHRSMNPCPVLDEHSGTIFLFFIA
FT                   VLGHTPEAVQIATGKNAARLCCVTSCDAGLTWGSVRDLTEEAIGAALQDWATFAVGPGH
FT                   GVQLRSGRLLVPAYTYHVDRRECFGKICWTSPHSLAFYSDDHGISWHCGGLVPNLRSGE
FT                   CQLAAVDGDFLYCNARSPLGNRVQALSADEGTSFLPGELVPTLAETARGCQGSIVGFLA
FT                   PPSIEPQDDRWTGSPRNTPHSPCFNLRVQESSGEGARGLLERWMPRLPLCYPQSRSPEN
FT                   HGLEPGSDGDKTSWTPECPMSSDSMLQSPTWLLYSHPAGRRARLHMGIYLSRSPLDPHS
FT                   WTEPWVIYEGPSGYSDLAFLGPMPGASLVFACLFESGTRTSYEDISFCLFSLADVLENV
FT                   PTGLEMLSLRDKAQGHCWPS"
FT   assembly_gap    8324016..8324096
FT                   /estimated_length=81
FT                   /gap_type="unknown"
FT   gene            complement(8324711..8338955)
FT                   /gene="Pdcd1"
FT                   /locus_tag="mCG_12634"
FT                   /note="gene_id=mCG12634.1"
FT   mRNA            complement(join(8324711..8325945,8326499..8326533,
FT                   8327115..8327276,8327561..8327920,8338817..8338955))
FT                   /gene="Pdcd1"
FT                   /locus_tag="mCG_12634"
FT                   /product="programmed cell death 1"
FT                   /note="gene_id=mCG12634.1 transcript_id=mCT13320.1 created
FT                   on 30-DEC-2002"
FT   CDS             complement(join(8325712..8325945,8326499..8326533,
FT                   8327115..8327276,8327561..8327920,8338817..8338892))
FT                   /codon_start=1
FT                   /gene="Pdcd1"
FT                   /locus_tag="mCG_12634"
FT                   /product="programmed cell death 1"
FT                   /note="gene_id=mCG12634.1 transcript_id=mCT13320.1
FT                   protein_id=mCP20985.1"
FT                   /db_xref="GOA:Q544F3"
FT                   /db_xref="InterPro:IPR003599"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013106"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="MGI:MGI:104879"
FT                   /db_xref="UniProtKB/TrEMBL:Q544F3"
FT                   /protein_id="EDL39922.1"
FT                   /translation="MWVRQVPWSFTWAVLQLSWQSGWLLEVPNGPWRSLTFYPAWLTVS
FT                   EGANATFTCSLSNWSEDLMLNWNRLSPSNQTEKQAAFCNGLSQPVQDARFQIIQLPNRH
FT                   DFHMNILDTRRNDSGIYLCGAISLHPKAKIEESPGAELVVTERILETSTRYPSPSPKPE
FT                   GRFQGMVIGIMSALVGIPVLLLLAWALAVFCSTSMSEARGAGSKDDTLKEEPSAAPVPS
FT                   VAYEELDFQGREKTPELPTACVHTEYATIVFTEGLGASAMGRRGSADGLQGPRPPRHED
FT                   GHCSWPL"
FT   assembly_gap    8381850..8381933
FT                   /estimated_length=84
FT                   /gap_type="unknown"
FT   assembly_gap    8388440..8394204
FT                   /estimated_length=5765
FT                   /gap_type="unknown"
FT   assembly_gap    8395702..8395756
FT                   /estimated_length=55
FT                   /gap_type="unknown"
FT   assembly_gap    8400679..8400698
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8436175..8436240
FT                   /estimated_length=66
FT                   /gap_type="unknown"
FT   assembly_gap    8455288..8455308
FT                   /estimated_length=21
FT                   /gap_type="unknown"
FT   assembly_gap    8462072..8462189
FT                   /estimated_length=118
FT                   /gap_type="unknown"
FT   assembly_gap    8474235..8474254
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8508419..8508522
FT                   /estimated_length=104
FT                   /gap_type="unknown"
FT   assembly_gap    8509987..8511182
FT                   /estimated_length=1196
FT                   /gap_type="unknown"
FT   assembly_gap    8516927..8519056
FT                   /estimated_length=2130
FT                   /gap_type="unknown"
FT   assembly_gap    8523612..8524146
FT                   /estimated_length=535
FT                   /gap_type="unknown"
FT   assembly_gap    8525373..8525465
FT                   /estimated_length=93
FT                   /gap_type="unknown"
FT   assembly_gap    8526492..8526946
FT                   /estimated_length=455
FT                   /gap_type="unknown"
FT   assembly_gap    8532187..8532206
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8534688..8537492
FT                   /estimated_length=2805
FT                   /gap_type="unknown"
FT   assembly_gap    8566911..8566930
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8601230..8601249
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8616347..8616709
FT                   /estimated_length=363
FT                   /gap_type="unknown"
FT   assembly_gap    8619345..8619364
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8622755..8623749
FT                   /estimated_length=995
FT                   /gap_type="unknown"
FT   assembly_gap    8625275..8625304
FT                   /estimated_length=30
FT                   /gap_type="unknown"
FT   assembly_gap    8633261..8633651
FT                   /estimated_length=391
FT                   /gap_type="unknown"
FT   assembly_gap    8658010..8658029
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8670299..8671518
FT                   /estimated_length=1220
FT                   /gap_type="unknown"
FT   assembly_gap    8679468..8680018
FT                   /estimated_length=551
FT                   /gap_type="unknown"
FT   assembly_gap    8681006..8683972
FT                   /estimated_length=2967
FT                   /gap_type="unknown"
FT   assembly_gap    8685644..8685791
FT                   /estimated_length=148
FT                   /gap_type="unknown"
FT   assembly_gap    8716116..8716135
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8722543..8722562
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(8745532..8748396)
FT                   /pseudo
FT                   /locus_tag="mCG_12633"
FT                   /note="gene_id=mCG12633.2"
FT   mRNA            complement(8745532..8748396)
FT                   /pseudo
FT                   /locus_tag="mCG_12633"
FT                   /note="gene_id=mCG12633.2 transcript_id=mCT13319.2 created
FT                   on 03-FEB-2003"
FT   assembly_gap    8757910..8760010
FT                   /estimated_length=2101
FT                   /gap_type="unknown"
FT   assembly_gap    8760785..8761001
FT                   /estimated_length=217
FT                   /gap_type="unknown"
FT   assembly_gap    8767514..8767533
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8769115..8769134
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8798710..8798729
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8807671..8807731
FT                   /estimated_length=61
FT                   /gap_type="unknown"
FT   assembly_gap    8846672..8846691
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8879251..8879270
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8893322..8893396
FT                   /estimated_length=75
FT                   /gap_type="unknown"
FT   assembly_gap    8922838..8923295
FT                   /estimated_length=458
FT                   /gap_type="unknown"
FT   assembly_gap    8926126..8926444
FT                   /estimated_length=319
FT                   /gap_type="unknown"
FT   assembly_gap    8929371..8929390
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8955292..8955311
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9004951..9006058
FT                   /estimated_length=1108
FT                   /gap_type="unknown"
FT   assembly_gap    9020376..9020395
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9046523..9046542
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9048676..9048695
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9052735..9052917
FT                   /estimated_length=183
FT                   /gap_type="unknown"
FT   assembly_gap    9063670..9063689
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <9075865..>9080898
FT                   /locus_tag="mCG_145050"
FT                   /note="gene_id=mCG145050.0"
FT   mRNA            join(<9075865..9076135,9077792..9078810,9079424..9079542,
FT                   9080740..>9080898)
FT                   /locus_tag="mCG_145050"
FT                   /product="mCG145050"
FT                   /note="gene_id=mCG145050.0 transcript_id=mCT184474.0
FT                   created on 05-JUN-2003"
FT   CDS             <9080745..>9080898
FT                   /codon_start=1
FT                   /locus_tag="mCG_145050"
FT                   /product="mCG145050"
FT                   /note="gene_id=mCG145050.0 transcript_id=mCT184474.0
FT                   protein_id=mCP106063.0"
FT                   /protein_id="EDL39921.1"
FT                   /translation="KEHLANTQRLNLTQYRSHPDYGSEEFPRKRTKCRIQIKRFYLINI
FT                   NIDVKC"
FT   assembly_gap    9089106..9090057
FT                   /estimated_length=952
FT                   /gap_type="unknown"
FT   assembly_gap    9114136..9114367
FT                   /estimated_length=232
FT                   /gap_type="unknown"
FT   assembly_gap    9149186..9149508
FT                   /estimated_length=323
FT                   /gap_type="unknown"
FT   assembly_gap    9200856..9201696
FT                   /estimated_length=841
FT                   /gap_type="unknown"
FT   assembly_gap    9205514..9205533
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9235443..9235503
FT                   /estimated_length=61
FT                   /gap_type="unknown"
FT   assembly_gap    9284846..9284865
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9296203..9296222
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9331653..9331672
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9404331..9405286
FT                   /estimated_length=956
FT                   /gap_type="unknown"
FT   assembly_gap    9427649..9427668
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9436191..9437662
FT                   /estimated_length=1472
FT                   /gap_type="unknown"
FT   assembly_gap    9441754..9441773
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9483393..9483412
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9500452..9500505
FT                   /estimated_length=54
FT                   /gap_type="unknown"
FT   assembly_gap    9507049..9507166
FT                   /estimated_length=118
FT                   /gap_type="unknown"
FT   assembly_gap    9508416..9509803
FT                   /estimated_length=1388
FT                   /gap_type="unknown"
FT   assembly_gap    9513559..9519197
FT                   /estimated_length=5639
FT                   /gap_type="unknown"
FT   assembly_gap    9521635..9521654
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9531799..9532329
FT                   /estimated_length=531
FT                   /gap_type="unknown"
FT   gene            complement(9536340..9537175)
FT                   /pseudo
FT                   /locus_tag="mCG_14018"
FT                   /note="gene_id=mCG14018.2"
FT   mRNA            complement(9536340..9537175)
FT                   /pseudo
FT                   /locus_tag="mCG_14018"
FT                   /note="gene_id=mCG14018.2 transcript_id=mCT19034.2 created
FT                   on 03-FEB-2003"
FT   assembly_gap    9540312..9540801
FT                   /estimated_length=490
FT                   /gap_type="unknown"
FT   assembly_gap    9544790..9544902
FT                   /estimated_length=113
FT                   /gap_type="unknown"
FT   gene            9593866..9614739
FT                   /gene="Tmem157"
FT                   /locus_tag="mCG_14016"
FT                   /note="gene_id=mCG14016.1"
FT   mRNA            join(9593866..9594464,9605323..9605457,9614150..9614739)
FT                   /gene="Tmem157"
FT                   /locus_tag="mCG_14016"
FT                   /product="transmembrane protein 157"
FT                   /note="gene_id=mCG14016.1 transcript_id=mCT19032.1 created
FT                   on 30-DEC-2002"
FT   CDS             join(9594031..9594464,9605323..9605457,9614150..9614153)
FT                   /codon_start=1
FT                   /gene="Tmem157"
FT                   /locus_tag="mCG_14016"
FT                   /product="transmembrane protein 157"
FT                   /note="gene_id=mCG14016.1 transcript_id=mCT19032.1
FT                   protein_id=mCP21004.2"
FT                   /protein_id="EDL39920.1"
FT                   /translation="MPTPRGCSGPCHFLAPAFVLLLLPALSGSGAVPSMVVREVQESKS
FT                   PKPGPHTLSPLPPGPTAAQPRGQAQSDAAGLPGAESRNDSIPGAGSEADGLEGKAGEGS
FT                   QGGSLAVSPSPGDKPMTQRALTVLVVVSAAVLVYFVVRTVRMRRRNRKTRRYGVLDTNI
FT                   ENMELTPLEQDDEDDDNTLFDANHPRR"
FT   assembly_gap    9718307..9718326
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9743545..9744370
FT                   /estimated_length=826
FT                   /gap_type="unknown"
FT   assembly_gap    9767817..9767836
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            9778501..9779089
FT                   /locus_tag="mCG_14017"
FT                   /note="gene_id=mCG14017.2"
FT   mRNA            9778501..9779089
FT                   /locus_tag="mCG_14017"
FT                   /product="mCG14017"
FT                   /note="gene_id=mCG14017.2 transcript_id=mCT19033.2 created
FT                   on 13-FEB-2003"
FT   CDS             9778523..9779053
FT                   /codon_start=1
FT                   /locus_tag="mCG_14017"
FT                   /product="mCG14017"
FT                   /note="gene_id=mCG14017.2 transcript_id=mCT19033.2
FT                   protein_id=mCP21010.1"
FT                   /protein_id="EDL39919.1"
FT                   /translation="MKASGTLREYKVVGRCLPTPKCHTPPLYRMRIFAPNHVVAKSRFW
FT                   YFVSQLKKMKKSSGEIVYCRQVFEKSPLRVKNFGIWLRYDSRSGTHNMYREYRDLTTAG
FT                   AVTQCYRDMGARHRARAHSIQIMKVEEIAAGKCRRPAVKQFHDSKIKFPLPHRVLRSQH
FT                   KPRFTTKRPNTFF"
FT   assembly_gap    9793201..9796616
FT                   /estimated_length=3416
FT                   /gap_type="unknown"
FT   assembly_gap    9830834..9831085
FT                   /estimated_length=252
FT                   /gap_type="unknown"
FT   gene            complement(9867673..9947043)
FT                   /gene="St8sia4"
FT                   /locus_tag="mCG_14019"
FT                   /note="gene_id=mCG14019.1"
FT   mRNA            complement(join(9867673..9871955,9907487..9907780,
FT                   9933013..9933270,9940362..9940493,9946598..9947043))
FT                   /gene="St8sia4"
FT                   /locus_tag="mCG_14019"
FT                   /product="ST8 alpha-N-acetyl-neuraminide
FT                   alpha-2,8-sialyltransferase 4"
FT                   /note="gene_id=mCG14019.1 transcript_id=mCT19035.1 created
FT                   on 30-DEC-2002"
FT   CDS             complement(join(9871673..9871955,9907487..9907780,
FT                   9933013..9933270,9940362..9940493,9946598..9946710))
FT                   /codon_start=1
FT                   /gene="St8sia4"
FT                   /locus_tag="mCG_14019"
FT                   /product="ST8 alpha-N-acetyl-neuraminide
FT                   alpha-2,8-sialyltransferase 4"
FT                   /note="gene_id=mCG14019.1 transcript_id=mCT19035.1
FT                   protein_id=mCP21014.2"
FT                   /db_xref="GOA:Q53WR7"
FT                   /db_xref="InterPro:IPR001675"
FT                   /db_xref="InterPro:IPR012163"
FT                   /db_xref="MGI:MGI:106018"
FT                   /db_xref="UniProtKB/TrEMBL:Q53WR7"
FT                   /protein_id="EDL39918.1"
FT                   /translation="MRSIRKRWTICTISLLLIFYKTKEIARTEEHQETQLIGDGELCLS
FT                   RSLVNSSDKIIRKAGSTIFQHSVQGWKINSSLVLEIRKNILRFLDAERDVSVVKSSFKP
FT                   GDVIHYVLDRRRTLNISHNLHSLLPEVSPMKNRRFKTCAVVGNSGILLDSGCGKEIDSH
FT                   NFVIRCNLAPVVEFAADVGTKSDFITMNPSVVQRAFGGFRNESDREKFVHRLSMLNDSV
FT                   LWIPAFMVKGGEKHVEWVNALILKNKLQVRTAYPSLRLIHAVRGYWLTNKVPIKRPSTG
FT                   LLMYTLATRFCDEIHLYGFWPFPKDLNGKAVKYHYYDDLKYRYFSNASPHRMPLEFKTL
FT                   NVLHNRGALKLTTGKCMKQ"
FT   assembly_gap    9876402..9876421
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9915597..9915616
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9946345..9946364
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9974606..9974625
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9975822..9975841
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(9977706..>9993063)
FT                   /locus_tag="mCG_145618"
FT                   /note="gene_id=mCG145618.0"
FT   mRNA            complement(join(9977706..9978018,9989144..9989246,
FT                   9992529..9992591,9992779..>9993063))
FT                   /locus_tag="mCG_145618"
FT                   /product="mCG145618"
FT                   /note="gene_id=mCG145618.0 transcript_id=mCT185042.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(9977789..>9977998)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145618"
FT                   /product="mCG145618"
FT                   /note="gene_id=mCG145618.0 transcript_id=mCT185042.0
FT                   protein_id=mCP106095.0"
FT                   /protein_id="EDL39917.1"
FT                   /translation="QTKCLRLRNLRQKSSLADKSCGLSRSCKCGIRRSAHKPLFLFAAL
FT                   RVQGNCVADVILVSTFLSLPIKPL"
FT   assembly_gap    9988465..9988793
FT                   /estimated_length=329
FT                   /gap_type="unknown"
FT   assembly_gap    10019226..10019748
FT                   /estimated_length=523
FT                   /gap_type="unknown"
FT   assembly_gap    10046145..10046164
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10063327..10068687
FT                   /estimated_length=5361
FT                   /gap_type="unknown"
FT   assembly_gap    10073355..10074362
FT                   /estimated_length=1008
FT                   /gap_type="unknown"
FT   assembly_gap    10080475..10080494
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10081715..10081734
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10083386..10083405
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10084995..10085014
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10087271..10087290
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10089105..10090602
FT                   /estimated_length=1498
FT                   /gap_type="unknown"
FT   assembly_gap    10093034..10096289
FT                   /estimated_length=3256
FT                   /gap_type="unknown"
FT   assembly_gap    10101959..10107448
FT                   /estimated_length=5490
FT                   /gap_type="unknown"
FT   assembly_gap    10109005..10109024
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10111496..10111515
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10112626..10112645
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10113696..10113715
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10115056..10115075
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10117116..10117135
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10121119..10121138
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10123907..10125461
FT                   /estimated_length=1555
FT                   /gap_type="unknown"
FT   assembly_gap    10146217..10146672
FT                   /estimated_length=456
FT                   /gap_type="unknown"
FT   assembly_gap    10149044..10150699
FT                   /estimated_length=1656
FT                   /gap_type="unknown"
FT   assembly_gap    10159392..10160729
FT                   /estimated_length=1338
FT                   /gap_type="unknown"
FT   assembly_gap    10180768..10181226
FT                   /estimated_length=459
FT                   /gap_type="unknown"
FT   assembly_gap    10182248..10182267
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10183630..10183827
FT                   /estimated_length=198
FT                   /gap_type="unknown"
FT   assembly_gap    10188077..10188096
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10189595..10191928
FT                   /estimated_length=2334
FT                   /gap_type="unknown"
FT   assembly_gap    10192969..10192988
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(10195948..10197144)
FT                   /pseudo
FT                   /locus_tag="mCG_51920"
FT                   /note="gene_id=mCG51920.1"
FT   mRNA            complement(10195948..10197144)
FT                   /pseudo
FT                   /locus_tag="mCG_51920"
FT                   /note="gene_id=mCG51920.1 transcript_id=mCT52103.1 created
FT                   on 14-FEB-2003"
FT   assembly_gap    10199949..10200247
FT                   /estimated_length=299
FT                   /gap_type="unknown"
FT   assembly_gap    10226298..10226317
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10243815..10243834
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10246892..10246911
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10255500..10256575
FT                   /estimated_length=1076
FT                   /gap_type="unknown"
FT   assembly_gap    10257288..10257966
FT                   /estimated_length=679
FT                   /gap_type="unknown"
FT   assembly_gap    10260826..10261355
FT                   /estimated_length=530
FT                   /gap_type="unknown"
FT   assembly_gap    10262020..10263412
FT                   /estimated_length=1393
FT                   /gap_type="unknown"
FT   gene            complement(10291740..>10322855)
FT                   /locus_tag="mCG_146140"
FT                   /note="gene_id=mCG146140.0"
FT   mRNA            complement(join(10291740..10291984,10296515..10296593,
FT                   10322822..>10322855))
FT                   /locus_tag="mCG_146140"
FT                   /product="mCG146140"
FT                   /note="gene_id=mCG146140.0 transcript_id=mCT186243.0
FT                   created on 14-JUL-2003"
FT   CDS             complement(join(10291779..10291984,10296515..>10296533))
FT                   /codon_start=1
FT                   /locus_tag="mCG_146140"
FT                   /product="mCG146140"
FT                   /note="gene_id=mCG146140.0 transcript_id=mCT186243.0
FT                   protein_id=mCP107676.0"
FT                   /protein_id="EDL39916.1"
FT                   /translation="LIYSSLGDATNVPSQTRHKSPLQEGRKFIQGIEQLDPTVLKTAPV
FT                   LLTGNMPASLNTELGYCCKHSCNRNSESP"
FT   assembly_gap    10351607..10351626
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10382644..10382679
FT                   /estimated_length=36
FT                   /gap_type="unknown"
FT   assembly_gap    10397209..10397950
FT                   /estimated_length=742
FT                   /gap_type="unknown"
FT   assembly_gap    10399336..10403154
FT                   /estimated_length=3819
FT                   /gap_type="unknown"
FT   assembly_gap    10410345..10411656
FT                   /estimated_length=1312
FT                   /gap_type="unknown"
FT   assembly_gap    10442228..10442247
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10449672..10449929
FT                   /estimated_length=258
FT                   /gap_type="unknown"
FT   assembly_gap    10473883..10474205
FT                   /estimated_length=323
FT                   /gap_type="unknown"
FT   assembly_gap    10494426..10498281
FT                   /estimated_length=3856
FT                   /gap_type="unknown"
FT   assembly_gap    10505768..10505787
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10518593..10518612
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10524096..10524232
FT                   /estimated_length=137
FT                   /gap_type="unknown"
FT   assembly_gap    10532477..10532496
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10535619..10535687
FT                   /estimated_length=69
FT                   /gap_type="unknown"
FT   assembly_gap    10541762..10546664
FT                   /estimated_length=4903
FT                   /gap_type="unknown"
FT   assembly_gap    10567093..10567112
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10579308..10579543
FT                   /estimated_length=236
FT                   /gap_type="unknown"
FT   assembly_gap    10663944..10665956
FT                   /estimated_length=2013
FT                   /gap_type="unknown"
FT   assembly_gap    10667258..10667889
FT                   /estimated_length=632
FT                   /gap_type="unknown"
FT   assembly_gap    10682972..10682991
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10685894..10686594
FT                   /estimated_length=701
FT                   /gap_type="unknown"
FT   assembly_gap    10713491..10713549
FT                   /estimated_length=59
FT                   /gap_type="unknown"
FT   assembly_gap    10715667..10715747
FT                   /estimated_length=81
FT                   /gap_type="unknown"
FT   assembly_gap    10744950..10745112
FT                   /estimated_length=163
FT                   /gap_type="unknown"
FT   assembly_gap    10748546..10748755
FT                   /estimated_length=210
FT                   /gap_type="unknown"
FT   assembly_gap    10786327..10786346
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10787976..10787995
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10791751..10791770
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10794995..10795014
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10796139..10796697
FT                   /estimated_length=559
FT                   /gap_type="unknown"
FT   assembly_gap    10821135..10821154
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10831931..10832193
FT                   /estimated_length=263
FT                   /gap_type="unknown"
FT   assembly_gap    10833368..10833387
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10835172..10835191
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10836465..10836484
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10839839..10839858
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10842894..10844973
FT                   /estimated_length=2080
FT                   /gap_type="unknown"
FT   assembly_gap    10846392..10846901
FT                   /estimated_length=510
FT                   /gap_type="unknown"
FT   assembly_gap    10872754..10872773
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10874405..10874424
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10888831..10888893
FT                   /estimated_length=63
FT                   /gap_type="unknown"
FT   assembly_gap    10890698..10891025
FT                   /estimated_length=328
FT                   /gap_type="unknown"
FT   assembly_gap    10891579..10891598
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10901125..10901247
FT                   /estimated_length=123
FT                   /gap_type="unknown"
FT   gene            complement(10910585..>10960859)
FT                   /locus_tag="mCG_145611"
FT                   /note="gene_id=mCG145611.0"
FT   mRNA            complement(join(10910585..10910858,10913546..10913698,
FT                   10960704..>10960859))
FT                   /locus_tag="mCG_145611"
FT                   /product="mCG145611"
FT                   /note="gene_id=mCG145611.0 transcript_id=mCT185035.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(10913634..10913698,10960704..>10960806))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145611"
FT                   /product="mCG145611"
FT                   /note="gene_id=mCG145611.0 transcript_id=mCT185035.0
FT                   protein_id=mCP106088.0"
FT                   /protein_id="EDL39915.1"
FT                   /translation="FWGNIFVIHFLLMFCLFQYDMILLDSKCMALGLRALCSQGKEQAR
FT                   ALMNHCLGCH"
FT   assembly_gap    10936497..10936516
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            10943803..10944937
FT                   /pseudo
FT                   /locus_tag="mCG_6205"
FT                   /note="gene_id=mCG6205.2"
FT   mRNA            join(10943803..10943996,10944068..10944937)
FT                   /pseudo
FT                   /locus_tag="mCG_6205"
FT                   /note="gene_id=mCG6205.2 transcript_id=mCT6022.2 created on
FT                   03-FEB-2003"
FT   assembly_gap    10951431..10951618
FT                   /estimated_length=188
FT                   /gap_type="unknown"
FT   assembly_gap    10953709..10953792
FT                   /estimated_length=84
FT                   /gap_type="unknown"
FT   assembly_gap    10979610..10979654
FT                   /estimated_length=45
FT                   /gap_type="unknown"
FT   assembly_gap    10980921..10981095
FT                   /estimated_length=175
FT                   /gap_type="unknown"
FT   assembly_gap    10988225..10992378
FT                   /estimated_length=4154
FT                   /gap_type="unknown"
FT   assembly_gap    11001110..11001570
FT                   /estimated_length=461
FT                   /gap_type="unknown"
FT   assembly_gap    11017188..11017309
FT                   /estimated_length=122
FT                   /gap_type="unknown"
FT   assembly_gap    11030645..11030981
FT                   /estimated_length=337
FT                   /gap_type="unknown"
FT   assembly_gap    11034880..11034924
FT                   /estimated_length=45
FT                   /gap_type="unknown"
FT   assembly_gap    11036621..11036640
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11039657..11039676
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11041248..11042781
FT                   /estimated_length=1534
FT                   /gap_type="unknown"
FT   assembly_gap    11055382..11056082
FT                   /estimated_length=701
FT                   /gap_type="unknown"
FT   assembly_gap    11099303..11099337
FT                   /estimated_length=35
FT                   /gap_type="unknown"
FT   assembly_gap    11108977..11109342
FT                   /estimated_length=366
FT                   /gap_type="unknown"
FT   gene            complement(11113950..11174806)
FT                   /gene="Slco4c1"
FT                   /locus_tag="mCG_6204"
FT                   /note="gene_id=mCG6204.2"
FT   mRNA            complement(join(11113950..11115447,11115597..11116873,
FT                   11118754..11118900))
FT                   /gene="Slco4c1"
FT                   /locus_tag="mCG_6204"
FT                   /product="solute carrier organic anion transporter family,
FT                   member 4C1, transcript variant mCT129351"
FT                   /note="gene_id=mCG6204.2 transcript_id=mCT129351.1 created
FT                   on 21-MAR-2003"
FT   assembly_gap    11115448..11115596
FT                   /estimated_length=149
FT                   /gap_type="unknown"
FT   mRNA            complement(join(11115597..11116873,11123002..11123139,
FT                   11125184..11125248,11130258..11130442,11133453..11133606,
FT                   11138338..11138533,11138912..11139056,11140590..11140708,
FT                   11142553..11142674,11143877..11143973,11145899..11146078,
FT                   11170366..11170629,11174402..11174806))
FT                   /gene="Slco4c1"
FT                   /locus_tag="mCG_6204"
FT                   /product="solute carrier organic anion transporter family,
FT                   member 4C1, transcript variant mCT6027"
FT                   /note="gene_id=mCG6204.2 transcript_id=mCT6027.2 created on
FT                   21-MAR-2003"
FT   CDS             complement(join(11116713..11116873,11123002..11123139,
FT                   11125184..11125248,11130258..11130442,11133453..11133606,
FT                   11138338..11138533,11138912..11139056,11140590..11140708,
FT                   11142553..11142674,11143877..11143973,11145899..11146078,
FT                   11170366..11170629,11174402..11174744))
FT                   /codon_start=1
FT                   /gene="Slco4c1"
FT                   /locus_tag="mCG_6204"
FT                   /product="solute carrier organic anion transporter family,
FT                   member 4C1, isoform CRA_b"
FT                   /note="gene_id=mCG6204.2 transcript_id=mCT6027.2
FT                   protein_id=mCP4993.2 isoform=CRA_b"
FT                   /protein_id="EDL39913.1"
FT                   /translation="MQGSKGIENPAFVPSSPGTPRRASASPSQVEVSAVASRNQNGGSQ
FT                   PRESEEPQKSTEPSPPSSNPPASDEPPGSQLSELEEGPCGWRGFHPQCLQRCNTPQGFL
FT                   LHYCLLALTQGIVVNGLVNISISTIEKRYEMKSSLTGLISSSYDISFCVLSLFVSFFGE
FT                   RGHKPRWLAFASFMIGLGALVFSLPHFFSGRYELGSIFEDTCLTRNSTRCSSSTSLLSN
FT                   YFYVFVLGQLLLGTGGTPLYTLGTAFIDDSVPTHKSSLYIGIGYSMSILGPAIGYVLGG
FT                   QLLTMYIDIAMGQSSDLTEDDPRWLGAWWIGFLLAWLFAWSLIMPFSCFPKHLPGTAKI
FT                   QAGKTSQTHQNNSTSFQHTDENFGKSIKDFPTAVKNLMRNTVFICLVLSTTSEALITTG
FT                   FATFLPKFIENQFGLTSSFAATLGGAVLIPGAALGQILGGVLVSKFKMKCKNTMKFALC
FT                   TSGVALVLSFVFIYAKCENEPFAGVSESYNGTGEMGNLTAPCNANCNCLRSYYYPLCGS
FT                   DGIQYFSPCFAGCLNSVSNRKPKVYYNCSCIERKITSTAESTDFEAKAGKCRTRCSNLP
FT                   IFLGIFFITVIFTFMAGTPITVSILRCVNHRHRSLALGVQFMLLRLLGTIPGPIIFGVI
FT                   IDSTCVLWDVNECGIKGACWIYDNIKMAHMLVAISVTCKVITIFFNGLAIVLYKPPPPG
FT                   TEVSFQSQNVIVSTISVEEDLDKAENEG"
FT   CDS             complement(join(11116713..11116873,11118754..11118778))
FT                   /codon_start=1
FT                   /gene="Slco4c1"
FT                   /locus_tag="mCG_6204"
FT                   /product="solute carrier organic anion transporter family,
FT                   member 4C1, isoform CRA_c"
FT                   /note="gene_id=mCG6204.2 transcript_id=mCT129351.1
FT                   protein_id=mCP82530.1 isoform=CRA_c"
FT                   /protein_id="EDL39914.1"
FT                   /translation="MAHMLVAISVTCKVITIFFNGLAIVLYKPPPPGTEVSFQSQNVIV
FT                   STISVEEDLDKAENEG"
FT   assembly_gap    11120352..11120371
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            complement(join(11120390..11120922,11123002..11123139,
FT                   11125184..11125248,11130258..11130442,11133453..11133606,
FT                   11138338..11138533,11138912..11139056,11140590..11140708,
FT                   11142553..11142674,11143877..11143973,11145899..11146078,
FT                   11170366..11170629,11174402..11174806))
FT                   /gene="Slco4c1"
FT                   /locus_tag="mCG_6204"
FT                   /product="solute carrier organic anion transporter family,
FT                   member 4C1, transcript variant mCT179610"
FT                   /note="gene_id=mCG6204.2 transcript_id=mCT179610.0 created
FT                   on 21-MAR-2003"
FT   CDS             complement(join(11120762..11120922,11123002..11123139,
FT                   11125184..11125248,11130258..11130442,11133453..11133606,
FT                   11138338..11138533,11138912..11139056,11140590..11140708,
FT                   11142553..11142674,11143877..11143973,11145899..11146078,
FT                   11170366..11170629,11174402..11174744))
FT                   /codon_start=1
FT                   /gene="Slco4c1"
FT                   /locus_tag="mCG_6204"
FT                   /product="solute carrier organic anion transporter family,
FT                   member 4C1, isoform CRA_a"
FT                   /note="gene_id=mCG6204.2 transcript_id=mCT179610.0
FT                   protein_id=mCP102532.0 isoform=CRA_a"
FT                   /protein_id="EDL39912.1"
FT                   /translation="MQGSKGIENPAFVPSSPGTPRRASASPSQVEVSAVASRNQNGGSQ
FT                   PRESEEPQKSTEPSPPSSNPPASDEPPGSQLSELEEGPCGWRGFHPQCLQRCNTPQGFL
FT                   LHYCLLALTQGIVVNGLVNISISTIEKRYEMKSSLTGLISSSYDISFCVLSLFVSFFGE
FT                   RGHKPRWLAFASFMIGLGALVFSLPHFFSGRYELGSIFEDTCLTRNSTRCSSSTSLLSN
FT                   YFYVFVLGQLLLGTGGTPLYTLGTAFIDDSVPTHKSSLYIGIGYSMSILGPAIGYVLGG
FT                   QLLTMYIDIAMGQSSDLTEDDPRWLGAWWIGFLLAWLFAWSLIMPFSCFPKHLPGTAKI
FT                   QAGKTSQTHQNNSTSFQHTDENFGKSIKDFPTAVKNLMRNTVFICLVLSTTSEALITTG
FT                   FATFLPKFIENQFGLTSSFAATLGGAVLIPGAALGQILGGVLVSKFKMKCKNTMKFALC
FT                   TSGVALVLSFVFIYAKCENEPFAGVSESYNGTGEMGNLTAPCNANCNCLRSYYYPLCGS
FT                   DGIQYFSPCFAGCLNSVSNRKPKVYYNCSCIERKITSTAESTDFEAKAGKCRTRCSNLP
FT                   IFLGIFFITVIFTFMAGTPITVSILRCVNHRHRSLALGVQFMLLRLLGTIPGPIIFGVI
FT                   IDSTCVLWDVNECGIKGACWIYDNIKMAHMLVAISVTCKVITIFFNGLAIVLYKPPPPG
FT                   TEVSFQSQNVIVSTISVEEDLDKAENEG"
FT   assembly_gap    11123319..11123338
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11129678..11129697
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11160261..11161578
FT                   /estimated_length=1318
FT                   /gap_type="unknown"
FT   assembly_gap    11166027..11166929
FT                   /estimated_length=903
FT                   /gap_type="unknown"
FT   gene            11174855..11184011
FT                   /locus_tag="mCG_148360"
FT                   /note="gene_id=mCG148360.0"
FT   mRNA            join(11174855..11175303,11180615..11184011)
FT                   /locus_tag="mCG_148360"
FT                   /product="mCG148360"
FT                   /note="gene_id=mCG148360.0 transcript_id=mCT188623.0
FT                   created on 13-JAN-2004"
FT   assembly_gap    11177815..11178015
FT                   /estimated_length=201
FT                   /gap_type="unknown"
FT   CDS             11182915..11183235
FT                   /codon_start=1
FT                   /locus_tag="mCG_148360"
FT                   /product="mCG148360"
FT                   /note="gene_id=mCG148360.0 transcript_id=mCT188623.0
FT                   protein_id=mCP108645.0"
FT                   /protein_id="EDL39911.1"
FT                   /translation="MVQEKLRVLHLHLKAASRILVSRQPRVLKPMPTVTHLLQQGHTSQ
FT                   KCHFLNQTYANHNTLFQRKMASALFSVAHISRQSHQTRNSRTTLTTHCPYLMCDSCFYD
FT                   ST"
FT   gene            complement(11208976..11300672)
FT                   /locus_tag="mCG_20870"
FT                   /note="gene_id=mCG20870.2"
FT   mRNA            complement(join(11208976..11209140,11213011..11213060,
FT                   11214622..11214780,11224688..11224825,11227059..11227123,
FT                   11232462..11232649,11244565..11244718,11250170..11250365,
FT                   11255708..11255852,11263846..11263955,11268049..11268164,
FT                   11290859..11290955,11291583..11291774,11298118..11298378,
FT                   11300216..11300672))
FT                   /locus_tag="mCG_20870"
FT                   /product="mCG20870"
FT                   /note="gene_id=mCG20870.2 transcript_id=mCT22353.2 created
FT                   on 30-DEC-2002"
FT   CDS             complement(join(11214674..11214780,11224688..11224825,
FT                   11227059..11227123,11232462..11232649,11244565..11244718,
FT                   11250170..11250365,11255708..11255852,11263846..11263955,
FT                   11268049..11268164,11290859..11290955,11291583..11291774,
FT                   11298118..11298378,11300216..11300576))
FT                   /codon_start=1
FT                   /locus_tag="mCG_20870"
FT                   /product="mCG20870"
FT                   /note="gene_id=mCG20870.2 transcript_id=mCT22353.2
FT                   protein_id=mCP4995.1"
FT                   /protein_id="EDL39910.1"
FT                   /translation="MDQNPEQTLNSTVKAWVNNTVQAPVDNTVEPPVDITGEAPVEKLN
FT                   DVREVHFQTKLSAAMLHIASLQNPVSEDSSQLSDTMQDASLEGPFGLGPLVFPSLQRFN
FT                   NINYFLISFCILSLSQGTISGLTRVSTGNFEKDFYLSRAEKVILTISYDLASLLVAILV
FT                   AHYGGKGSRSKWLAAAALLVGLASILFAVPYLKYEIVRPVEDSEELCIDEEERTMPDCE
FT                   ENIVPFKSEIIIFSIIGQSLQGIAGMPMYILGVTYIYDNISTYMAGIYLGIADAAFVLG
FT                   YGLGYAVGSPNLRPSFNHSSEEEVNDNFLLWQFNWFVGFLFATLLAWFTFFPFLCFPHR
FT                   LPGAHKPKQQKEKEPLAFYKKLKNMKYGYNLQDLFHALWSLLRNPLLMCYSMCKATEAL
FT                   ATIGAAEFLPKYLESQFLLSPSRATLLTGIILVPGSALGNFLGGFIVSKLKMSSRSQMK
FT                   FIVITSIISLLLLILNIFIKCERVKFAGITANYEGTGSLGNLTAPCNAHCGCDRSTYSS
FT                   VCGRDETEYFSPCFAGCLASKHLDYEKTFYNCSCIKHGLANADSEADPIDATSGKCNTK
FT                   CYALPLFFAFFFSSIAFSSSASIPITLIILRTVPHNLHSLGIAVTYTTLRLFGSIPGPL
FT                   LFQLTASRSCIYWDINKCGDKGRCWIYNKLKMMFILMGFCIFCKLATTFFTLLAFFKYN
FT                   VSRVGSKNAKKRSKK"
FT   assembly_gap    11216169..11216188
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11239708..11239759
FT                   /estimated_length=52
FT                   /gap_type="unknown"
FT   assembly_gap    11260795..11261173
FT                   /estimated_length=379
FT                   /gap_type="unknown"
FT   assembly_gap    11281581..11284160
FT                   /estimated_length=2580
FT                   /gap_type="unknown"
FT   assembly_gap    11286463..11287802
FT                   /estimated_length=1340
FT                   /gap_type="unknown"
FT   assembly_gap    11288561..11289434
FT                   /estimated_length=874
FT                   /gap_type="unknown"
FT   assembly_gap    11293489..11293694
FT                   /estimated_length=206
FT                   /gap_type="unknown"
FT   assembly_gap    11320000..11320064
FT                   /estimated_length=65
FT                   /gap_type="unknown"
FT   assembly_gap    11324799..11325072
FT                   /estimated_length=274
FT                   /gap_type="unknown"
FT   gene            11327526..11329650
FT                   /locus_tag="mCG_129396"
FT                   /note="gene_id=mCG129396.1"
FT   mRNA            11327526..11329650
FT                   /locus_tag="mCG_129396"
FT                   /product="mCG129396"
FT                   /note="gene_id=mCG129396.1 transcript_id=mCT130705.1
FT                   created on 03-FEB-2003"
FT   CDS             11327789..11329036
FT                   /codon_start=1
FT                   /locus_tag="mCG_129396"
FT                   /product="mCG129396"
FT                   /note="gene_id=mCG129396.1 transcript_id=mCT130705.1
FT                   protein_id=mCP82491.1"
FT                   /protein_id="EDL39909.1"
FT                   /translation="MMLGPEGGEGYVVKLRGLPWSCSIEDVQNFLSDCTIHDGVAGVHF
FT                   IYTREGSQSGEAFVELESEDDVKLALKKDRESMGHPYIEVFKSHRTEMDWVLKHSGPNS
FT                   ADSANDGFVRLRGLPFGCTKEEIVQFFSGLEIVPNGITLPVDPEGKITGEAFVQFASQE
FT                   LAEKALGKHKERIGHRYIEVFKSSQEEVRSYSDPPLKFMSVQRPGPYDRPGTARRYIGI
FT                   VKQAGLDRMRSGAYSAGYGGYEEYSGLSDGYGFTTDLFGRDLSYCLSGMYDHRYGDSEF
FT                   TVQSTTGHRVHMRGLPYKATENDIYNFFSPFNPVRVHIEIGPDGRVTGEADVEFATHEE
FT                   AVAAMSKDRANMQHRYIELFLNSTTGASNGAYSSQVMQSMGVSAAQATYSGLESQSVSG
FT                   CYWAGYSGQNSMGGYD"
FT   assembly_gap    11359323..11359342
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(11362002..11431350)
FT                   /gene="Slco6c1"
FT                   /locus_tag="mCG_20872"
FT                   /note="gene_id=mCG20872.2"
FT   mRNA            complement(join(11362002..11362572,11365335..11365494,
FT                   11368998..11369135,11371949..11372013,11375760..11375947,
FT                   11378721..11378874,11384217..11384412,11390769..11390913,
FT                   11401338..11401447,11407676..11407794,11421427..11421523,
FT                   11422693..11422881,11428638..11428898,11430899..11431350))
FT                   /gene="Slco6c1"
FT                   /locus_tag="mCG_20872"
FT                   /product="solute carrier organic anion transporter family,
FT                   member 6c1, transcript variant mCT179586"
FT                   /note="gene_id=mCG20872.2 transcript_id=mCT179586.0 created
FT                   on 03-FEB-2003"
FT   mRNA            complement(join(11362002..11362572,11365335..11365494,
FT                   11368998..11369135,11371949..11372013,11375760..11375947,
FT                   11378721..11378874,11384217..11384412,11390769..11390913,
FT                   11401338..11401447,11407676..11407794,11421427..11421523,
FT                   11422693..11422830,11428638..11428898,11430899..11431349))
FT                   /gene="Slco6c1"
FT                   /locus_tag="mCG_20872"
FT                   /product="solute carrier organic anion transporter family,
FT                   member 6c1, transcript variant mCT22355"
FT                   /note="gene_id=mCG20872.2 transcript_id=mCT22355.2 created
FT                   on 03-FEB-2003"
FT   CDS             complement(join(11365358..11365494,11368998..11369135,
FT                   11371949..11372013,11375760..11375947,11378721..11378874,
FT                   11384217..11384412,11390769..11390913,11401338..11401447,
FT                   11407676..11407794,11421427..11421523,11422693..11422830,
FT                   11428638..11428898,11430899..11431220))
FT                   /codon_start=1
FT                   /gene="Slco6c1"
FT                   /locus_tag="mCG_20872"
FT                   /product="solute carrier organic anion transporter family,
FT                   member 6c1, isoform CRA_b"
FT                   /note="gene_id=mCG20872.2 transcript_id=mCT22355.2
FT                   protein_id=mCP4984.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q9D4B7"
FT                   /db_xref="InterPro:IPR002350"
FT                   /db_xref="InterPro:IPR004156"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="MGI:MGI:1921691"
FT                   /db_xref="UniProtKB/TrEMBL:Q9D4B7"
FT                   /protein_id="EDL39908.1"
FT                   /translation="MAHVRNKKSDDKKAMVVAKEDTNKSESEGVTKLQTYLKTIPIAKK
FT                   KFAKLPKRKKSPTSAELLLIDPRYSASKEGPLGLGPIVLPFVQRFNNIDGFMTLYVAAV
FT                   LIHGALFAVVDMTLNIYQVQFSLTRTEWYLMDFSDYIASFVVAIIIAHFGSKGNRTRWI
FT                   AASCILMGLESMLFAFPFFTYEIIIPGRQSIVPNRSKCIYFHIAGQCIHGIAGMPIYIL
FT                   GITFIFDHIPTSSCGFYLAIGHSAYLIGYLLGMVGGLQNFQPPPKEKTVEIEPAKVYQL
FT                   LQSGWWKTFLIIAAISFCVSFMMVCFPTSLPGAHKLRLAKRKEPPTIDRRLKDMKIQPH
FT                   LKGFLHNIWHILKNPLMLTQAICKVSEYLTFNTSLYFLPHHLQTQFLITPGIASLLTGA
FT                   FVLPGGIIGHFLGGLIVDRLEMTNKNKLKFTLVTTVVSVGLFLLIFFVECQTTTFAGIN
FT                   EDYDGYGQLGNLTADCNEYCDCTTSLYTSICGRDEKEYFSPCFAGCKATKVSQTEKTYY
FT                   NCSCIKEGLAASDDEGQFIDAIAGTCDSDCLKLPLFFAFYFSATVFSNMCSIPVISIIL
FT                   QSVPANFTSLSLGVTYAIVKFVASVPAPLLFRLSSAIACIYWDNNRCGGKERCWIYNKN
FT                   ILVYEFMGIWMSSQLIIVLLNIYAIQIHDVVVHGEITESKTTVKDVKEQKERKA"
FT   CDS             complement(join(11365358..11365494,11368998..11369135,
FT                   11371949..11372013,11375760..11375947,11378721..11378874,
FT                   11384217..11384412,11390769..11390913,11401338..11401447,
FT                   11407676..11407794,11421427..11421523,11422693..11422881,
FT                   11428638..11428898,11430899..11431220))
FT                   /codon_start=1
FT                   /gene="Slco6c1"
FT                   /locus_tag="mCG_20872"
FT                   /product="solute carrier organic anion transporter family,
FT                   member 6c1, isoform CRA_a"
FT                   /note="gene_id=mCG20872.2 transcript_id=mCT179586.0
FT                   protein_id=mCP102508.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q8C0X7"
FT                   /db_xref="InterPro:IPR002350"
FT                   /db_xref="InterPro:IPR004156"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="MGI:MGI:1921691"
FT                   /db_xref="UniProtKB/TrEMBL:Q8C0X7"
FT                   /protein_id="EDL39907.1"
FT                   /translation="MAHVRNKKSDDKKAMVVAKEDTNKSESEGVTKLQTYLKTIPIAKK
FT                   KFAKLPKRKKSPTSAELLLIDPRYSASKEGPLGLGPIVLPFVQRFNNIDGFMTLYVAAV
FT                   LIHGALFAVVDMTLNIYQVQFSLTRTEWYLMDFSDYIASFVVAIIIAHFGSKGNRTRWI
FT                   AASCILMGLESMLFAFPFFTYEIIIPGRQSIELCMEENEKRNIICGNSVPNRSKCIYFH
FT                   IAGQCIHGIAGMPIYILGITFIFDHIPTSSCGFYLAIGHSAYLIGYLLGMVGGLQNFQP
FT                   PPKEKTVEIEPAKVYQLLQSGWWKTFLIIAAISFCVSFMMVCFPTSLPGAHKLRLAKRK
FT                   EPPTIDRRLKDMKIQPHLKGFLHNIWHILKNPLMLTQAICKVSEYLTFNTSLYFLPHHL
FT                   QTQFLITPGIASLLTGAFVLPGGIIGHFLGGLIVDRLEMTNKNKLKFTLVTTVVSVGLF
FT                   LLIFFVECQTTTFAGINEDYDGYGQLGNLTADCNEYCDCTTSLYTSICGRDEKEYFSPC
FT                   FAGCKATKVSQTEKTYYNCSCIKEGLAASDDEGQFIDAIAGTCDSDCLKLPLFFAFYFS
FT                   ATVFSNMCSIPVISIILQSVPANFTSLSLGVTYAIVKFVASVPAPLLFRLSSAIACIYW
FT                   DNNRCGGKERCWIYNKNILVYEFMGIWMSSQLIIVLLNIYAIQIHDVVVHGEITESKTT
FT                   VKDVKEQKERKA"
FT   assembly_gap    11378027..11378046
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11425452..11425471
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            11465824..11593187
FT                   /pseudo
FT                   /locus_tag="mCG_64070"
FT                   /note="gene_id=mCG64070.1"
FT   mRNA            join(11465824..11466208,11467829..11468086,
FT                   11481910..11482097,11512114..11512232,11517890..11517999,
FT                   11537420..11537564,11542448..11542643,11556571..11556724,
FT                   11568513..11568701,11593031..11593187)
FT                   /pseudo
FT                   /locus_tag="mCG_64070"
FT                   /note="gene_id=mCG64070.1 transcript_id=mCT64253.2 created
FT                   on 31-JAN-2003"
FT   assembly_gap    11475811..11478406
FT                   /estimated_length=2596
FT                   /gap_type="unknown"
FT   assembly_gap    11479539..11479558
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11485729..11486041
FT                   /estimated_length=313
FT                   /gap_type="unknown"
FT   assembly_gap    11499696..11499715
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11508125..11508144
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11519042..11519902
FT                   /estimated_length=861
FT                   /gap_type="unknown"
FT   assembly_gap    11552310..11552329
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11580564..11580583
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11581591..11584907
FT                   /estimated_length=3317
FT                   /gap_type="unknown"
FT   assembly_gap    11587961..11587980
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11602825..11602874
FT                   /estimated_length=50
FT                   /gap_type="unknown"
FT   assembly_gap    11642083..11642302
FT                   /estimated_length=220
FT                   /gap_type="unknown"
FT   gene            <11646293..11873133
FT                   /locus_tag="mCG_59082"
FT                   /note="gene_id=mCG59082.2"
FT   mRNA            join(<11646293..11646584,11648146..11648403,
FT                   11700245..11700354,11714606..11714750,11734584..11734779,
FT                   11742275..11742428,11759360..11759547,11767407..11767471,
FT                   11769586..11769723,11851589..11851649,11872841..11873133)
FT                   /locus_tag="mCG_59082"
FT                   /product="mCG59082"
FT                   /note="gene_id=mCG59082.2 transcript_id=mCT59265.2 created
FT                   on 31-JAN-2003"
FT   CDS             join(11646293..11646584,11648146..11648403,
FT                   11700245..11700354,11714606..11714750,11734584..11734779,
FT                   11742275..11742428,11759360..11759547,11767407..11767471,
FT                   11769586..11769723,11851589..11851641)
FT                   /codon_start=1
FT                   /locus_tag="mCG_59082"
FT                   /product="mCG59082"
FT                   /note="gene_id=mCG59082.2 transcript_id=mCT59265.2
FT                   protein_id=mCP27824.2"
FT                   /protein_id="EDL39906.1"
FT                   /translation="MAQDKIKQNDAVKQAQVVDRDEHQKTKESKRLGTYLITVPAAKKK
FT                   FADISDKINPDPIYNDTSEGPFGLGPLVYPCLQRFNTIECFLTLYFMLTLSHGMLYALV
FT                   DLSLKILVSQFSASNSETFLMDFSDYFASFLVSMFVAHFGGRGNRAKWVAAASIVTGLS
FT                   AIAFAVLFFHYEIIKLNIVEGAHKIKLEKSKESSRIDRRLKDKEIKPNLKGVLHVTWCL
FT                   IRNPLVLTQILCNVTESVTFKASSHYLPLYLQTQFVMTPKSAAMLTGIFILPGCIIGRF
FT                   LGGYIVDKLQMNIKNKLKFITTASVISIVLFLLLISVKCETAKFPGINDDYDGFGMVGS
FT                   LKAPCNEKCGCTTSAYNSVCGRDDKQYFSPCFAGCHASKRLRKEKVYYNCSCIKQGLTT
FT                   VDDEGQYIDAVFGTCNTKCISLPLFFAFFFSATIFSTLCGIPTSIIIMESVPTSWNSVS
FT                   LGVMFTLWRFIGSVPAPIFFAETSALCCSFWDIDECGIKVRCWIYKGKQLVYTFVGTCR
FT                   STHERTIRLCEFYKL"
FT   assembly_gap    11700811..11701438
FT                   /estimated_length=628
FT                   /gap_type="unknown"
FT   assembly_gap    11716742..11721445
FT                   /estimated_length=4704
FT                   /gap_type="unknown"
FT   assembly_gap    11744612..11744663
FT                   /estimated_length=52
FT                   /gap_type="unknown"
FT   assembly_gap    11777202..11777680
FT                   /estimated_length=479
FT                   /gap_type="unknown"
FT   assembly_gap    11779937..11780647
FT                   /estimated_length=711
FT                   /gap_type="unknown"
FT   assembly_gap    11812298..11812317
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11829641..11830054
FT                   /estimated_length=414
FT                   /gap_type="unknown"
FT   assembly_gap    11857476..11857625
FT                   /estimated_length=150
FT                   /gap_type="unknown"
FT   assembly_gap    11879159..11880099
FT                   /estimated_length=941
FT                   /gap_type="unknown"
FT   assembly_gap    11886871..11887057
FT                   /estimated_length=187
FT                   /gap_type="unknown"
FT   assembly_gap    11891621..11891742
FT                   /estimated_length=122
FT                   /gap_type="unknown"
FT   assembly_gap    11943643..11943662
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(11944503..11962728)
FT                   /gene="D1Ertd622e"
FT                   /locus_tag="mCG_55735"
FT                   /note="gene_id=mCG55735.2"
FT   mRNA            complement(join(11944503..11946961,11955200..11955289,
FT                   11962433..11962634,11962687..11962728))
FT                   /gene="D1Ertd622e"
FT                   /locus_tag="mCG_55735"
FT                   /product="DNA segment, Chr 1, ERATO Doi 622, expressed,
FT                   transcript variant mCT178039"
FT                   /note="gene_id=mCG55735.2 transcript_id=mCT178039.0 created
FT                   on 30-DEC-2002"
FT   mRNA            complement(join(11944504..11946961,11962433..11962578))
FT                   /gene="D1Ertd622e"
FT                   /locus_tag="mCG_55735"
FT                   /product="DNA segment, Chr 1, ERATO Doi 622, expressed,
FT                   transcript variant mCT55918"
FT                   /note="gene_id=mCG55735.2 transcript_id=mCT55918.1 created
FT                   on 30-DEC-2002"
FT   mRNA            complement(join(11944506..11946961,11955200..11955289,
FT                   11961333..>11961983))
FT                   /gene="D1Ertd622e"
FT                   /locus_tag="mCG_55735"
FT                   /product="DNA segment, Chr 1, ERATO Doi 622, expressed,
FT                   transcript variant mCT193784"
FT                   /note="gene_id=mCG55735.2 transcript_id=mCT193784.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(11946315..11946961,11955200..>11955203))
FT                   /codon_start=1
FT                   /gene="D1Ertd622e"
FT                   /locus_tag="mCG_55735"
FT                   /product="DNA segment, Chr 1, ERATO Doi 622, expressed,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG55735.2 transcript_id=mCT193784.0
FT                   protein_id=mCP114762.0 isoform=CRA_b"
FT                   /protein_id="EDL39904.1"
FT                   /translation="SGVCSLVPKMEVDINGDSRSTLTTLPLPVAEGSSPGKAEAEKPRC
FT                   SSTPCSPMRRTVSGYQILHMDSNYLVGFTTGEELLKLAQKCTGGEDSKGEAMPALRAKQ
FT                   LDTGLARSSRLYKTRSRYYQPYEIPAVNGRRRRRMPSSGDKCTKPLPYEPYKALHGPLP
FT                   LCLLKGKRAHSKSLDYLNLDKMNIKEPADTEVLQYQLQHLTLRGDRVFARNNT"
FT   CDS             complement(11946315..11946938)
FT                   /codon_start=1
FT                   /gene="D1Ertd622e"
FT                   /locus_tag="mCG_55735"
FT                   /product="DNA segment, Chr 1, ERATO Doi 622, expressed,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG55735.2 transcript_id=mCT178039.0
FT                   protein_id=mCP100961.0 isoform=CRA_a"
FT                   /protein_id="EDL39903.1"
FT                   /translation="MEVDINGDSRSTLTTLPLPVAEGSSPGKAEAEKPRCSSTPCSPMR
FT                   RTVSGYQILHMDSNYLVGFTTGEELLKLAQKCTGGEDSKGEAMPALRAKQLDTGLARSS
FT                   RLYKTRSRYYQPYEIPAVNGRRRRRMPSSGDKCTKPLPYEPYKALHGPLPLCLLKGKRA
FT                   HSKSLDYLNLDKMNIKEPADTEVLQYQLQHLTLRGDRVFARNNT"
FT   CDS             complement(11946315..11946938)
FT                   /codon_start=1
FT                   /gene="D1Ertd622e"
FT                   /locus_tag="mCG_55735"
FT                   /product="DNA segment, Chr 1, ERATO Doi 622, expressed,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG55735.2 transcript_id=mCT55918.1
FT                   protein_id=mCP27843.2 isoform=CRA_a"
FT                   /protein_id="EDL39905.1"
FT                   /translation="MEVDINGDSRSTLTTLPLPVAEGSSPGKAEAEKPRCSSTPCSPMR
FT                   RTVSGYQILHMDSNYLVGFTTGEELLKLAQKCTGGEDSKGEAMPALRAKQLDTGLARSS
FT                   RLYKTRSRYYQPYEIPAVNGRRRRRMPSSGDKCTKPLPYEPYKALHGPLPLCLLKGKRA
FT                   HSKSLDYLNLDKMNIKEPADTEVLQYQLQHLTLRGDRVFARNNT"
FT   assembly_gap    11962636..11962679
FT                   /estimated_length=44
FT                   /gap_type="unknown"
FT   assembly_gap    11964506..11964786
FT                   /estimated_length=281
FT                   /gap_type="unknown"
FT   assembly_gap    11991857..11991876
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(12007274..12070944)
FT                   /gene="Hisppd1"
FT                   /locus_tag="mCG_20875"
FT                   /note="gene_id=mCG20875.2"
FT   mRNA            complement(join(12007274..12008466,12012347..12012472,
FT                   12013628..12013768,12020458..12020530,12024295..12024459,
FT                   12027814..12027930,12028020..12028127,12029543..12029657,
FT                   12030536..12030663,12034491..12034714,12035572..12035713,
FT                   12041065..12041247,12041427..12041548,12041673..12041798,
FT                   12044662..12044747,12045768..12045873,12045996..12046075,
FT                   12047023..12047109,12048152..12048253,12050147..12050268,
FT                   12051172..12051333,12053309..12053410,12055977..12056131,
FT                   12056809..12056894,12057767..12057857,12060092..12060287,
FT                   12062348..12062744,12070779..12070944))
FT                   /gene="Hisppd1"
FT                   /locus_tag="mCG_20875"
FT                   /product="histidine acid phosphatase domain containing 1,
FT                   transcript variant mCT179199"
FT                   /note="gene_id=mCG20875.2 transcript_id=mCT179199.0 created
FT                   on 31-JAN-2003"
FT   mRNA            complement(join(12007274..12008466,12012347..12012472,
FT                   12013628..12013768,12017166..12017228,12018066..12018185,
FT                   12020458..12020530,12024295..12024459,12027814..12027930,
FT                   12028020..12028127,12029543..12029657,12030536..12030663,
FT                   12034491..12034714,12035572..12035713,12041065..12041247,
FT                   12041427..12041548,12041673..12041798,12044662..12044747,
FT                   12045768..12045873,12045996..12046075,12047023..12047109,
FT                   12048152..12048253,12050147..12050268,12051172..12051333,
FT                   12053309..12053410,12055977..12056131,12056809..12056894,
FT                   12057767..12057857,12060092..12060287,12062348..12062744,
FT                   12070779..12070944))
FT                   /gene="Hisppd1"
FT                   /locus_tag="mCG_20875"
FT                   /product="histidine acid phosphatase domain containing 1,
FT                   transcript variant mCT22358"
FT                   /note="gene_id=mCG20875.2 transcript_id=mCT22358.2 created
FT                   on 31-JAN-2003"
FT   CDS             complement(join(12008354..12008466,12012347..12012472,
FT                   12013628..12013768,12020458..12020530,12024295..12024459,
FT                   12027814..12027930,12028020..12028127,12029543..12029657,
FT                   12030536..12030663,12034491..12034714,12035572..12035713,
FT                   12041065..12041247,12041427..12041548,12041673..12041798,
FT                   12044662..12044747,12045768..12045873,12045996..12046075,
FT                   12047023..12047109,12048152..12048253,12050147..12050268,
FT                   12051172..12051333,12053309..12053410,12055977..12056131,
FT                   12056809..12056894,12057767..12057857,12060092..12060287,
FT                   12062348..12062479))
FT                   /codon_start=1
FT                   /gene="Hisppd1"
FT                   /locus_tag="mCG_20875"
FT                   /product="histidine acid phosphatase domain containing 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG20875.2 transcript_id=mCT179199.0
FT                   protein_id=mCP102121.0 isoform=CRA_a"
FT                   /protein_id="EDL39901.1"
FT                   /translation="MSNSRKMSEPPRFFVGPEDAEINPGNYRRFFHHAEEEEEEEDESP
FT                   PERQIVVGICSMAKKSKSKPMKEILERISLFKYITVVVFEEEIILNEPVENWPLCDCLI
FT                   SFHSKGFPLDKAVAYAKLRNPFVINDLNMQYLIQDRRDVYSILQAEGILLPRYAILNRD
FT                   PNNPKECNLIEGEDHVEVNGEVFQKPFVEKPVSAEDHNVYIYYPTSAGGGSQRLFRKIG
FT                   SRSSVYSPESNVRKTGSYIYEEFMPTDGTDVKVYTVGPDYAHAEARKSPALDGKVERDS
FT                   EGKEVRYPVILNAREKLIAWKVCLAFKQTVCGFDLLRANGQSYVCDVNGFSFVKNSMKY
FT                   YDDCAKILGNIVMRELAPQFHIPWSIPLEAEDIPIVPTTSGTMMELRCVIAVIRHGDRT
FT                   PKQKMKMEVRHQKFFDLFEKCDGYKSGKLKLKKPKQLQAILDIARQLLMELGQNNDSEI
FT                   EENKSKLEQLKTVLEMYGHFSGINRKVQLTYLPHGCPKTSSEEEDNRREEPSLLLVLKW
FT                   GGELTPAGRVQAEELGRAFRCMYPGGQGDYAGFPGCGLLRLHSTYRHDLKIYASDEGRV
FT                   QMTAAAFAKGLLALEGELTPILVQMVKSANMNGLLDSDSDSLSSCQQRVKARLHEILQK
FT                   DRDFTAEDYEKLTPSGSISVIKSMHLIKNPVKTCDKVYSLIQSLTSQIRYRMEDPKSAD
FT                   IQLYHSETLELMLRRWSKLEKDFKTKNGRYDISKIPDIYDCIKYDVQHNGSLKLENTME
FT                   LYRLSKALADIVIPQEYGITKAEKLEIAKGYCTPLVRKIRSDLQRTQDDDTVNKLHPVY
FT                   SRGVLSPERHVRTRLYFTSESHVHSLLSILRYGALCDDSKDEQWKRAMDYLNVVNELNY
FT                   MTQIVIMLYEDPNKDLSSEERFHVELHFSPGAKGCEEDKNLPSGYGYRPASRENEGRRS
FT                   LKTDDDEPHTSKRDEVDRAVMLFKPLVSEPIHIHRKSPLPRSRKITANEVVSENANYLR
FT                   TPRNLVEQKQNPTVGFELYSMVPSICPLETLHNALFLKQVDDFLASIASPSTEVLRKVP
FT                   EMSSMATRSSPGMRRKISLNTYTPTKILPTPPAALKSSKASSKAAAGGPSQAMAPHTSS
FT                   RKKSINSKTEGHEPKKSTGKKR"
FT   CDS             complement(join(12008354..12008466,12012347..12012472,
FT                   12013628..12013768,12017166..12017228,12018066..12018185,
FT                   12020458..12020530,12024295..12024459,12027814..12027930,
FT                   12028020..12028127,12029543..12029657,12030536..12030663,
FT                   12034491..12034714,12035572..12035713,12041065..12041247,
FT                   12041427..12041548,12041673..12041798,12044662..12044747,
FT                   12045768..12045873,12045996..12046075,12047023..12047109,
FT                   12048152..12048253,12050147..12050268,12051172..12051333,
FT                   12053309..12053410,12055977..12056131,12056809..12056894,
FT                   12057767..12057857,12060092..12060287,12062348..12062479))
FT                   /codon_start=1
FT                   /gene="Hisppd1"
FT                   /locus_tag="mCG_20875"
FT                   /product="histidine acid phosphatase domain containing 1,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG20875.2 transcript_id=mCT22358.2
FT                   protein_id=mCP4978.2 isoform=CRA_b"
FT                   /protein_id="EDL39902.1"
FT                   /translation="MSNSRKMSEPPRFFVGPEDAEINPGNYRRFFHHAEEEEEEEDESP
FT                   PERQIVVGICSMAKKSKSKPMKEILERISLFKYITVVVFEEEIILNEPVENWPLCDCLI
FT                   SFHSKGFPLDKAVAYAKLRNPFVINDLNMQYLIQDRRDVYSILQAEGILLPRYAILNRD
FT                   PNNPKECNLIEGEDHVEVNGEVFQKPFVEKPVSAEDHNVYIYYPTSAGGGSQRLFRKIG
FT                   SRSSVYSPESNVRKTGSYIYEEFMPTDGTDVKVYTVGPDYAHAEARKSPALDGKVERDS
FT                   EGKEVRYPVILNAREKLIAWKVCLAFKQTVCGFDLLRANGQSYVCDVNGFSFVKNSMKY
FT                   YDDCAKILGNIVMRELAPQFHIPWSIPLEAEDIPIVPTTSGTMMELRCVIAVIRHGDRT
FT                   PKQKMKMEVRHQKFFDLFEKCDGYKSGKLKLKKPKQLQAILDIARQLLMELGQNNDSEI
FT                   EENKSKLEQLKTVLEMYGHFSGINRKVQLTYLPHGCPKTSSEEEDNRREEPSLLLVLKW
FT                   GGELTPAGRVQAEELGRAFRCMYPGGQGDYAGFPGCGLLRLHSTYRHDLKIYASDEGRV
FT                   QMTAAAFAKGLLALEGELTPILVQMVKSANMNGLLDSDSDSLSSCQQRVKARLHEILQK
FT                   DRDFTAEDYEKLTPSGSISVIKSMHLIKNPVKTCDKVYSLIQSLTSQIRYRMEDPKSAD
FT                   IQLYHSETLELMLRRWSKLEKDFKTKNGRYDISKIPDIYDCIKYDVQHNGSLKLENTME
FT                   LYRLSKALADIVIPQEYGITKAEKLEIAKGYCTPLVRKIRSDLQRTQDDDTVNKLHPVY
FT                   SRGVLSPERHVRTRLYFTSESHVHSLLSILRYGALCDDSKDEQWKRAMDYLNVVNELNY
FT                   MTQIVIMLYEDPNKDLSSEERFHVELHFSPGAKGCEEDKNLPSGYGYRPASRENEGRRS
FT                   LKTDDDEPHTSKRDEVDRAVMLFKPLVSEPIHIHRKSPLPRSRKITANEVVSENANYLR
FT                   TPRNLVEQKQNPTVGSHCAGLFSTSVLGGSSSAPNLQDYARTHRKKLTSSGCIDDATRG
FT                   SAVKRFSISFARHPTNGFELYSMVPSICPLETLHNALFLKQVDDFLASIASPSTEVLRK
FT                   VPEMSSMATRSSPGMRRKISLNTYTPTKILPTPPAALKSSKASSKAAAGGPSQAMAPHT
FT                   SSRKKSINSKTEGHEPKKSTGKKR"
FT   assembly_gap    12031265..12031284
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(12054528..>12115454)
FT                   /locus_tag="mCG_145610"
FT                   /note="gene_id=mCG145610.0"
FT   mRNA            complement(join(12054528..12055354,12115211..12115230,
FT                   12115423..>12115454))
FT                   /locus_tag="mCG_145610"
FT                   /product="mCG145610"
FT                   /note="gene_id=mCG145610.0 transcript_id=mCT185034.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(12055045..12055354,12115211..12115230,
FT                   12115423..>12115452))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145610"
FT                   /product="mCG145610"
FT                   /note="gene_id=mCG145610.0 transcript_id=mCT185034.0
FT                   protein_id=mCP106087.0"
FT                   /protein_id="EDL39896.1"
FT                   /translation="KGRKEGRKEGEGRKEGRKEGRQAGRQAGRQAFFELWFKQTQGSRA
FT                   VTVHCGRRSQAEGMAEGTETAESSYLLTTSLTGMACQREALSSQSPPQGTMSTCLPEPL
FT                   TLQSSDTSGQQVFNT"
FT   assembly_gap    12055359..12055736
FT                   /estimated_length=378
FT                   /gap_type="unknown"
FT   gene            12071101..12095618
FT                   /gene="4930429M06Rik"
FT                   /locus_tag="mCG_20871"
FT                   /note="gene_id=mCG20871.2"
FT   mRNA            join(12071101..12071179,12077243..12077388,
FT                   12079069..12079627)
FT                   /gene="4930429M06Rik"
FT                   /locus_tag="mCG_20871"
FT                   /product="RIKEN cDNA 4930429M06Rik, transcript variant
FT                   mCT178365"
FT                   /note="gene_id=mCG20871.2 transcript_id=mCT178365.0 created
FT                   on 10-JAN-2003"
FT   mRNA            join(12071102..12071179,12077243..12077388,
FT                   12079069..12079262,12084729..12085034,12086555..12086746,
FT                   12086870..12087037,12087790..12088072,12094207..12094880)
FT                   /gene="4930429M06Rik"
FT                   /locus_tag="mCG_20871"
FT                   /product="RIKEN cDNA 4930429M06Rik, transcript variant
FT                   mCT22354"
FT                   /note="gene_id=mCG20871.2 transcript_id=mCT22354.1 created
FT                   on 10-JAN-2003"
FT   mRNA            join(12071118..12071179,12077243..12077388,
FT                   12079069..12079262,12084996..12085034,12086555..12086746,
FT                   12086870..12087037,12087790..12088072,12094207..12095618)
FT                   /gene="4930429M06Rik"
FT                   /locus_tag="mCG_20871"
FT                   /product="RIKEN cDNA 4930429M06Rik, transcript variant
FT                   mCT178364"
FT                   /note="gene_id=mCG20871.2 transcript_id=mCT178364.0 created
FT                   on 10-JAN-2003"
FT   mRNA            join(12071140..12071174,12077234..12077388,
FT                   12079069..12079262,12084729..12085034,12086555..12086746,
FT                   12086870..12087037,12087790..12088072,12094207..12094879)
FT                   /gene="4930429M06Rik"
FT                   /locus_tag="mCG_20871"
FT                   /product="RIKEN cDNA 4930429M06Rik, transcript variant
FT                   mCT178363"
FT                   /note="gene_id=mCG20871.2 transcript_id=mCT178363.0 created
FT                   on 10-JAN-2003"
FT   CDS             join(12077250..12077388,12079069..12079262,
FT                   12084729..12085034,12086555..12086746,12086870..12087037,
FT                   12087790..12088072,12094207..12094481)
FT                   /codon_start=1
FT                   /gene="4930429M06Rik"
FT                   /locus_tag="mCG_20871"
FT                   /product="RIKEN cDNA 4930429M06Rik, isoform CRA_b"
FT                   /note="gene_id=mCG20871.2 transcript_id=mCT178363.0
FT                   protein_id=mCP101287.0 isoform=CRA_b"
FT                   /protein_id="EDL39898.1"
FT                   /translation="MVRSGKNGDLHLKQIAYYKRTGEYHPTTLPSERSGIRRAAKKFVF
FT                   KEKKLFYVGKDRKQNRLVVVSEEEKKKVLRECHENGPGVHHGISRTLTLVESGYYWTSV
FT                   TNDVKQWVYACQHCQVAKNTVIVAPQQHLPMVGNPWSVVTVDLMGPFHTSNRSHVYAII
FT                   MTDLFTKWVMILPLCDVSASEISKAIINIFFLYGPPQKIIMDQRDEFIEQINVELYRLF
FT                   GAKEIVISRASGSVNPAENTPSTIKTFLSKHCADHPNSWDEHLPALSFAFNVTHLEPNK
FT                   NTPYFQMFNRNPCVLECPPEEGSEGTSVFARIVAAIREADGVVENKTPASSQMENNNSD
FT                   ELSKSKVVKKKAKQLNPFHLKVGHEVLRQRKNWWKDGRFQSEWVGPCVIDYITESGCAV
FT                   LRDNTGTRLKRPIKMSHLRPYVRESSEQDSLYLLQGSIVADHDYIGLPEIPVGTYQANI
FT                   LVEDATIGIADNELLISSKDHELLEYRNSKISALVEDHSSLEKQTFSLLDSSNQVLEYL
FT                   S"
FT   CDS             join(12077250..12077388,12079069..12079262,
FT                   12084729..12085034,12086555..12086746,12086870..12087037,
FT                   12087790..12088072,12094207..12094481)
FT                   /codon_start=1
FT                   /gene="4930429M06Rik"
FT                   /locus_tag="mCG_20871"
FT                   /product="RIKEN cDNA 4930429M06Rik, isoform CRA_b"
FT                   /note="gene_id=mCG20871.2 transcript_id=mCT22354.1
FT                   protein_id=mCP4982.2 isoform=CRA_b"
FT                   /protein_id="EDL39900.1"
FT                   /translation="MVRSGKNGDLHLKQIAYYKRTGEYHPTTLPSERSGIRRAAKKFVF
FT                   KEKKLFYVGKDRKQNRLVVVSEEEKKKVLRECHENGPGVHHGISRTLTLVESGYYWTSV
FT                   TNDVKQWVYACQHCQVAKNTVIVAPQQHLPMVGNPWSVVTVDLMGPFHTSNRSHVYAII
FT                   MTDLFTKWVMILPLCDVSASEISKAIINIFFLYGPPQKIIMDQRDEFIEQINVELYRLF
FT                   GAKEIVISRASGSVNPAENTPSTIKTFLSKHCADHPNSWDEHLPALSFAFNVTHLEPNK
FT                   NTPYFQMFNRNPCVLECPPEEGSEGTSVFARIVAAIREADGVVENKTPASSQMENNNSD
FT                   ELSKSKVVKKKAKQLNPFHLKVGHEVLRQRKNWWKDGRFQSEWVGPCVIDYITESGCAV
FT                   LRDNTGTRLKRPIKMSHLRPYVRESSEQDSLYLLQGSIVADHDYIGLPEIPVGTYQANI
FT                   LVEDATIGIADNELLISSKDHELLEYRNSKISALVEDHSSLEKQTFSLLDSSNQVLEYL
FT                   S"
FT   CDS             join(12077250..12077388,12079069..12079262,
FT                   12084996..12085034,12086555..12086746,12086870..12087037,
FT                   12087790..12088072,12094207..12094481)
FT                   /codon_start=1
FT                   /gene="4930429M06Rik"
FT                   /locus_tag="mCG_20871"
FT                   /product="RIKEN cDNA 4930429M06Rik, isoform CRA_a"
FT                   /note="gene_id=mCG20871.2 transcript_id=mCT178364.0
FT                   protein_id=mCP101285.0 isoform=CRA_a"
FT                   /protein_id="EDL39897.1"
FT                   /translation="MVRSGKNGDLHLKQIAYYKRTGEYHPTTLPSERSGIRRAAKKFVF
FT                   KEKKLFYVGKDRKQNRLVVVSEEEKKKVLRECHENGPGVHHGISRTLTLVESGYYWTSV
FT                   TNDVKQWKIIMDQRDEFIEQINVELYRLFGAKEIVISRASGSVNPAENTPSTIKTFLSK
FT                   HCADHPNSWDEHLPALSFAFNVTHLEPNKNTPYFQMFNRNPCVLECPPEEGSEGTSVFA
FT                   RIVAAIREADGVVENKTPASSQMENNNSDELSKSKVVKKKAKQLNPFHLKVGHEVLRQR
FT                   KNWWKDGRFQSEWVGPCVIDYITESGCAVLRDNTGTRLKRPIKMSHLRPYVRESSEQDS
FT                   LYLLQGSIVADHDYIGLPEIPVGTYQANILVEDATIGIADNELLISSKDHELLEYRNSK
FT                   ISALVEDHSSLEKQTFSLLDSSNQVLEYLS"
FT   CDS             join(12077250..12077388,12079069..12079286)
FT                   /codon_start=1
FT                   /gene="4930429M06Rik"
FT                   /locus_tag="mCG_20871"
FT                   /product="RIKEN cDNA 4930429M06Rik, isoform CRA_c"
FT                   /note="gene_id=mCG20871.2 transcript_id=mCT178365.0
FT                   protein_id=mCP101286.0 isoform=CRA_c"
FT                   /protein_id="EDL39899.1"
FT                   /translation="MVRSGKNGDLHLKQIAYYKRTGEYHPTTLPSERSGIRRAAKKFVF
FT                   KEKKLFYVGKDRKQNRLVVVSEEEKKKVLRECHENGPGVHHGISRTLTLVESGYYWTSV
FT                   TNDVKQWVWLPRRA"
FT   assembly_gap    12081424..12081443
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12086806..12086825
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12090727..12091536
FT                   /estimated_length=810
FT                   /gap_type="unknown"
FT   assembly_gap    12100450..12100555
FT                   /estimated_length=106
FT                   /gap_type="unknown"
FT   gene            complement(12123101..12397091)
FT                   /gene="Pam"
FT                   /locus_tag="mCG_20873"
FT                   /note="gene_id=mCG20873.2"
FT   mRNA            complement(join(12123101..12123996,12127921..12128124,
FT                   12133539..12133592,12136492..12136600,12140047..12140162,
FT                   12142364..12142564,12142783..12142993,12144316..12144388,
FT                   12146680..12146796,12155187..12155316,12166287..12166604,
FT                   12186270..12186341,12187746..12187930,12196505..12196608,
FT                   12197735..12197811,12198072..12198152,12199311..12199378,
FT                   12200444..12200492,12225254..12225337,12226591..12226676,
FT                   12236811..12236898,12246759..12246816,12277925..12278045,
FT                   12278997..12279399,12397063..12397091))
FT                   /gene="Pam"
FT                   /locus_tag="mCG_20873"
FT                   /product="peptidylglycine alpha-amidating monooxygenase"
FT                   /note="gene_id=mCG20873.2 transcript_id=mCT22356.2 created
FT                   on 30-DEC-2002"
FT   CDS             complement(join(12123974..12123996,12127921..12128124,
FT                   12133539..12133592,12136492..12136600,12140047..12140162,
FT                   12142364..12142564,12142783..12142993,12144316..12144388,
FT                   12146680..12146796,12155187..12155316,12166287..12166604,
FT                   12186270..12186341,12187746..12187930,12196505..12196608,
FT                   12197735..12197811,12198072..12198152,12199311..12199378,
FT                   12200444..12200492,12225254..12225337,12226591..12226676,
FT                   12236811..12236898,12246759..12246816,12277925..12278045,
FT                   12278997..12279097))
FT                   /codon_start=1
FT                   /gene="Pam"
FT                   /locus_tag="mCG_20873"
FT                   /product="peptidylglycine alpha-amidating monooxygenase"
FT                   /note="gene_id=mCG20873.2 transcript_id=mCT22356.2
FT                   protein_id=mCP4985.2"
FT                   /protein_id="EDL39893.1"
FT                   /translation="MAGRARSRLLLLLGLLALQSSCLAFRSPLSVFKRFKETTRSFSNE
FT                   CLGTTRPITPIDSSDFTLDIRMPGVTPKESDTYFCMSMRLPVDEEAFVIDFKPRASMDT
FT                   VHHMLLFGCNMPSSTGSYWFCDEGTCTDKANILYAWARNAPPTRLPKGVGFRVGGETGS
FT                   KYFVLQVHYGDISAFRDNHKDCSGVSLHLTRVPQPLIAGMYLMMSVNTVIPPGEKVVNS
FT                   DISCHYKMYPMHVFAYRVHTHHLGKVVSGYRVRNGQWTLIGRQSPQLPQAFYPVEHPVD
FT                   VAFGDILAARCVFTGEGRTEATHIGGTSSDEMCNLYIMYYMEAKHAVSFMTCTQNVAPD
FT                   MFRTIPEEANIPIPVKSDMVMIHGHHKETENKEKSALIQQPKQGEEEAFEQGDFYSLLS
FT                   KLLGEREDVVHVHKYNPTEKTESGSDLVAEIANVVQKKDLGRSDAREGAEHEEGGNAIL
FT                   VRDRIHKFHRLESTLRPAESRALSFQQPGEGPWEPELAGDFHVEEALEWPGVYLLPGQV
FT                   SGVALDSKNNLVIFHRGDHVWDGNSFDSKFVYQQRGLGPIEEDTILVIDPNKAEILQSS
FT                   GKNLFYLPHGLSIDTDGNYWVTDVALHQVFKLEPRSKEGPLLVLGRSMQPGSDQNHFCQ
FT                   PTDVAVEPSTGAVFVSDGYCNSRIVQFSPSGKFITQWGEESSGSSPKPGQFSVPHSLAL
FT                   VPHLNQLCVADRENGRIQCFKTDTKEFVREIKHASFGRNVFAISYIPGFLFAVNGKPYF
FT                   GDQEPVQGFVMNFSSGEIIDVFKPVRKHFDMPHDIVASEDGTVYIGDAHTNTVWKFTLT
FT                   ESRLEVEHRSVKKAGIEVPEIKEAEAVVEPKVKNKPTSSELQKMQEKKKLIKDPGSGVP
FT                   VVLITTLLVIPVVVLLAIAMFIRWKKSRAFGEEREAAA"
FT   assembly_gap    12124609..12125090
FT                   /estimated_length=482
FT                   /gap_type="unknown"
FT   assembly_gap    12168565..12174166
FT                   /estimated_length=5602
FT                   /gap_type="unknown"
FT   assembly_gap    12196689..12196708
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12212684..12212703
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12245373..12245392
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(12250796..12251630)
FT                   /pseudo
FT                   /locus_tag="mCG_129593"
FT                   /note="gene_id=mCG129593.1"
FT   mRNA            complement(12250796..12251630)
FT                   /pseudo
FT                   /locus_tag="mCG_129593"
FT                   /note="gene_id=mCG129593.1 transcript_id=mCT130906.1
FT                   created on 31-JAN-2003"
FT   assembly_gap    12312000..12312365
FT                   /estimated_length=366
FT                   /gap_type="unknown"
FT   assembly_gap    12312932..12312986
FT                   /estimated_length=55
FT                   /gap_type="unknown"
FT   gene            complement(12333414..>12349257)
FT                   /locus_tag="mCG_146138"
FT                   /note="gene_id=mCG146138.0"
FT   mRNA            complement(join(12333414..12334395,12335403..12335502,
FT                   12349199..>12349257))
FT                   /locus_tag="mCG_146138"
FT                   /product="mCG146138"
FT                   /note="gene_id=mCG146138.0 transcript_id=mCT186241.0
FT                   created on 14-JUL-2003"
FT   CDS             complement(12334162..>12334359)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146138"
FT                   /product="mCG146138"
FT                   /note="gene_id=mCG146138.0 transcript_id=mCT186241.0
FT                   protein_id=mCP107674.0"
FT                   /protein_id="EDL39895.1"
FT                   /translation="LKHRWSSSLPWVFDWQTLCDQHSSLVNTSAPSAFCLPGETCHSRA
FT                   SSASHEPLQRMCAPFAEAVK"
FT   assembly_gap    12341110..12341352
FT                   /estimated_length=243
FT                   /gap_type="unknown"
FT   assembly_gap    12343188..12343452
FT                   /estimated_length=265
FT                   /gap_type="unknown"
FT   assembly_gap    12345115..12345134
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12387833..12387960
FT                   /estimated_length=128
FT                   /gap_type="unknown"
FT   gene            complement(12394080..12396961)
FT                   /locus_tag="mCG_148370"
FT                   /note="gene_id=mCG148370.0"
FT   mRNA            complement(12394080..12396961)
FT                   /locus_tag="mCG_148370"
FT                   /product="mCG148370"
FT                   /note="gene_id=mCG148370.0 transcript_id=mCT188633.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(12396388..12396597)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148370"
FT                   /product="mCG148370"
FT                   /note="gene_id=mCG148370.0 transcript_id=mCT188633.0
FT                   protein_id=mCP108655.0"
FT                   /protein_id="EDL39894.1"
FT                   /translation="MEIPHPHRQPSSAVSPRFSASFRVCVILQGRVIALSGRMDSTHYF
FT                   LYSLNLVGSPHLCGLGTLFHQNLC"
FT   assembly_gap    12413785..12417943
FT                   /estimated_length=4159
FT                   /gap_type="unknown"
FT   gene            12432073..12445227
FT                   /locus_tag="mCG_1047497"
FT                   /note="gene_id=mCG1047497.2"
FT   mRNA            join(12432073..12432311,12434119..12434208,
FT                   12443869..12445227)
FT                   /locus_tag="mCG_1047497"
FT                   /product="mCG1047497"
FT                   /note="gene_id=mCG1047497.2 transcript_id=mCT165201.0
FT                   created on 19-JUN-2003"
FT   CDS             join(12434147..12434208,12443869..12443935)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1047497"
FT                   /product="mCG1047497"
FT                   /note="gene_id=mCG1047497.2 transcript_id=mCT165201.0
FT                   protein_id=mCP82205.1"
FT                   /protein_id="EDL39892.1"
FT                   /translation="MATILFILQLWRTAIHNNFPGFNMKRSFASSLSWKPPWKGCL"
FT   assembly_gap    12438996..12439065
FT                   /estimated_length=70
FT                   /gap_type="unknown"
FT   assembly_gap    12448586..12448605
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            12474156..12491262
FT                   /locus_tag="mCG_1051114"
FT                   /note="gene_id=mCG1051114.0"
FT   mRNA            join(12474156..12474247,12475583..12475674,
FT                   12485997..12486133,12487411..12491262)
FT                   /locus_tag="mCG_1051114"
FT                   /product="mCG1051114"
FT                   /note="gene_id=mCG1051114.0 transcript_id=mCT194903.0
FT                   created on 27-JAN-2005"
FT   assembly_gap    12479600..12480279
FT                   /estimated_length=680
FT                   /gap_type="unknown"
FT   assembly_gap    12484893..12484933
FT                   /estimated_length=41
FT                   /gap_type="unknown"
FT   CDS             12488875..12489171
FT                   /codon_start=1
FT                   /locus_tag="mCG_1051114"
FT                   /product="mCG1051114"
FT                   /note="gene_id=mCG1051114.0 transcript_id=mCT194903.0
FT                   protein_id=mCP115932.0"
FT                   /protein_id="EDL39891.1"
FT                   /translation="MPISKMSPSFHVTRHILIYQLSCSSAYDLIGPLLRIHHFLIWHPA
FT                   WNNTHFITENIPLCQINKGIIIFEGRWSYAVVCFIAFCLPDWASHLVLSLSKS"
FT   assembly_gap    12497627..12497646
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12500208..12500335
FT                   /estimated_length=128
FT                   /gap_type="unknown"
FT   assembly_gap    12502566..12505557
FT                   /estimated_length=2992
FT                   /gap_type="unknown"
FT   assembly_gap    12509620..12510275
FT                   /estimated_length=656
FT                   /gap_type="unknown"
FT   assembly_gap    12539512..12541285
FT                   /estimated_length=1774
FT                   /gap_type="unknown"
FT   assembly_gap    12556044..12556107
FT                   /estimated_length=64
FT                   /gap_type="unknown"
FT   gene            12563554..12564505
FT                   /pseudo
FT                   /locus_tag="mCG_6226"
FT                   /note="gene_id=mCG6226.1"
FT   mRNA            12563554..12564505
FT                   /pseudo
FT                   /locus_tag="mCG_6226"
FT                   /note="gene_id=mCG6226.1 transcript_id=mCT5826.1 created on
FT                   31-JAN-2003"
FT   gene            <12567174..12567614
FT                   /locus_tag="mCG_50893"
FT                   /note="gene_id=mCG50893.1"
FT   mRNA            <12567174..12567614
FT                   /locus_tag="mCG_50893"
FT                   /product="mCG50893"
FT                   /note="gene_id=mCG50893.1 transcript_id=mCT51076.1 created
FT                   on 14-FEB-2003"
FT   CDS             <12567183..12567470
FT                   /codon_start=1
FT                   /locus_tag="mCG_50893"
FT                   /product="mCG50893"
FT                   /note="gene_id=mCG50893.1 transcript_id=mCT51076.1
FT                   protein_id=mCP27831.1"
FT                   /protein_id="EDL39890.1"
FT                   /translation="PLDMFAEEVAEGELETPTPTQREEAESTGDGLMDVMWEYKWENTG
FT                   DAELYGPFTSAQMQTWVSEGYFPDGGYCQKLDPPGGQFYNSKRIDFELYT"
FT   assembly_gap    12588511..12588530
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12662284..12662851
FT                   /estimated_length=568
FT                   /gap_type="unknown"
FT   assembly_gap    12664614..12670148
FT                   /estimated_length=5535
FT                   /gap_type="unknown"
FT   assembly_gap    12683783..12688218
FT                   /estimated_length=4436
FT                   /gap_type="unknown"
FT   assembly_gap    12708414..12708433
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12710916..12712758
FT                   /estimated_length=1843
FT                   /gap_type="unknown"
FT   gene            12717310..12805504
FT                   /locus_tag="mCG_6225"
FT                   /note="gene_id=mCG6225.1"
FT   mRNA            join(12717310..12717684,12719276..12719536,
FT                   12724443..12724628,12728408..12728504,12739803..12739921,
FT                   12742888..12742997,12762842..12762986,12776775..12776970,
FT                   12786639..12786792,12792327..12792514,12793619..12793683,
FT                   12795881..12796018,12803635..12803767,12805341..12805504)
FT                   /locus_tag="mCG_6225"
FT                   /product="mCG6225"
FT                   /note="gene_id=mCG6225.1 transcript_id=mCT5825.2 created on
FT                   31-JAN-2003"
FT   CDS             join(12717393..12717684,12719276..12719536,
FT                   12724443..12724628,12728408..12728504,12739803..12739921,
FT                   12742888..12742997,12762842..12762986,12776775..12776970,
FT                   12786639..12786792,12792327..12792514,12793619..12793683,
FT                   12795881..12796018,12803635..12803735)
FT                   /codon_start=1
FT                   /locus_tag="mCG_6225"
FT                   /product="mCG6225"
FT                   /note="gene_id=mCG6225.1 transcript_id=mCT5825.2
FT                   protein_id=mCP4990.1"
FT                   /db_xref="GOA:Q9D5W6"
FT                   /db_xref="InterPro:IPR002350"
FT                   /db_xref="InterPro:IPR004156"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="MGI:MGI:1918116"
FT                   /db_xref="UniProtKB/TrEMBL:Q9D5W6"
FT                   /protein_id="EDL39888.1"
FT                   /translation="MAQDKIKQKDAVKQAQVVDMDEHQKTKEPRKLEMFLVTLPTAVKK
FT                   FADTPDMKKSDRKYKDPSEEPYGLGSLVFPCLQRFNNVKSFLTLSFLAVVAHSMIFALV
FT                   DQSIKLYVAQLSPSRIEEYLMDTSDNFVAFLFSMFVAHFGGRGNRANWVAAGCFLTGIA
FT                   AIVFAVPFLNFEIIKLSVVKEELCEEGKLPKVCEPTVLPHKSICIFIFIFGQCLHGIAG
FT                   LPLYILATSFIFDHVPTNSSGLYIALVDAALGVGYCLGFIGGMLNFKMSAQEVMQAVGH
FT                   RQRIRILQRGWWRTFIFVAVFAFCTTLPLLGFPSSLPGARQIRLEKSQEPPTFDRRLKN
FT                   KEIKNNLKSVLHATWCLIRNPLVLSQVVCKFTEFTTFKSSAVFLPQYLQTRFLIRPSSA
FT                   SMLTGVFILPGSIFGHFFGGFIVHRMQMNNKNKLKFLVVASFVSIVLFLLTFFVECEIS
FT                   KFAGINDDYDRLGIIGNLTAPCNVPCGCTTSEYNPVCGRDETQYFSPCFAGCKATKKLR
FT                   KEKTYYNCSCIKEGLTTADNEGQYIDAVSGTCNTRCLTLPLFFAFYFTATFLSSFCSIP
FT                   SALIVIQSVPTSWNSMSLGLMSTVWRFTGSVPAPILFAATSDFTCQFWGINECGEKVRC
FT                   WIYNTENLVYTFKTVWINMQILSGLSCLYGVYRHDYVVKGDGKKAEEK"
FT   gene            12753886..12756172
FT                   /locus_tag="mCG_6227"
FT                   /note="gene_id=mCG6227.2"
FT   mRNA            12753886..12756172
FT                   /locus_tag="mCG_6227"
FT                   /product="mCG6227"
FT                   /note="gene_id=mCG6227.2 transcript_id=mCT5827.2 created on
FT                   31-JAN-2003"
FT   CDS             12753951..12755345
FT                   /codon_start=1
FT                   /locus_tag="mCG_6227"
FT                   /product="mCG6227"
FT                   /note="gene_id=mCG6227.2 transcript_id=mCT5827.2
FT                   protein_id=mCP4981.2"
FT                   /protein_id="EDL39889.1"
FT                   /translation="MAMTAGATTTFPMSNHTRERVTVAKLTLENFYSNLILQHEERETR
FT                   QKKLEVAMEEEGLADEEKKLRRSQHAHKETEFLRLKRTRLGLDDFESLKVIGRGAFGEV
FT                   RLVQKKDTGHIYAMKILRKADMLEKEQVAHIQAERDILVEADGAWVVKMFYSFQDKRNL
FT                   YLIMEFLPGGDMMTLLMKKDTLTEEETQFYISETVLAIDAIHQLGFIHWDIKPDNLLLD
FT                   AKGHVKLSDFGLCTGLKKAHRTELYRNLTHNPPSDFSFQNMNSKWTAETWKKNRRQLAY
FT                   STVGTADYIAPEVFMQTGSNKLCDWWSLGVIMYEMLIGFPPFCSETPQETYRKVMSWKE
FT                   TLAFPPEVPVSEKAKDLILRFCTDSENRIGNGGVEEIRGHPFFEGVDWGHIRERPAAIP
FT                   IEIRSIDDTSNFDDFPESDILQPVLNTTEPDYKSKDWVFLNYTYKRFEGLIQRGSIPTY
FT                   MKAGKL"
FT   assembly_gap    12778584..12778687
FT                   /estimated_length=104
FT                   /gap_type="unknown"
FT   assembly_gap    12895465..12895532
FT                   /estimated_length=68
FT                   /gap_type="unknown"
FT   assembly_gap    12910296..12910785
FT                   /estimated_length=490
FT                   /gap_type="unknown"
FT   assembly_gap    12911596..12912605
FT                   /estimated_length=1010
FT                   /gap_type="unknown"
FT   assembly_gap    12914551..12914812
FT                   /estimated_length=262
FT                   /gap_type="unknown"
FT   assembly_gap    12923952..12923971
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12931338..12931406
FT                   /estimated_length=69
FT                   /gap_type="unknown"
FT   assembly_gap    12937836..12937855
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12939336..12944621
FT                   /estimated_length=5286
FT                   /gap_type="unknown"
FT   assembly_gap    13004604..13004623
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13010148..13010562
FT                   /estimated_length=415
FT                   /gap_type="unknown"
FT   assembly_gap    13013347..13013473
FT                   /estimated_length=127
FT                   /gap_type="unknown"
FT   assembly_gap    13017793..13018238
FT                   /estimated_length=446
FT                   /gap_type="unknown"
FT   assembly_gap    13062307..13062326
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13098759..13098991
FT                   /estimated_length=233
FT                   /gap_type="unknown"
FT   assembly_gap    13122552..13122571
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13134407..13134584
FT                   /estimated_length=178
FT                   /gap_type="unknown"
FT   assembly_gap    13138193..13138212
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13176526..13180415
FT                   /estimated_length=3890
FT                   /gap_type="unknown"
FT   assembly_gap    13186622..13186641
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13188799..13194709
FT                   /estimated_length=5911
FT                   /gap_type="unknown"
FT   assembly_gap    13239809..13244271
FT                   /estimated_length=4463
FT                   /gap_type="unknown"
FT   assembly_gap    13252997..13253233
FT                   /estimated_length=237
FT                   /gap_type="unknown"
FT   assembly_gap    13259020..13259208
FT                   /estimated_length=189
FT                   /gap_type="unknown"
FT   assembly_gap    13260304..13260323
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13262663..13263185
FT                   /estimated_length=523
FT                   /gap_type="unknown"
FT   assembly_gap    13264085..13265128
FT                   /estimated_length=1044
FT                   /gap_type="unknown"
FT   assembly_gap    13268539..13268776
FT                   /estimated_length=238
FT                   /gap_type="unknown"
FT   assembly_gap    13274286..13276366
FT                   /estimated_length=2081
FT                   /gap_type="unknown"
FT   assembly_gap    13280124..13280837
FT                   /estimated_length=714
FT                   /gap_type="unknown"
FT   assembly_gap    13285569..13285588
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13288165..13288184
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13297163..13298370
FT                   /estimated_length=1208
FT                   /gap_type="unknown"
FT   assembly_gap    13368111..13368248
FT                   /estimated_length=138
FT                   /gap_type="unknown"
FT   assembly_gap    13370964..13371006
FT                   /estimated_length=43
FT                   /gap_type="unknown"
FT   assembly_gap    13378012..13378031
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13379539..13379558
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13380716..13380735
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13382187..13382206
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13383564..13385019
FT                   /estimated_length=1456
FT                   /gap_type="unknown"
FT   assembly_gap    13390066..13390085
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13429226..13429245
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13430709..13430728
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13433298..13433317
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13442373..13442593
FT                   /estimated_length=221
FT                   /gap_type="unknown"
FT   assembly_gap    13461473..13461492
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13468390..13468409
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13471429..13471448
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13472617..13472636
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13474353..13474372
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13481915..13486158
FT                   /estimated_length=4244
FT                   /gap_type="unknown"
FT   assembly_gap    13487448..13487467
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13494252..13494271
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13504507..13504538
FT                   /estimated_length=32
FT                   /gap_type="unknown"
FT   assembly_gap    13505591..13505872
FT                   /estimated_length=282
FT                   /gap_type="unknown"
FT   assembly_gap    13508062..13508603
FT                   /estimated_length=542
FT                   /gap_type="unknown"
FT   assembly_gap    13516996..13517015
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13518959..13518978
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13521747..13523229
FT                   /estimated_length=1483
FT                   /gap_type="unknown"
FT   assembly_gap    13523954..13524509
FT                   /estimated_length=556
FT                   /gap_type="unknown"
FT   assembly_gap    13548121..13548140
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13554457..13555243
FT                   /estimated_length=787
FT                   /gap_type="unknown"
FT   assembly_gap    13556690..13556709
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13557964..13557983
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13559178..13559197
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13563168..13563187
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13566602..13566621
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13569410..13569429
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13591211..13591230
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13597700..13597719
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13603424..13603443
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13633178..13633891
FT                   /estimated_length=714
FT                   /gap_type="unknown"
FT   assembly_gap    13635586..13636457
FT                   /estimated_length=872
FT                   /gap_type="unknown"
FT   assembly_gap    13640905..13643084
FT                   /estimated_length=2180
FT                   /gap_type="unknown"
FT   assembly_gap    13645573..13645592
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13648822..13649140
FT                   /estimated_length=319
FT                   /gap_type="unknown"
FT   assembly_gap    13650477..13652438
FT                   /estimated_length=1962
FT                   /gap_type="unknown"
FT   assembly_gap    13674209..13674658
FT                   /estimated_length=450
FT                   /gap_type="unknown"
FT   assembly_gap    13718771..13718790
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13724109..13724128
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13731767..13731874
FT                   /estimated_length=108
FT                   /gap_type="unknown"
FT   assembly_gap    13748250..13748270
FT                   /estimated_length=21
FT                   /gap_type="unknown"
FT   assembly_gap    13754701..13754720
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13765066..13765745
FT                   /estimated_length=680
FT                   /gap_type="unknown"
FT   assembly_gap    13768852..13768871
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13779061..13779080
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13801100..13801119
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13813643..13813682
FT                   /estimated_length=40
FT                   /gap_type="unknown"
FT   assembly_gap    13833898..13833917
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13837563..13840058
FT                   /estimated_length=2496
FT                   /gap_type="unknown"
FT   assembly_gap    13841205..13841315
FT                   /estimated_length=111
FT                   /gap_type="unknown"
FT   assembly_gap    13849194..13849524
FT                   /estimated_length=331
FT                   /gap_type="unknown"
FT   assembly_gap    13871480..13871499
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13872545..13872564
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13882110..13882129
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13933406..13933425
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14010601..14010620
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14013370..14013389
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14030367..14033951
FT                   /estimated_length=3585
FT                   /gap_type="unknown"
FT   assembly_gap    14035938..14035985
FT                   /estimated_length=48
FT                   /gap_type="unknown"
FT   assembly_gap    14039658..14039677
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14043578..14043597
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14085306..14085335
FT                   /estimated_length=30
FT                   /gap_type="unknown"
FT   gene            complement(14096880..14097718)
FT                   /locus_tag="mCG_128264"
FT                   /note="gene_id=mCG128264.0"
FT   mRNA            complement(14096880..14097718)
FT                   /locus_tag="mCG_128264"
FT                   /product="mCG128264"
FT                   /note="gene_id=mCG128264.0 transcript_id=mCT129558.0
FT                   created on 16-JAN-2003"
FT   CDS             complement(14097109..14097705)
FT                   /codon_start=1
FT                   /locus_tag="mCG_128264"
FT                   /product="mCG128264"
FT                   /note="gene_id=mCG128264.0 transcript_id=mCT129558.0
FT                   protein_id=mCP81532.1"
FT                   /protein_id="EDL39887.1"
FT                   /translation="MASGNAHIGKSTPDFTATAVVDGTFKEIKLSDYRGKYMVLFFYPL
FT                   DITFVCPTEIIAFSDHAEDFRKLGCEVLGVSVDSQFTHQAWINTSRKEGGLGPLNIPLL
FT                   ADVTKSLSQNYGVLKNDEGIAYRGLFIIDAKGVLRQITVNDLPVGRSVHEALRLVQAFQ
FT                   YTDEHGEVSPAGWKPGSDTIKPNVDYSKEYFSKHN"
FT   assembly_gap    14097719..14097738
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14099446..14099465
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14104477..14104496
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14106249..14106268
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14130068..14130087
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14172202..14172221
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14182586..14182605
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14200941..14200960
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14211814..14211833
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14216401..14216420
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14219172..14219191
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14223896..14224238
FT                   /estimated_length=343
FT                   /gap_type="unknown"
FT   assembly_gap    14236136..14236562
FT                   /estimated_length=427
FT                   /gap_type="unknown"
FT   gene            14252095..14790529
FT                   /locus_tag="mCG_142065"
FT                   /note="gene_id=mCG142065.0"
FT   mRNA            join(14252095..14252199,14278644..14278837,
FT                   14362729..14362876,14410259..14410428,14454055..14454319,
FT                   14472925..14473074,14476946..14477117,14526479..14526585,
FT                   14559814..14559933,14579075..14579275,14656769..14656886,
FT                   14667877..14668004,14668178..14668348,14677208..14677426,
FT                   14682785..14683024,14689868..14690092,14735957..14736087,
FT                   14751090..14751240,14782945..14783163,14786492..14786563,
FT                   14789092..14790529)
FT                   /locus_tag="mCG_142065"
FT                   /product="mCG142065"
FT                   /note="gene_id=mCG142065.0 transcript_id=mCT178772.0
FT                   created on 16-JAN-2003"
FT   CDS             join(14252196..14252199,14278644..14278837,
FT                   14362729..14362876,14410259..14410428,14454055..14454319,
FT                   14472925..14473074,14476946..14477117,14526479..14526585,
FT                   14559814..14559933,14579075..14579275,14656769..14656886,
FT                   14667877..14668004,14668178..14668348,14677208..14677426,
FT                   14682785..14683024,14689868..14690092,14735957..14736087,
FT                   14751090..14751240,14782945..14783163,14786492..14786563,
FT                   14789092..14789288)
FT                   /codon_start=1
FT                   /locus_tag="mCG_142065"
FT                   /product="mCG142065"
FT                   /note="gene_id=mCG142065.0 transcript_id=mCT178772.0
FT                   protein_id=mCP101694.0"
FT                   /protein_id="EDL39886.1"
FT                   /translation="MGTGGWSPENSSAHQWLQLDLGNRVEITAVATQGRYGSSDWVTSY
FT                   CLIFSDTGHNWQQYKQGDSIWTFIGNMNANSVVHHKLLHAVRARFVRFVPLEWNPNGKI
FT                   GMRVEVYGCFYIDFYFFHQKLSFGGIPVPSKPGTFLKKNFQGCIENLYYNGVNIIDLAK
FT                   RRKHQIYSVGNVTFSCSEPQIVPITFVNSRSSYLLLPGTPQIDGLSVSFQFRTWNEDGL
FT                   LLSTELSEGSGTLLLILEGGTLRLLIKNVAGHGTESLTGRSLNDGQWHSVNINARRNRV
FT                   TLTLDNDPASPALETPWLQIYSGYSYYFGGCPDNLTDSQCLNPIKAFQGCMRLIFIDNQ
FT                   PKDLISVQQGSLGNFSDLHIDLCSIKDRCFPNYCEHGGHCTQTWTNFYCNCSNTGYTGA
FT                   TCHDSIYEQSCEVYRHRGNTAGYFYVDSDGSGPLRPLQVYCNVTEDKIWMTVQHNNTEL
FT                   TWIQSSNTEKPYVMNLNYGGSMEQLEALIDGSEHCEQEVTYYCRRSHLLNTPDGAPFAW
FT                   WTGRSNERHPYWGGYFPGDQKCGCGLEESCLEMSNDTGFLSFKDHLPVTQIIISDTNRS
FT                   NSEAAWRIGPLRCYGDRHFWNAVSFSTEAAYLHIPTFHAEFSADISFFFKTTALSGVFL
FT                   ENLGVKNFLRLEMSSPSEVIFAIDVGNGPMELLVQSPYPLNDNQWHYIQAERNIKETLL
FT                   HVDNLPKSMRMASEEGHFLLQLNSQLFVGGTSSRQKGFLGCIRSLHLNGQKVDLEERAK
FT                   ITSGVRPGCAGHCNSYGRNCQNGGKCVEKHIGYTCDCTNSPYEGPFCKKEISALFYSGT
FT                   SVTYMFQEPYPVTKNTSLSSSAIYKDTAPSKEAITLSFMTAQAPTLLLYLNFSSQNFLA
FT                   ILLSRNGSLQIQYRLSKEESHVFTISTENLANRRVHQVKMSRDGPELSIQMDQQLFSYN
FT                   FPPEVEFQTVRSLILGKVTGLLFYSIYFVDVVKLEEFVTSVETLGLDPEVAKANTLGFV
FT                   GCLSSVQYNHIAPLKAALRHASISPVTVQGTLTESSCDSMIDSDVTGVTTVYSPSVPFG
FT                   KTDEHEPLTNTIQSDSAFIGGVIAIVTFITFCVLGIMVHFLYQQKQSHRTNQMKEKEYP
FT                   DNLDSSFRNDIDLQNTAIECKREYFI"
FT   assembly_gap    14315162..14315181
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14318054..14318112
FT                   /estimated_length=59
FT                   /gap_type="unknown"
FT   assembly_gap    14319573..14319592
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14327485..14327504
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14342554..14342573
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14383423..14389326
FT                   /estimated_length=5904
FT                   /gap_type="unknown"
FT   assembly_gap    14412808..14412850
FT                   /estimated_length=43
FT                   /gap_type="unknown"
FT   assembly_gap    14440311..14440330
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14488350..14488369
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14535728..14535747
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14561852..14561871
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14611421..14611440
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14618895..14618914
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14627323..14627421
FT                   /estimated_length=99
FT                   /gap_type="unknown"
FT   assembly_gap    14630312..14630331
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14648920..14649375
FT                   /estimated_length=456
FT                   /gap_type="unknown"
FT   assembly_gap    14654215..14654234
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14669346..14670320
FT                   /estimated_length=975
FT                   /gap_type="unknown"
FT   assembly_gap    14671601..14672056
FT                   /estimated_length=456
FT                   /gap_type="unknown"
FT   assembly_gap    14679244..14679263
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14713790..14713809
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14727765..14727784
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14729161..14729180
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14730781..14730800
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14751621..14752246
FT                   /estimated_length=626
FT                   /gap_type="unknown"
FT   assembly_gap    14778225..14778244
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14810418..14810437
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14828684..14828703
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14830431..14830450
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14836130..14836427
FT                   /estimated_length=298
FT                   /gap_type="unknown"
FT   assembly_gap    14859610..14860297
FT                   /estimated_length=688
FT                   /gap_type="unknown"
FT   assembly_gap    14862993..14863220
FT                   /estimated_length=228
FT                   /gap_type="unknown"
FT   assembly_gap    14885522..14885915
FT                   /estimated_length=394
FT                   /gap_type="unknown"
FT   gene            14902909..14903472
FT                   /pseudo
FT                   /locus_tag="mCG_1047346"
FT                   /note="gene_id=mCG1047346.1"
FT   mRNA            14902909..14903472
FT                   /pseudo
FT                   /locus_tag="mCG_1047346"
FT                   /note="gene_id=mCG1047346.1 transcript_id=mCT165050.1
FT                   created on 11-FEB-2003"
FT   assembly_gap    14922486..14922505
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14942415..14942434
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14943562..14943581
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14966122..14966141
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14967998..14968017
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14969743..14970868
FT                   /estimated_length=1126
FT                   /gap_type="unknown"
FT   assembly_gap    14973284..14973303
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14975530..14976897
FT                   /estimated_length=1368
FT                   /gap_type="unknown"
FT   assembly_gap    14984462..14984481
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14990460..14990479
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15007874..15007906
FT                   /estimated_length=33
FT                   /gap_type="unknown"
FT   assembly_gap    15050358..15050377
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15051968..15052185
FT                   /estimated_length=218
FT                   /gap_type="unknown"
FT   assembly_gap    15055841..15061726
FT                   /estimated_length=5886
FT                   /gap_type="unknown"
FT   assembly_gap    15075392..15076287
FT                   /estimated_length=896
FT                   /gap_type="unknown"
FT   assembly_gap    15108130..15108149
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15131780..15132164
FT                   /estimated_length=385
FT                   /gap_type="unknown"
FT   assembly_gap    15150232..15150267
FT                   /estimated_length=36
FT                   /gap_type="unknown"
FT   assembly_gap    15200032..15200051
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15202332..15202419
FT                   /estimated_length=88
FT                   /gap_type="unknown"
FT   assembly_gap    15244707..15244726
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15253682..15253701
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15280848..15280927
FT                   /estimated_length=80
FT                   /gap_type="unknown"
FT   assembly_gap    15284501..15287054
FT                   /estimated_length=2554
FT                   /gap_type="unknown"
FT   assembly_gap    15291464..15293364
FT                   /estimated_length=1901
FT                   /gap_type="unknown"
FT   assembly_gap    15303548..15303567
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15311941..15312124
FT                   /estimated_length=184
FT                   /gap_type="unknown"
FT   assembly_gap    15335664..15335835
FT                   /estimated_length=172
FT                   /gap_type="unknown"
FT   assembly_gap    15337713..15338386
FT                   /estimated_length=674
FT                   /gap_type="unknown"
FT   assembly_gap    15340491..15346167
FT                   /estimated_length=5677
FT                   /gap_type="unknown"
FT   assembly_gap    15362324..15362343
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15363956..15363975
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15379945..15379964
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15400662..15400681
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15425224..15425243
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15442315..15442334
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15443635..15444169
FT                   /estimated_length=535
FT                   /gap_type="unknown"
FT   gene            <15449864..15469026
FT                   /locus_tag="mCG_145617"
FT                   /note="gene_id=mCG145617.0"
FT   mRNA            join(<15449864..15450069,15462512..15462586,
FT                   15468517..15469026)
FT                   /locus_tag="mCG_145617"
FT                   /product="mCG145617"
FT                   /note="gene_id=mCG145617.0 transcript_id=mCT185041.0
FT                   created on 05-JUN-2003"
FT   CDS             <15449865..15450068
FT                   /codon_start=1
FT                   /locus_tag="mCG_145617"
FT                   /product="mCG145617"
FT                   /note="gene_id=mCG145617.0 transcript_id=mCT185041.0
FT                   protein_id=mCP106091.0"
FT                   /protein_id="EDL39885.1"
FT                   /translation="FIELGALMCQAPVSVNVTHCPIPCRVSYWGSTGPQEQASFNQNRL
FT                   PFTTPQLSQDLRIQRSSDIVFN"
FT   assembly_gap    15452642..15452684
FT                   /estimated_length=43
FT                   /gap_type="unknown"
FT   assembly_gap    15454343..15454461
FT                   /estimated_length=119
FT                   /gap_type="unknown"
FT   assembly_gap    15490547..15490598
FT                   /estimated_length=52
FT                   /gap_type="unknown"
FT   assembly_gap    15492518..15492838
FT                   /estimated_length=321
FT                   /gap_type="unknown"
FT   assembly_gap    15514730..15514749
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15527801..15527820
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15529826..15529845
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15531396..15531415
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15532546..15533903
FT                   /estimated_length=1358
FT                   /gap_type="unknown"
FT   assembly_gap    15537354..15537373
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15538642..15538661
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15540541..15540560
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15541820..15541839
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15559126..15559145
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15561714..15561733
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15618558..15621771
FT                   /estimated_length=3214
FT                   /gap_type="unknown"
FT   assembly_gap    15630782..15630801
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15646911..15646930
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15649532..15651331
FT                   /estimated_length=1800
FT                   /gap_type="unknown"
FT   assembly_gap    15656143..15656162
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15659928..15662016
FT                   /estimated_length=2089
FT                   /gap_type="unknown"
FT   assembly_gap    15666169..15672241
FT                   /estimated_length=6073
FT                   /gap_type="unknown"
FT   gene            15672243..15672688
FT                   /pseudo
FT                   /locus_tag="mCG_50718"
FT                   /note="gene_id=mCG50718.2"
FT   mRNA            15672243..15672688
FT                   /pseudo
FT                   /locus_tag="mCG_50718"
FT                   /note="gene_id=mCG50718.2 transcript_id=mCT50901.2 created
FT                   on 16-JAN-2003"
FT   assembly_gap    15678455..15678474
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15681452..15681471
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15683192..15684026
FT                   /estimated_length=835
FT                   /gap_type="unknown"
FT   assembly_gap    15725716..15725850
FT                   /estimated_length=135
FT                   /gap_type="unknown"
FT   assembly_gap    15757799..15757818
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15764016..15764303
FT                   /estimated_length=288
FT                   /gap_type="unknown"
FT   assembly_gap    15790707..15790726
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15810834..15810885
FT                   /estimated_length=52
FT                   /gap_type="unknown"
FT   assembly_gap    15815485..15815504
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15846422..15846916
FT                   /estimated_length=495
FT                   /gap_type="unknown"
FT   assembly_gap    15847857..15848284
FT                   /estimated_length=428
FT                   /gap_type="unknown"
FT   assembly_gap    15852356..15853027
FT                   /estimated_length=672
FT                   /gap_type="unknown"
FT   assembly_gap    15855598..15858236
FT                   /estimated_length=2639
FT                   /gap_type="unknown"
FT   assembly_gap    15861042..15861979
FT                   /estimated_length=938
FT                   /gap_type="unknown"
FT   assembly_gap    15877830..15878270
FT                   /estimated_length=441
FT                   /gap_type="unknown"
FT   assembly_gap    15879990..15880676
FT                   /estimated_length=687
FT                   /gap_type="unknown"
FT   assembly_gap    15885193..15885212
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15886508..15887358
FT                   /estimated_length=851
FT                   /gap_type="unknown"
FT   assembly_gap    15889435..15891699
FT                   /estimated_length=2265
FT                   /gap_type="unknown"
FT   assembly_gap    15894090..15896059
FT                   /estimated_length=1970
FT                   /gap_type="unknown"
FT   assembly_gap    15901687..15901832
FT                   /estimated_length=146
FT                   /gap_type="unknown"
FT   assembly_gap    15909716..15909735
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15919124..15919143
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15919907..15919926
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15954858..15955340
FT                   /estimated_length=483
FT                   /gap_type="unknown"
FT   assembly_gap    15959789..15959808
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15989354..15989373
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16003549..16003568
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16017525..16017544
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16018909..16020344
FT                   /estimated_length=1436
FT                   /gap_type="unknown"
FT   assembly_gap    16022672..16022691
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16024214..16024233
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16025590..16025609
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16027440..16027459
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16028484..16028503
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16035519..16036577
FT                   /estimated_length=1059
FT                   /gap_type="unknown"
FT   assembly_gap    16037362..16037387
FT                   /estimated_length=26
FT                   /gap_type="unknown"
FT   gene            complement(16045529..16046226)
FT                   /pseudo
FT                   /locus_tag="mCG_1047487"
FT                   /note="gene_id=mCG1047487.1"
FT   mRNA            complement(16045529..16046226)
FT                   /pseudo
FT                   /locus_tag="mCG_1047487"
FT                   /note="gene_id=mCG1047487.1 transcript_id=mCT165191.1
FT                   created on 23-FEB-2003"
FT   assembly_gap    16050250..16050647
FT                   /estimated_length=398
FT                   /gap_type="unknown"
FT   assembly_gap    16074562..16074615
FT                   /estimated_length=54
FT                   /gap_type="unknown"
FT   assembly_gap    16094141..16094911
FT                   /estimated_length=771
FT                   /gap_type="unknown"
FT   assembly_gap    16112921..16113086
FT                   /estimated_length=166
FT                   /gap_type="unknown"
FT   assembly_gap    16156531..16156550
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16173896..16173931
FT                   /estimated_length=36
FT                   /gap_type="unknown"
FT   gene            16179227..>16182198
FT                   /locus_tag="mCG_1047893"
FT                   /note="gene_id=mCG1047893.0"
FT   mRNA            join(16179227..16179282,16181537..>16182198)
FT                   /locus_tag="mCG_1047893"
FT                   /product="mCG1047893"
FT                   /note="gene_id=mCG1047893.0 transcript_id=mCT165597.0
FT                   created on 14-MAR-2003"
FT   CDS             16182107..>16182198
FT                   /codon_start=1
FT                   /locus_tag="mCG_1047893"
FT                   /product="mCG1047893"
FT                   /note="gene_id=mCG1047893.0 transcript_id=mCT165597.0
FT                   protein_id=mCP81291.1"
FT                   /protein_id="EDL39884.1"
FT                   /translation="MLTHKYKLFSFEFIDNMYVKMVPLKSIFHTG"
FT   gene            complement(16184715..16189099)
FT                   /locus_tag="mCG_2893"
FT                   /note="gene_id=mCG2893.2"
FT   mRNA            complement(join(16184715..16185217,16186591..16186708,
FT                   16188929..16189099))
FT                   /locus_tag="mCG_2893"
FT                   /product="mCG2893"
FT                   /note="gene_id=mCG2893.2 transcript_id=mCT2525.2 created on
FT                   14-MAR-2003"
FT   CDS             complement(16184903..16185055)
FT                   /codon_start=1
FT                   /locus_tag="mCG_2893"
FT                   /product="mCG2893"
FT                   /note="gene_id=mCG2893.2 transcript_id=mCT2525.2
FT                   protein_id=mCP21600.2"
FT                   /protein_id="EDL39883.1"
FT                   /translation="MILCDGALLLLWMVCKLKAQTKRDKMVIAQALAALEYGTSPDIWL
FT                   SILKQ"
FT   assembly_gap    16194835..16195169
FT                   /estimated_length=335
FT                   /gap_type="unknown"
FT   assembly_gap    16204907..16204950
FT                   /estimated_length=44
FT                   /gap_type="unknown"
FT   assembly_gap    16214039..16214754
FT                   /estimated_length=716
FT                   /gap_type="unknown"
FT   assembly_gap    16240484..16240704
FT                   /estimated_length=221
FT                   /gap_type="unknown"
FT   assembly_gap    16250546..16250576
FT                   /estimated_length=31
FT                   /gap_type="unknown"
FT   assembly_gap    16253958..16254633
FT                   /estimated_length=676
FT                   /gap_type="unknown"
FT   assembly_gap    16259908..16262586
FT                   /estimated_length=2679
FT                   /gap_type="unknown"
FT   assembly_gap    16264418..16264437
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16266014..16266033
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16277516..16277535
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16282595..16284666
FT                   /estimated_length=2072
FT                   /gap_type="unknown"
FT   assembly_gap    16285323..16288529
FT                   /estimated_length=3207
FT                   /gap_type="unknown"
FT   assembly_gap    16344657..16344676
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16364419..16368997
FT                   /estimated_length=4579
FT                   /gap_type="unknown"
FT   assembly_gap    16406283..16406302
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16496122..16496141
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16497685..16497704
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16501952..16502400
FT                   /estimated_length=449
FT                   /gap_type="unknown"
FT   assembly_gap    16510450..16512058
FT                   /estimated_length=1609
FT                   /gap_type="unknown"
FT   assembly_gap    16518128..16518147
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16519872..16520281
FT                   /estimated_length=410
FT                   /gap_type="unknown"
FT   assembly_gap    16524810..16525277
FT                   /estimated_length=468
FT                   /gap_type="unknown"
FT   assembly_gap    16527758..16527777
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16529272..16533445
FT                   /estimated_length=4174
FT                   /gap_type="unknown"
FT   assembly_gap    16595929..16595989
FT                   /estimated_length=61
FT                   /gap_type="unknown"
FT   assembly_gap    16668585..16672326
FT                   /estimated_length=3742
FT                   /gap_type="unknown"
FT   assembly_gap    16688663..16688994
FT                   /estimated_length=332
FT                   /gap_type="unknown"
FT   gene            16728854..>16817580
FT                   /locus_tag="mCG_52454"
FT                   /note="gene_id=mCG52454.2"
FT   mRNA            join(16728854..16729043,16776151..16776307,
FT                   16799116..16799341,16817356..>16817580)
FT                   /locus_tag="mCG_52454"
FT                   /product="mCG52454"
FT                   /note="gene_id=mCG52454.2 transcript_id=mCT52637.2 created
FT                   on 11-FEB-2003"
FT   assembly_gap    16741951..16742222
FT                   /estimated_length=272
FT                   /gap_type="unknown"
FT   assembly_gap    16748072..16748803
FT                   /estimated_length=732
FT                   /gap_type="unknown"
FT   assembly_gap    16772097..16772116
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(16776305..16776307,16799116..16799341,
FT                   16817356..>16817580)
FT                   /codon_start=1
FT                   /locus_tag="mCG_52454"
FT                   /product="mCG52454"
FT                   /note="gene_id=mCG52454.2 transcript_id=mCT52637.2
FT                   protein_id=mCP41630.2"
FT                   /protein_id="EDL39882.1"
FT                   /translation="MRQKAFLRCICSLHLNGENRDLKEKAMVTSGVRPGCPGHCSGYGS
FT                   NCHNGGKCVEKQSGYFCDCTSSPYEGPFCQKEISGLFDSGTSVTYMLQEPYPVTKNTSL
FT                   SSSGIYKDTAASKKIITLSFMTAQAPSILLYLNSSFQNFLAILLSRN"
FT   assembly_gap    16783379..16783403
FT                   /estimated_length=25
FT                   /gap_type="unknown"
FT   assembly_gap    16784503..16784585
FT                   /estimated_length=83
FT                   /gap_type="unknown"
FT   assembly_gap    16791090..16791109
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16804296..16804597
FT                   /estimated_length=302
FT                   /gap_type="unknown"
FT   assembly_gap    16826633..16826982
FT                   /estimated_length=350
FT                   /gap_type="unknown"
FT   assembly_gap    16829751..16829992
FT                   /estimated_length=242
FT                   /gap_type="unknown"
FT   assembly_gap    16837549..16838326
FT                   /estimated_length=778
FT                   /gap_type="unknown"
FT   assembly_gap    16874391..16874410
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16880167..16883992
FT                   /estimated_length=3826
FT                   /gap_type="unknown"
FT   assembly_gap    16907616..16907990
FT                   /estimated_length=375
FT                   /gap_type="unknown"
FT   assembly_gap    16953361..16953380
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16954944..16954963
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16968730..16968749
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16978755..16979836
FT                   /estimated_length=1082
FT                   /gap_type="unknown"
FT   assembly_gap    17023823..17024339
FT                   /estimated_length=517
FT                   /gap_type="unknown"
FT   assembly_gap    17057694..17057713
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17064004..17064023
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17068296..17068368
FT                   /estimated_length=73
FT                   /gap_type="unknown"
FT   assembly_gap    17069782..17070044
FT                   /estimated_length=263
FT                   /gap_type="unknown"
FT   assembly_gap    17096834..17096853
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17127109..17127190
FT                   /estimated_length=82
FT                   /gap_type="unknown"
FT   assembly_gap    17173451..17173811
FT                   /estimated_length=361
FT                   /gap_type="unknown"
FT   assembly_gap    17200604..17208279
FT                   /estimated_length=7676
FT                   /gap_type="unknown"
FT   assembly_gap    17212739..17213162
FT                   /estimated_length=424
FT                   /gap_type="unknown"
FT   assembly_gap    17239467..17239562
FT                   /estimated_length=96
FT                   /gap_type="unknown"
FT   assembly_gap    17260432..17260451
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17269210..17269451
FT                   /estimated_length=242
FT                   /gap_type="unknown"
FT   assembly_gap    17270648..17271351
FT                   /estimated_length=704
FT                   /gap_type="unknown"
FT   assembly_gap    17277351..17281587
FT                   /estimated_length=4237
FT                   /gap_type="unknown"
FT   assembly_gap    17285349..17285368
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17287282..17287979
FT                   /estimated_length=698
FT                   /gap_type="unknown"
FT   assembly_gap    17306833..17306909
FT                   /estimated_length=77
FT                   /gap_type="unknown"
FT   assembly_gap    17316689..17316708
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17327739..17327819
FT                   /estimated_length=81
FT                   /gap_type="unknown"
FT   assembly_gap    17331209..17331228
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17362953..17363007
FT                   /estimated_length=55
FT                   /gap_type="unknown"
FT   assembly_gap    17372489..17372829
FT                   /estimated_length=341
FT                   /gap_type="unknown"
FT   assembly_gap    17382204..17383269
FT                   /estimated_length=1066
FT                   /gap_type="unknown"
FT   assembly_gap    17411333..17411352
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17419165..17419184
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17420706..17420725
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17430783..17430802
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17471229..17473425
FT                   /estimated_length=2197
FT                   /gap_type="unknown"
FT   assembly_gap    17481003..17481022
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17507493..17508093
FT                   /estimated_length=601
FT                   /gap_type="unknown"
FT   assembly_gap    17519091..17519348
FT                   /estimated_length=258
FT                   /gap_type="unknown"
FT   assembly_gap    17553796..17554225
FT                   /estimated_length=430
FT                   /gap_type="unknown"
FT   assembly_gap    17562078..17562170
FT                   /estimated_length=93
FT                   /gap_type="unknown"
FT   assembly_gap    17571677..17572164
FT                   /estimated_length=488
FT                   /gap_type="unknown"
FT   assembly_gap    17574649..17574668
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17626590..17626846
FT                   /estimated_length=257
FT                   /gap_type="unknown"
FT   assembly_gap    17669552..17671190
FT                   /estimated_length=1639
FT                   /gap_type="unknown"
FT   assembly_gap    17680643..17680662
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17697596..17697959
FT                   /estimated_length=364
FT                   /gap_type="unknown"
FT   assembly_gap    17790550..17790968
FT                   /estimated_length=419
FT                   /gap_type="unknown"
FT   assembly_gap    17805844..17805863
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17807976..17809586
FT                   /estimated_length=1611
FT                   /gap_type="unknown"
FT   assembly_gap    17810731..17810750
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17858344..17858363
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17871705..17871724
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17969956..17969996
FT                   /estimated_length=41
FT                   /gap_type="unknown"
FT   assembly_gap    17980308..17980518
FT                   /estimated_length=211
FT                   /gap_type="unknown"
FT   assembly_gap    18031069..18031088
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18033109..18033195
FT                   /estimated_length=87
FT                   /gap_type="unknown"
FT   assembly_gap    18105170..18105189
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18151093..18153202
FT                   /estimated_length=2110
FT                   /gap_type="unknown"
FT   assembly_gap    18161540..18161559
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18189357..18191698
FT                   /estimated_length=2342
FT                   /gap_type="unknown"
FT   assembly_gap    18230081..18230160
FT                   /estimated_length=80
FT                   /gap_type="unknown"
FT   assembly_gap    18296091..18296173
FT                   /estimated_length=83
FT                   /gap_type="unknown"
FT   assembly_gap    18318660..18319312
FT                   /estimated_length=653
FT                   /gap_type="unknown"
FT   assembly_gap    18341805..18348445
FT                   /estimated_length=6641
FT                   /gap_type="unknown"
FT   assembly_gap    18353079..18353994
FT                   /estimated_length=916
FT                   /gap_type="unknown"
FT   assembly_gap    18392092..18392471
FT                   /estimated_length=380
FT                   /gap_type="unknown"
FT   assembly_gap    18393419..18393925
FT                   /estimated_length=507
FT                   /gap_type="unknown"
FT   assembly_gap    18411496..18411515
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18413111..18413229
FT                   /estimated_length=119
FT                   /gap_type="unknown"
FT   assembly_gap    18415565..18415632
FT                   /estimated_length=68
FT                   /gap_type="unknown"
FT   assembly_gap    18452250..18454058
FT                   /estimated_length=1809
FT                   /gap_type="unknown"
FT   assembly_gap    18479992..18480094
FT                   /estimated_length=103
FT                   /gap_type="unknown"
FT   assembly_gap    18483141..18483392
FT                   /estimated_length=252
FT                   /gap_type="unknown"
FT   assembly_gap    18495054..18495073
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18497669..18497688
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18500011..18500030
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18510198..18510217
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18553641..18553864
FT                   /estimated_length=224
FT                   /gap_type="unknown"
FT   assembly_gap    18564591..18564610
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18573664..18573683
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18575059..18575078
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18579945..18579964
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18583310..18584175
FT                   /estimated_length=866
FT                   /gap_type="unknown"
FT   assembly_gap    18598181..18600436
FT                   /estimated_length=2256
FT                   /gap_type="unknown"
FT   assembly_gap    18621726..18621787
FT                   /estimated_length=62
FT                   /gap_type="unknown"
FT   assembly_gap    18631093..18631112
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18637001..18637020
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18640797..18640816
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18643077..18643096
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18647954..18647973
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18649852..18649871
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18656463..18657511
FT                   /estimated_length=1049
FT                   /gap_type="unknown"
FT   assembly_gap    18671116..18671203
FT                   /estimated_length=88
FT                   /gap_type="unknown"
FT   assembly_gap    18712551..18712594
FT                   /estimated_length=44
FT                   /gap_type="unknown"
FT   assembly_gap    18738452..18738537
FT                   /estimated_length=86
FT                   /gap_type="unknown"
FT   assembly_gap    18777932..18778006
FT                   /estimated_length=75
FT                   /gap_type="unknown"
FT   assembly_gap    18826975..18830781
FT                   /estimated_length=3807
FT                   /gap_type="unknown"
FT   assembly_gap    18841378..18841397
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18853570..18853589
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18854682..18854701
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18856289..18856308
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18869864..18870051
FT                   /estimated_length=188
FT                   /gap_type="unknown"
FT   assembly_gap    18877193..18877212
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            18881173..18882980
FT                   /pseudo
FT                   /locus_tag="mCG_48852"
FT                   /note="gene_id=mCG48852.2"
FT   mRNA            join(18881173..18881310,18882339..18882520,
FT                   18882641..18882711,18882788..18882980)
FT                   /pseudo
FT                   /locus_tag="mCG_48852"
FT                   /note="gene_id=mCG48852.2 transcript_id=mCT49035.2 created
FT                   on 10-FEB-2003"
FT   assembly_gap    18898078..18899499
FT                   /estimated_length=1422
FT                   /gap_type="unknown"
FT   assembly_gap    18902095..18908758
FT                   /estimated_length=6664
FT                   /gap_type="unknown"
FT   assembly_gap    18912260..18912279
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18913512..18913531
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18918167..18918186
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18920031..18920818
FT                   /estimated_length=788
FT                   /gap_type="unknown"
FT   assembly_gap    18922336..18924671
FT                   /estimated_length=2336
FT                   /gap_type="unknown"
FT   assembly_gap    18931093..18931756
FT                   /estimated_length=664
FT                   /gap_type="unknown"
FT   assembly_gap    18936524..18936543
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18938210..18938229
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18939655..18940977
FT                   /estimated_length=1323
FT                   /gap_type="unknown"
FT   assembly_gap    18957220..18957239
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19026405..19027192
FT                   /estimated_length=788
FT                   /gap_type="unknown"
FT   assembly_gap    19029351..19029370
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19038126..19038284
FT                   /estimated_length=159
FT                   /gap_type="unknown"
FT   assembly_gap    19044164..19044603
FT                   /estimated_length=440
FT                   /gap_type="unknown"
FT   gene            19051182..19278193
FT                   /gene="Cdh20"
FT                   /locus_tag="mCG_3576"
FT                   /note="gene_id=mCG3576.2"
FT   mRNA            join(19051182..19051551,19224497..19224882,
FT                   19231589..19231883,19232642..19232761,19235695..19235862,
FT                   19237827..19238014,19244342..19244595,19254435..19254571,
FT                   19258607..19258728,19262639..19262756,19268220..19268471,
FT                   19277395..19278193)
FT                   /gene="Cdh20"
FT                   /locus_tag="mCG_3576"
FT                   /product="cadherin 20"
FT                   /note="gene_id=mCG3576.2 transcript_id=mCT3226.2 created on
FT                   13-DEC-2002"
FT   assembly_gap    19104868..19104887
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19118906..19118925
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19132434..19132653
FT                   /estimated_length=220
FT                   /gap_type="unknown"
FT   assembly_gap    19160133..19160152
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19162595..19162614
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19190270..19190660
FT                   /estimated_length=391
FT                   /gap_type="unknown"
FT   assembly_gap    19194065..19194216
FT                   /estimated_length=152
FT                   /gap_type="unknown"
FT   assembly_gap    19198296..19199060
FT                   /estimated_length=765
FT                   /gap_type="unknown"
FT   CDS             join(19224637..19224882,19231589..19231883,
FT                   19232642..19232761,19235695..19235862,19237827..19238014,
FT                   19244342..19244595,19254435..19254571,19258607..19258728,
FT                   19262639..19262756,19268220..19268471,19277395..19277900)
FT                   /codon_start=1
FT                   /gene="Cdh20"
FT                   /locus_tag="mCG_3576"
FT                   /product="cadherin 20"
FT                   /note="gene_id=mCG3576.2 transcript_id=mCT3226.2
FT                   protein_id=mCP14537.1"
FT                   /protein_id="EDL39880.1"
FT                   /translation="MWTTGRMSNAKSWLGLGTSLYFWALMDLTATVLSSTPMPEVELET
FT                   LFSGRSQSHQRSKRSWVWNQFFVLEEYTGTDPLYVGKLHSDMDRGDGSIKYILSGEGAG
FT                   IVFTIDDTTGDIHAIQRLDREERAQYTLRAQALDRRTGRPMEPESEFIIKIQDINDNEP
FT                   KFLDGPYIATVPEMSPVGTSVIQVTATDADDPTYGNSARVVYSILQGQPYFSVDSKTGV
FT                   IRTALMNMDREAKEYYEVIIQAKDMGGQLGGLAGTTTVNITLSDVNDNPPRFPQKHYQM
FT                   SVLESAPISSTVGRVFAKDLDEGINAEMKYTIVDGDGADAFDINTDQNFQVGIITVKKP
FT                   LSFESKKSYTLKVEGSNPHLEMRFLNLGPFQDTTTVHISVEDVDEPPVFEPGFYFVEVP
FT                   EDVTIGTTIQIISAKDPDVTNNSIRYSIDRGSDPGRFFYVDITTGALMTARPLDREEFS
FT                   WHNITVLAMEMNNPSQVGSVAVTIKVLDVNDNAPEFPRFYEAFICENAKAGQLIQTVSA
FT                   VDQDDPHNGQHFYYSLAPEAANNPNFTVRDNQDNTARILTRRSGFRQQEQSVFYLPILI
FT                   ADSGQPVLSSTGTLTIQVCSCNDDGHVMSCSPEAYLLPVSLSRGALIAILACIFVLLVL
FT                   VLLILSMRRHRKQPYIIDDDENIHENIVRYDDEGGGEEDTEAFDIAAMWNPREAQAGAA
FT                   PKTRQDMLPEIESLSRYVPQTCAVSSTVHSYVLAKLYEADMDLWAPPFDSLQTYMFEGD
FT                   GSVAGSLSSLQSATSDSEQSFDFLTDWGPRFRKLAELYGASEGPAPLW"
FT   assembly_gap    19232881..19232900
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19249773..19250004
FT                   /estimated_length=232
FT                   /gap_type="unknown"
FT   assembly_gap    19260862..19260881
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            19263230..19265707
FT                   /locus_tag="mCG_148392"
FT                   /note="gene_id=mCG148392.0"
FT   mRNA            join(19263230..19263263,19263316..19265707)
FT                   /locus_tag="mCG_148392"
FT                   /product="mCG148392"
FT                   /note="gene_id=mCG148392.0 transcript_id=mCT188655.0
FT                   created on 13-JAN-2004"
FT   CDS             19264144..19264380
FT                   /codon_start=1
FT                   /locus_tag="mCG_148392"
FT                   /product="mCG148392"
FT                   /note="gene_id=mCG148392.0 transcript_id=mCT188655.0
FT                   protein_id=mCP108676.0"
FT                   /protein_id="EDL39881.1"
FT                   /translation="MTVYHKGCLFLAHPLPIWCASNTLLVRAGRGLWIKPRALNMLGKP
FT                   PTTKQYPHSAPFSPLSFYLAFREQISLSKLTGL"
FT   assembly_gap    19280696..19280925
FT                   /estimated_length=230
FT                   /gap_type="unknown"
FT   assembly_gap    19299991..19310465
FT                   /estimated_length=10475
FT                   /gap_type="unknown"
FT   assembly_gap    19317338..19319362
FT                   /estimated_length=2025
FT                   /gap_type="unknown"
FT   assembly_gap    19361819..19361888
FT                   /estimated_length=70
FT                   /gap_type="unknown"
FT   assembly_gap    19365132..19365151
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19386061..19386080
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            19388102..19399019
FT                   /locus_tag="mCG_1047867"
FT                   /note="gene_id=mCG1047867.1"
FT   mRNA            join(19388102..19388147,19394507..19394749,
FT                   19398840..19399019)
FT                   /locus_tag="mCG_1047867"
FT                   /product="mCG1047867"
FT                   /note="gene_id=mCG1047867.1 transcript_id=mCT165571.1
FT                   created on 14-MAR-2003"
FT   CDS             join(19394742..19394749,19398840..19398954)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1047867"
FT                   /product="mCG1047867"
FT                   /note="gene_id=mCG1047867.1 transcript_id=mCT165571.1
FT                   protein_id=mCP81578.1"
FT                   /protein_id="EDL39879.1"
FT                   /translation="MQKMLSTWIGSPPKGRICPCLSYQAQSSMDSRHNVSSRSL"
FT   assembly_gap    19401702..19401721
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19402888..19402907
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19412276..19412295
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19417372..19417391
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19428377..19428396
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19455343..19455362
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19464403..19464422
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19467226..19467245
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19552533..19552608
FT                   /estimated_length=76
FT                   /gap_type="unknown"
FT   gene            complement(19553556..>19632544)
FT                   /gene="Rnf152"
FT                   /locus_tag="mCG_146137"
FT                   /note="gene_id=mCG146137.0"
FT   mRNA            complement(join(19553556..19558565,19630908..19631030,
FT                   19632216..>19632544))
FT                   /gene="Rnf152"
FT                   /locus_tag="mCG_146137"
FT                   /product="ring finger protein 152"
FT                   /note="gene_id=mCG146137.0 transcript_id=mCT186240.0
FT                   created on 14-JUL-2003"
FT   CDS             complement(19557830..>19558501)
FT                   /codon_start=1
FT                   /gene="Rnf152"
FT                   /locus_tag="mCG_146137"
FT                   /product="ring finger protein 152"
FT                   /note="gene_id=mCG146137.0 transcript_id=mCT186240.0
FT                   protein_id=mCP107673.0"
FT                   /protein_id="EDL39878.1"
FT                   /translation="HLRTGFSSFLLVLPFDSWSAMETLSQDSLLECQICFNYYSPRRRP
FT                   KLLDCKHTCCSVCLQQMRTSQKDVRCPWCRGITKLPPGFSVSQLPDDPEVLAVIAIPHT
FT                   SEHTPVFIKLPSNGCYMLPLPISKERTLLPGDMGCRLLPGSQQKSLTVVTIPAEQQPLQ
FT                   GGAPPEAVEEEPDRRGVVKSSTWSGVCTVILVACVLVFLLGIVLHNMSCISKRFTVISC
FT                   G"
FT   assembly_gap    19581438..19581457
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19583625..19583644
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            19631878..19637492
FT                   /locus_tag="mCG_1047862"
FT                   /note="gene_id=mCG1047862.1"
FT   mRNA            join(19631878..19633122,19637461..19637492)
FT                   /locus_tag="mCG_1047862"
FT                   /product="mCG1047862"
FT                   /note="gene_id=mCG1047862.1 transcript_id=mCT165566.1
FT                   created on 21-JAN-2003"
FT   CDS             19631950..19632312
FT                   /codon_start=1
FT                   /locus_tag="mCG_1047862"
FT                   /product="mCG1047862"
FT                   /note="gene_id=mCG1047862.1 transcript_id=mCT165566.1
FT                   protein_id=mCP81509.1"
FT                   /protein_id="EDL39877.1"
FT                   /translation="MTPSRSQLKAMPEENPTPGTTSSRDASPAPHSFNQTNHPNHSPGR
FT                   TSSYIPGYRCPFPLSPRHSLPRESPLHPGPGSTLNRKTNRNSLTSLSSRLGSVTPPAAA
FT                   ATSEASRGSALPAALC"
FT   assembly_gap    19658828..19658847
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19659819..19659838
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19664268..19664764
FT                   /estimated_length=497
FT                   /gap_type="unknown"
FT   assembly_gap    19672091..19672110
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19674102..19674205
FT                   /estimated_length=104
FT                   /gap_type="unknown"
FT   assembly_gap    19679447..19679466
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19708723..19708827
FT                   /estimated_length=105
FT                   /gap_type="unknown"
FT   assembly_gap    19715969..19717039
FT                   /estimated_length=1071
FT                   /gap_type="unknown"
FT   assembly_gap    19719668..19719687
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            19732796..19733816
FT                   /locus_tag="mCG_50956"
FT                   /note="gene_id=mCG50956.2"
FT   mRNA            19732796..19733816
FT                   /locus_tag="mCG_50956"
FT                   /product="mCG50956"
FT                   /note="gene_id=mCG50956.2 transcript_id=mCT51139.2 created
FT                   on 30-JAN-2003"
FT   CDS             19732808..19733668
FT                   /codon_start=1
FT                   /locus_tag="mCG_50956"
FT                   /product="mCG50956"
FT                   /note="gene_id=mCG50956.2 transcript_id=mCT51139.2
FT                   protein_id=mCP33711.1"
FT                   /protein_id="EDL39876.1"
FT                   /translation="MADFEDRVSDEEKVRIAAKFITHAPPGEFNEVFNDVRLLLNNDNL
FT                   LREGAAHAFAQYNMDQFTPVKIEGYDDQVLITEHGDLGNSRFLDPRNQISFKFDHLRKE
FT                   ASDPQPEDVDGGLKSWRESCDSALRAYVKDHYSNGFCTVYAKTIDGQQTIIACIESHQF
FT                   QPKNFWNGRWRSEWKFTITPPSAQVVGVLKIQVHYYEDGNVQLVSHKDVQDSVTVSNEV
FT                   QTTKEFIKIIESAENEYQTAISENYQTMSDTAFKALRRQLPVTRTKIDWNKILSYKIGK
FT                   EMQNA"
FT   assembly_gap    19734312..19734331
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19736311..19736463
FT                   /estimated_length=153
FT                   /gap_type="unknown"
FT   assembly_gap    19745459..19745478
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19751655..19751674
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19752815..19752834
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19754100..19754547
FT                   /estimated_length=448
FT                   /gap_type="unknown"
FT   assembly_gap    19755938..19755957
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19762006..19762298
FT                   /estimated_length=293
FT                   /gap_type="unknown"
FT   assembly_gap    19766651..19766955
FT                   /estimated_length=305
FT                   /gap_type="unknown"
FT   assembly_gap    19784655..19785140
FT                   /estimated_length=486
FT                   /gap_type="unknown"
FT   gene            complement(19797865..19934428)
FT                   /gene="Pign"
FT                   /locus_tag="mCG_16111"
FT                   /note="gene_id=mCG16111.1"
FT   mRNA            complement(join(19797865..19798850,19824049..19824101,
FT                   19826450..19826492,19829753..19829826,19831445..19831520,
FT                   19831825..19831880,19835014..19835100,19835539..19835641,
FT                   19843707..19843809,19851558..19851666,19857395..19857503,
FT                   19860386..19860477,19861455..19861547,19861632..19861731,
FT                   19864028..19864167,19870082..19870264,19871463..19871541,
FT                   19906211..19906266,19906884..19906976,19909366..19909425,
FT                   19913180..19913220,19917454..19917570,19918865..19918995,
FT                   19920039..19920163,19923860..19923966,19926690..19926788,
FT                   19927429..19927550,19928365..19928613,19929653..19929772,
FT                   19930059..19930132,19934266..19934428))
FT                   /gene="Pign"
FT                   /locus_tag="mCG_16111"
FT                   /product="phosphatidylinositol glycan anchor biosynthesis,
FT                   class N"
FT                   /note="gene_id=mCG16111.1 transcript_id=mCT15473.1 created
FT                   on 12-DEC-2002"
FT   CDS             complement(join(19798727..19798850,19824049..19824101,
FT                   19826450..19826492,19829753..19829826,19831445..19831520,
FT                   19831825..19831880,19835014..19835100,19835539..19835641,
FT                   19843707..19843809,19851558..19851666,19857395..19857503,
FT                   19860386..19860477,19861455..19861547,19861632..19861731,
FT                   19864028..19864167,19870082..19870264,19871463..19871541,
FT                   19906211..19906266,19906884..19906976,19909366..19909425,
FT                   19913180..19913220,19917454..19917570,19918865..19918995,
FT                   19920039..19920163,19923860..19923966,19926690..19926788,
FT                   19927429..19927550,19928365..19928585))
FT                   /codon_start=1
FT                   /gene="Pign"
FT                   /locus_tag="mCG_16111"
FT                   /product="phosphatidylinositol glycan anchor biosynthesis,
FT                   class N"
FT                   /note="gene_id=mCG16111.1 transcript_id=mCT15473.1
FT                   protein_id=mCP11932.2"
FT                   /db_xref="GOA:G3X9F1"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR007070"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR017852"
FT                   /db_xref="MGI:MGI:1351629"
FT                   /db_xref="UniProtKB/TrEMBL:G3X9F1"
FT                   /protein_id="EDL39874.1"
FT                   /translation="MLLFFALGLLIHFVFFASIFDIYFTSPLVHGMTPQFTPLPPPAKR
FT                   LVLFVADGLRADTLYELDEDGNSRAPFIRNVIMHEGSWGVSHTRVPTESRPGHVALIAG
FT                   FYEDVSAVAKGWKENPVEFDSLFNESKYTWSWGSPDILPMFAKGASGDHVYTYSYDAQR
FT                   EDFGAHDATKLDTWVFDKVKDFFDAARNNQSLFTKVNEEKVVFFLHLLGIDTNGHAHRP
FT                   SSREYKDNIKKVDDGVKEIVSIFKHFYGDDGKTAFIFTSDHGMTDWGSHGAGHPSETLT
FT                   PFVTWGAGIKFPQNVSAQQYDDEFLKEWRLENWKRRDVNQADIAPLMASLIGVPFPLNS
FT                   VGILPVGYLNNTGLFKAESMFTNAVQILEQFKVKMTQKKEATLPFLFTPFKLLSDSQQL
FT                   DILRKARSYIKQEKFDEVVSLCEELIDLALRGLSYYHTYDRLFLGINVAVGFVGWMSYT
FT                   SLLIIKSHSNIPKGTRKEGKKPHCLLLYSFIATGVLVACFLMIQACPWTYYVYCLLPVP
FT                   IWYAVLREHEVIQDLVESLLTFPRSHFVAYLLVFTLGIEVLVLSFFYRYMLTAGLIVFA
FT                   GWPFLTQLWTRAKITFLSWAFFSLLLAVFPLMPVVGRKPNLSLVMGAGFLVLLLSLAVV
FT                   TTLGKRNIKLVKGELLVLLLQMLSTVLSMYVVYSTHHSLLKKEGLPLMNQIVSWATLAS
FT                   SLVAPLLSSTALSQRLASILLSLMSTYLLLSTGYEALFPLVLSCLMFVWIQVEQETLQQ
FT                   PGVSCKQKLTSIQFTCDTDIAQFRQLCPDDIRRAFFLVFFLLTAFFGTGNIASINSFDL
FT                   ASVYCFLTVFSPFMMGALMMWKILIPFVLVMCAFEAVQITTQLSSKGLFLVVLIISDIM
FT                   ALHFFFLVKDSGSWLDIGTSISHYVIVMSMTIFLVFLNGLAQLLTTKKLQLCGKPKSHL
FT                   M"
FT   assembly_gap    19806807..19806826
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19821356..19821443
FT                   /estimated_length=88
FT                   /gap_type="unknown"
FT   assembly_gap    19833847..19833998
FT                   /estimated_length=152
FT                   /gap_type="unknown"
FT   gene            complement(19846269..19847583)
FT                   /locus_tag="mCG_148368"
FT                   /note="gene_id=mCG148368.0"
FT   mRNA            complement(19846269..19847583)
FT                   /locus_tag="mCG_148368"
FT                   /product="mCG148368"
FT                   /note="gene_id=mCG148368.0 transcript_id=mCT188631.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(19847100..19847207)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148368"
FT                   /product="mCG148368"
FT                   /note="gene_id=mCG148368.0 transcript_id=mCT188631.0
FT                   protein_