spacer

EBI Dbfetch

ID   CH236953; SV 1; linear; genomic DNA; CON; HUM; 3998513 BP.
XX
AC   CH236953;
XX
PR   Project:PRJNA10793;
XX
DT   05-JUL-2005 (Rel. 84, Created)
DT   06-JUL-2005 (Rel. 84, Last updated, Version 2)
XX
DE   Homo sapiens chromosome 7 Scaffold08, whole genome shotgun sequence.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3998513
RX   DOI; 10.1126/science.1083423.
RX   PUBMED; 12690205.
RA   Scherer S.W., Cheung J., MacDonald J.R., Osborne L.R., Nakabayashi K.,
RA   Herbrick J.A., Carson A.R., Parker-Katiraee L., Skaug J., Khaja R.,
RA   Zhang J., Hudek A.K., Li M., Haddad M., Duggan G.E., Fernandez B.A.,
RA   Kanematsu E., Gentles S., Christopoulos C.C., Choufani S., Kwasnicka D.,
RA   Zheng X.H., Lai Z., Nusskern D., Zhang Q., Gu Z., Lu F., Zeesman S.,
RA   Nowaczyk M.J., Teshima I., Chitayat D., Shuman C., Weksberg R.,
RA   Zackai E.H., Grebe T.A., Cox S.R., Kirkpatrick S.J., Rahman N.,
RA   Friedman J.M., Heng H.H., Pelicci P.G., Lo-Coco F., Belloni E.,
RA   Shaffer L.G., Pober B., Morton C.C., Gusella J.F., Bruns G.A., Korf B.R.,
RA   Quade B.J., Ligon A.H., Ferguson H., Higgins A.W., Leach N.T.,
RA   Herrick S.R., Lemyre E., Farra C.G., Kim H.G., Summers A.M., Gripp K.W.,
RA   Roberts W., Szatmari P., Winsor E.J., Grzeschik K.H., Teebi A.,
RA   Minassian B.A., Kere J., Armengol L., Pujana M.A., Estivill X.,
RA   Wilson M.D., Koop B.F., Tosi S., Moore G.E., Boright A.P., Zlotorynski E.,
RA   Kerem B., Kroisel P.M., Petek E., Oscier D.G., Mould S.J., Dohner H.,
RA   Dohner K., Rommens J.M., Vincent J.B., Venter J.C., Li P.W., Mural R.J.,
RA   Adams M.D., Tsui L.C.;
RT   "Human chromosome 7: DNA sequence and biology";
RL   Science 300(5620):767-772(2003).
XX
RN   [2]
RP   1-3998513
RA   Scherer S.W., Cheung J., MacDonald J.R., Osborne L.R., Nakabayashi K.,
RA   Herbrick J.-A., Carson A.R., Parker-Katiraee L., Skaug J., Khaja R.,
RA   Zhang J., Hudek A.K., Li M., Haddad M., Duggan G.E., Fernandez B.A.,
RA   Kanematsu E., Gentles S., Christopoulos C.C., Choufani S., Kwasnicka D.,
RA   Zheng X.H., Nusskern D., Zhang Q., Gu Z., Lu F., Zeesman S., Teshima I.,
RA   Chitayat D., Shuman C., Weksberg R., Zackai E.H., Grebe T.A., Cox S.R.,
RA   Kirkpatrick S.J., Rahman N., Friedman J.M., Heng H.H.Q., Pelicci P.,
RA   Lococo F., Belloni E., Shaffer L.G., Morton C.C., Pober B., Gusella J.,
RA   Bruns G., Korf B.R., Quade B.J., Ligon A.H., Ferguson H., Higgins A.W.,
RA   Leach N.T., Herrick S.R., Lemyre E., Farra C.G., Kim H.-G., Summers A.M.,
RA   Gripp K.W., Roberts W., Szatmari P., Winsor E.J.T., Grzeschik K.-H.,
RA   Teebi A., Minassian B.A., Kere J., Armengol L., Pujana M.Angel.,
RA   Estivill X., Wilson M.D., Koop B.F., Tosi S., Moore G.E., Boright A.P.,
RA   Zlotorynski E., Kerem B., Kroisel P.M., Petek E., Oscier D.G., Mould S.J.,
RA   Doehner H., Doehner K., Rommens J.M., Vincent J.B., Venter J.C., Li P.W.,
RA   Mural R.J., Adams M.D., Tsui L.-C.;
RT   ;
RL   Submitted (29-JUN-2004) to the INSDC.
RL   Department of Genetics and Genomic Biology, The Hospital for Sick Children,
RL   555 University Avenue, Toronto, Ontario M5G 1X8, Canada
XX
DR   MD5; 1220a7945083761195e65b7431b9ba22.
DR   ENA; AACC020000000; SET.
DR   ENA; AACC000000000; SET.
DR   Ensembl-Gn; ENSG00000106009; homo_sapiens.
DR   Ensembl-Gn; ENSG00000106263; homo_sapiens.
DR   Ensembl-Gn; ENSG00000106266; homo_sapiens.
DR   Ensembl-Gn; ENSG00000106268; homo_sapiens.
DR   Ensembl-Gn; ENSG00000136213; homo_sapiens.
DR   Ensembl-Gn; ENSG00000136295; homo_sapiens.
DR   Ensembl-Gn; ENSG00000146535; homo_sapiens.
DR   Ensembl-Gn; ENSG00000157778; homo_sapiens.
DR   Ensembl-Gn; ENSG00000157927; homo_sapiens.
DR   Ensembl-Gn; ENSG00000164850; homo_sapiens.
DR   Ensembl-Gn; ENSG00000164853; homo_sapiens.
DR   Ensembl-Gn; ENSG00000164880; homo_sapiens.
DR   Ensembl-Gn; ENSG00000174945; homo_sapiens.
DR   Ensembl-Gn; ENSG00000178381; homo_sapiens.
DR   Ensembl-Gn; ENSG00000198286; homo_sapiens.
DR   Ensembl-Gn; ENSG00000198517; homo_sapiens.
DR   Ensembl-Gn; ENSG00000217455; homo_sapiens.
DR   Ensembl-Gn; ENSG00000218823; homo_sapiens.
DR   Ensembl-Gn; ENSG00000242802; homo_sapiens.
DR   Ensembl-Tr; ENST00000222990; homo_sapiens.
DR   Ensembl-Tr; ENST00000252329; homo_sapiens.
DR   Ensembl-Tr; ENST00000258711; homo_sapiens.
DR   Ensembl-Tr; ENST00000258796; homo_sapiens.
DR   Ensembl-Tr; ENST00000275364; homo_sapiens.
DR   Ensembl-Tr; ENST00000288607; homo_sapiens.
DR   Ensembl-Tr; ENST00000297469; homo_sapiens.
DR   Ensembl-Tr; ENST00000312371; homo_sapiens.
DR   Ensembl-Tr; ENST00000316333; homo_sapiens.
DR   Ensembl-Tr; ENST00000316495; homo_sapiens.
DR   Ensembl-Tr; ENST00000339737; homo_sapiens.
DR   Ensembl-Tr; ENST00000340611; homo_sapiens.
DR   Ensembl-Tr; ENST00000343242; homo_sapiens.
DR   Ensembl-Tr; ENST00000343985; homo_sapiens.
DR   Ensembl-Tr; ENST00000348624; homo_sapiens.
DR   Ensembl-Tr; ENST00000356714; homo_sapiens.
DR   Ensembl-Tr; ENST00000360876; homo_sapiens.
DR   Ensembl-Tr; ENST00000389470; homo_sapiens.
DR   Ensembl-Tr; ENST00000396946; homo_sapiens.
DR   Ensembl-Tr; ENST00000397011; homo_sapiens.
DR   Ensembl-Tr; ENST00000397046; homo_sapiens.
DR   Ensembl-Tr; ENST00000397048; homo_sapiens.
DR   Ensembl-Tr; ENST00000397049; homo_sapiens.
DR   Ensembl-Tr; ENST00000397088; homo_sapiens.
DR   Ensembl-Tr; ENST00000397092; homo_sapiens.
DR   Ensembl-Tr; ENST00000399583; homo_sapiens.
DR   Ensembl-Tr; ENST00000401670; homo_sapiens.
DR   Ensembl-Tr; ENST00000401903; homo_sapiens.
DR   Ensembl-Tr; ENST00000402115; homo_sapiens.
DR   Ensembl-Tr; ENST00000403150; homo_sapiens.
DR   Ensembl-Tr; ENST00000403167; homo_sapiens.
DR   Ensembl-Tr; ENST00000403226; homo_sapiens.
DR   Ensembl-Tr; ENST00000404674; homo_sapiens.
DR   Ensembl-Tr; ENST00000404991; homo_sapiens.
DR   Ensembl-Tr; ENST00000406174; homo_sapiens.
DR   Ensembl-Tr; ENST00000407643; homo_sapiens.
XX
CC   Annotation of this scaffold was determined by mapping RefSeq genes
CC   and proteins using BLAT.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3998513
FT                   /organism="Homo sapiens"
FT                   /chromosome="7"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            12304..19215
FT                   /gene="GPR30"
FT                   /locus_tag="tcag7.527"
FT   mRNA            join(12304..12672,16807..18589,18592..19215)
FT                   /gene="GPR30"
FT                   /locus_tag="tcag7.527"
FT                   /product="G protein-coupled receptor 30"
FT                   /note="NM_001505.1"
FT   CDS             17129..18256
FT                   /codon_start=1
FT                   /gene="GPR30"
FT                   /locus_tag="tcag7.527"
FT                   /product="G protein-coupled receptor 30"
FT                   /note="NP_001496.1"
FT                   /db_xref="GOA:Q99527"
FT                   /db_xref="HGNC:HGNC:4485"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q99527"
FT                   /protein_id="EAL23938.1"
FT                   /translation="MDVTSQARGVGLEMYPGTAQPAAPNTTSPELNLSHPLLGTALANG
FT                   TGELSEHQQYVIGLFLSCLYTIFLFPIGFVGNILILVVNISFREKMTIPDLYFINLAVA
FT                   DLILVADSLIEVFNLHERYYDIAVLCTFMSLFLQVNMYSSVFFLTWMSFDRYIALARAM
FT                   RCSLFRTKHHARLSCGLIWMASVSATLVPFTAVHLQHTDEACFCFADVREVQWLEVTLG
FT                   FIVPFAIIGLCYSLIVRVLVRAHRHRGLRPRRQKALRMILAVVLVFFVCWLPENVFISV
FT                   HLLQRTQPGAAPCKQSFRHAHPLTGHIVNLAAFSNSCLNPLIYSFLGETFRDKLRLYIE
FT                   QKTNLPALNRFCHAALKAVIPDSTEQSDVRFSSAV"
FT   gene            complement(77143..83991)
FT                   /gene="LOC90637"
FT                   /locus_tag="tcag7.529"
FT   mRNA            complement(join(77143..77460,79689..79820,81700..81794,
FT                   82202..82301,83793..83991))
FT                   /gene="LOC90637"
FT                   /locus_tag="tcag7.529"
FT                   /product="hypothetical protein LOC90637"
FT                   /note="NM_182491.1"
FT   CDS             complement(join(77305..77460,79689..79820,81700..81794,
FT                   82202..82256))
FT                   /codon_start=1
FT                   /gene="LOC90637"
FT                   /locus_tag="tcag7.529"
FT                   /product="hypothetical protein LOC90637"
FT                   /note="NP_872297.1"
FT                   /db_xref="GOA:Q8N6M9"
FT                   /db_xref="HGNC:HGNC:28073"
FT                   /db_xref="InterPro:IPR000058"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8N6M9"
FT                   /protein_id="EAL23939.1"
FT                   /translation="MEFPDLGKHCSEKTCKQLDFLPVKCDACKQDFCKDHFPYAAHKCP
FT                   FAFQKDVHVPVCPLCNTPIPVKKGQIPDVVVGDHIDRDCDSHPGKKKEKIFTYRCSKEG
FT                   CKKKEMLQMVCAQCHGNFCIQHRHPLDHSCRHGSRPTIKAG"
FT   gene            100187..160335
FT                   /gene="LOC340260"
FT                   /locus_tag="tcag7.1272"
FT   mRNA            join(100187..100339,134903..135048,135314..135455,
FT                   156855..157087,157181..157355,159489..159580,
FT                   160242..160335)
FT                   /gene="LOC340260"
FT                   /locus_tag="tcag7.1272"
FT                   /product="similar to Unc4.1 homeobox"
FT                   /note="XM_294209.4"
FT   CDS             join(100187..100339,134903..135048,135314..135455,
FT                   156855..157087,157181..157355,159489..159580,
FT                   160242..160335)
FT                   /codon_start=1
FT                   /gene="LOC340260"
FT                   /locus_tag="tcag7.1272"
FT                   /product="similar to Unc4.1 homeobox"
FT                   /note="XP_294209.4"
FT                   /db_xref="GOA:A6NJT0"
FT                   /db_xref="HGNC:HGNC:33194"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017970"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6NJT0"
FT                   /protein_id="EAL23940.1"
FT                   /translation="MSVSSLSINGSVDPRPAVPEVSGISFEGGCRVLSCKAQAHRDSLH
FT                   ALWFGEPEHRRQDRARLWGEKPSPGSQTEAALPFGLIQLRQRLPVVPRITRSTASAKER
FT                   LPDLRLVIAAADPGARVGSSCLGISAGIHLGEATGRELRSHEQFGGSLGGVVGFPYPLG
FT                   HHHVYELAGHQLQSAAAAAMCPSPSTACSGARAPPPPRCQPHAAAASRLRGRRGRPALQ
FT                   AVRLGGPGQGEPGLQRRRTRTNFTGWQLEELEKAFNESHYPDVFMREVRPVPQHLVESR
FT                   VQVWFQNRRAKWRKKENTKKGPGRPAHNSHPTTPAEEPATCGVPEPGAAAGPSPPEGEE
FT                   LDMD"
FT   gene            complement(357711..382822)
FT                   /gene="FLJ23471"
FT                   /locus_tag="tcag7.552"
FT   mRNA            complement(join(357711..358017,358446..358492,
FT                   360087..360201,360880..360953,361235..361325,
FT                   361442..361565,361634..361698,362185..362340,
FT                   363272..363432,363938..364031,365539..365831,
FT                   368000..368701,382595..382784,382786..382822))
FT                   /gene="FLJ23471"
FT                   /locus_tag="tcag7.552"
FT                   /product="MICAL-like 2"
FT                   /note="NM_024723.1"
FT   mRNA            complement(join(357711..358017,358446..358492,
FT                   360087..360201,360880..360953,361235..361325,
FT                   361442..361565,361634..361698,362185..362340,
FT                   363272..363432,363938..364031,365539..365831,
FT                   368000..368776,370061..370176,370923..371113,
FT                   371968..372109,373587..373635,382532..382784,
FT                   382786..382799))
FT                   /gene="FLJ23471"
FT                   /locus_tag="tcag7.552"
FT                   /product="MICAL-like 2"
FT                   /note="NM_182924.1"
FT   gene            complement(393928..429262)
FT                   /gene="DKFZP586J0619"
FT                   /locus_tag="tcag7.531"
FT   mRNA            complement(join(393928..394043,394197..394306,
FT                   394484..394575,394922..394992,395624..395737,
FT                   396423..396535,396917..397044,397519..397711,
FT                   398058..398191,399301..399424,399582..399808,
FT                   399908..400010,400147..400271,400903..401026,
FT                   401106..401166,401168..401290,401720..401860,
FT                   402080..402223,402225..402240,402787..403041,
FT                   403674..403798,404192..404314,404612..404845,
FT                   405903..406064,407099..407210,407360..407527,
FT                   408455..408559,408647..408883,409982..410131,
FT                   410279..410458,410677..410787,410789..410807,
FT                   411073..411315,412753..412813,413000..413091,
FT                   416419..416515,417163..417320,418225..418302,
FT                   418842..418962,419565..419673,420547..420723,
FT                   421821..421962,422116..422261,422384..422570,
FT                   422664..422769,422882..423041,423293..423430,
FT                   423579..423775,426310..426600,427312..427410,
FT                   427732..428016,429205..429262))
FT                   /gene="DKFZP586J0619"
FT                   /locus_tag="tcag7.531"
FT                   /product="DKFZP586J0619 protein"
FT                   /note="XM_291222.4"
FT   mRNA            complement(join(393928..394043,394197..394306,
FT                   394484..394575,394922..394992,395624..395737,
FT                   396423..396535,396917..397044,397519..397711,
FT                   398058..398191,399301..399424,399582..399808,
FT                   399908..400010,400147..400271,400903..401026,
FT                   401122..401290,401720..401860,402080..402240,
FT                   402749..403041,403674..403798,404192..404314,
FT                   404612..404845,405903..406064,407099..407210,
FT                   407360..407527,408455..408559,408647..408883,
FT                   409982..410131,410279..410458,410677..410807,
FT                   411056..411315,412753..412813,413000..413091,
FT                   416419..416515,417163..417320,418225..418302,
FT                   418842..418962,419565..419673,420547..420723,
FT                   421821..421962,422116..422261,422384..422570,
FT                   422664..422769,422882..423041,423293..423430,
FT                   423579..423775,426310..426600,427312..427410,
FT                   427732..428016,429205..429262))
FT                   /gene="DKFZP586J0619"
FT                   /locus_tag="tcag7.531"
FT                   /product="DKFZP586J0619 protein"
FT                   /note="XM_379767.1"
FT   CDS             complement(join(393928..394043,394197..394306,
FT                   394484..394575,394922..394992,395624..395737,
FT                   396423..396535,396917..397044,397519..397711,
FT                   398058..398191,399301..399424,399582..399808,
FT                   399908..400010,400147..400271,400903..401026,
FT                   401106..401166,401168..401290,401720..401860,
FT                   402080..402223,402225..402240,402787..403041,
FT                   403674..403798,404192..404314,404612..404845,
FT                   405903..406064,407099..407210,407360..407527,
FT                   408455..408559,408647..408883,409982..410131,
FT                   410279..410458,410677..410787,410789..410807,
FT                   411073..411315,412753..412813,413000..413091,
FT                   416419..416515,417163..417320,418225..418302,
FT                   418842..418962,419565..419673,420547..420723,
FT                   421821..421962,422116..422261,422384..422570,
FT                   422664..422769,422882..423041,423293..423430,
FT                   423579..423775,426310..426600,427312..427410,
FT                   427732..428016,429205..429262))
FT                   /codon_start=1
FT                   /gene="DKFZP586J0619"
FT                   /locus_tag="tcag7.531"
FT                   /product="DKFZP586J0619 protein"
FT                   /note="XP_291222.3"
FT                   /db_xref="HGNC:HGNC:24555"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR022145"
FT                   /db_xref="UniProtKB/TrEMBL:A4D212"
FT                   /protein_id="EAL23941.1"
FT                   /translation="MWLSGKSQVQKRGAVRYLQAPPVNGEASACPAPPTHLDRTTCARR
FT                   RPARLPPPWGAAGIRPAPRASRASFWARFPPHCFPSGCSGSRVLEGGEIGFRFRGGRVA
FT                   AAALRSRWARGDAAAAGSREGRGRMNRAKPTTVRRPSAAAKPSGHPPPGDFIALGSKGQ
FT                   ANESKTASTLLKPAPSGLPSERKRDAAAALSSASALTGLTKRPKLSSTPPLSALGRLAE
FT                   AAVAEKRAISPSIKEPSVVPIEVLPTVLLDEIEAAELEGNDDRIEGVLCGAVKQLKVTR
FT                   AKPDSTLYLSLMYLAKIKPNIFATEGVIEALCSLLRRDASINFKAKGNSLVSVLACNLL
FT                   MAAYEEDENWPEIFVKVYIEDSLGERIWVDSPHCKTFVDNIQTAFNTRMPPRSVLLQGE
FT                   AGRVAGDLGAGSSPHPSLTEEEDSQTELLIAEEKLSPEQEGQLMPRYEELAESVEEYVL
FT                   DMLRDQLNRRQPIDNVSRNLLRLLTSTCGYKEVRLLAVQKLEMWLQNPKLTRPAQDLLM
FT                   SVCMNCNTHGSEDMDVISHLIKIRLKPKVLLNHFMLCIRELLSAHKDNLGTTIKLVIFN
FT                   ELSSARNPNNMQVLYTALQHSSELAPKFLAMVFQDLLTNKDDYLRASRALLREIIKQTK
FT                   HEINFQAFCLGLMQERKEPQYLEMEFKERFVVHITDVLAVSMMLGITAQVKEAGIAWDK
FT                   GEKRNLEVLRSFQNQIAAIQRDAVWWLHTVVPSISKLAPKDYVHCLHKVLFTEQPETYY
FT                   KWDNWPPESDRNFFLRLCSEVPILEDTLMRILVIGLSRELPLGPADAMELADHLVKRAA
FT                   AVQADDVEVLKVGRTQLIDAVLNLCTYHHPENIQLPPGYQPPNLAISTLYWKAWPLLLV
FT                   VAAFNPENIGLAAWEEYPTLKMLMEMVMTNNYSYPPCTLTDEETRTEMLNRELQTAQRE
FT                   KQEILAFEGHLAAASTKQTITESSSLLLSQLTSLDPQYAAHTAPPCACRRDLGPPRRPP
FT                   PHILDQVKSLNQSLRLGHLLCRSRNPDFLLHIIQRQASSQSMPWLADLVQSSEGSLDVL
FT                   PVQCLCEFLLHDAVDDAASGEEDDEGESKEQKAKKRQRQQKQRQLLGRLQDLLLGPKAD
FT                   EQTTCEVLDYFLRRLGSSQVASRVLAMKGETLPALPKAGPAHECLPQGLSLVLSEGSLR
FT                   DGEEKEPPMEEDVGDTDVLQGYQWLLRDLPRLPLFDSVRSTTALALQQAIHMETDPQTI
FT                   SAYLIYLSQHTPVEEQAQHSDLALDVARLVVERSTIMSHLFSKLSPSAASDAVLSALLS
FT                   IFSRYVRRMRQSKEGEEVYSWSESQDQVFLRWSSGETATMHILVVHAMVILLTLGPPRA
FT                   DDSEFQALLDIWFPEEKPLPTAFLVDTSEEALLLPDWLKLRMIRSEVLRLVDAALQDLE
FT                   PQQLLLFVQSFGIPVSSMSKLLQFLDQAVAHDPQTLEQNIMDKSKMPGTCGVGSHTLTE
FT                   PQPGQAFGAWVRAGVTLLRFADYMAHLVEVQHERGASGGQTFHSLLTASLPPRRDSTEA
FT                   PKPKSSPEQPIGQGRIRVGTQLRVLGPEDDLAGMFLQIFPLSPDPRWQSSSPRPVALAL
FT                   QQALGQELARVVQGSPEVPGITVRVLQALATLLSSPHGGALVMSMHRSHFLACPLLRQL
FT                   CQYQRCVPQDTGFSSLFLKVLLQMLQWLDSPGVEGGPLRAQLRMLASQASAGRRLSDVR
FT                   GGLLRLAEALAFRQDLEVVSSTVRAVIATLRSGEQCSVEPDLISKVLQGLIEVRSPHLE
FT                   ELLTAFFSATADAASPFPACKPVVVVSSLLLQEEEPLAGGKPGADGGSLEAVRLGPSSG
FT                   LLVDWLEMLDPEVVSSCPDLQLRLLFSRRKGKGQAQVPSFRPYLLTLFTHQSSWPTLHQ
FT                   CIRVLLGKSREQRFDPSASLDFLWACIHVPRIWQGRDQRTPQAGLGRKRREELVLRVQG
FT                   PELISLVELILAEAETRSQDGDTAACSLIQARLPLLLSCCCGDDESVRKVTEHLSGCIQ
FT                   QWGDSVLGRRCRDLLLQLYLQRPELRVPVPEVLLHSEGAASSSVCKLDGLIHRFITLLA
FT                   DTSDSRALENRGADASMACRKLAVAHPLLLLRHLPMIAALLHGRTHLNFQEFRQQNHLS
FT                   CFLHVLGLLELLQPHVFRSEHQGALWDCLLSFIRLLLNYRKSSRHLAAFINKFVQFIHK
FT                   YITYNAPAAISFLQKHADPLHDLSFDNSDLVMLKSLLAGLSLPSRDDRTDRGLDEEGEE
FT                   ESSAGSLPLVSVSLFTPLTAAEMAPYMKRLSRGQTVEDLLEVLSDIDEMSRRRPEILSF
FT                   FSTNLQRLMSSAEECCRNLAFSLALRSMQNSPSIAAAFLPTFMYCLGSQDFEVVQTALR
FT                   NLPEYALLCQEHAAVLLHRAFLVGMYGQMDPSAQISEALRILHMEAVM"
FT   CDS             complement(join(393928..394043,394197..394306,
FT                   394484..394575,394922..394992,395624..395737,
FT                   396423..396535,396917..397044,397519..397711,
FT                   398058..398191,399301..399424,399582..399808,
FT                   399908..400010,400147..400271,400903..401026,
FT                   401122..401290,401720..401860,402080..402240,
FT                   402749..403041,403674..403798,404192..404314,
FT                   404612..404845,405903..406064,407099..407210,
FT                   407360..407527,408455..408559,408647..408883,
FT                   409982..410131,410279..410458,410677..410807,
FT                   411056..411315,412753..412813,413000..413091,
FT                   416419..416515,417163..417320,418225..418302,
FT                   418842..418962,419565..419673,420547..420723,
FT                   421821..421962,422116..422261,422384..422570,
FT                   422664..422769,422882..423041,423293..423430,
FT                   423579..423775,426310..426600,427312..427410,
FT                   427732..428016,429205..429262))
FT                   /codon_start=1
FT                   /gene="DKFZP586J0619"
FT                   /locus_tag="tcag7.531"
FT                   /product="DKFZP586J0619 protein"
FT                   /note="XP_379767.1"
FT                   /db_xref="InterPro:IPR022145"
FT                   /db_xref="UniProtKB/TrEMBL:A4D213"
FT                   /protein_id="EAL23942.1"
FT                   /translation="MWLSGKSQVQKRGAVRYLQAPPVNGEASACPAPPTHLDRTTCARR
FT                   RPARLPPPWGAAGIRPAPRASRASFWARFPPHCFPSGCSGSRVLEGGEIGFRFRGGRVA
FT                   AAALRSRWARGDAAAAGSREGRGRMNRAKPTTVRRPSAAAKPSGHPPPGDFIALGSKGQ
FT                   ANESKTASTLLKPAPSGLPSERKRDAAAALSSASALTGLTKRPKLSSTPPLSALGRLAE
FT                   AAVAEKRAISPSIKEPSVVPIEVLPTVLLDEIEAAELEGNDDRIEGVLCGAVKQLKVTR
FT                   AKPDSTLYLSLMYLAKIKPNIFATEGVIEALCSLLRRDASINFKAKGNSLVSVLACNLL
FT                   MAAYEEDENWPEIFVKVYIEDSLGERIWVDSPHCKTFVDNIQTAFNTRMPPRSVLLQGE
FT                   AGRVAGDLGAGSSPHPSLTEEEDSQTELLIAEEKLSPEQEGQLMPRYEELAESVEEYVL
FT                   DMLRDQLNRRQPIDNVSRNLLRLLTSTCGYKEVRLLAVQKLEMWLQNPKLTRPAQDLLM
FT                   SVCMNCNTHGSEDMDVISHLIKIRLKPKVLLNHFMLCIRELLSAHKDNLGTTIKLVIFN
FT                   ELSSARNPNNMQVLYTALQHSSELAPKFLAMVFQDLLTNKDDYLRASRALLREIIKQTK
FT                   HEINFQAFCLGLMQERKEPQYLEMEFKERFVVHITDVLAVSMMLGITAQVKEAGIAWDK
FT                   GEKRNLEVLRSFQNQIAAIQRDAVWWLHTVVPSISKLAPKDYVHCLHKVLFTEQPETYY
FT                   KWDNWPPESDRNFFLRLCSEVPILEDTLMRILVIGLSRELPLGPADAMELADHLVKRAA
FT                   AVQADDVEVLKVGRTQLIDAVLNLCTYHHPENIQLPPGYQPPNLAISTLYWKAWPLLLV
FT                   VAAFNPENIGLAAWEEYPTLKMLMEMVMTNNYSYPPCTLTDEETRTEMLNRELQTAQRE
FT                   KQEILAFEGHLAAASTKQTITESSSLLLSQLTSLDPQYAAHTAPPCACRRDLWVVGVGG
FT                   PPGGLPPHILDQVKSLNQSLRLGHLLCRSRNPDFLLHIIQRQASSQSMPWLADLVQSSE
FT                   GSLDVLPVQCLCEFLLHDAVDDAASGEEDDEGESKEQKAKKRQRQQKQRQLLGRLQDLL
FT                   LGPKADEQTTCEVLDYFLRRLGSSQVASRVLAMKGETLPALPKAGPAHECLPQGLSLVL
FT                   SEGSLRDGEEKEPPMEEDVGDTDVLQGYQWLLRDLPRLPLFDSVRSTTALALQQAIHME
FT                   TDPQTISAYLIYLSQHTPVEEQAQHSDLALDVARLVVERSTIMSHLFSKLSPSAASDAV
FT                   LSALLSIFSRYVRRMRQSKEGEEVYSWSESQDQVFLRWSSGETATMHILVVHAMVILLT
FT                   LGPPRADDSEFQALLDIWFPEEKPLPTAFLVDTSEEALLLPDWLKLRMIRSEVLRLVDA
FT                   ALQDLEPQQLLLFVQSFGIPVSSMSKLLQFLDQAVAHDPQTLEQNIMDKSKMPGTCGVG
FT                   SHTLTEPQPGQAFGAWVRAGVTLLRFADYMAHLVEVQHERGASGGQTFHSLLTASLPPR
FT                   RDSTEAPKPKSSPEQPIGQGRIRVGTQLRVLGPEDDLAGMFLQIFPLSPDPRWQSSSPR
FT                   PVALALQQALGQELARVVQGSPEVPGITVRVLQALATLLSSPHGGALVMSMHRSHFLAC
FT                   PLLRQLCQYQVLGAWASCGGGGHAVCHRYTGFSSLFLKVLLQMLQWLDSPGVEGGPLRA
FT                   QLRMLASQASAGRRLSDVRGGLLRLAEALAFRQDLEVVSSTVRAVIATLRSGEQCSVEP
FT                   DLISKVLQGLIEVRSPHLEELLTAFFSATADAASPFPACKPVVVVSSPAAAGGGAPGWG
FT                   EAGLEAVRLGPSSGLLVDWLEMLDPEVVSSCPDLQLRLLFSRRKGKGQAQVPSFRPYLL
FT                   TLFTHQSSWPTLHQCIRVLLGKSREQRFDPSASLDFLWACIHVPRIWQGRDQRTPQAGL
FT                   GRKRREELVLRVQGPELISLVELILAEAETRSQDGDTAACSLIQARLPLLLSCCCGDDE
FT                   SVRKVTEHLSGCIQQWGDSVLGRRCRDLLLQLYLQRPELRVPVPEVLLHSEGAASSSVC
FT                   KLDGLIHRFITLLADTSDSRALENRGADASMACRKLAVAHPLLLLRHLPMIAALLHGRT
FT                   HLNFQEFRQQNHLSCFLHVLGLLELLQPHVFRSEHQGALWDCLLSFIRLLLNYRKSSRH
FT                   LAAFINKFVQFIHKYITYNAPAAISFLQKHADPLHDLSFDNSDLVMLKSLLAGLSLPSR
FT                   DDRTDRGLDEEGEEESSAGSLPLVSVSLFTPLTAAEMAPYMKRLSRGQTVEDLLEVLSD
FT                   IDEMSRRRPEILSFFSTNLQRLMSSAEECCRNLAFSLALRSMQNSPSIAAAFLPTFMYC
FT                   LGSQDFEVVQTALRNLPEYALLCQEHAAVLLHRAFLVGMYGQMDPSAQISEALRILHME
FT                   AVM"
FT   gene            454141..464139
FT                   /gene="MAFK"
FT                   /locus_tag="tcag7.535"
FT   mRNA            join(454141..454307,462558..462637,463350..464024,
FT                   464026..464139)
FT                   /gene="MAFK"
FT                   /locus_tag="tcag7.535"
FT                   /product="v-maf musculoaponeurotic fibrosarcoma oncogene
FT                   homolog K (avian)"
FT                   /note="NM_002360.1"
FT   CDS             join(462602..462637,463350..463784)
FT                   /codon_start=1
FT                   /gene="MAFK"
FT                   /locus_tag="tcag7.535"
FT                   /product="v-maf musculoaponeurotic fibrosarcoma oncogene
FT                   homolog K (avian)"
FT                   /note="NP_002351.1"
FT                   /db_xref="GOA:O60675"
FT                   /db_xref="HGNC:HGNC:6782"
FT                   /db_xref="InterPro:IPR004826"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="InterPro:IPR008917"
FT                   /db_xref="InterPro:IPR024874"
FT                   /db_xref="InterPro:IPR028574"
FT                   /db_xref="UniProtKB/Swiss-Prot:O60675"
FT                   /protein_id="EAL23943.1"
FT                   /translation="MTTNPKPNKALKVKKEAGENAPVLSDDELVSMSVRELNQHLRGLT
FT                   KEEVTRLKQRRRTLKNRGYAASCRIKRVTQKEELERQRVELQQEVEKLARENSSMRLEL
FT                   DALRSKYEALQTFARTVARGPVAPSKVATTSVITIVKSTELSSTSVPFSAAS"
FT   gene            complement(467223..479520)
FT                   /gene="MGC9712"
FT                   /locus_tag="tcag7.540"
FT   mRNA            complement(join(467223..470434,470436..470590,
FT                   471151..471348,471928..472097,473263..473354,
FT                   473714..473804,474226..474360,474362..474391,
FT                   478675..478822,479259..479520))
FT                   /gene="MGC9712"
FT                   /locus_tag="tcag7.540"
FT                   /product="hypothetical protein MGC9712"
FT                   /note="NM_152689.2"
FT   CDS             complement(468785..470185)
FT                   /codon_start=1
FT                   /gene="MGC9712"
FT                   /locus_tag="tcag7.540"
FT                   /product="hypothetical protein MGC9712"
FT                   /note="NP_689902.2"
FT                   /protein_id="EAL23944.1"
FT                   /translation="MALAGTQVGPPPQERAPEPIGRAWGPPGITQPSAPGATVGRRVSV
FT                   AAGPWLHGPHGSCEWVRLPGSGDRQRTDPRLGSWREGRRGAGQPGSDTVSSSGRRRPAG
FT                   STQAGRGWASLEPATALVGTWRRAHVSPHASHRGALARRPARGACAWDGSQNQRAPVRL
FT                   ASTVGLWESLLFIFKHLGFSTGSWLLFPQGMSLRSRTRWGSQEAAAQSLHAGKGSHLSG
FT                   VGSLVVQGSAGQSLGCAITATAFLLGASTSSKTGLVPAPPAASGQGHEGRALSTWAGGT
FT                   LPGGTEGAPTWAPASCPSLLPPRARWGPGFEEPRTRALPAGSWRRASGLGNRGRKNSSR
FT                   PGTKGASGRTHGWPRARGVTAGRPPGPGPVRGQYGDPACRWQSVLCVWGPQHRLGGGWG
FT                   RGSRSGQGLGGSGTGRGEQTGSSSGHHPGTAAPTRAAPHPWPRSPGTAGPGVSEGLSRA
FT                   GTDQWSPG"
FT   gene            complement(490720..492960)
FT                   /gene="MGC10911"
FT                   /locus_tag="tcag7.532"
FT   mRNA            complement(join(490720..491238,492512..492960))
FT                   /gene="MGC10911"
FT                   /locus_tag="tcag7.532"
FT                   /product="hypothetical protein MGC10911"
FT                   /note="NM_032302.1"
FT   CDS             complement(join(491086..491238,492512..492727))
FT                   /codon_start=1
FT                   /gene="MGC10911"
FT                   /locus_tag="tcag7.532"
FT                   /product="hypothetical protein MGC10911"
FT                   /note="NP_115678.1"
FT                   /db_xref="HGNC:HGNC:22420"
FT                   /db_xref="InterPro:IPR018788"
FT                   /db_xref="PDB:2Z5E"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9BT73"
FT                   /protein_id="EAL23945.1"
FT                   /translation="MEDTPLVISKQKTEVVCGVPTQVVCTAFSSHILVVVTQFGKMGTL
FT                   VSLEPSSVASDVSKPVLTTKVLLGQDEPLIHVFAKNLVAFVSQEAGNRAVLLAVAVKDK
FT                   SMEGLKALREVIRVCQVW"
FT   gene            complement(616231..617746)
FT                   /gene="LOC401296"
FT                   /locus_tag="tcag7.1167"
FT   mRNA            complement(join(616231..617506,617600..617746))
FT                   /gene="LOC401296"
FT                   /locus_tag="tcag7.1167"
FT                   /product="hypothetical gene supported by AK125766"
FT                   /note="XM_379467.1"
FT   CDS             complement(616363..616641)
FT                   /codon_start=1
FT                   /gene="LOC401296"
FT                   /locus_tag="tcag7.1167"
FT                   /product="hypothetical gene supported by AK125766"
FT                   /note="XP_379467.1"
FT                   /db_xref="UniProtKB/TrEMBL:A4D217"
FT                   /protein_id="EAL23946.1"
FT                   /translation="MNISRACTAHYQDPSGTQHLVTRGLHGQSLPGGLHPLRRVKDGPA
FT                   QLGLNPHSLVHRERLTCAHFTDNKTEAERVTARPAHGRAWRRPRPAL"
FT   gene            668013..670496
FT                   /gene="LOC346355"
FT                   /locus_tag="tcag7.1308"
FT   mRNA            join(668013..670000,670012..670496)
FT                   /gene="LOC346355"
FT                   /locus_tag="tcag7.1308"
FT                   /product="similar to RIKEN cDNA A930017N06 gene"
FT                   /note="XM_294219.3"
FT   gene            complement(739703..1150391)
FT                   /gene="MAD1L1"
FT                   /locus_tag="tcag7.525"
FT   mRNA            complement(join(739703..740134,822073..822083,
FT                   822085..822263,858477..858687,879210..879300,
FT                   902031..902119,922809..922865,935241..935381,
FT                   988875..989019,1068832..1068918,1132886..1132947,
FT                   1135559..1135674,1135677..1135683,1135842..1135961,
FT                   1137636..1137717,1139006..1139130,1142249..1142428,
FT                   1145084..1145224,1149658..1149817,1150223..1150391))
FT                   /gene="MAD1L1"
FT                   /locus_tag="tcag7.525"
FT                   /product="MAD1 mitotic arrest deficient-like 1 (yeast)"
FT                   /note="NM_003550.1"
FT   CDS             complement(join(739717..740134,822073..822083,
FT                   822085..822263,858477..858687,879210..879300,
FT                   902031..902119,922809..922865,935241..935381,
FT                   988875..989019,1068832..1068918,1132886..1132947,
FT                   1135559..1135674,1135677..1135683,1135842..1135961,
FT                   1137636..1137717,1139006..1139130,1142249..1142428,
FT                   1145084..1145224,1149658..1149807))
FT                   /codon_start=1
FT                   /gene="MAD1L1"
FT                   /locus_tag="tcag7.525"
FT                   /product="MAD1 mitotic arrest deficient-like 1 (yeast)"
FT                   /note="NP_003541.1"
FT                   /db_xref="GOA:A4D218"
FT                   /db_xref="InterPro:IPR008672"
FT                   /db_xref="UniProtKB/TrEMBL:A4D218"
FT                   /protein_id="EAL23947.1"
FT                   /translation="MEDLGENTMVLSTLRSLNNFISQRVEGGSGLDISTSAPGSLQMQY
FT                   QQSMQLEERAEQIRSKSHLIQVEREKMQMELSHKRARVELERAASTSARNYEREVDRNQ
FT                   ELLTRIRQLQEREAGAEEKMQEQLERNRQCQQNLDAASKRLREKEDSLAQAGETINALK
FT                   GRISELQWSVMDQEMRVKRLESEKQELQEQLDLQHKKCQEANQKIQELQASQEARADHE
FT                   QQIKDLEQKLSLQEQDAAIVKNMKSELVRLPRLERELKQLREESALREMRETNGLLQEE
FT                   LEGLQRKLGRQEKMQETLVGLELENERLLAKLQSWERLDQTMGLSIRTPEDLSRFVVEL
FT                   QQRELALKDKNSAVTSSARGLEKARQQLQEELRQVSGQLLEERKKRETHEALARRLQKR
FT                   VLLLTKERDGMRAILGSYDSELTPAEYSPQLTRRMREAEDMVQKVHSHSAEMEAQLSQA
FT                   LEELGGQKQRADMLEMELKMLKSQSSSAEQSFLFSREEADTLRLKVEELEGERSRLEEE
FT                   KRMLEAQLERRALQGDYDQSRTKVLHMSLNPTSVARQRLREDHSQLQAECERLRGLLRA
FT                   MERGGTVPADLEAAAASLPSSKEVAELKKQVESAELKNQRLKEVFQTKIQEFRKACYTL
FT                   TGYQIDITTENQYRLTSLYAEHPGDCSSSRPPAPRVPRCSYWRQSSHTPWASSSRCTCG
FT                   ARTASLPSSARSPSSSSAARPWRSLQARGHSRSHSAWPDLQVPCPASHRLGARPASPAP
FT                   QGSSMTDRHAGTYVGLPAGAASTLSTCRPHASRSLVCGRRPPAWVPHLVK"
FT   gene            complement(1153965..1161874)
FT                   /gene="FTSJ2"
FT                   /locus_tag="tcag7.549"
FT   mRNA            complement(join(1153965..1155238,1159092..1159381,
FT                   1161838..1161874))
FT                   /gene="FTSJ2"
FT                   /locus_tag="tcag7.549"
FT                   /product="FtsJ homolog 2 (E. coli)"
FT                   /note="NM_013393.1"
FT   mRNA            complement(join(1153965..1155238,1157689..1158611,
FT                   1159092..1159381,1161838..1161874))
FT                   /gene="FTSJ2"
FT                   /locus_tag="tcag7.549"
FT                   /product="FtsJ homolog 2 (E. coli)"
FT                   /note="NM_177442.1"
FT   gene            1161898..1170820
FT                   /gene="NUDT1"
FT                   /locus_tag="tcag7.546"
FT   mRNA            join(1161898..1161932,1162601..1162724,1164239..1164402,
FT                   1169533..1169678,1170504..1170820)
FT                   /gene="NUDT1"
FT                   /locus_tag="tcag7.546"
FT                   /product="nudix (nucleoside diphosphate linked moiety
FT                   X)-type motif 1"
FT                   /note="NM_198949.1"
FT   mRNA            join(1161898..1161932,1164239..1164402,1169533..1169678,
FT                   1170504..1170820)
FT                   /gene="NUDT1"
FT                   /locus_tag="tcag7.546"
FT                   /product="nudix (nucleoside diphosphate linked moiety
FT                   X)-type motif 1"
FT                   /note="NM_002452.3"
FT   CDS             join(1162668..1162724,1164239..1164402,1169533..1169678,
FT                   1170504..1170676)
FT                   /codon_start=1
FT                   /gene="NUDT1"
FT                   /locus_tag="tcag7.546"
FT                   /product="nudix (nucleoside diphosphate linked moiety
FT                   X)-type motif 1"
FT                   /note="NP_945187.1"
FT                   /db_xref="GOA:P36639"
FT                   /db_xref="HGNC:HGNC:8048"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR003563"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="PDB:1IRY"
FT                   /db_xref="PDB:3Q93"
FT                   /db_xref="PDB:3WHW"
FT                   /db_xref="PDB:3ZR0"
FT                   /db_xref="PDB:3ZR1"
FT                   /db_xref="PDB:4C9W"
FT                   /db_xref="PDB:4C9X"
FT                   /db_xref="PDB:4N1T"
FT                   /db_xref="PDB:4N1U"
FT                   /db_xref="UniProtKB/Swiss-Prot:P36639"
FT                   /protein_id="EAL23948.1"
FT                   /translation="MSGISPQQMGEPEGSWSGKNPGTMGASRLYTLVLVLQPQRVLLGM
FT                   KKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELM
FT                   DVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQ
FT                   GQDTILDYTLREVDTV"
FT   CDS             join(1164251..1164402,1169533..1169678,1170504..1170676)
FT                   /codon_start=1
FT                   /gene="NUDT1"
FT                   /locus_tag="tcag7.546"
FT                   /product="nudix (nucleoside diphosphate linked moiety
FT                   X)-type motif 1"
FT                   /note="NP_002443.3"
FT                   /db_xref="GOA:P36639"
FT                   /db_xref="HGNC:HGNC:8048"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR003563"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="PDB:1IRY"
FT                   /db_xref="PDB:3Q93"
FT                   /db_xref="PDB:3WHW"
FT                   /db_xref="PDB:3ZR0"
FT                   /db_xref="PDB:3ZR1"
FT                   /db_xref="PDB:4C9W"
FT                   /db_xref="PDB:4C9X"
FT                   /db_xref="PDB:4N1T"
FT                   /db_xref="PDB:4N1U"
FT                   /db_xref="UniProtKB/Swiss-Prot:P36639"
FT                   /protein_id="EAL23949.1"
FT                   /translation="MGASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETI
FT                   EDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPC
FT                   WFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV"
FT   gene            complement(1174677..1233874)
FT                   /gene="SNX8"
FT                   /locus_tag="tcag7.530"
FT   mRNA            complement(join(1174677..1174843,1176548..1176697,
FT                   1177039..1177188,1177409..1177477,1182903..1183035,
FT                   1183971..1184131,1189234..1189314,1191529..1191650,
FT                   1194790..1194907,1197777..1197982,1233738..1233874))
FT                   /gene="SNX8"
FT                   /locus_tag="tcag7.530"
FT                   /product="sorting nexin 8"
FT                   /note="NM_013321.1"
FT   CDS             complement(join(1174730..1174843,1176548..1176697,
FT                   1177039..1177188,1177409..1177477,1182903..1183035,
FT                   1183971..1184131,1189234..1189314,1191529..1191650,
FT                   1194790..1194907,1197777..1197982,1233738..1233831))
FT                   /codon_start=1
FT                   /gene="SNX8"
FT                   /locus_tag="tcag7.530"
FT                   /product="sorting nexin 8"
FT                   /note="NP_037453.1"
FT                   /db_xref="GOA:Q9Y5X2"
FT                   /db_xref="HGNC:HGNC:14972"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="InterPro:IPR028662"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Y5X2"
FT                   /protein_id="EAL23950.1"
FT                   /translation="MTGRAMDPLPAAAVGAAAEAEADEEADPPASDLPTPQAIEPQAIV
FT                   QQVPAPSRMQMPQGNPLLLSHTLQELLARDTVQVELIPEKKGLFLKHVEYEVSSQRFKS
FT                   SVYRRYNDFVVFQEMLLHKFPYRMVPALPPKRMLGADREFIEARRRALKRFVNLVARHP
FT                   LFSEDVVLKLFLSFSGSDVQNKLKESAQCVGDEFLNCKLATRAKDFLPADIQAQFAISR
FT                   ELIRNIYNSFHKLRDRAERIASRAIDNAADLLIFGKELSAIGSDTTPLPSWAALNSSTW
FT                   GSLKQALKGLSVEFALLADKAAQQGKQEENDVVEKLNLFLDLLQSYKDLCERHEKGVLH
FT                   KHQRALHKYSLMKRQMMSATAQNREPESVEQLESRIVEQENAIQTMELRNYFSLYCLHQ
FT                   ETQLIHVYLPLTSHILRAFVNSQIQGHKEMSKVWNDLRPKLSCLFAGPHSTLTPPCSPP
FT                   EDGLCPH"
FT   gene            1273933..1299639
FT                   /gene="EIF3S9"
FT                   /locus_tag="tcag7.544"
FT   mRNA            join(1273933..1274487,1279777..1279969,1281721..1281840,
FT                   1282146..1282203,1282708..1282836,1283448..1283605,
FT                   1285393..1285524,1285601..1285667,1286075..1286121,
FT                   1288548..1288758,1290854..1290926,1291750..1291872,
FT                   1293605..1293683,1294466..1294604,1296027..1296152,
FT                   1297583..1297660,1298028..1298136,1298288..1298405,
FT                   1299173..1299639)
FT                   /gene="EIF3S9"
FT                   /locus_tag="tcag7.544"
FT                   /product="eukaryotic translation initiation factor 3,
FT                   subunit 9 eta, 116kDa"
FT                   /note="NM_003751.2"
FT   mRNA            join(1273933..1274183,1274301..1274487,1279777..1279969,
FT                   1281721..1281840,1282146..1282203,1282708..1282836,
FT                   1283448..1283605,1285393..1285524,1285601..1285667,
FT                   1286075..1286121,1288548..1288758,1290854..1290926,
FT                   1291750..1291872,1293605..1293683,1294466..1294604,
FT                   1296027..1296152,1297583..1297660,1298028..1298136,
FT                   1298288..1298405,1299173..1299639)
FT                   /gene="EIF3S9"
FT                   /locus_tag="tcag7.544"
FT                   /product="eukaryotic translation initiation factor 3,
FT                   subunit 9 eta, 116kDa"
FT                   /note="NM_182712.1"
FT   CDS             join(1273989..1274487,1279777..1279969,1281721..1281840,
FT                   1282146..1282203,1282708..1282836,1283448..1283605,
FT                   1285393..1285524,1285601..1285667,1286075..1286121,
FT                   1288548..1288758,1290854..1290926,1291750..1291872,
FT                   1293605..1293683,1294466..1294604,1296027..1296152,
FT                   1297583..1297660,1298028..1298136,1298288..1298391)
FT                   /codon_start=1
FT                   /gene="EIF3S9"
FT                   /locus_tag="tcag7.544"
FT                   /product="eukaryotic translation initiation factor 3,
FT                   subunit 9 eta, 116kDa"
FT                   /note="NP_003742.2"
FT                   /db_xref="GOA:P55884"
FT                   /db_xref="HGNC:HGNC:3280"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR011400"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR013979"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="PDB:2KRB"
FT                   /db_xref="PDB:2NLW"
FT                   /db_xref="UniProtKB/Swiss-Prot:P55884"
FT                   /protein_id="EAL23951.1"
FT                   /translation="MQDAENVAVPEAAEERAEPGQQQPAAEPPPAEGLLRPAGPGAPEA
FT                   AGTEASSEEVGIAEAGPESEVRTEPAAEAEAASGPSESPSPPAAEELPGSHAEPPVPAQ
FT                   GEAPGEQARDERSDSRAQAVSEDAGGNEGRAAEAEPRALENGDADEPSFSDPEDFVDDV
FT                   SEEELLGDVLKDRPQEADGIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKITNDFY
FT                   PEEDGKTKGYIFLEYASPAHAVDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWDI
FT                   PEKQPFKDLGNLRYWLEEAECRDQYSVIFESGDRTSIFWNDVKDPVSIEERARWTETYV
FT                   RWSPKGTYLATFHQRGIALWGGEKFKQIQRFSHQGVQLIDFSPCERYLVTFSPLMDTQD
FT                   DPQAIIIWDILTGHKKRGFHCESSAHWPIFKWSHDGKFFARMTLDTLSIYETPSMGLLD
FT                   KKSLKISGIKDFSWSPGGNIIAFWVPEDKDIPARVTLMQLPTRQEIRVRNLFNVVDCKL
FT                   HWQKNGDYLCVKVDRTPKGTQGVVTNFEIFRMREKQVPVDVVEMKETIIAFAWEPNGSK
FT                   FAVLHGEAPRISVSFYHVKNNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGAL
FT                   AFVDTSDCTVMNIAEHYMASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKN
FT                   NKDRFCQLLWRPRPPTLLSQEQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTM
FT                   MEDFRKYRKMAQELYMEQKNERLELRGGVDTDELDSNVDDWEEETIEFFVTEEIIPLGN
FT                   QE"
FT   CDS             join(1273989..1274183,1274301..1274487,1279777..1279969,
FT                   1281721..1281840,1282146..1282203,1282708..1282836,
FT                   1283448..1283605,1285393..1285524,1285601..1285667,
FT                   1286075..1286121,1288548..1288758,1290854..1290926,
FT                   1291750..1291872,1293605..1293683,1294466..1294604,
FT                   1296027..1296152,1297583..1297660,1298028..1298136,
FT                   1298288..1298391)
FT                   /codon_start=1
FT                   /gene="EIF3S9"
FT                   /locus_tag="tcag7.544"
FT                   /product="eukaryotic translation initiation factor 3,
FT                   subunit 9 eta, 116kDa"
FT                   /note="NP_874371.1"
FT                   /db_xref="GOA:A4D210"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011400"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR013979"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:A4D210"
FT                   /protein_id="EAL23952.1"
FT                   /translation="MQDAENVAVPEAAEERAEPGQQQPAAEPPPAEGLLRPAGPGAPEA
FT                   AGTEASSEEVGIAEAGPESEGEAPGEQARDERSDSRAQAVSEDAGGNEGRAAEAEPRAL
FT                   ENGDADEPSFSDPEDFVDDVSEEELLGDVLKDRPQEADGIDSVIVVDNVPQVGPDRLEK
FT                   LKNVIHKIFSKFGKITNDFYPEEDGKTKGYIFLEYASPAHAVDAVKNADGYKLDKQHTF
FT                   RVNLFTDFDKYMTISDEWDIPEKQPFKDLGNLRYWLEEAECRDQYSVIFESGDRTSIFW
FT                   NDVKDPVSIEERARWTETYVRWSPKGTYLATFHQRGIALWGGEKFKQIQRFSHQGVQLI
FT                   DFSPCERYLVTFSPLMDTQDDPQAIIIWDILTGHKKRGFHCESSAHWPIFKWSHDGKFF
FT                   ARMTLDTLSIYETPSMGLLDKKSLKISGIKDFSWSPGGNIIAFWVPEDKDIPARVTLMQ
FT                   LPTRQEIRVRNLFNVVDCKLHWQKNGDYLCVKVDRTPKGTQGVVTNFEIFRMREKQVPV
FT                   DVVEMKETIIAFAWEPNGSKFAVLHGEAPRISVSFYHVKNNGKIELIKMFDKQQANTIF
FT                   WSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYMASDVEWDPTGRYVVTSVSWWS
FT                   HKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLSQEQIKQIKKDLKKYSKIFEQ
FT                   KDRLSQSKASKELVERRRTMMEDFRKYRKMAQELYMEQKNERLELRGGVDTDELDSNVD
FT                   DWEEETIEFFVTEEIIPLGNQE"
FT   gene            1298689..1309557
FT                   /gene="LOC402244"
FT                   /locus_tag="tcag7.1093"
FT   mRNA            join(1298689..1298730,1303441..1303566,1307436..1307600,
FT                   1309522..1309557)
FT                   /gene="LOC402244"
FT                   /locus_tag="tcag7.1093"
FT                   /product="similar to hypothetical protein FLJ37300"
FT                   /note="XM_377925.1"
FT   CDS             join(1298689..1298730,1303441..1303566,1307436..1307600,
FT                   1309522..1309557)
FT                   /codon_start=1
FT                   /gene="LOC402244"
FT                   /locus_tag="tcag7.1093"
FT                   /product="similar to hypothetical protein FLJ37300"
FT                   /note="XP_377925.1"
FT                   /db_xref="GOA:A4D209"
FT                   /db_xref="InterPro:IPR001752"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027640"
FT                   /db_xref="UniProtKB/TrEMBL:A4D209"
FT                   /protein_id="EAL23953.1"
FT                   /translation="MPGHFLIPVLVTAARLSRSQSSRPGDCLQVALRIHPLNDAELKEG
FT                   AAVIAHKVGDQMVMLMDPSEDPEDVARTRRSRERTFIFDRVFGQHASQVSTCPCHPCVL
FT                   LWGWSPLGGRPNGEAGAL"
FT   gene            complement(1312741..1324743)
FT                   /gene="LOC402245"
FT                   /locus_tag="tcag7.874"
FT   mRNA            complement(join(1312741..1312931,1313654..1313748,
FT                   1324649..1324743))
FT                   /gene="LOC402245"
FT                   /locus_tag="tcag7.874"
FT                   /product="similar to mesenchymal stem cell protein DSC92;
FT                   neurite outgrowth associated protein"
FT                   /note="XM_377926.1"
FT   CDS             complement(join(1312741..1312931,1313654..1313748,
FT                   1324649..1324743))
FT                   /codon_start=1
FT                   /gene="LOC402245"
FT                   /locus_tag="tcag7.874"
FT                   /product="similar to mesenchymal stem cell protein DSC92;
FT                   neurite outgrowth associated protein"
FT                   /note="XP_377926.1"
FT                   /db_xref="InterPro:IPR010487"
FT                   /db_xref="UniProtKB/TrEMBL:A4D211"
FT                   /protein_id="EAL23954.1"
FT                   /translation="MATNTANSAGLKPTCVCVALPLPPGRSAPHRRLAPCGIAGPGPIG
FT                   WEQDPDSCRRNGSCRRWRGHQRELQKYSSDSESTRRTGDAALPSEQKLEELKAEEPGHF
FT                   SSKVVQRGREFFDSSGNFPCRI"
FT   gene            1322482..1353498
FT                   /gene="CHST12"
FT                   /locus_tag="tcag7.997"
FT   mRNA            join(1322482..1322539,1351457..1353498)
FT                   /gene="CHST12"
FT                   /locus_tag="tcag7.997"
FT                   /product="carbohydrate (chondroitin 4) sulfotransferase 12"
FT                   /note="NM_018641.2"
FT   CDS             1351534..1352778
FT                   /codon_start=1
FT                   /gene="CHST12"
FT                   /locus_tag="tcag7.997"
FT                   /product="carbohydrate (chondroitin 4) sulfotransferase 12"
FT                   /note="NP_061111.1"
FT                   /db_xref="GOA:Q9NRB3"
FT                   /db_xref="HGNC:HGNC:17423"
FT                   /db_xref="InterPro:IPR005331"
FT                   /db_xref="InterPro:IPR018011"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9NRB3"
FT                   /protein_id="EAL23955.1"
FT                   /translation="MTKARLFRLWLVLGSVFMILLIIVYWDSAGAAHFYLHTSFSRPHT
FT                   GPPLPTPGPDRDRELTADSDVDEFLDKFLSAGVKQSDLPRKETEQPPAPGSMEESVRGY
FT                   DWSPRDARRSPDQGRQQAERRSVLRGFCANSSLAFPTKERAFDDIPNSELSHLIVDDRH
FT                   GAIYCYVPKVACTNWKRVMIVLSGSLLHRGAPYRDPLRIPREHVHNASAHLTFNKFWRR
FT                   YGKLSRHLMKVKLKKYTKFLFVRDPFVRLISAFRSKFELENEEFYRKFAVPMLRLYANH
FT                   TSLPASAREAFRAGLKVSFANFIQYLLDPHTEKLAPFNEHWRQVYRLCHPCQIDYDFVG
FT                   KLETLDEDAAQLLQLLQVDRQLRFPPSYRNRTASSWEEDWFAKIPLAWRQQLYKLYEAD
FT                   FVLFGYPKPENLLRD"
FT   gene            complement(1394029..1436586)
FT                   /gene="LOC402635"
FT                   /locus_tag="tcag7.945"
FT   mRNA            complement(join(1394029..1394208,1394547..1394721,
FT                   1394813..1394892,1395265..1395310,1396492..1396682,
FT                   1436518..1436586))
FT                   /gene="LOC402635"
FT                   /locus_tag="tcag7.945"
FT                   /product="similar to galectin-related inter-fiber protein"
FT                   /note="XM_379988.1"
FT   CDS             complement(join(1394029..1394208,1394547..1394721,
FT                   1394813..1394892,1395265..1395310,1396492..1396682,
FT                   1436518..1436586))
FT                   /codon_start=1
FT                   /gene="LOC402635"
FT                   /locus_tag="tcag7.945"
FT                   /product="similar to galectin-related inter-fiber protein"
FT                   /note="XP_379988.1"
FT                   /db_xref="GOA:A4D1Z8"
FT                   /db_xref="HGNC:HGNC:4577"
FT                   /db_xref="InterPro:IPR001079"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4D1Z8"
FT                   /protein_id="EAL23956.1"
FT                   /translation="MAKPPNMCTGCALYLDFTSVAPMGHGQPCYEPGRRDGLHSRRLRT
FT                   ALHHPGGWRTVTTTLRPLPASAVPPSYQDVRAQAPAAAPMERLPAPSHSGWEQMAVQSK
FT                   AFCAGGLAPGWKLLVQGHADSGEDRFETNFLLETGDIAFHIKPRFSSATVVGNAFQYGR
FT                   WGPEQVSSIFPLAPGEPFEVTGAWPAQIEVSWDAEHFHVYAPEHKVLQFPCRQRPLGAT
FT                   TRVRVLSDHCLAQVELAKRGLSWG"
FT   gene            complement(1456745..1474424)
FT                   /gene="C7orf27"
FT                   /locus_tag="tcag7.1270"
FT   mRNA            complement(join(1456745..1457632,1458047..1458219,
FT                   1458412..1458510,1458654..1458756,1459847..1459920,
FT                   1460166..1460352,1460586..1460704,1460988..1461079,
FT                   1462090..1462209,1462476..1462848,1463799..1463946,
FT                   1466214..1466368,1473216..1473358,1474398..1474424))
FT                   /gene="C7orf27"
FT                   /locus_tag="tcag7.1270"
FT                   /product="chromosome 7 open reading frame 27"
FT                   /note="NM_152743.1"
FT   CDS             complement(join(1456937..1457632,1458047..1458219,
FT                   1458412..1458510,1458654..1458756,1459847..1459920,
FT                   1460166..1460352,1460586..1460704,1460988..1461079,
FT                   1462090..1462209,1462476..1462848,1463799..1463946,
FT                   1466214..1466368,1473216..1473342))
FT                   /codon_start=1
FT                   /gene="C7orf27"
FT                   /locus_tag="tcag7.1270"
FT                   /product="chromosome 7 open reading frame 27"
FT                   /note="NP_689956.1"
FT                   /db_xref="GOA:Q6PJG6"
FT                   /db_xref="HGNC:HGNC:21701"
FT                   /db_xref="InterPro:IPR000357"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="PDB:4IFI"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6PJG6"
FT                   /protein_id="EAL23957.1"
FT                   /translation="MDPECAQLLPALCAVLVDPRQPVADDTCLEKLLDWFKTVTEGESS
FT                   VVLLQEHPCLVELLSHVLKVQDLSSGVLSFSLRLAGTFAAQENCFQYLQQGELLPGLFG
FT                   EPGPLGRATWAVPTVRSGWIQGLRSLAQHPSALRFLADHGAVDTIFSLQGDSSLFVASA
FT                   ASQLLVHVLALSMRGGAEGQPCLPGGDWPACAQKIMDHVEESLCSAATPKVTQALNVLT
FT                   TTFGRCQSPWTEALWVRLSPRVACLLERDPIPAAHSFVDLLLCVARSPVFSSSDGSLWE
FT                   TVARALSCLGPTHMGPLALGILKLEHCPQALRTQAFQVLLQPLACVLKATVQAPGPPGL
FT                   LDGTADDATTVDTLLASKSSCAGLLCRTLAHLEELQPLPQRPSPWPQASLLGATVTVLR
FT                   LCDGSAAPASSVGGHLCGTLAGCVRVQRAALDFLGTLSQGTGPQELVTQALAVLLECLE
FT                   SPGSSPTVLKKAFQATLRWLLSSPKTPGCSDLGPLIPQFLRELFPVLQKRLCHPCWEVR
FT                   DSALEFLTQLSRHWGGQADFRCALLASEVPQLALQLLQDPESYVRASAVTAMGQLSSQG
FT                   LHAPTSPEHAEARQSLFLELLHILSVDSEGFPRRAVMQVFTEWLRDGHADAAQDTEQFV
FT                   ATVLQAASRDLDWEVRAQGLELALVFLGQTLGPPRTHCPYAVALPEVAPAQPLTEALRA
FT                   LCHVGLFDFAFCALFDCDRPVAQKSCDLLLFLRDKIASYSSLREARGSPNTASAEATLP
FT                   RWRAGEQAQPPGDQEPEAVLAMLRSLDLEGLRSTLAESSDHVEKSPQSLLQDMLATGGF
FT                   LQGDEADCY"
FT   gene            1548422..1580619
FT                   /gene="TTYH3"
FT                   /locus_tag="tcag7.1241"
FT   mRNA            join(1548422..1548460,1549171..1549380,1550943..1551116,
FT                   1551181..1551257,1560427..1560761,1562266..1562360,
FT                   1565693..1565862,1565982..1566093,1566258..1566478,
FT                   1566787..1566894,1568445..1568517,1568791..1568898,
FT                   1570391..1570469,1571065..1571120,1571217..1571390,
FT                   1571796..1571888,1574991..1575062,1575276..1575412,
FT                   1577164..1577337,1577818..1577893,1578818..1578894,
FT                   1579543..1579644,1580161..1580182,1580548..1580619)
FT                   /gene="TTYH3"
FT                   /locus_tag="tcag7.1241"
FT                   /product="tweety homolog 3 (Drosophila)"
FT                   /note="XM_166523.2"
FT   CDS             join(1548422..1548460,1549171..1549380,1550943..1551116,
FT                   1551181..1551257,1560427..1560761,1562266..1562360,
FT                   1565693..1565862,1565982..1566093,1566258..1566478,
FT                   1566787..1566894,1568445..1568517,1568791..1568898,
FT                   1570391..1570469,1571065..1571120,1571217..1571390,
FT                   1571796..1571888,1574991..1575062,1575276..1575412,
FT                   1577164..1577337,1577818..1577893,1578818..1578894,
FT                   1579543..1579644,1580161..1580182,1580548..1580619)
FT                   /codon_start=1
FT                   /gene="TTYH3"
FT                   /locus_tag="tcag7.1241"
FT                   /product="tweety homolog 3 (Drosophila)"
FT                   /note="XP_166523.2"
FT                   /db_xref="GOA:Q9C0H2"
FT                   /db_xref="HGNC:HGNC:22222"
FT                   /db_xref="InterPro:IPR006990"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9C0H2"
FT                   /protein_id="EAL23958.1"
FT                   /translation="MSASDFLALSKGKENRRVRAVNEPKSRPPGKTLPGTVPACKELFL
FT                   PGTACLPTELAKSGTADGGARVWKPVSQYTGGPGIRPQQGSPAQAARIRRRPGPAMAGV
FT                   SYAAPWWVSLLHRLPHFDLSWEATSSQFRPEDTDYQQGHGPHPRGPKDPSSPPPGSRPP
FT                   PPRRRKIPFGQSPAADQTVPILSLNGPGRGGGAASPVERGGWATVGMPLARCPAGDRLL
FT                   GIWLREVGAEARLATARSPQTAGLRPGALGAGALTWDEAAARFAEHPDTQALHARSASL
FT                   TIQQASQFTYDDAECLCSLTTLQAAPRARALLLLGAAALACLALDLLFLLFYSFWLCCR
FT                   RRKSEEHLDADCCCTAWCVIIATLVCSAGIAVGFYGNGETSDGIHRATYSLRHANRTVA
FT                   GVQDRVWDTAVGLNHTAEPSLQTLERQLAGRPEPLRAVQRLQGLLETLLGYTAAIPFWR
FT                   NTAVSLEVLAEQVDLYDWYRFACRWLGYLGLLLLDVIICLLVLVGLIRSSKGILVGVCL
FT                   LGVLALVISWGALGLELAVSVGSSDFCVDPDAYVTKMVEEYSVLSGGESVSTAVSQRVP
FT                   TVAGGLWGDLIKYEQRPLHVYMYTHILQYYLACSPRAANPFQQPAGLGNWGRELDKGCV
FT                   DVTNSPWGYHAGDLVTWLRAFRGDLLNAPASLGLLLLLGLALKLSGSHKALVEMQDVVA
FT                   ELLRTVPWEQPATKEVLNGTEVNLQHLTALVDCRSLHLDYVQALTGFCYDGVEGLIYLA
FT                   LFSFVTALMFSSIVCSVPHTWQQKRGPDEDGEEEAAPGPRQAHDSLYRVHMPSLYSCGS
FT                   SYGSETSIPAAAHTVSNAPVTEYMSQNANFQNPRCENTPLIGRESPPPSRYLAALDSGS
FT                   HAGWQFKPMDSARTLWLLETFLVSQEGPRGPGELCASESGDYGDGPGALGSWVRKVQYT
FT                   SSMRAKYLATSQPRPDSSGSH"
FT   gene            1598415..1634340
FT                   /gene="KIAA1950"
FT                   /locus_tag="tcag7.537"
FT   mRNA            join(1598415..1598557,1619123..1619644,1621613..1621780,
FT                   1627482..1627610,1627969..1628138,1628545..1628721,
FT                   1631235..1634340)
FT                   /gene="KIAA1950"
FT                   /locus_tag="tcag7.537"
FT                   /product="KIAA1950 protein"
FT                   /note="XM_166532.3"
FT   CDS             join(1619341..1619644,1621613..1621780,1627482..1627610,
FT                   1627969..1628138,1628545..1628721,1631235..1631783)
FT                   /codon_start=1
FT                   /gene="KIAA1950"
FT                   /locus_tag="tcag7.537"
FT                   /product="KIAA1950 protein"
FT                   /note="XP_166532.1"
FT                   /db_xref="GOA:A4D202"
FT                   /db_xref="InterPro:IPR012962"
FT                   /db_xref="UniProtKB/TrEMBL:A4D202"
FT                   /protein_id="EAL23959.1"
FT                   /translation="MLQCRPAQEFSFGPRALKDALVSTDAALQQLYVSAFSPAERLFLA
FT                   EAYNPQRTLFCTLLIRTGFDWLLSRPEAPEDFQTFHASLQHRKPRLARKHIYLQPIDLS
FT                   EEPVGSSLLHQLCSCTEAFFLGLRVKCLPSVAAASIRCSSRPSRDSDRLQLHTDGILSF
FT                   LKNNKPGDALCVLGLTLSDLYPHEAWSFTFSKFLPGHEVGVCSFARFSGEFPKSGPSAP
FT                   DLALVEAAADGPEAPLQDRGWALCFSALGMVQCCKVTCHELCHLLGLGNCRWLRCLMQG
FT                   ALSLDEALRRPLDLCPICLRKLQHVLGFRLIERYQRLYTWTQAVVGTWPSQEAGEPSVW
FT                   EDTPPASADSGMCCESDSEPGTSVSEPLTPDAGSHTFASGPEEGLSYLAASEAPLPPGG
FT                   PAEAIKEHERWLAMCIQALQREVAEEDLVQVDRAVDALDRWEMFTGQLPATRQDPPSSR
FT                   DSVGLRKVLGDKFSSLRRKLSARKLARAESAPRPWDGEES"
FT   gene            complement(1640727..1642038)
FT                   /gene="LOC285919"
FT                   /locus_tag="tcag7.545"
FT   mRNA            complement(join(1640727..1641230,1641869..1642038))
FT                   /gene="LOC285919"
FT                   /locus_tag="tcag7.545"
FT                   /product="hypothetical LOC285919"
FT                   /note="XM_212094.1"
FT   CDS             complement(1640865..1641173)
FT                   /codon_start=1
FT                   /gene="LOC285919"
FT                   /locus_tag="tcag7.545"
FT                   /product="hypothetical LOC285919"
FT                   /note="XP_212094.1"
FT                   /db_xref="UniProtKB/TrEMBL:A4D203"
FT                   /protein_id="EAL23960.1"
FT                   /translation="MPFFLTPFEPAHIDGHKRRQEIQCGKLGTYSWPPCPELPFLCSGP
FT                   SPRSRRTHCRRDQLDGLLALAPVPFRTLNTERNRVLCAAPPRRSLQRQHHLRRAIMP"
FT   gene            complement(1647006..1763200)
FT                   /gene="GNA12"
FT                   /locus_tag="tcag7.539"
FT   mRNA            complement(join(1647006..1650651,1652354..1652404,
FT                   1713817..1714032,1762728..1763200))
FT                   /gene="GNA12"
FT                   /locus_tag="tcag7.539"
FT                   /product="guanine nucleotide binding protein (G protein)
FT                   alpha 12"
FT                   /note="NM_007353.2"
FT   CDS             complement(join(1650082..1650651,1652354..1652404,
FT                   1713817..1714032,1762728..1763036))
FT                   /codon_start=1
FT                   /gene="GNA12"
FT                   /locus_tag="tcag7.539"
FT                   /product="guanine nucleotide binding protein (G protein)
FT                   alpha 12"
FT                   /note="NP_031379.2"
FT                   /db_xref="GOA:Q03113"
FT                   /db_xref="HGNC:HGNC:4380"
FT                   /db_xref="InterPro:IPR000469"
FT                   /db_xref="InterPro:IPR001019"
FT                   /db_xref="InterPro:IPR011025"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03113"
FT                   /protein_id="EAL23961.1"
FT                   /translation="MSGVVRTLSRCLLPAEAGGARERRAGSGARDAEREARRRSRDIDA
FT                   LLARERRAVRRLVKILLLGAGESGKSTFLKQMRIIHGREFDQKALLEFRDTIFDNILKG
FT                   SRVLVDARDKLGIPWQYSENEKHGMFLMAFENKAGLPVEPATFQLYVPALSALWRDSGI
FT                   REAFSRRSEFQLGESVKYFLDNLDRIGQLNYFPSKQDILLARKATKGIVEHDFVIKKIP
FT                   FKMVDVGGQRSQRQKWFQCFDGITSILFMVSSSEYDQVLMEDRRTNRLVESMNIFETIV
FT                   NNKLFFNVSIILFLNKMDLLVEKVKTVSIKKHFPDFRGDPHRLEDVQRYLVQCFDRKRR
FT                   NRSKPLFHHFTTAIDTENVRFVFHAVKDTILQENLKDIMLQ"
FT   gene            complement(1825017..1962716)
FT                   /gene="CARD11"
FT                   /locus_tag="tcag7.524"
FT   mRNA            complement(join(1825017..1825711,1828918..1829033,
FT                   1831040..1831164,1832155..1832334,1834105..1834240,
FT                   1836158..1836253,1837359..1837455,1838240..1838480,
FT                   1841510..1841636,1842008..1842209,1843109..1843241,
FT                   1845616..1845668,1847475..1847575,1848869..1848951,
FT                   1851414..1851465,1853325..1853501,1855909..1856106,
FT                   1856779..1856904,1857551..1857703,1858621..1858800,
FT                   1863085..1863410,1864690..1864827,1866446..1866658,
FT                   1877371..1877502,1962547..1962716))
FT                   /gene="CARD11"
FT                   /locus_tag="tcag7.524"
FT                   /product="caspase recruitment domain family, member 11"
FT                   /note="NM_032415.2"
FT   CDS             complement(join(1825507..1825711,1828918..1829033,
FT                   1831040..1831164,1832155..1832334,1834105..1834240,
FT                   1836158..1836253,1837359..1837455,1838240..1838480,
FT                   1841510..1841636,1842008..1842209,1843109..1843241,
FT                   1845616..1845668,1847475..1847575,1848869..1848951,
FT                   1851414..1851465,1853325..1853501,1855909..1856106,
FT                   1856779..1856904,1857551..1857703,1858621..1858800,
FT                   1863085..1863410,1864690..1864827,1866446..1866644))
FT                   /codon_start=1
FT                   /gene="CARD11"
FT                   /locus_tag="tcag7.524"
FT                   /product="caspase recruitment domain family, member 11"
FT                   /note="NP_115791.2"
FT                   /db_xref="GOA:Q9BXL7"
FT                   /db_xref="HGNC:HGNC:16393"
FT                   /db_xref="InterPro:IPR001315"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR011029"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="PDB:4JUP"
FT                   /db_xref="PDB:4LWD"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9BXL7"
FT                   /protein_id="EAL23962.1"
FT                   /translation="MDDYMETLKDEEDALWENVECNRHMLSRYINPAKLTPYLRQCKVI
FT                   DEQDEDEVLNAPMLPSKINRAGRLLDILHTKGQRGYVVFLESLEFYYPELYKLVTGKEP
FT                   TRRFSTIVVEEGHEGLTHFLMNEVIKLQQQMKAKDLQRCELLARLRQLEDEKKQMTLTR
FT                   VELLTFQERYYKMKEERDSYNDELVKVKDDNYNLAMRYAQLSEEKNMAVMRSRDLQLEI
FT                   DQLKHRLNKMEEECKLERNQSLKLKNDIENRPKKEQVLELERENEMLKTKNQELQSIIQ
FT                   AGKRSLPDSDKAILDILEHDRKEALEDRQELVNRIYNLQEEARQAEELRDKYLEEKEDL
FT                   ELKCSTLGKDCEMYKHRMNTVMLQLEEVERERDQAFHSRDEAQTQYSQCLIEKDKYRKQ
FT                   IRELEEKNDEMRIEMVRREACIVNLESKLRRLSKDSNNLDQSLPRNLPVTIISQDFGDA
FT                   SPRTNGQEADDSSTSEESPEDSKYFLPYHPPQRRMNLKGIQLQRAKSPISLKRTSDFQA
FT                   KGHEEEGTDASPSSCGSLPITNSFTKMQPPRSRSSIMSITAEPPGNDSIVRRYKEDAPH
FT                   RSTVEEDNDSGGFDALDLDDDSHERYSFGPSSIHSSSSSHQSEGLDAYDLEQVNLMFRK
FT                   FSLERPFRPSVTSVGHVRGPGPSVQHTTLNGDSLTSQLTLLGGNARGSFVHSVKPGSLA
FT                   EKAGLREGHQLLLLEGCIRGERQSVPLDTCTKEEAHWTIQRCSGPVTLHYKVNHEGYRK
FT                   LVKDMEDGLITSGDSFYIRLNLNISSQLDACTMSLKCDDVVHVRDTMYQDRHEWLCARV
FT                   DPFTDHDLDMGTIPSYSRAQQLLLVKLQRLMHRGSREEVDGTHHTLRALRNTLQPEEAL
FT                   STSDPRVSPRLSRASFLFGQLLQFVSRSENKYKRMNSNERVRIISGSPLGSLARSSLDA
FT                   TKLLTEKQEELDPESELGKNLSLIPYSLVRAFYCERRRPVLFTPTVLAKTLVQRLLNSG
FT                   GAMEFTICKSDIVTRDEFLRRQKTETIIYSREKNPNAFECIAPANIEAVAAKNKHCLLE
FT                   AGIGCTRDLIKSNIYPIVLFIRVCEKNIKRFRKLLPRPETEEEFLRVCRLKEKELEALP
FT                   CLYATVEPDMWGSVEELLRVVKDKIGEEQRKTIWVDEDQL"
FT   gene            complement(2059794..2077404)
FT                   /gene="LOC392621"
FT                   /locus_tag="tcag7.935"
FT   mRNA            complement(join(2059794..2060061,2067814..2067901,
FT                   2076971..2077404))
FT                   /gene="LOC392621"
FT                   /locus_tag="tcag7.935"
FT                   /product="LOC392621"
FT                   /note="XM_374711.1"
FT   CDS             complement(join(2059951..2060061,2067814..2067901,
FT                   2076971..2077062))
FT                   /codon_start=1
FT                   /gene="LOC392621"
FT                   /locus_tag="tcag7.935"
FT                   /product="LOC392621"
FT                   /note="XP_374711.1"
FT                   /db_xref="UniProtKB/TrEMBL:A4D1Z2"
FT                   /protein_id="EAL23963.1"
FT                   /translation="MSPCLCPACLPPHPSLARGMRLRMTSIRRTRRVCFAVAFHRDCEF
FT                   PEAFPSHASCIVCGTSRLWTAELYLVIEQNLIRNLGLKARQTERFSGMQLI"
FT   gene            2220205..3182998
FT                   /gene="SDK1"
FT                   /locus_tag="tcag7.523"
FT   mRNA            join(2220205..2220393,2220395..2220514,2220516..2220641,
FT                   2537572..2537731,2557494..2557600,2560448..2560595,
FT                   2739907..2740040,2869354..2869465,2870161..2870351,
FT                   2877364..2877447,2881090..2881284,2885254..2885370,
FT                   2887193..2887360,2889402..2889504,2892306..2892482,
FT                   2905269..2905406,2929049..2929195,2930177..2930317,
FT                   2935253..2935434,2967430..2967545,2969720..2969912,
FT                   2985904..2986002,2995064..2995255,2997530..2997651,
FT                   3028707..3028816,3031333..3031483,3032081..3032318,
FT                   3045425..3045540,3047982..3048171,3050397..3050495,
FT                   3063665..3063859,3067205..3067406,3076294..3076397,
FT                   3079632..3079702,3092071..3092206,3093624..3093683,
FT                   3096334..3096435,3123728..3123843,3125948..3126134,
FT                   3127874..3128011,3137788..3137949,3138918..3139043,
FT                   3150932..3151096,3155323..3155460,3159469..3159589,
FT                   3163352..3163481,3182520..3182998)
FT                   /gene="SDK1"
FT                   /locus_tag="tcag7.523"
FT                   /product="sidekick homolog 1 (chicken)"
FT                   /note="NM_152744.2"
FT   gene            3565053..3566299
FT                   /gene="LOC401297"
FT                   /locus_tag="tcag7.1214"
FT   mRNA            3565053..3566299
FT                   /gene="LOC401297"
FT                   /locus_tag="tcag7.1214"
FT                   /product="hypothetical gene supported by BC032734"
FT                   /note="XM_379469.1"
FT   CDS             3565572..3565907
FT                   /codon_start=1
FT                   /gene="LOC401297"
FT                   /locus_tag="tcag7.1214"
FT                   /product="hypothetical gene supported by BC032734"
FT                   /note="XP_379469.1"
FT                   /db_xref="UniProtKB/TrEMBL:A4D1Z3"
FT                   /protein_id="EAL23964.1"
FT                   /translation="MAFPSLDTMGEDDLWTAWGDAEPASAGEQHRPHRPWRELEPQVNS
FT                   PQNCSNIQIPVMIWTETFQHCLDRFQLGFLVLDELNLHPFHQGSPLWGRDKGRLTLDLV
FT                   SPWSWAR"
FT   gene            3654726..3711741
FT                   /gene="KIAA0415"
FT                   /locus_tag="tcag7.1310"
FT   mRNA            join(3654726..3654763,3658180..3658330,3660083..3660191,
FT                   3668851..3669079,3671320..3671472,3671804..3671960,
FT                   3672582..3672728,3674339..3674532,3676398..3676564,
FT                   3676658..3676942,3678411..3678635,3679531..3679607,
FT                   3681656..3681738,3692944..3693102,3698521..3698658,
FT                   3698914..3699100,3700662..3700806,3701035..3701144,
FT                   3701549..3701717,3702254..3702394,3702761..3702798,
FT                   3702868..3703030,3703596..3703774,3704980..3705122,
FT                   3705500..3705640,3706186..3706297,3707178..3707275,
FT                   3707805..3707937,3708019..3708233,3708461..3711741)
FT                   /gene="KIAA0415"
FT                   /locus_tag="tcag7.1310"
FT                   /product="KIAA0415 gene product"
FT                   /note="XM_166527.6"
FT   CDS             join(3654726..3654763,3658180..3658330,3660083..3660191,
FT                   3668851..3669079,3671320..3671472,3671804..3671960,
FT                   3672582..3672728,3674339..3674532,3676398..3676564,
FT                   3676658..3676942,3678411..3678635,3679531..3679607,
FT                   3681656..3681738,3692944..3693102,3698521..3698658,
FT                   3698914..3699100,3700662..3700806,3701035..3701144,
FT                   3701549..3701717,3702254..3702394,3702761..3702798,
FT                   3702868..3703030,3703596..3703774,3704980..3705122,
FT                   3705500..3705640,3706186..3706297,3707178..3707275,
FT                   3707805..3707937,3708019..3708233,3708461..3708731)
FT                   /codon_start=1
FT                   /gene="KIAA0415"
FT                   /locus_tag="tcag7.1310"
FT                   /product="KIAA0415 gene product"
FT                   /note="XP_166527.5"
FT                   /db_xref="GOA:A4D1Z4"
FT                   /db_xref="InterPro:IPR001766"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR018122"
FT                   /db_xref="InterPro:IPR028222"
FT                   /db_xref="UniProtKB/TrEMBL:A4D1Z4"
FT                   /protein_id="EAL23965.1"
FT                   /translation="MTAIVSSTGGTGRCTFRFPSTAIKIQFTSLYHKEEAPASPLRPLY
FT                   PQISPLKIHIPEPDLRSMGPQLELHTGFSWNTAIRGTAPLPCFADKLPVTYKLQGHFTA
FT                   LSGCEARAASASRLRQLQAWYRGPWYQEPGTRHSPVAEARLRRTVEWGLLRDGLLRGLE
FT                   EPCEQTHVVPQPRAMAPPQPLSRICLCDHTGLSWARAFSHSAALWTPVQEPAARGGYLL
FT                   RVHILVPNSCPASPRGAGSSSYRFVQNVTSDLQLAAEFAAKAASEQQADTSGGDSPKDE
FT                   SKPPFSYAQLIVQAISSAQDRQLTLSGIYAHITKHYPYYRTADKGWQNSIRHNLSLNRY
FT                   FIKVPRSQEEPGKGSFWRIDPASEAKLVEQAFRKRRQRGVSCFRTPFGPLSSRSAPASP
FT                   THPGLMSPRSGGLQTPECLSREGSPIPHDPEFGSKLASVPEYRYSQSAPGSPVSAQPVI
FT                   MAVPPRPSSLVAKPVAYMPASIVTSQQPAGHAIHVVQQAPTVTMVRVVTTSANSANGYI
FT                   LTSQGAAGGSHDAAGAAVLDLGSEARGLEEKPTIAFATIPAAGGVIQTVASQMAPGVPG
FT                   HTVTILQPATPVTLGQHHLPVRAVTQNGKHAVPTNSLAGNAYALTSPLQLLATQASSSA
FT                   PVVVTRVCEPPELSRFYGTNLSMGNKLFVEVRTCCPGHVRPLRSRDAVPEVDRGAELLG
FT                   CSSWSFRGSCASGGGGVMFSAGAESLLHQAREIQDEELKKFCSRICKLLQAEDLGPDTL
FT                   DSLQRLFLIISATKYSRRLEKTCVDLLQATLGLPACPEQLQVLCAAILREMSPSDSLSL
FT                   AWDHTQNSRQLSLVASVLLAQGDRNEEVRAVGQGVLRALESRQPEGPSLRHLLPVMAKV
FT                   VVLSPGTLQEDQATLLSKRLVDWLRYASLQQGLPHSGGFFSTPRARQPGPVTEVDGAVA
FT                   TDFFTVLSSGHRFTDDQWLNVQAFSMLRAWLLHSGPEGPGTLDTDDRSEQEGSTLSVIS
FT                   ATSSAGRLLPPRERLREVAFEYCQRLIEQSNRRALRKGDSDLQKACLVEAVLVLDVLCR
FT                   QDPSFLYRSLSCLKALHGRVRGDPASVRVLLPLAHFFLSHGEAAAVDSEAVYQHLFTRI
FT                   PVEQFHSPMLAFEFIQFCRDNLHLFSGHLSTLRLSFPNLFKFLAWNSPPLTSEFVALLP
FT                   ALVDAGTALEMLHALLDLPCLTAVLDLQLRSAPAASERPLWDTSLRAPSCLEAFRDPQF
FT                   QGLFQYLLRPKASGATERLAPLHQLLQPMAGCARVAQCAQAVPTLLQAFFSAVTQVADG
FT                   SLINQLALLLLGRSDSLYPAPGYAAGVHSVLSSQFLALCTLKPSLVVELARDLLEFLGS
FT                   VNGLCSRASLVTSVVWAIGEYLSVTYDRRCTVEQINKFFEALEALLFEVTQCRPSAALP
FT                   RCPPQVVTVLMTTLTKLASRSQDLIPRASLLLSKMRTLAHSPATSSTHSEEGAEAIRTR
FT                   ATELLTLLKMPSVAQFVLTPSTEVCSPRYHRDANTALPLALRTVSRLVEREAGLMPG"
FT   gene            complement(3712000..3801211)
FT                   /gene="FLJ10324"
FT                   /locus_tag="tcag7.1245"
FT   mRNA            complement(join(3712000..3712288,3714402..3716829,
FT                   3716976..3717115,3717517..3717656,3718999..3719341,
FT                   3720893..3721101,3722913..3723063,3732836..3733008,
FT                   3733786..3734023,3734797..3734909,3739952..3740112,
FT                   3749699..3749736,3752165..3752744,3752746..3752792,
FT                   3753916..3754163,3795164..3795762,3801153..3801211))
FT                   /gene="FLJ10324"
FT                   /locus_tag="tcag7.1245"
FT                   /product="hypothetical protein FLJ10324"
FT                   /note="NM_018059.2"
FT   CDS             complement(join(3716724..3716829,3716976..3717115,
FT                   3717517..3717656,3718999..3719341,3720893..3721101,
FT                   3722913..3723063,3732836..3733008,3733786..3734023,
FT                   3734797..3734909,3739952..3740112,3749699..3749736,
FT                   3752165..3752744,3752746..3752792,3753916..3754163,
FT                   3795164..3795698))
FT                   /codon_start=1
FT                   /gene="FLJ10324"
FT                   /locus_tag="tcag7.1245"
FT                   /product="hypothetical protein FLJ10324"
FT                   /note="NP_060529.2"
FT                   /db_xref="GOA:Q96JH8"
FT                   /db_xref="HGNC:HGNC:22226"
FT                   /db_xref="InterPro:IPR000159"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR002710"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR018444"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="PDB:1UM1"
FT                   /db_xref="PDB:3EC8"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q96JH8"
FT                   /protein_id="EAL23966.1"
FT                   /translation="MFYGTHFIMSPPTKSKLKRQSQLLSSMLSRTLSYKYRDLDSTFSS
FT                   LGASDDPAELSTQLSAPGVLKVFGDSVCTGTHYKSVLATGTSSARELVKEALERYALDP
FT                   RQAGQYVLCDVVGQAGDAGQRWQARCFRVFGDSEKPLLIQELWKPREGLSRRFELRKRS
FT                   DVEELAAKEVDTITAGINAQARRLQRSRAKGTPTPALGDARSSPPPRLRRTVSETSLSP
FT                   VNALPAAAQGPEEPGPDAMRYSLYQSPHLLLLQGYSQQHPGVCAQPGPAHGGPADPSSK
FT                   PSISLSAPDILPLHCTIRRQPLPDSGQAAGRLVLEPIPGAHISVNFSEVGHRTVVLHHG
FT                   DLLSLGLYYLLLFKDPAQAQPLPARALARLRAVPQSCRLCGAALGARGAASPTQAALPR
FT                   RQQLLLEFEPHLEDTLLQRIMTLIEPGGDDHKLTPAFLLCLCIQHSATHFQPGTFGQLL
FT                   LKIARLIRETVWEKTKELAEKQAQLQEPISLASCAMADLVPDLQPILFWMSNSIELLYF
FT                   IQQKCPLYMQSMEEQLDITGSKESLFSCTLTASEEAMAVLEEVVLYAFQQCVYYVSKSL
FT                   YICLPALLECPPFQTERRESWSSAPELPEELRRVVSVYQAALDLLRQLQVHPEVASQML
FT                   AYLFFFSGTLLLNQLLDRGPSLSCFHWPRGVQACARLQQLLEWMRSAGFGAAGEHFFQK
FT                   LSCTLNLLATPRAQLIQMSWTALRAAFPALSPAQLHRLLTHYQLASAMGPMSTWEPGAQ
FT                   DSPEAFRSEDVLESYENPPPIVLPSDGFQVDLEANCLDDSIYQHLLYVRHFLWGLRSRA
FT                   SPGSPGRPGSGASQPVCPEGMHHVVLDGHLEAPSCPLAPRDPGPAAREVAPERTLPLRG
FT                   APWAQAPPGRQPGRGGSQAGPPHTDSSCLLTPPSTPLGPEPGDPDWPESGGPCGKALPE
FT                   RQRNGLSGLRGAAPEGDSAALAEESPPAPSSRSSSTEDFCYVFTVELERGPSGLGMGLI
FT                   DGMHTHLGAPGLYIQTLLPGSPAAADGRLSLGDRILEVNGSSLLGLGYLRAVDLIRHGG
FT                   KKMRFLVAKSDVETAKKIHFRTPPL"
FT   gene            complement(3775297..3779553)
FT                   /gene="PAPOLB"
FT                   /locus_tag="tcag7.894"
FT   mRNA            complement(join(3775297..3777092,3777094..3779553))
FT                   /gene="PAPOLB"
FT                   /locus_tag="tcag7.894"
FT                   /product="poly(A) polymerase beta (testis specific)"
FT                   /note="NM_020144.3"
FT   CDS             complement(3777456..3779369)
FT                   /codon_start=1
FT                   /gene="PAPOLB"
FT                   /locus_tag="tcag7.894"
FT                   /product="poly(A) polymerase beta (testis specific)"
FT                   /note="NP_064529.3"
FT                   /db_xref="GOA:A4D1Z6"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="InterPro:IPR007010"
FT                   /db_xref="InterPro:IPR007012"
FT                   /db_xref="InterPro:IPR011068"
FT                   /db_xref="InterPro:IPR014492"
FT                   /db_xref="UniProtKB/TrEMBL:A4D1Z6"
FT                   /protein_id="EAL23967.1"
FT                   /translation="MMPFPVTTQGPPQPAPPPNRYGVSSPISLAVPKETDCLLTQRLIE
FT                   TLRPFGVFEEEEELQRRILVLEKLNNLVKEWIREISESKSLPQSVIENVGGKIFTFGSY
FT                   RLGVHTKGADIDALCVAPSHVDRSDFFTSFYAKLKLQEEVKDLRAVEEAFVPVIKLCFD
FT                   GIEIDILFARLALQTIPEDLDLRDDSLLKNLDIRCIRSLNGCRVTDEILHLVPNIDNFR
FT                   LTLRAIKLWAKCHNIYSNILGFLGGVSWAMLVARTCQLYPNAVASTLVRKFFLVFSEWE
FT                   WPNPVLLKEPEERNLNLPVWDPRVNPSDRYHLMPIITPAYPQQNSTYNVSISTRMVMIE
FT                   EFKQGLAITHEILLSKAEWSKLFEAPSFFQKYKHYIVLLASASTEKQHLEWVGLVESKI
FT                   RILVGSLEKNEFITLAHVNPQSFPAPKENPDMEEFRTMWVIGLGLKKPDNSEILSIDLT
FT                   YDIQSFTDTVYRQAVNSKMFEMGMKITAMHLRRKELHQLLPHHVLQDKKAHSTEGRRLT
FT                   DLNDSSFDLSAGCENSMSVPSSTSTMKTGPLISSSQGRNSPALAVMTASVANIQATEFS
FT                   LQQVNTNESSGVALNESIPHAVSQPAISPSPKAMVARVVSSTCLISHPDLQETQQQTYL
FT                   IL"
FT   gene            complement(3823609..3876822)
FT                   /gene="PAQR10"
FT                   /locus_tag="tcag7.1224"
FT   mRNA            complement(join(3823609..3825210,3827492..3827561,
FT                   3828756..3828857,3833620..3833696,3837789..3837946,
FT                   3843066..3843147,3876580..3876822))
FT                   /gene="PAQR10"
FT                   /locus_tag="tcag7.1224"
FT                   /product="progestin and adipoQ receptor family member X"
FT                   /note="NM_198403.2"
FT   assembly_gap    153667..154200
FT                   /estimated_length=534
FT                   /gap_type="unknown"
FT   assembly_gap    159638..159779
FT                   /estimated_length=142
FT                   /gap_type="unknown"
FT   assembly_gap    190519..190667
FT                   /estimated_length=149
FT                   /gap_type="unknown"
FT   assembly_gap    3724937..3724956
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3877387..3877406
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3886089..3886108
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3892722..3892741
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3897509..3897528
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3903397..3904298
FT                   /estimated_length=902
FT                   /gap_type="unknown"
FT   assembly_gap    3912021..3916985
FT                   /estimated_length=4965
FT                   /gap_type="unknown"
FT   assembly_gap    3932382..3932967
FT                   /estimated_length=586
FT                   /gap_type="unknown"
FT   assembly_gap    3936511..3942243
FT                   /estimated_length=5733
FT                   /gap_type="unknown"
FT   assembly_gap    3955904..3955923
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3962400..3964381
FT                   /estimated_length=1982
FT                   /gap_type="unknown"
FT   assembly_gap    3981204..3987694
FT                   /estimated_length=6491
FT                   /gap_type="unknown"
FT   assembly_gap    3996008..3996027
FT                   /estimated_length=20
FT                   /gap_type="unknown"
XX
CO   join(AACC02000050.1:1..153666,gap(534),AACC02000051.1:1..5437,gap(142),
CO   AACC02000052.1:1..30739,gap(149),AACC02000053.1:1..3534269,gap(20),
CO   AACC02000054.1:1..152430,gap(20),AACC02000055.1:1..8682,gap(20),
CO   AACC02000056.1:1..6613,gap(20),AACC02000057.1:1..4767,gap(20),
CO   AACC02000058.1:1..5868,gap(902),AACC02000059.1:1..7722,gap(4965),
CO   AACC02000060.1:1..15396,gap(586),AACC02000061.1:1..3543,gap(5733),
CO   AACC02000062.1:1..13660,gap(20),AACC02000063.1:1..6476,gap(1982),
CO   AACC02000064.1:1..16822,gap(6491),AACC02000065.1:1..8313,gap(20),
CO   AACC02000066.1:1..2486)
//


spacer
spacer