spacer

EBI Dbfetch

ID   BT020014; SV 1; linear; mRNA; STD; HUM; 738 BP.
XX
AC   BT020014;
XX
DT   29-OCT-2004 (Rel. 81, Created)
DT   16-OCT-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Homo sapiens tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation
DE   protein, theta polypeptide mRNA, complete cds.
XX
KW   FLI_CDNA.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-738
RA   Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S.,
RA   Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y.,
RA   Phelan M., Farmer A.;
RT   "Cloning of human full-length CDSs in BD Creator(TM) System Donor vector";
RL   Unpublished.
XX
RN   [2]
RP   1-738
RA   Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S.,
RA   Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y.,
RA   Phelan M., Farmer A.;
RT   ;
RL   Submitted (28-OCT-2004) to the INSDC.
RL   BD Biosciences Clontech, 1020 East Meadow circle, Palo Alto, California
RL   94303, USA
XX
DR   MD5; fae395efd333a20a4dae26ee92d1c2a9.
DR   Ensembl-Gn; ENSG00000134308; homo_sapiens.
DR   Ensembl-Tr; ENST00000238081; homo_sapiens.
DR   Ensembl-Tr; ENST00000381844; homo_sapiens.
XX
CC   This CDS clone is a part of a collection of human full length
CC   expression clones generated by BD Biosciences Clontech and the
CC   Harvard Institute of Proteomics. Each CDS has been cloned in two
CC   forms: with and without stop-codon (to allow fusion with C-terminal
CC   tag). The CDS has been  directionally cloned using BD In-Fusion(TM)
CC    cloning system between the SalI  and HindIII sites of the
CC   pDNR-DUAL  vector. Additional sequences in the clone:  'ACC' after
CC   SalI site  and before 'ATG' to provide Kozak consensus sequence;
CC   'GG' after  last codon and before HindIII site to maintain reading
CC   frame.  Clone distribution: http://bioinfo.clontech.com/orfclones.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..738
FT                   /organism="Homo sapiens"
FT                   /lab_host="DH5alpha T1 resistant"
FT                   /mol_type="mRNA"
FT                   /clone_lib="BD Creator(TM) CDS Library derived from MGC
FT                   collection"
FT                   /clone="GH01533X1.0"
FT                   /note="Vector: pDNR-Dual"
FT                   /db_xref="taxon:9606"
FT   CDS             1..738
FT                   /codon_start=1
FT                   /product="tyrosine 3-monooxygenase/tryptophan
FT                   5-monooxygenase activation protein, theta polypeptide"
FT                   /note="Mutations: 406:D->N"
FT                   /db_xref="GOA:P27348"
FT                   /db_xref="H-InvDB:HIT000266777.13"
FT                   /db_xref="HGNC:HGNC:12854"
FT                   /db_xref="InterPro:IPR000308"
FT                   /db_xref="InterPro:IPR023409"
FT                   /db_xref="InterPro:IPR023410"
FT                   /db_xref="PDB:2BTP"
FT                   /db_xref="UniProtKB/Swiss-Prot:P27348"
FT                   /protein_id="AAV38817.1"
FT                   /translation="MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLS
FT                   VAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKY
FT                   LIANATNPESKVFYLKMKGDYFRYLAEVACGNDRKQTIDNSQGAYQEAFDISKKEMQPT
FT                   HPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLR
FT                   DNLTLWTSDSAGEECDAAEGAEN"
XX
SQ   Sequence 738 BP; 217 A; 172 C; 196 G; 153 T; 0 other;
     atggagaaga ctgagctgat ccagaaggcc aagctggccg agcaggccga gcgctacgac        60
     gacatggcca cctgcatgaa ggcagtgacc gagcagggcg ccgagctgtc caacgaggag       120
     cgcaacctgc tctccgtggc ctacaagaac gtggtcgggg gccgcaggtc cgcctggagg       180
     gtcatctcta gcatcgagca gaagaccgac acctccgaca agaagttgca gctgattaag       240
     gactatcggg agaaagtgga gtccgagctg agatccatct gcaccacggt gctggaattg       300
     ttggataaat atttaatagc caatgcaact aatccagaga gtaaggtctt ctatctgaaa       360
     atgaagggtg attacttccg gtaccttgct gaagttgcgt gtggtaatga tcgaaaacaa       420
     acgatagata attcccaagg agcttaccaa gaggcatttg atataagcaa gaaagagatg       480
     caacccacac acccaatccg cctggggctt gctcttaact tttctgtatt ttactatgag       540
     attcttaata acccagagct tgcctgcacg ctggctaaaa cggcttttga tgaggccatt       600
     gctgaacttg atacactgaa tgaagactca tacaaagaca gcaccctcat catgcagttg       660
     cttagagaca acctaacact ttggacatca gacagtgcag gagaagaatg tgatgcggca       720
     gaaggggctg aaaactag                                                     738
//


spacer
spacer