spacer

EBI Dbfetch

ID   BT019927; SV 1; linear; mRNA; STD; HUM; 1386 BP.
XX
AC   BT019927;
XX
DT   29-OCT-2004 (Rel. 81, Created)
DT   16-OCT-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Homo sapiens tumor necrosis factor receptor superfamily, member 1B mRNA,
DE   complete cds.
XX
KW   FLI_CDNA.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1386
RA   Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S.,
RA   Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y.,
RA   Phelan M., Farmer A.;
RT   "Cloning of human full-length CDSs in BD Creator(TM) System Donor vector";
RL   Unpublished.
XX
RN   [2]
RP   1-1386
RA   Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S.,
RA   Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y.,
RA   Phelan M., Farmer A.;
RT   ;
RL   Submitted (28-OCT-2004) to the INSDC.
RL   BD Biosciences Clontech, 1020 East Meadow circle, Palo Alto, California
RL   94303, USA
XX
DR   MD5; 28f868c9cc8f897894245c3935630081.
DR   Ensembl-Gn; ENSG00000028137; homo_sapiens.
DR   Ensembl-Tr; ENST00000376259; homo_sapiens.
XX
CC   This CDS clone is a part of a collection of human full length
CC   expression clones generated by BD Biosciences Clontech and the
CC   Harvard Institute of Proteomics. Each CDS has been cloned in two
CC   forms: with and without stop-codon (to allow fusion with C-terminal
CC   tag). The CDS has been  directionally cloned using BD In-Fusion(TM)
CC    cloning system between the SalI  and HindIII sites of the
CC   pDNR-DUAL  vector. Additional sequences in the clone:  'ACC' after
CC   SalI site  and before 'ATG' to provide Kozak consensus sequence;
CC   'GG' after  last codon and before HindIII site to maintain reading
CC   frame.  Clone distribution: http://bioinfo.clontech.com/orfclones.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1386
FT                   /organism="Homo sapiens"
FT                   /lab_host="DH5alpha T1 resistant"
FT                   /mol_type="mRNA"
FT                   /clone_lib="BD Creator(TM) CDS Library derived from MGC
FT                   collection"
FT                   /clone="GH01193X1.0"
FT                   /note="Vector: pDNR-Dual"
FT                   /db_xref="taxon:9606"
FT   CDS             1..1386
FT                   /codon_start=1
FT                   /product="tumor necrosis factor receptor superfamily,
FT                   member 1B"
FT                   /db_xref="GOA:P20333"
FT                   /db_xref="H-InvDB:HIT000266733.13"
FT                   /db_xref="HGNC:HGNC:11917"
FT                   /db_xref="InterPro:IPR001368"
FT                   /db_xref="InterPro:IPR020411"
FT                   /db_xref="PDB:1CA9"
FT                   /db_xref="PDB:3ALQ"
FT                   /db_xref="UniProtKB/Swiss-Prot:P20333"
FT                   /protein_id="AAV38730.1"
FT                   /translation="MAPVAVWAALAVGLELWAAAHALPAQVAFTPYAPEPGSTCRLREY
FT                   YDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQ
FT                   VETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKP
FT                   CAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTSTSPTRSMAPGAVHLPQPVST
FT                   RSQHTQPTPEPSTAPSTSFLLPMGPSPPAEGSTGDFALPVGLIVGVTALGLLIIGVVNC
FT                   VIMTQVKKKPLCLQREAKVPHLPADKARGTQGPEQQHLLITAPSSSSSSLESSASALDR
FT                   RAPTRNQPQAPGVEASGAGEARASTGSSDSSPGGHGTQVNVTCIVNVCSSSDHSSQCSS
FT                   QASSTMGDTDSSPSESPKDEQVPFSKEECAFRSQLETPETLLGSTEEKPLPLGVPDAGM
FT                   KPS"
XX
SQ   Sequence 1386 BP; 288 A; 457 C; 411 G; 230 T; 0 other;
     atggcgcccg tcgccgtctg ggccgcgctg gccgtcggac tggagctctg ggctgcggcg        60
     cacgccttgc ccgcccaggt ggcatttaca ccctacgccc cggagcccgg gagcacatgc       120
     cggctcagag aatactatga ccagacagct cagatgtgct gcagcaaatg ctcgccgggc       180
     caacatgcaa aagtcttctg taccaagacc tcggacaccg tgtgtgactc ctgtgaggac       240
     agcacataca cccagctctg gaactgggtt cccgagtgct tgagctgtgg ctcccgctgt       300
     agctctgacc aggtggaaac tcaagcctgc actcgggaac agaaccgcat ctgcacctgc       360
     aggcccggct ggtactgcgc gctgagcaag caggaggggt gccggctgtg cgcgccgctg       420
     cgcaagtgcc gcccgggctt cggcgtggcc agaccaggaa ctgaaacatc agacgtggtg       480
     tgcaagccct gtgccccggg gacgttctcc aacacgactt catccacgga tatttgcagg       540
     ccccaccaga tctgtaacgt ggtggccatc cctgggaatg caagcatgga tgcagtctgc       600
     acgtccacgt cccccacccg gagtatggcc ccaggggcag tacacttacc ccagccagtg       660
     tccacacgat cccaacacac gcagccaact ccagaaccca gcactgctcc aagcacctcc       720
     ttcctgctcc caatgggccc cagcccccca gctgaaggga gcactggcga cttcgctctt       780
     ccagttggac tgattgtggg tgtgacagcc ttgggtctac taataatagg agtggtgaac       840
     tgtgtcatca tgacccaggt gaaaaagaag cccttgtgcc tgcagagaga agccaaggtg       900
     cctcacttgc ctgccgataa ggcccggggt acacagggcc ccgagcagca gcacctgctg       960
     atcacagcgc cgagctccag cagcagctcc ctggagagct cggccagtgc gttggacaga      1020
     agggcgccca ctcggaacca gccacaggca ccaggcgtgg aggccagtgg ggccggggag      1080
     gcccgggcca gcaccgggag ctcagattct tcccctggtg gccatgggac ccaggtcaat      1140
     gtcacctgca tcgtgaacgt ctgtagcagc tctgaccaca gctcacagtg ctcctcccaa      1200
     gccagctcca caatgggaga cacagattcc agcccctcgg agtccccgaa ggacgagcag      1260
     gtccccttct ccaaggagga atgtgccttt cggtcacagc tggagacgcc agagaccctg      1320
     ctggggagca ccgaagagaa gcccctgccc cttggagtgc ctgatgctgg gatgaagccc      1380
     agttag                                                                 1386
//


spacer
spacer