spacer

EBI Dbfetch

ID   BT019916; SV 1; linear; mRNA; STD; HUM; 1041 BP.
XX
AC   BT019916;
XX
DT   29-OCT-2004 (Rel. 81, Created)
DT   16-OCT-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Homo sapiens annexin A1 mRNA, complete cds.
XX
KW   FLI_CDNA.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1041
RA   Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S.,
RA   Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y.,
RA   Phelan M., Farmer A.;
RT   "Cloning of human full-length CDSs in BD Creator(TM) System Donor vector";
RL   Unpublished.
XX
RN   [2]
RP   1-1041
RA   Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S.,
RA   Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y.,
RA   Phelan M., Farmer A.;
RT   ;
RL   Submitted (28-OCT-2004) to the INSDC.
RL   BD Biosciences Clontech, 1020 East Meadow circle, Palo Alto, California
RL   94303, USA
XX
DR   MD5; d190fd103d5d8e13875b7c992f226d22.
DR   Ensembl-Gn; ENSG00000135046; homo_sapiens.
DR   Ensembl-Tr; ENST00000257497; homo_sapiens.
DR   Ensembl-Tr; ENST00000376911; homo_sapiens.
XX
CC   This CDS clone is a part of a collection of human full length
CC   expression clones generated by BD Biosciences Clontech and the
CC   Harvard Institute of Proteomics. Each CDS has been cloned in two
CC   forms: with and without stop-codon (to allow fusion with C-terminal
CC   tag). The CDS has been  directionally cloned using BD In-Fusion(TM)
CC    cloning system between the SalI  and HindIII sites of the
CC   pDNR-DUAL  vector. Additional sequences in the clone:  'ACC' after
CC   SalI site  and before 'ATG' to provide Kozak consensus sequence;
CC   'GG' after  last codon and before HindIII site to maintain reading
CC   frame.  Clone distribution: http://bioinfo.clontech.com/orfclones.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1041
FT                   /organism="Homo sapiens"
FT                   /lab_host="DH5alpha T1 resistant"
FT                   /mol_type="mRNA"
FT                   /clone_lib="BD Creator(TM) CDS Library derived from MGC
FT                   collection"
FT                   /clone="GH01174X1.1"
FT                   /note="Vector: pDNR-Dual"
FT                   /db_xref="taxon:9606"
FT   CDS             1..1041
FT                   /codon_start=1
FT                   /product="annexin A1"
FT                   /note="Mutations: 288:OK"
FT                   /db_xref="GOA:Q5TZZ9"
FT                   /db_xref="H-InvDB:HIT000266726.13"
FT                   /db_xref="InterPro:IPR001464"
FT                   /db_xref="InterPro:IPR002388"
FT                   /db_xref="InterPro:IPR018252"
FT                   /db_xref="InterPro:IPR018502"
FT                   /db_xref="UniProtKB/TrEMBL:Q5TZZ9"
FT                   /protein_id="AAV38719.1"
FT                   /translation="MAMVSEFLKQAWFIENEEQEYVQTVKSSKGGPGSAVSPYPTFNPS
FT                   SDVAALHKAIMVKGVDEATIIDILTKRNNAQRQQIKAAYLQETGKPLDETLKKALTGHL
FT                   EEVVLALLKTPAQFDADELRAAMKGLGTDEDTLIEILASRTNKEIRDINRVYREELKRD
FT                   LAKDITSDTSGDFRNALLSLAKGDRSEDFGVNEDLADSDARALYEAGERRKGTDVNVFN
FT                   TILTTRSYPQLRRVFQKYTKYSKHDMNKVLDLELKGDIEKCLTAIVKCATSKPAFFAEK
FT                   LHQAMKGVGTRHKALIRIMVSRSEIDMNDIKAFYQKMYGISLCQAILDETKGDYEKILV
FT                   ALCGGN"
XX
SQ   Sequence 1041 BP; 330 A; 216 C; 249 G; 246 T; 0 other;
     atggcaatgg tatcagaatt cctcaagcag gcctggttta ttgaaaatga agagcaggaa        60
     tatgttcaaa ctgtgaagtc atccaaaggt ggtcccggat cagcggtgag cccctatcct       120
     accttcaatc catcctcgga tgtcgctgcc ttgcataagg ccataatggt taaaggtgtg       180
     gatgaagcaa ccatcattga cattctaact aagcgaaaca atgcacagcg tcaacagatc       240
     aaagcagcat atctccagga aacaggaaag cccctggatg aaacactgaa gaaagccctt       300
     acaggtcacc ttgaggaggt tgttttagct ctgctaaaaa ctccagcgca atttgatgct       360
     gatgaacttc gtgctgccat gaagggcctt ggaactgatg aagatactct aattgagatt       420
     ttggcatcaa gaactaacaa agaaatcaga gacattaaca gggtctacag agaggaactg       480
     aagagagatc tggccaaaga cataacctca gacacatctg gagattttcg gaacgctttg       540
     ctttctcttg ctaagggtga ccgatctgag gactttggtg tgaatgaaga cttggctgat       600
     tcagatgcca gggccttgta tgaagcagga gaaaggagaa aggggacaga cgtaaacgtg       660
     ttcaatacca tccttaccac cagaagctat ccacaacttc gcagagtgtt tcagaaatac       720
     accaagtaca gtaagcatga catgaacaaa gttctggacc tggagttgaa aggtgacatt       780
     gagaaatgcc tcacagctat cgtgaagtgc gccacaagca aaccagcttt ctttgcagag       840
     aagcttcatc aagccatgaa aggtgttgga actcgccata aggcattgat caggattatg       900
     gtttcccgtt ctgaaattga catgaatgat atcaaagcat tctatcagaa gatgtatggt       960
     atctcccttt gccaagccat cctggatgaa accaaaggag attatgagaa aatcctggtg      1020
     gctctttgtg gaggaaacta g                                                1041
//


spacer
spacer