spacer

EBI Dbfetch

ID   BR000408; SV 1; linear; mRNA; STD; HUM; 3470 BP.
XX
AC   BR000408;
XX
DT   14-FEB-2007 (Rel. 90, Created)
DT   14-FEB-2007 (Rel. 90, Last updated, Version 1)
XX
DE   TPA: Homo sapiens AURA17 mRNA for augmented in rheumatoid arthritis 17,
DE   complete cds.
XX
KW   Third Party Data; TPA; TPA:experimental.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3470
RA   Nojima H., Tougan T.;
RT   ;
RL   Submitted (12-FEB-2007) to the INSDC.
RL   Hiroshi Nojima, Osaka University, Research Institute for Microbial
RL   Diseases; 3-1 Yamadaoka, Suita, Osaka 565-0871, Japan
RL   (E-mail:snj-0212@biken.osaka-u.ac.jp, Tel:81-6-6875-3980(ex.9070),
RL   Fax:81-6-6875-5192)
XX
RN   [2]
RX   DOI; 10.1093/dnares/dsl006.
RX   PUBMED; 17082220.
RA   Nakamura N., Shimaoka Y., Tougan T., Onda H., Okuzaki D., Zhao H.,
RA   Fujimori A., Yabuta N., Nagamori I., Tanigawa A., Sato J., Oda T.,
RA   Hayashida K., Suzuki R., Yukioka M., Nojima H., Ochi T.;
RT   "Isolation and expression profiling of genes upregulated in bone
RT   marrow-derived mononuclear cells of rheumatoid arthritis patients";
RL   DNA Res. 13(4):169-183(2006).
XX
DR   MD5; e7ab049258a1433a734f4c7fc97e35d6.
DR   Ensembl-Gn; ENSG00000188906; homo_sapiens.
DR   Ensembl-Tr; ENST00000343742; homo_sapiens.
XX
CC   http://www.biken.osaka-u.ac.jp/kenkyu/bio/dmg-021208/dmg-021107.htm
XX
AH   LOCAL_SPAN      PRIMARY_IDENTIFIER   PRIMARY_SPAN   COMP
AS   1-3470          AK127729.1           1-3470             
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3470
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   CDS             55..2667
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="AURA17"
FT                   /product="augmented in rheumatoid arthritis 17"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniProtKB/TrEMBL:A2VED2"
FT                   /protein_id="FAA00322.1"
FT                   /translation="MLSMLMHSSSKEVFQASANALSTLLEQNVNFRKILLSKGIHLNVL
FT                   ELMQKHIHSPEVAESGCKMLNHLFEGSNTSLDIMAAVVPKILTVMKRHETSLPVQLEAL
FT                   RAILHFIVPGMPEESREDTEFHHKLNMVKKQCFKNDIHKLVLAALNRFIGNPGIQKCGL
FT                   KVISSIVHFPDALEMLSLEGAMDSVLHTLQMYPDDQEIQCLGLSLIGYLITKKNVFIGT
FT                   GHLLAKILVSSLYRFKDVAEIQTKGFQTILAILKLSASFSKLLVHHSFDLVIFHQMSSN
FT                   IMEQKDQQFLNLCCKCFAKVAMDDYLKNVMLERACDQNNSIMVECLLLLGADANQAKEG
FT                   SSLICQVCEKESSPKLVELLLNSGSREQDVRKALTISIGKGDSQIISLLLRRLALDVAN
FT                   NSICLGGFCIGKVEPSWLGPLFPDKTSNLRKQTNIASTLARMVIRYQMKSAVEEGTASG
FT                   SDGNFSEDVLSKFDEWTFIPDSSMDSVFAQSDDLDSEGSEGSFLVKKKSNSISVGEFYR
FT                   DAVLQRCSPNLQRHSNSLGPIFDHEDLLKRKRKILSSDDSLRSSKLQSHMRHSDSISSL
FT                   ASEREYITSLDLSANELRDIDALSQKCCISVHLEHLEKLELHQNALTSFPQQLCETLKS
FT                   LTHLDLHSNKFTSFPSYLLKMSCIANLDVSRNDIGPSVVLDPTVKCPTLKQFNLSYNQL
FT                   SFVPENLTDVVEKLEQLILEGNKISGICSPLRLKELKILNLSKNHISSLSENFLEACPK
FT                   VESFSARMNFLAAMPFLPPSMTILKLSQNKFSCIPEAILNLPHLRSLDMSSNDIQYLPG
FT                   PAHWKSLNLRELLFSHNQISILDLSEKAYLWSRVEKLHLSHNKLKEVRRLLPLKKYTL"
XX
SQ   Sequence 3470 BP; 1151 A; 607 C; 631 G; 1081 T; 0 other;
     ttacatgaga agattggaga tgaagatggc catttcccag ctcataggga agtgatgctc        60
     tccatgctga tgcattcttc atcaaaggaa gttttccagg catctgcgaa tgcattgtca       120
     actctcttag aacaaaatgt taatttcaga aaaatactgt tatcaaaagg aatacacctg       180
     aatgttttgg agttaatgca gaagcatata cattctcctg aagtggctga aagtggctgt       240
     aaaatgctaa atcatctttt tgaaggaagc aacacttccc tggatataat ggcagcagtg       300
     gtccccaaaa tactaacagt tatgaaacgt catgagacat cattaccagt gcagctggag       360
     gcgcttcgag ctattttaca ttttatagtg cctggcatgc cagaagaatc cagggaggat       420
     acagaatttc atcataagct aaatatggtt aaaaaacagt gtttcaagaa tgatattcac       480
     aaactggtcc tagcagcttt gaacaggttc attggaaatc ctgggattca gaaatgtgga       540
     ttaaaagtaa tttcttctat tgtacatttt cctgatgcat tagagatgtt atccctggaa       600
     ggtgctatgg attcagtgct tcacacactg cagatgtatc cagatgacca agaaattcag       660
     tgtctgggtt taagtcttat aggatacttg attacaaaga agaatgtgtt cataggaact       720
     ggacatctgc tggcaaaaat tctggtttcc agcttatacc gatttaagga tgttgctgaa       780
     atacagacta aaggatttca gacaatctta gcaatcctca aattgtcagc atctttttct       840
     aagctgctgg tgcatcattc atttgactta gtaatattcc atcaaatgtc ttccaatatc       900
     atggaacaaa aggatcaaca gtttctaaac ctctgttgca agtgttttgc aaaagtagct       960
     atggatgatt acttaaaaaa tgtgatgcta gagagagcgt gtgatcagaa taacagcatc      1020
     atggttgaat gcttgcttct attgggagca gatgccaatc aagcaaagga gggatcttct      1080
     ttaatttgtc aggtatgtga gaaagagagc agtcccaaat tggtggaact cttactgaat      1140
     agtggatctc gtgaacaaga tgtacgaaaa gcgttgacga taagcattgg gaaaggtgac      1200
     agccagatca tcagcttgct cttaaggagg ctggccctgg atgtggccaa caatagcatt      1260
     tgccttggag gattttgtat aggaaaagtt gaaccttctt ggcttggtcc tttatttcca      1320
     gataagactt ctaatttaag gaaacaaaca aatatagcat ctacactagc aagaatggtg      1380
     atcagatatc agatgaaaag tgctgtggaa gaaggaacag cctcaggcag cgatggaaat      1440
     ttttctgaag atgtgctgtc taaatttgat gaatggacct ttattcctga ctcttctatg      1500
     gacagtgtgt ttgctcaaag tgatgacctg gatagtgaag gaagtgaagg ctcatttctt      1560
     gtgaaaaaga aatctaattc aattagtgta ggagaatttt accgagatgc cgtattacag      1620
     cgttgctcac caaatttgca aagacattcc aattccttgg ggcccatttt tgatcatgaa      1680
     gatttactga agcgaaaaag aaaaatatta tcttcagatg attcactcag gtcatcaaaa      1740
     cttcaatccc atatgaggca ttcagacagc atttcttctc tggcttctga gagagaatat      1800
     attacatcac tagacctttc agcaaatgaa ctaagagata ttgatgccct aagccagaaa      1860
     tgctgtataa gtgttcattt ggagcatctt gaaaagctgg agcttcacca gaatgcactc      1920
     acgagctttc cacaacagct atgtgaaact ctgaagagtt tgacacattt ggacttgcac      1980
     agtaataaat ttacatcatt tccttcttat ttgttgaaaa tgagttgtat tgctaatctt      2040
     gatgtctctc gaaatgacat tggaccctca gtggttttag atcctacagt gaaatgtcca      2100
     actctgaaac agtttaacct gtcatataac cagctgtctt ttgtacctga gaacctcact      2160
     gatgtggtag agaaactgga gcagctcatt ttagaaggaa ataaaatatc agggatatgc      2220
     tcccccttga gactgaagga actgaagatt ttaaacctta gtaagaacca catttcatcc      2280
     ctatcagaga actttcttga ggcttgtcct aaagtggaga gtttcagtgc cagaatgaat      2340
     tttcttgctg ctatgccttt cttgcctcct tctatgacaa tcctaaaatt atctcagaac      2400
     aaattttcct gtattccaga agcaatttta aatcttccac acttgcggtc tttagatatg      2460
     agcagcaatg atattcagta cctaccaggt cccgcacact ggaaatcttt gaacttaagg      2520
     gaactcttat ttagccataa tcagatcagc atcttggact tgagtgaaaa agcatattta      2580
     tggtctagag tagagaaact gcatctttct cacaataaac tgaaagaggt aagacgatta      2640
     ttgccactta aaaaatatac tttatgattt gcatcattac aaattatcat tttaagtgat      2700
     atttagcttc taaataccaa tttcatgaaa ctagaagctt cctgttaact ataaattcct      2760
     gtcaactata aatccagatt tccattaaat ttaaaaataa gaacagctac taatgatgtg      2820
     tcacttaatt taatttccat tctcacaccg acaatttaaa aaaatctact tttaaaaata      2880
     aggtagtagc cttaatactt ccactaaaca ataaaacaat atgctatact tatcagaacc      2940
     ttttaatctg aaagctaaac agctagatat aaatttgtct acccaacatt tgtacaaagt      3000
     aaaaattatt agaatattca tttcaaatta tgtgtgatgt tatcatataa catattatag      3060
     attaactcaa attattctta actgttactt aactatgaca aaacaactta gaacgctttg      3120
     ctaatacaca agatagtata aggataaaaa ttctttatag tactagctca taaagagtgt      3180
     tctatggaat agtagtggat gtcatttaat aactataaat tcaaaataag cattgtaaat      3240
     atcaatacca ttcaattttt ttttgttttt taaacaagtt gtaagcctac cctatggtaa      3300
     atggatatgg taacacagca taatttcctc aaaaaattac ttttgtgata tacttttaaa      3360
     ggattatatg aatatataca taattataga tgaatgtgat gctgtgtgtc attgtatcac      3420
     caaatctctg tccaatctgt taacagactc ttaaataaac catttttctc                 3470
//


spacer
spacer