spacer

EBI Dbfetch

ID   BK001304; SV 1; linear; mRNA; STD; MUS; 1338 BP.
XX
AC   BK001304;
XX
DT   21-JUL-2003 (Rel. 76, Created)
DT   10-MAY-2014 (Rel. 120, Last updated, Version 4)
XX
DE   TPA: Mus musculus Nogo-66 receptor-related protein 3 mRNA, complete cds.
XX
KW   Third Party Data; TPA; TPA:experimental.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1338
RX   DOI; 10.1093/emboj/cdg325.
RX   PUBMED; 12839991.
RA   Barton W.A., Liu B.P., Tzvetkova D., Jeffrey P.D., Fournier A.E., Sah D.,
RA   Cate R., Strittmatter S.M., Nikolov D.B.;
RT   "Structure and axon outgrowth inhibitor binding of the Nogo-66 receptor and
RT   related proteins";
RL   EMBO J. 22(13):3291-3302(2003).
XX
RN   [2]
RP   1-1338
RA   Cate R.L., Strittmatter S.M., Sah D.;
RT   ;
RL   Submitted (28-APR-2003) to the INSDC.
RL   Gene Discovery, Biogen, Inc., 14 Cambridge Center, Cambridge, MA 02142, USA
XX
DR   MD5; ceccd3d226ea2611d6865a4165ef547b.
DR   Ensembl-Gn; ENSMUSG00000045287; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102514; mus_musculus.
DR   EuropePMC; PMC165649; 12839991.
XX
AH   LOCAL_SPAN      PRIMARY_IDENTIFIER   PRIMARY_SPAN   COMP
AS   1-13            AL603905.19          113977-113989      
AS   14-1338         AL603905.19          184452-185776      
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1338
FT                   /organism="Mus musculus"
FT                   /chromosome="11"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             1..1338
FT                   /codon_start=1
FT                   /product="Nogo-66 receptor-related protein 3"
FT                   /note="NgR3"
FT                   /db_xref="GOA:Q8K0S5"
FT                   /db_xref="InterPro:IPR000372"
FT                   /db_xref="InterPro:IPR000483"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="MGI:MGI:2661375"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8K0S5"
FT                   /protein_id="DAA01387.1"
FT                   /translation="MLRKGCCVELLLLLLAGELPLGGGCPRDCVCYPAPMTVSCQAHNF
FT                   AAIPEGIPEDSERIFLQNNRITFLQQGHFSPAMVTLWIYSNNITFIAPNTFEGFVHLEE
FT                   LDLGDNRQLRTLAPETFQGLVKLHALYLYKCGLSALPAGIFGGLHSLQYLYLQDNHIEY
FT                   LQDDIFVDLVNLSHLFLHGNKLWSLGQGIFRGLVNLDRLLLHENQLQWVHHKAFHDLHR
FT                   LTTLFLFNNSLTELQGDCLAPLVALEFLRLNGNAWDCGCRARSLWEWLRRFRGSSSAVP
FT                   CATPELRQGQDLKLLRVEDFRNCTGPVSPHQIKSHTLTTSDRAARKEHHPSHGASRDKG
FT                   HPHGHPPGSRSGYKKAGKNCTSHRNRNQISKVSSGKELTELQDYAPDYQHKFSFDIMPT
FT                   ARPKRKGKCARRTPIRAPSGVQQASSGTALGAPLLAWILGLAVTLR"
XX
SQ   Sequence 1338 BP; 272 A; 430 C; 361 G; 275 T; 0 other;
     atgcttcgca aagggtgctg tgtggaattg ctgctgttgc tgctcgctgg agagctacct        60
     ctgggtggtg gttgtcctcg agactgtgtg tgctaccctg cgcccatgac tgtcagctgc       120
     caggcacaca actttgctgc catcccggag ggcatcccag aggacagtga gcgcatcttc       180
     ctgcagaaca atcgcatcac cttcctccag cagggccact tcagccccgc catggtcacc       240
     ctctggatct actccaacaa catcactttc attgctccca acaccttcga gggctttgtg       300
     catctggagg agctagacct tggagacaac cgacagctgc gaacgctggc acccgagacc       360
     ttccaaggcc tggtgaagct tcacgccctc tacctctata agtgtggact gagcgccctg       420
     cccgcaggca tctttggtgg cctgcacagc ctgcagtatc tctacttgca ggacaaccat       480
     atcgagtacc tccaagatga catctttgtg gacctggtca atctcagtca cttgtttctc       540
     catggtaaca agctatggag cctgggccaa ggcatcttcc ggggcctggt gaacctggac       600
     cggttgctgc tgcatgagaa ccagctacag tgggttcacc acaaggcttt ccatgacctc       660
     cacaggctaa ccaccctctt tctcttcaac aacagcctca ctgagctgca gggtgactgt       720
     ctggcccccc tggtggcctt ggagttcctt cgcctcaatg ggaatgcttg ggactgtggc       780
     tgccgggcac gttccctgtg ggaatggctg cgaaggttcc gtggctctag ctctgctgtc       840
     ccctgcgcga cccccgagct gcggcaaggc caggatctga agctgctgag ggtggaggac       900
     ttccggaact gcacaggacc agtgtctcct caccagatca agtctcacac gcttaccacc       960
     tctgacaggg ctgcccgcaa ggagcaccat ccgtcccatg gggcctccag ggacaaaggc      1020
     cacccacatg gccatccgcc tggctccagg tcaggttaca agaaggcagg caagaactgc      1080
     accagccaca ggaaccggaa ccagatctct aaggtgagct ctgggaaaga gcttaccgaa      1140
     ctgcaggact atgcccccga ctatcagcac aagttcagct ttgacatcat gcccaccgca      1200
     cgacccaaga ggaagggcaa gtgtgctcgc aggaccccca tccgtgcccc cagtggggtg      1260
     cagcaggcat cctcaggcac ggcccttggg gccccactcc tggcctggat actggggctg      1320
     gcagtcactc tccgctga                                                    1338
//


spacer
spacer