spacer

EBI Dbfetch

ID   BC172174; SV 1; linear; mRNA; STD; MUS; 2671 BP.
XX
AC   BC172174;
XX
DT   04-JAN-2009 (Rel. 98, Created)
DT   19-MAR-2009 (Rel. 100, Last updated, Version 2)
XX
DE   Mus musculus fibroblast growth factor receptor 2, mRNA (cDNA clone
DE   MGC:198879 IMAGE:9054844), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2671
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2671
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (19-DEC-2008) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 7ad7c47773ed08a32ae8ddbb8ea7bfdc.
DR   Ensembl-Gn; ENSMUSG00000030849; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000120141; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Ambion
CC   cDNA Library Preparation: British Columbia Cancer Research Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRCK Plate: 21 Row: H Column: 24.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2671
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_390"
FT                   /clone="MGC:198879 IMAGE:9054844"
FT                   /tissue_type="Brain,thymus,testicle,kidney,spleen,liver,
FT                   heart,lung,ovary,embryo - PCR rescued clones"
FT                   /note="Vector: pCR4-TOPO with reversed insert; Clone
FT                   identification sequence tag: ACCCCATC"
FT                   /db_xref="taxon:10090"
FT   gene            1..2671
FT                   /gene="Fgfr2"
FT                   /gene_synonym="KGFRTr"
FT   CDS             373..2631
FT                   /codon_start=1
FT                   /gene="Fgfr2"
FT                   /gene_synonym="KGFRTr"
FT                   /product="Fgfr2 protein"
FT                   /db_xref="GOA:B7ZWP2"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR003598"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR008266"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR013098"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016248"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR020635"
FT                   /db_xref="InterPro:IPR028175"
FT                   /db_xref="MGI:MGI:95523"
FT                   /db_xref="UniProtKB/TrEMBL:B7ZWP2"
FT                   /protein_id="AAI72174.1"
FT                   /translation="MGLPSTWRYGRGPGIGTVTMVSWGRFICLVLVTMATLSLARPSFS
FT                   LVEDTTLEPEDAISSGDDEDDTDSSEDVVSENRSNQRAPYWTNTEKMEKRLHAVPAANT
FT                   VKFRCPAGGNPTPTMRWLKNGKEFKQEHRIGGYKVRNQHWSLIMESVVPSDKGNYTCLV
FT                   ENEYGSINHTYHLDVVERSPHRPILQAGLPANASTVVGGDVEFVCKVYSDAQPHIQWIK
FT                   HVEKNGSKYGPDGLPYLKVLKHSGINSSNAEVLALFNVTEMDAGEYICKVSNYIGQANQ
FT                   SAWLTVLPKQQAPVREKEITASPDYLEIAIYCIGVFLIACMVVTVIFCRMKTTTKKPDF
FT                   SSQPAVHKLTKRIPLRRQVTVSAESSSSMNSNTPLVRITTRLSSTADTPMLAGVSEYEL
FT                   PEDPKWEFPRDKLTLGKPLGEGCFGQVVMAEAVGIDKDKPKEAVTVAVKMLKDDATEKD
FT                   LSDLVSEMEMMKMIGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLRARRPPGMEY
FT                   SYDINRVPEEQMTFKDLVSCTYQLARGMEYLASQKCIHRDLAARNVLVTENNVMKIADF
FT                   GLARDINNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPY
FT                   PGIPVEELFKLLKEGHRMDKPTNCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRILTL
FT                   TTNEEYLDLTQPLEQYSPSYPDTRSSCSSGDDSVFSPDPMPYEPCLPQYPHINGSVKT"
XX
SQ   Sequence 2671 BP; 688 A; 705 C; 724 G; 554 T; 0 other;
     ctttcttctg ctgctgccca gatccgagag cagctccggt gtcatgtcct agctgttctg        60
     cgatccccgg cgcgcgtgaa gcctcggaac cttggcgccg gctgctaccc aaggaatcgt       120
     tctctttttg gagttttcct ccgagatcat cgcctgctcc atcccgatcc actctgggct       180
     ccggcgcagc accgagcgca gaggagcgct gccattcaag tggcagccac agcagcagca       240
     gcagcagcag tgggagcagg aacagcagta acaacagcaa cagcagcaca gccgcctcag       300
     agctttggct cctgagcccc ctgtgggctg aaggcattgc aggtagccca tggtctcaga       360
     agaagtgtgc agatgggatt accgtccacg tggagatatg gaagaggacc agggattggc       420
     actgtgacca tggtcagctg ggggcgcttc atctgcctgg tcttggtcac catggcaacc       480
     ttgtccctgg cccggccctc cttcagttta gttgaggata ccactttaga accagaagat       540
     gccatctcat ctggagatga tgaggacgac acagatagct ccgaagacgt tgtcagtgag       600
     aacaggagca accagagagc accgtactgg accaacaccg agaagatgga gaagcggctc       660
     cacgctgtcc ctgccgccaa cactgtgaag ttccgctgtc cggctggggg gaatccaacg       720
     cccacaatga ggtggttaaa aaacgggaag gagtttaagc aggagcatcg cattggaggc       780
     tataaggtac gaaaccagca ctggagcctt attatggaaa gtgtggtccc gtcagacaaa       840
     ggcaactaca cctgcctggt ggagaatgaa tacgggtcca tcaaccacac ctaccacctc       900
     gatgtcgttg aacggtcacc acaccggccc atcctccaag ctggactgcc tgcaaatgcc       960
     tccacggtgg tcggagggga tgtggagttt gtctgcaagg tttacagcga tgcccagccc      1020
     cacatccagt ggatcaagca cgtggaaaag aacggcagta aatacgggcc tgatgggctg      1080
     ccctacctca aggtcctgaa gcactcgggg ataaatagct ccaatgcaga agtgctggct      1140
     ctgttcaatg tgacggagat ggatgctggg gaatatatat gtaaggtctc caattatata      1200
     gggcaggcca accagtctgc ctggctcact gtcctgccca aacagcaagc gcctgtgaga      1260
     gagaaggaga tcacggcttc cccagattat ctggagatag ctatttactg cataggggtc      1320
     ttcttaatcg cctgcatggt ggtgacagtc atcttttgcc gaatgaagac cacgaccaag      1380
     aagccagact tcagcagcca gccagctgtg cacaagctga ccaagcgcat ccccctgcgg      1440
     agacaggtaa cagtttcggc cgagtccagc tcctccatga actccaacac cccgctggtg      1500
     aggataacaa cgcgtctgtc ctcaacagcg gacaccccga tgctagcagg ggtctccgag      1560
     tatgagttgc cagaggatcc aaagtgggaa ttccccagag ataagctgac gctgggcaaa      1620
     cccctggggg aaggttgctt cgggcaagta gtcatggctg aagcagtggg aatcgataaa      1680
     gacaaaccca aggaggcggt caccgtggca gtgaagatgt tgaaagatga tgccacagag      1740
     aaggacctgt ctgatctggt atcagagatg gagatgatga agatgattgg gaaacataag      1800
     aacattatca acctcctggg ggcctgcacg caggatggac ctctctacgt catagttgaa      1860
     tatgcatcga aaggcaacct ccgggaatac ctccgagccc ggaggccacc tggcatggag      1920
     tactcctatg acattaaccg tgtccccgag gagcagatga ccttcaagga cttggtgtcc      1980
     tgcacctacc agctggctag aggcatggag tacttggctt cccaaaaatg tatccatcga      2040
     gatttggctg ccagaaacgt gttggtaaca gaaaacaatg tgatgaagat agcagacttt      2100
     ggcctggcca gggatatcaa caacatagac tactataaaa agaccacaaa tgggcgactt      2160
     ccagtcaagt ggatggctcc tgaagccctt tttgatagag tttacactca tcagagcgat      2220
     gtctggtcct tcggggtgtt aatgtgggag atctttactt tagggggctc accctaccca      2280
     gggattcccg tggaggaact ttttaagctg ctcaaagagg gacacaggat ggacaagccc      2340
     accaactgca ccaatgaact gtacatgatg atgagggatt gctggcatgc tgtaccctca      2400
     cagagaccca cattcaagca gttggtcgaa gacttggatc gaattctgac tctcacaacc      2460
     aatgaggaat acttggatct cacccagcct ctcgaacagt attctcctag ttaccccgac      2520
     acaaggagct cttgttcttc aggggacgat tctgtgtttt ctccagaccc catgccttat      2580
     gaaccctgtc tgcctcagta tccacacata aacggcagtg ttaaaacatg agtgaatgtg      2640
     tcttcctgtc cccaaacagg acagcaccag g                                     2671
//


spacer
spacer