spacer

EBI Dbfetch

ID   BC171958; SV 1; linear; mRNA; STD; MUS; 1591 BP.
XX
AC   BC171958;
XX
DT   04-JAN-2009 (Rel. 98, Created)
DT   04-JAN-2009 (Rel. 98, Last updated, Version 1)
XX
DE   Mus musculus estrogen related receptor, alpha, mRNA (cDNA clone MGC:198663
DE   IMAGE:9054244), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1591
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1591
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (19-DEC-2008) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 84bf5ec29056da2b8eefcad38f731276.
DR   Ensembl-Gn; ENSMUSG00000024955; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025906; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Ambion
CC   cDNA Library Preparation: British Columbia Cancer Research Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRCK Plate: 20 Row: F Column: 7.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1591
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_378"
FT                   /clone="MGC:198663 IMAGE:9054244"
FT                   /tissue_type="Brain, PCR rescued clones"
FT                   /note="Vector: pCR4-TOPO with reversed insert; Clone
FT                   identification sequence tag: CTTTGTGC"
FT                   /db_xref="taxon:10090"
FT   gene            1..1591
FT                   /gene="Esrra"
FT                   /gene_synonym="Nr3b1"
FT                   /gene_synonym="Estrra"
FT                   /gene_synonym="ERRalpha"
FT   CDS             160..1428
FT                   /codon_start=1
FT                   /gene="Esrra"
FT                   /gene_synonym="Nr3b1"
FT                   /gene_synonym="Estrra"
FT                   /gene_synonym="ERRalpha"
FT                   /product="estrogen related receptor, alpha"
FT                   /db_xref="GOA:O08580"
FT                   /db_xref="InterPro:IPR000536"
FT                   /db_xref="InterPro:IPR001628"
FT                   /db_xref="InterPro:IPR001723"
FT                   /db_xref="InterPro:IPR008946"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="InterPro:IPR024178"
FT                   /db_xref="InterPro:IPR027289"
FT                   /db_xref="MGI:MGI:1346831"
FT                   /db_xref="UniProtKB/Swiss-Prot:O08580"
FT                   /protein_id="AAI71958.1"
FT                   /translation="MSSQVVGIEPLYIKAEPASPDSPKGSSETETEPPVTLASGPAPAR
FT                   CLPGHKEEEDGEGAGSGEQGSGKLVLSSLPKRLCLVCGDVASGYHYGVASCEACKAFFK
FT                   RTIQGSIEYSCPASNECEITKRRRKACQACRFTKCLRVGMLKEGVRLDRVRGGRQKYKR
FT                   RPEVDPLPFPGPFPAGPLAVAGGPRKTAPVNALVSHLLVVEPEKLYAMPDPASPDGHLP
FT                   AVATLCDLFDREIVVTISWAKSIPGFSSLSLSDQMSVLQSVWMEVLVLGVAQRSLPLQD
FT                   ELAFAEDLVLDEEGARAAGLGDLGAALLQLVRRLQALRLEREEYVLLKALALANSDSVH
FT                   IEDAEAVEQLREALHEALLEYEAGRAGPGGGAERRRAGRLLLTLPLLRQTAGKVLAHFY
FT                   GVKLEGKVPMHKLFLEMLEAMMD"
XX
SQ   Sequence 1591 BP; 287 A; 471 C; 546 G; 287 T; 0 other;
     cttcctacaa gcagccagcg gcgccgccga gtgagggggg acgcagcgcg gcggggcggt        60
     gcggccggag gaggcggccc ccgctcaccc cggcgctccg ggccactcgg cccccatgcc       120
     tgcccgccag ccctgccgga gcccaaggtg accagcacca tgtccagcca ggtggtgggc       180
     atcgagcctc tctacatcaa ggcagagcca gccagccctg acagtccaaa gggttcctca       240
     gagactgaga ctgaaccccc ggtgaccctg gcctctggtc cagctccagc ccgctgcctt       300
     ccagggcaca aggaggagga ggatggggag ggggcagggt ctggtgagca gggcagtggg       360
     aagctagtgc tcagctctct acccaaacgc ctctgcctgg tctgtgggga tgtggcctct       420
     ggctaccact acggtgtggc atcctgtgag gcctgcaaag ccttcttcaa gaggaccatc       480
     caggggagca tcgagtacag ctgtccggcc tccaatgagt gtgagatcac caagcggaga       540
     cgcaaggcct gtcaggcctg ccgcttcacc aagtgcctgc gggtgggcat gctcaaggag       600
     ggtgtgcgtc tggaccgtgt ccgcggcgga cggcagaagt acaaacggcg gccagaggtg       660
     gaccctttgc ctttcccggg ccccttccct gctggacctc tggcagtagc tggaggaccc       720
     aggaagacag ccccagtgaa cgctctggtg tcgcatctgc tggtggttga acctgagaag       780
     ctgtacgcca tgcctgaccc agcaagcccc gatggacacc tccccgctgt ggccactctc       840
     tgtgaccttt ttgatcgaga gatagtggtc accatcagct gggccaagag catcccaggc       900
     ttctcctcac tgtcactgtc tgaccagatg tcagtactgc agagtgtgtg gatggaagtg       960
     ctggtgctgg gtgtggccca gcgctcactg ccactgcagg atgagctggc ctttgctgag      1020
     gacctggtcc tagatgaaga gggggcacgg gcagctggcc tgggggatct gggggcagcc      1080
     ctgctgcagc tggttcggcg actgcaagct cttcggctgg agcgggagga gtacgtcctg      1140
     ctgaaagctc tggcccttgc caattctgac tctgtgcaca ttgaagatgc tgaggctgtg      1200
     gagcagctgc gcgaagccct gcatgaggcc ctgctggagt atgaagctgg ccgggctggc      1260
     cctggagggg gtgctgagcg gaggcgtgca ggcaggctgc tgcttacgct gccactcctc      1320
     cgccagacag caggcaaagt cctggcccat ttctatgggg tgaagctgga gggcaaggtg      1380
     cccatgcaca agctgttttt ggaaatgctt gaggccatga tggactgagg caaggggtgg      1440
     gacagggtgg ggtggctggc aggatctgcc cagcataggg tgttagcccc aaaggggcaa      1500
     agctggagtc tgggcagtgc catagcctgc tggcagggcc agggcaatgc catccgcccc      1560
     tgggagaagg cttcatgccc ttccctcccc a                                     1591
//


spacer
spacer