Dbfetch

ID   BC151201; SV 1; linear; mRNA; STD; MUS; 2590 BP.
XX
AC   BC151201;
XX
DT   12-FEB-2009 (Rel. 99, Created)
DT   19-MAR-2009 (Rel. 100, Last updated, Version 2)
XX
DE   Mus musculus fibroblast growth factor receptor 2, mRNA (cDNA clone
DE   MGC:184100 IMAGE:9088089), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2590
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2590
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (20-JUL-2007) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; dfe6fef0d8d628a060e069431983b59b.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Ambion
CC   cDNA Library Preparation: British Columbia Cancer Research Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRCK Plate: 17 Row: A Column: 9
CC   single stranded.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2590
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_390"
FT                   /clone="MGC:184100 IMAGE:9088089"
FT                   /tissue_type="Brain,thymus,testicle,kidney,spleen,liver,
FT                   heart,lung,ovary,embryo - PCR rescued clones"
FT                   /note="Vector: pCR4-TOPO with reversed insert; Clone
FT                   identification sequence tag: TAACAGCT"
FT                   /db_xref="taxon:10090"
FT   gene            1..2590
FT                   /gene="Fgfr2"
FT                   /gene_synonym="KGFRTr"
FT   CDS             373..2550
FT                   /codon_start=1
FT                   /gene="Fgfr2"
FT                   /gene_synonym="KGFRTr"
FT                   /product="Fgfr2 protein"
FT                   /db_xref="GOA:B9EKY4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR003598"
FT                   /db_xref="InterPro:IPR003599"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR008266"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR013098"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016248"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR020635"
FT                   /db_xref="InterPro:IPR028175"
FT                   /db_xref="MGI:MGI:95523"
FT                   /db_xref="UniProtKB/TrEMBL:B9EKY4"
FT                   /protein_id="AAI51202.1"
FT                   /translation="MGLPSTWRYGRGPGIGTVTMVSWGRFICLVLVTMATLSLARPSFS
FT                   LVEDTTLEPEGAPYWTNTEKMEKRLHAVPAANTVKFRCPAGGNPTPTMRWLKNGKEFKQ
FT                   EHRIGGYKVRNQHWSLIMESVVPSDKGNYTCLVENEYGSINHTYHLDVVERSPHRPILQ
FT                   AGLPANASTVVGGDVEFVCKVYSDAQPHIQWIKHVEKNGSKYGPDGLPYLKVLKAAGVN
FT                   TTDKEIEVLYIRNVTFEDAGEYTCLAGNSIGISFHSAWLTVLPAPVREKEITASPDYLE
FT                   IAIYCIGVFLIACMVVTVIFCRMKTTTKKPDFSSQPAVHKLTKRIPLRRQVTVSAESSS
FT                   SMNSNTPLVRITTRLSSTADTPMLAGVSEYELPEDPKWEFPRDKLTLGKPLGEGCFGQV
FT                   VMAEAVGIDKDKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKMIGKHKNIINLLGAC
FT                   TQDGPLYVIVEYASKGNLREYLRARRPPGMEYSYDINRVPEEQMTFKDLVSCTYQLARG
FT                   MEYLASQKCIHRDLAARNVLVTENNVMKIADFGLARDINNIDYYKKTTNGRLPVKWMAP
FT                   EALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPTNCTNE
FT                   LYMMMRDCWHAVPSQRPTFKQLVEDLDRILTLTTNEEYLDLTQPLEQYSPSYPDTRSSC
FT                   SSGDDSVFSPDPMPYEPCLPQYPHINGSVKT"
XX
SQ   Sequence 2590 BP; 655 A; 683 C; 702 G; 550 T; 0 other;
     ctttcttctg ctgctgccca gatccgagag cagctccggt gtcatgtcct agctgttctg        60
     cgatccccgg cgcgcgtgaa gcctcggaac cttggcgccg gctgctaccc aaggaatcgt       120
     tctctttttg gagttttcct ccgagatcat cgcctgctcc atcccgatcc actctgggct       180
     ccggcgcagc accgagcgca gaggagcgct gccattcaag tggcagccac agcagcagca       240
     gcagcagcag tgggagcagg aacagcagta acaacagcaa cagcagcaca gccgcctcag       300
     agctttggct cctgagcccc ctgtgggctg aaggcattgc aggtagccca tggtctcaga       360
     agaagtgtgc agatgggatt accgtccacg tggagatatg gaagaggacc agggattggc       420
     actgtgacca tggtcagctg ggggcgcttc atctgcctgg tcttggtcac catggcaacc       480
     ttgtccctgg cccggccctc cttcagttta gttgaggata ccactttaga accagaagga       540
     gcaccgtact ggaccaacac cgagaagatg gagaagcggc tccacgctgt ccctgccgcc       600
     aacactgtga agttccgctg tccggctggg gggaatccaa cgcccacaat gaggtggtta       660
     aaaaacggga aggagtttaa gcaggagcat cgcattggag gctataaggt acgaaaccag       720
     cactggagtc ttattatgga aagcgtggtc ccgtcagaca aaggcaacta cacctgcctg       780
     gtggagaatg aatacgggtc catcaaccac acctaccacc tcgatgtcgt tgaacggtca       840
     ccacaccggc ccatcctcca agctggactg cctgcaaatg cctccacggt ggtcggaggg       900
     gatgtggagt ttgtctgcaa ggtttacagc gatgcccagc cccacatcca gtggatcaag       960
     cacgtggaaa agaacggcag taaatacggg cctgatgggc tgccctacct caaggtcctg      1020
     aaggccgccg gtgttaacac cacggacaaa gagattgagg ttctctatat tcggaatgta      1080
     acttttgagg atgctgggga atatacgtgc ttggcgggta attctatcgg gatatccttt      1140
     cactctgcat ggttgacagt tctgccagcg cctgtgagag agaaggagat cacggcttcc      1200
     ccagattatc tggagatagc tatttactgc ataggggtct tcttaatcgc ctgcatggtg      1260
     gtgacagtca tcttttgccg aatgaagacc acgaccaaga agccagactt cagcagccag      1320
     ccagctgtgc acaagctgac caagcgcatc cccctgcgga gacaggtaac agtttcggcc      1380
     gagtccagct cctccatgaa ctccaacacc ccgctggtga ggataacaac gcgtctgtcc      1440
     tcaacagcgg acaccccgat gctagcaggg gtctccgagt atgagttgcc agaggatcca      1500
     aagtgggaat tccccagaga taagctgacg ctgggcaaac ccctggggga aggttgcttc      1560
     gggcaagtag tcatggctga agcagtggga atcgataaag acaaacccaa ggaggcggtc      1620
     accgtggcag tgaagatgtt gaaagatgat gccacagaga aggacctgtc tgatctggta      1680
     tcagagatgg agatgatgaa gatgattggg aaacataaga acattatcaa cctcctgggg      1740
     gcctgcacgc aggatggacc tctctacgtc atagttgaat atgcatcgaa aggcaacctc      1800
     cgggaatacc tccgagcccg gaggccacct ggcatggagt actcctatga cattaaccgt      1860
     gtccccgagg agcagatgac cttcaaggac ttggtgtcct gcacctacca gctggctaga      1920
     ggcatggagt acttggcttc ccaaaaatgt atccatcgag atttggctgc cagaaacgtg      1980
     ttggtaacag aaaacaatgt gatgaagata gcagactttg gcctggccag ggatatcaac      2040
     aacatagact actataaaaa gaccacaaat gggcgacttc cagtcaagtg gatggctcct      2100
     gaagcccttt ttgatagagt ttacactcat cagagcgatg tctggtcctt cggggtgtta      2160
     atgtgggaga tctttacttt agggggctca ccctacccag ggattcccgt ggaggaactt      2220
     tttaagctgc tcaaagaggg acacaggatg gacaagccca ccaactgcac caatgaactg      2280
     tacatgatga tgagggattg ctggcatgct gtaccctcac agagacccac attcaagcag      2340
     ttggtcgaag acttggatcg aattctgact ctcacaacca atgaggaata cttggatctc      2400
     acccagcctc tcgaacagta ttctcctagt taccccgaca caaggagctc ttgttcttca      2460
     ggggacgatt ctgtgttttc tccagacccc atgccttatg aaccctgtct gcctcagtat      2520
     ccacacataa acggcagtgt taaaacatga gtgaatgtgt cttcctgtcc ccaaacagga      2580
     cagcaccagg                                                             2590
//