Dbfetch

ID   BC151113; SV 1; linear; mRNA; STD; MUS; 2459 BP.
XX
AC   BC151113;
XX
DT   13-MAY-2008 (Rel. 95, Created)
DT   13-MAY-2008 (Rel. 95, Last updated, Version 1)
XX
DE   Mus musculus neuregulin 1, mRNA (cDNA clone MGC:184026 IMAGE:9088026),
DE   complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2459
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2459
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (13-JUL-2007) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 2a79e253305aebe443afd3ed76aad87a.
DR   Ensembl-Gn; ENSMUSG00000062991; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0033518; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0033498; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0033422; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0033494; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034010; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0032533; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0033184; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0033337; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0033282; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0033427; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033324; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034029; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032245; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0032649; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000073884; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0088551; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0088639; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0088565; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0088584; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0089100; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0088682; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0088098; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0088293; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0088134; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0088322; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0088169; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0089390; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0088099; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0087187; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Ambion
CC   cDNA Library Preparation: British Columbia Cancer Research Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: LLDM Plate: 686 Row: i Column: 16.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2459
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_390"
FT                   /clone="MGC:184026 IMAGE:9088026"
FT                   /tissue_type="Brain,thymus,testicle,kidney,spleen,liver,
FT                   heart,lung,ovary,embryo - PCR rescued clones"
FT                   /note="Vector: pCR4-TOPO with reversed insert; Clone
FT                   identification sequence tag: CTTTTTCA"
FT                   /db_xref="taxon:10090"
FT   gene            1..2459
FT                   /gene="Nrg1"
FT                   /note="synonyms: ARIA, GGF, HRG, NDF, SMDF, HRGalpha,
FT                   GGFII"
FT   CDS             85..2187
FT                   /codon_start=1
FT                   /gene="Nrg1"
FT                   /product="neuregulin 1"
FT                   /db_xref="GOA:Q6DR99"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR002154"
FT                   /db_xref="InterPro:IPR013032"
FT                   /db_xref="InterPro:IPR018250"
FT                   /db_xref="MGI:MGI:96083"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DR99"
FT                   /protein_id="AAI51114.1"
FT                   /translation="MEIYPPDMSEGAGGRSSSPSTQLSADPSLDGLPAAEHMPDTHTED
FT                   GRSPGLLGLAVPCCVCLEAERLRGCLNSEKICIVPILACLVSLCLCIAGLKWVFVDKIF
FT                   EYDSPTHLDPGGLGQDPVISLDPTAASAVLVSSEAYTSPVSKAQSEAEAHVTGQGDHVA
FT                   VASEPSAVPTRKNRLSAFPPLHSTPPPFPSPARTPEVRTPKSGTQPQTTETNLQTAPKL
FT                   STSTSTTGTSHLIKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVM
FT                   ASFYKHLGIEFMEAEELYQKRVLTITGICIALLVVGIMCVVAYCKTKKQRQKLHDRLRQ
FT                   SLRSERNNMVNIANGPHHPNPPPENVQLVNQYVSKNVISSEHIVEREVETSFSTSHYTS
FT                   TAHHSTTVTQTPSHSWSNGHTESIISESHSVIMMSSVENSRHSSPAGGPRGRLHGLGGP
FT                   RECNSFLRHARETPDSYRDSPHSERYVSAMTTPARMSPVDFHTPSSPKSPPSEMSPPVS
FT                   SMTVSMPSVAVSPFVEEERPLLLVTPPRLREKKYDHHPQQLNSFHHNPAHQSTSLPPSP
FT                   LRIVEDEEYETTQEYEPIQEPIKKVTNSRRAKRTKPNGHIANRLEMDSNPSSVSSNSES
FT                   ETEDERVGEDTPFLGIQNPLAASLEVAPAFRLAESRTNPAGRFSTQEELQARLSSVIAN
FT                   QDPIAV"
XX
SQ   Sequence 2459 BP; 667 A; 650 C; 578 G; 564 T; 0 other;
     tctgaacgct gtatcatttg gttgggggga gctctgcatg gtaatgcact gtgagagagg        60
     ccgggccttc tggaggtgat ccggatggag atttatcccc cagacatgtc tgagggagct       120
     ggcgggaggt cctccagccc ctccactcag ctgagtgcag acccatctct cgatgggctt       180
     ccggcagcgg aacatatgcc agacacccac acagaagatg ggagaagccc tggactcctg       240
     ggcctggcgg tgccctgctg tgtctgcctg gaagcggagc gtctcagagg gtgcctcaac       300
     tccgagaaga tctgcattgt tcccattctg gcttgtctag taagcctctg cctctgcatt       360
     gctggcctaa agtgggtatt tgtggacaag atatttgaat acgactctcc tacccacctt       420
     gaccctgggg ggttaggcca ggaccctgtt atttctctgg atccaacggc tgcctccgct       480
     gttttggtat catccgaggc atacacttca cctgtctcta aggctcagtc tgaagctgag       540
     gctcatgtta cagggcaagg tgaccatgtc gctgtggcct ctgaaccttc cgcagtaccc       600
     acccggaaga accggctgtc tgcttttcct cccttacact ccactccacc gcccttccct       660
     tctccagctc ggacccctga ggtgagaaca cccaagtcag gaactcagcc acaaacaaca       720
     gaaactaatc tgcaaactgc tcctaaactt tccacatcta catccacgac tgggaccagc       780
     catctcataa agtgtgcgga gaaggagaaa actttctgtg tgaatggagg cgagtgcttc       840
     atggtgaagg acctgtcaaa cccctcaaga tacttgtgca agtgcccaaa tgagtttact       900
     ggtgatcgtt gccaaaacta cgtaatggcc agcttctaca agcatcttgg gattgaattt       960
     atggaagcgg aggagctcta ccagaagagg gtactgacaa ttactggcat ctgtatcgcc      1020
     ctgttggtgg tcggcatcat gtgtgtggtg gcctactgca aaaccaagaa acagcggcag      1080
     aagcttcatg atcggctccg gcagagcctt cggtcagaac gaaacaacat ggtgaacata      1140
     gcgaatggcc ctcaccatcc aaacccacca ccagagaatg tgcaactggt gaatcaatat      1200
     gtatctaaaa acgtcatctc cagtgagcat attgtggaga gagaagtgga gacctccttt      1260
     tccaccagtc actacacttc cacagctcat cactccacga ctgtcaccca gactcctagt      1320
     cacagctgga gtaatgggca cacagaaagc atcatttcag aaagccactc tgtaatcatg      1380
     atgtcatcgg tagagaacag caggcacagc agcccagctg ggggcccacg aggacgtctt      1440
     catggcctgg gaggccctcg cgaatgtaac agcttcctca ggcatgccag agaaacccct      1500
     gactcctaca gagactctcc tcatagtgaa aggtatgtat cagccatgac caccccggct      1560
     cgtatgtcac ctgtagattt ccacacgcca agctccccta aatcgccccc ttcggaaatg      1620
     tctccacccg tgtccagcat gacggtgtcc atgccctctg tggcagtcag cccctttgtg      1680
     gaagaagaga ggcctctgct tcttgtgaca ccaccgaggc tacgggagaa gaagtatgat      1740
     catcaccccc agcaactcaa ctcctttcat cacaaccctg cacatcagag taccagcctc      1800
     ccccctagcc cattgaggat agtggaggat gaggaatacg aaacgaccca ggagtatgag      1860
     ccaattcaag agcctattaa gaaagtcacc aatagccggc gggccaaaag aaccaagccc      1920
     aatggccaca ttgccaatag gttggaaatg gacagcaacc caagttctgt gagcagtaac      1980
     tcagaaagtg agacagaaga tgaaagagta ggtgaagata caccattcct gggcatacag      2040
     aaccccctgg cagccagcct tgaggtggcc cctgccttcc gtctggctga gagcaggact      2100
     aacccagcag gccgcttctc cacacaggaa gaattacagg ccaggctgtc tagtgtaatc      2160
     gctaaccaag accctattgc tgtataaaac ctaaataaac acatagattc acctgtaaaa      2220
     ctttatttta tataataaag tatttcacct taaattaaac aatttatttt attttagcag      2280
     ttctgcaaat agaaaacagg aagaaaaaaa cttttataaa ttaaatatat gtatgtaaaa      2340
     atgtgttatg tgccatatgt agcaattttt tacagtattt caaaaaaacg agaaagatat      2400
     caatggtgcc tttatgttat gttatgtcga gagcaagttt tataaagtta cggtggttg       2459
//