Dbfetch

ID   BC150870; SV 1; linear; mRNA; STD; MUS; 1865 BP.
XX
AC   BC150870;
XX
DT   12-FEB-2009 (Rel. 99, Created)
DT   12-FEB-2009 (Rel. 99, Last updated, Version 1)
XX
DE   Mus musculus aminolevulinic acid synthase 2, erythroid, mRNA (cDNA clone
DE   MGC:183781 IMAGE:9087781), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1865
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1865
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (13-JUL-2007) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 8f09147290f71eb6b1ad1f04df5b6306.
DR   Ensembl-Gn; ENSMUSG00000025270; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000066337; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Ambion
CC   cDNA Library Preparation: British Columbia Cancer Research Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRCK Plate: 16 Row: P Column: 20
CC   single stranded.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1865
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_377"
FT                   /clone="MGC:183781 IMAGE:9087781"
FT                   /tissue_type="Brain, PCR rescued clones"
FT                   /note="Vector: pCR4-TOPO; Clone identification sequence
FT                   tag: CCTCCCAC"
FT                   /db_xref="taxon:10090"
FT   gene            1..1865
FT                   /gene="Alas2"
FT                   /gene_synonym="ALAS"
FT                   /gene_synonym="ALAS-E"
FT                   /gene_synonym="ALASE"
FT   CDS             32..1795
FT                   /codon_start=1
FT                   /gene="Alas2"
FT                   /gene_synonym="ALAS"
FT                   /gene_synonym="ALAS-E"
FT                   /gene_synonym="ALASE"
FT                   /product="aminolevulinic acid synthase 2, erythroid"
FT                   /db_xref="GOA:A2AFM0"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR010961"
FT                   /db_xref="InterPro:IPR015118"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="MGI:MGI:87990"
FT                   /db_xref="UniProtKB/TrEMBL:A2AFM0"
FT                   /protein_id="AAI50871.1"
FT                   /translation="MVAAAMLLRSCPVLSQGPTGLLGKVAKTYQFLFSIGRCPILATQG
FT                   PTCSQIHLKATKAGGDSPSWAKSHCPFMLSELQDRKSKIVQRAAPEVQEDVKTFKTDLL
FT                   STMDSTTRSHSFPSFQEPEQTEGAVPHLIQNNMTGSQAFGYDQFFRDKIMEKKQDHTYR
FT                   VFKTVNRWANAYPFAQHFSEASMASKDVSVWCSNDYLGISRHPRVLQAIEETLKNHGAG
FT                   AGGTRNISGTSKFHVELEQELAELHQKDSALLFSSCFVANDSTLFTLAKLLPGCEIYSD
FT                   AGNHASMIQGIRNSGAAKFVFRHNDPGHLKKLLEKSDPKTPKIVAFETVHSMDGAICPL
FT                   EELCDVAHQYGALTFVDEVHAVGLYGARGAGIGERDGIMHKLDIISGTLGKAFGCVGGY
FT                   IASTRDLVDMVRSYAAGFIFTTSLPPMVLSGALESVRLLKGEEGQALRRAHQRNVKHMR
FT                   QLLMDRGFPVIPCPSHIIPIRVGNAALNSKICDLLLSKHSIYVQAINYPTVPRGEELLR
FT                   LAPSPHHSPQMMENFVEKLLLAWTEVGLPLQDVSVAACNFCHRPVHFELMSEWERSYFG
FT                   NMGPQYVTTYA"
XX
SQ   Sequence 1865 BP; 430 A; 510 C; 480 G; 445 T; 0 other;
     cagtgcaggg caacaggact ttgggctcag gatggtggca gcagctatgt tgctacggtc        60
     ctgtccagtg ctctctcagg gccccacagg cctcctgggc aaagtggcta aaacctacca       120
     gttcctattt agtattggac gctgccccat cctggccact caaggaccaa cctgttctca       180
     aatccatctt aaggcaacca aggctggagg agactctcca tcttgggcta agagccattg       240
     tcctttcatg ctgtcagaac tccaagacag gaagagcaag attgtgcaga gggcagctcc       300
     agaagttcaa gaggatgtca agactttcaa gacagacctg ctgagcacca tggattcaac       360
     cacccgaagc cattcatttc ctagtttcca ggagccagag cagactgaag gggcagttcc       420
     ccacctgatt cagaacaata tgactggaag ccaggctttc ggttatgacc aatttttcag       480
     agacaagatc atggagaaga aacaggacca cacctaccgt gtgttcaaga ctgtgaatcg       540
     ttgggctaat gcctacccct ttgcccaaca cttctccgag gcatctatgg catcaaagga       600
     tgtttctgtt tggtgtagta atgactattt gggcataagc agacaccctc gtgtcttgca       660
     ggccatagag gagaccctga agaatcatgg agctggagct gggggcactc gcaatatctc       720
     aggtaccagc aagtttcatg tggagcttga acaggagctg gctgaactac accagaaaga       780
     ctcagctctg ctcttctcct cctgttttgt ggccaatgat tctactctct ttacactggc       840
     caagcttctg ccagggtgtg agatctactc agatgcaggc aatcatgcct ccatgatcca       900
     aggcattcgc aacagtggtg cagccaagtt tgtcttcaga cacaatgacc caggccacct       960
     gaagaaactt ctcgagaagt ctgatcccaa gacaccaaaa attgtggctt ttgagactgt      1020
     tcattccatg gatggtgcca tctgtcctct ggaggaattg tgtgatgtgg cccaccagta      1080
     tggagccctg accttcgtag atgaagtcca tgctgtagga ctgtatggag cccggggtgc      1140
     aggtatcggg gagcgtgatg gaattatgca caagcttgac atcatctctg gaactcttgg      1200
     caaggccttt ggttgcgtcg gtggctatat agccagcact cgggacttgg tggacatggt      1260
     gcgctcctac gctgcaggct tcatctttac cacttcactg cctcccatgg tgctctctgg      1320
     ggctctagaa tctgtgcgcc tactcaaggg agaggagggt caagccctga ggcgggcaca      1380
     ccagcgcaat gtcaaacaca tgcgccagct gctaatggac aggggctttc ctgttatccc      1440
     ctgtcccagc cacatcatcc ccatcagggt gggtaatgca gcactcaaca gcaagatctg      1500
     tgatcttctg ctctccaagc acagcatcta tgtgcaggcc atcaactacc caactgtgcc      1560
     tcgtggtgag gagctactgc gcttggcccc ctccccccac cacagccctc agatgatgga      1620
     aaactttgtg gagaagctgc tgctggcctg gactgaggtg gggctgcccc tccaagatgt      1680
     gtctgtggct gcatgcaact tctgtcatcg tcctgtgcac tttgaactta tgagcgagtg      1740
     ggagcgatcc tactttggga acatgggacc ccaatatgtt accacctatg cttaaggagc      1800
     cagctgcctt ggatgccagc tccacctgca ctccccctgg ggctgggctt cctcctgctc      1860
     tctgc                                                                  1865
//