spacer

EBI Dbfetch

ID   BC147077; SV 1; linear; mRNA; STD; MUS; 1417 BP.
XX
AC   BC147077;
XX
DT   13-MAY-2008 (Rel. 95, Created)
DT   13-MAY-2008 (Rel. 95, Last updated, Version 1)
XX
DE   Mus musculus protein O-fucosyltransferase 2, mRNA (cDNA clone MGC:182170
DE   IMAGE:9056064), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1417
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1417
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (26-JUN-2007) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; c2415a81186e88f46eade618878bc3dc.
DR   Ensembl-Gn; ENSMUSG00000020260; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020493; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Ambion
CC   cDNA Library Preparation: British Columbia Cancer Research Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: LLDM Plate: 682 Row: e Column: 22.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1417
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_378"
FT                   /clone="MGC:182170 IMAGE:9056064"
FT                   /tissue_type="Brain, PCR rescued clones"
FT                   /note="Vector: pCR4-TOPO with reversed insert; Clone
FT                   identification sequence tag: ACTTGGTA"
FT                   /db_xref="taxon:10090"
FT   gene            1..1417
FT                   /gene="Pofut2"
FT                   /note="synonyms: C21orf80, FUT13"
FT   CDS             91..1380
FT                   /codon_start=1
FT                   /gene="Pofut2"
FT                   /product="protein O-fucosyltransferase 2"
FT                   /db_xref="GOA:B2RV73"
FT                   /db_xref="InterPro:IPR019378"
FT                   /db_xref="MGI:MGI:1916863"
FT                   /db_xref="UniProtKB/TrEMBL:B2RV73"
FT                   /protein_id="AAI47078.1"
FT                   /translation="MAALSVVCLLLAAASWRPVSASGEEFWPGQSAADILSGAASRRRY
FT                   LLYDVNPPEGFNLRRDVYIRVASLLKTLLKTEEWVLVLPPWGRLYHWQSPDIHQVRIPW
FT                   SEFFDLPSLNKNIPVIEYEQFIAESGGPFIDQVYVLQGYAEGWKEGTWEEKVDARPCID
FT                   PLLYSQDKHEYYRGWFWGYEETRGLNVSCLSVQGSASIVAPVLLKNTSARSVMLDRAEN
FT                   LLHDHYGGREYWDTRRSMVFAKHLRAVGDEFRSQHLNSTDAADKMAPEEDWTKMKVKLG
FT                   SALGGPYLGVHLRRKDFIWGHREDVPSLEGAVKKIRSLMKTHQLDKVFVATDAIRKEQE
FT                   ELRKLLPEMVRFEPTWEELELYKDGGVAIIDQWICAHARFFIGTSVSTFSFRIHEEREI
FT                   LGLDPKTTYNRFCGDQEKACEQPTHWKIAY"
XX
SQ   Sequence 1417 BP; 301 A; 387 C; 450 G; 279 T; 0 other;
     gccgtagcta ctggagacgc gctccgtggg gcggacaggc gcacttccgg accggggcgc        60
     ggcagccgga agtgcgtggc cgccggggcc atggcggcgc tcagcgtcgt ctgcctgctg       120
     ctggcagcgg catcctggcg gccggtctcg gcttcaggag aagaattctg gcctggccag       180
     tcggcggcgg acatcctgtc gggggcggca tcccgcagac ggtacctcct gtatgatgtc       240
     aaccccccag aaggcttcaa tctccgcagg gatgtctata tccgggtggc atccttgctg       300
     aagacgctgt tgaagactga agagtgggtg ctagtcctgc ccccgtgggg ccgcctctac       360
     cactggcaaa gccctgacat ccaccaggtc cggattccct ggtccgagtt ttttgacctc       420
     ccgagtctca ataaaaacat ccccgttata gagtatgagc agttcattgc agagtccggc       480
     gggcccttta tcgaccaggt gtacgtccta caaggttacg ccgagggctg gaaggagggc       540
     acctgggagg agaaggtgga cgcacggccc tgtattgacc ctctgctgta ctcgcaggac       600
     aagcatgagt attacagagg ctggttttgg ggctacgaag aaacacgggg tctgaatgtc       660
     tcctgcctgt ccgtccaggg gtcggcttcc atcgtcgcgc ctgtcctctt aaaaaacaca       720
     tctgctcggt ctgtgatgct ggaccgagct gagaatctgc ttcatgacca ctatggaggc       780
     cgggagtact gggatacccg gcgcagcatg gtgtttgcaa agcacttgcg ggctgtggga       840
     gacgagttta ggagccagca cctcaactcg acggatgccg ctgataagat ggccccggag       900
     gaagactgga cgaagatgaa ggtcaaactg ggctcagcac taggcggccc ctacctcgga       960
     gtccacctga gaaggaagga cttcatctgg ggccacaggg aggatgtgcc cagcctggag      1020
     ggcgccgtga agaagatccg cagcctcatg aagactcatc agctggacaa ggtgttcgtg      1080
     gccacagacg ccatcaggaa ggagcaggaa gaattgagga agctgctgcc ggaaatggtg      1140
     aggtttgagc ccacgtggga ggagctggag ctgtacaagg acggaggcgt cgccatcatc      1200
     gatcagtgga tctgcgctca tgccaggttt tttattggca cctctgtttc cacattttcc      1260
     tttcggattc atgaagagag agagatcctg gggttggacc ccaagacaac atacaaccgg      1320
     ttttgtggag accaggagaa agcatgtgag cagcccacac actggaagat tgcgtactga      1380
     gggccaccta tccaccgcct gccaatcact cggtcac                               1417
//


spacer
spacer