spacer

EBI Dbfetch

ID   BC146003; SV 1; linear; mRNA; STD; MUS; 1849 BP.
XX
AC   BC146003;
XX
DT   17-JUN-2007 (Rel. 92, Created)
DT   14-JUL-2007 (Rel. 92, Last updated, Version 2)
XX
DE   Mus musculus 3-phosphoinositide dependent protein kinase-1, mRNA (cDNA
DE   clone MGC:175890 IMAGE:40131306), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1849
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1849
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (12-JUN-2007) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 15f9008addf982ba9b2619cdf0b988bd.
DR   Ensembl-Gn; ENSMUSG00000024122; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102927; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Ambion
CC   cDNA Library Preparation: British Columbia Cancer Research Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRCK Plate: 7 Row: P Column: 3.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1849
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_378"
FT                   /clone="MGC:175890 IMAGE:40131306"
FT                   /tissue_type="Brain, PCR rescued clones"
FT                   /note="Vector: pCR4-TOPO with reversed insert; Clone
FT                   identification sequence tag: TCTTGTCC"
FT                   /db_xref="taxon:10090"
FT   gene            1..1849
FT                   /gene="Pdpk1"
FT                   /note="synonym: Pdk1"
FT   CDS             72..1751
FT                   /codon_start=1
FT                   /gene="Pdpk1"
FT                   /product="3-phosphoinositide dependent protein kinase-1"
FT                   /db_xref="GOA:Q9Z2A0"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="MGI:MGI:1338068"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z2A0"
FT                   /protein_id="AAI46004.1"
FT                   /translation="MARTTSQLYDAVPIQSSVVLCSCPSPSMVRSQTEPGSSPGIPSGV
FT                   SRQGSTMDGTTAEARPSTNPLQQHPAQLPPQPRKKRPEDFKFGKILGEGSFSTVVLARE
FT                   LATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLS
FT                   YAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHI
FT                   QITDFGTAKVLSPESKQARANSFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAG
FT                   LPPFRAGNEYLIFQKIIKLEYHFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLK
FT                   AHPFFETITWENLHQQTPPKLTAYLPAMSEDDEDCYGNYDNLLSQFGFMQVSSSSSSHS
FT                   LSTVETSLPQRSGSNIEQYIHDLDTNSFELDLQFSEDEKRLLLEKQAGGNPWHQFVENN
FT                   LILKMGPVDKRKGLFARRRQLLLTEGPHLYYVDPVNKVLKGEIPWSQELRPEAKNFKTF
FT                   FVHTPNRTYYLMDPSGNAHKWCRKIQEVWRQQYQSNPDAAVQ"
XX
SQ   Sequence 1849 BP; 511 A; 463 C; 444 G; 431 T; 0 other;
     ggatgaggac gctgaggagg cgccgagcag cgcaacgctg cgggggaggc gcccgcgccg        60
     acttggggct catggccagg accaccagcc agctgtatga cgctgtgccc attcagtcca       120
     gtgtggtgct atgttcctgc ccatccccat caatggtgag gtcccagact gagcccggtt       180
     cgtcccctgg cattcctagt ggtgttagca ggcagggatc caccatggat ggcaccacag       240
     ctgaagcccg accaagcacc aaccccttgc agcagcaccc tgcccagctg ccaccacagc       300
     ctcgcaagaa acgccctgaa gacttcaagt ttgggaaaat tcttggcgag ggctcttttt       360
     caacagttgt tctggcccga gaactggcca cttccagaga atatgctatt aaaattctgg       420
     agaaacgtca tattataaaa gaaaacaaag ttccgtatgt aactagagag agagatgtga       480
     tgtcacgcct ggatcacccc ttctttgtga aactttattt tacatttcag gacgacgaaa       540
     agctgtattt tggccttagt tatgccaaaa atggagagct acttaaatac atccgcaaaa       600
     ttggctcatt tgatgagacc tgtacccggt tttacacggc tgagattgtg tctgctttag       660
     agtacttgca tggcaagggc atcattcaca gagaccttaa accagaaaac attttgttaa       720
     atgaagacat gcacatccag atcacagatt ttggaacagc aaaagtgtta tccccagaga       780
     gcaaacaagc cagggccaac tcatttgtag gaacagcaca gtatgtttct ccagagctgc       840
     tcacagagaa gtcggcgtgt aaaagttcag acctttgggc ccttggatgt ataatctatc       900
     agctcgtggc aggactccca ccattcagag ccgggaatga atatcttata tttcagaaga       960
     tcattaagct ggaatatcat ttcccagaaa aattcttccc taaggctaga gatcttgtgg      1020
     aaaaactctt ggttttagat gccacaaagc gtttaggctg tgaagagatg gaagggtacg      1080
     ggcctctcaa agctcatcca ttctttgaga ccatcacttg ggagaatttg caccagcaga      1140
     cacctccgaa gctcacagct tacctaccag ccatgtcaga ggatgatgaa gactgctatg      1200
     gcaactacga caatctcctg agccagtttg gcttcatgca ggtgtcatcc tcctcctctt      1260
     cccactccct gtctacggtg gaaaccagcc tgccccagag gtcgggcagc aacatagagc      1320
     agtacatcca tgatttggac actaactctt ttgaactaga cttacagttt tcagaagatg      1380
     aaaaaaggtt gttattggaa aagcaagccg gtggaaaccc ttggcaccag tttgtagaaa      1440
     ataatctaat attaaaaatg ggtccagtgg ataagcgaaa gggtttattt gcaagacgac      1500
     gacagttatt actcacagaa gggccacatt tatattatgt tgatcctgtc aacaaggtct      1560
     tgaaaggtga aatcccatgg tcacaagaac tccgaccaga agccaagaat tttaaaactt      1620
     tctttgtcca cacgcctaac aggacgtact acctgatgga tccaagcggg aatgctcaca      1680
     agtggtgcag aaagatccag gaggtttgga ggcagcagta ccagagcaat ccagatgctg      1740
     ctgtgcagtg acgtggcctg cggccgggct gcctattgct gccaggatac ctgccccagc      1800
     gcggctcggc cgccacccag gacgcttcca gaccacctgc cagccatct                  1849
//


spacer
spacer