spacer

EBI Dbfetch

ID   BC145971; SV 1; linear; mRNA; STD; MUS; 1029 BP.
XX
AC   BC145971;
XX
DT   17-JUN-2007 (Rel. 92, Created)
DT   14-JUL-2007 (Rel. 92, Last updated, Version 2)
XX
DE   Mus musculus calcium channel, voltage-dependent, gamma subunit 3, mRNA
DE   (cDNA clone MGC:175858 IMAGE:40131274), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1029
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1029
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (12-JUN-2007) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 444a00f06d5169ed9feffeb57747c4ae.
DR   Ensembl-Gn; ENSMUSG00000066189; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000084615; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Ambion
CC   cDNA Library Preparation: British Columbia Cancer Research Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRCK Plate: 7 Row: N Column: 19.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1029
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_378"
FT                   /clone="MGC:175858 IMAGE:40131274"
FT                   /tissue_type="Brain, PCR rescued clones"
FT                   /note="Vector: pCR4-TOPO with reversed insert; Clone
FT                   identification sequence tag: CTGTAACG"
FT                   /db_xref="taxon:10090"
FT   gene            1..1029
FT                   /gene="Cacng3"
FT   CDS             31..978
FT                   /codon_start=1
FT                   /gene="Cacng3"
FT                   /product="calcium channel, voltage-dependent, gamma subunit
FT                   3"
FT                   /db_xref="GOA:Q9JJV5"
FT                   /db_xref="InterPro:IPR004031"
FT                   /db_xref="InterPro:IPR008368"
FT                   /db_xref="MGI:MGI:1859165"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JJV5"
FT                   /protein_id="AAI45972.1"
FT                   /translation="MRMCDRGIQMLITTVGAFAAFSLMTIAVGTDYWLYSRGVCRTKST
FT                   SDNETSRKNEEVMTHSGLWRTCCLEGAFRGVCKKIDHFPEDADYEQDTAEYLLRAVRAS
FT                   SVFPILSVTLLFFGGLCVAASEFHRSRHSVILSAGIFFVSAGLSNIIGIIVYISANAGD
FT                   PGQRDSKKSYSYGWSFYFGAFSFIIAEIVGVVAVHIYIEKHQQLRARSHSELLKKSTFA
FT                   RLPPYRYRFRRRSSSRSTEPRSRDLSPISKGFHTIPSTDISMFTLSRDPSKLTMGTLLN
FT                   SDRDHAFLQFHNSTPKEFKESLHNNPANRRTTPV"
XX
SQ   Sequence 1029 BP; 246 A; 296 C; 244 G; 243 T; 0 other;
     ccccagccgt tcagagtacc atgaagaatt atgaggatgt gtgacagagg tatccagatg        60
     ttgatcacta ctgtaggagc cttcgcagct tttagtttaa tgaccattgc agtgggcacg       120
     gactactggc tatattccag aggtgtgtgc aggactaaat ctacaagtga caatgaaacc       180
     agcaggaaga atgaagaagt aatgacccac tccgggttgt ggaggacctg ctgcttggaa       240
     ggagctttcc gaggcgtgtg caagaaaatc gatcacttcc cagaagatgc agactatgaa       300
     caggatacag cagaatatct tctacgagct gtgagggcct ccagcgtctt tcccatcctc       360
     agcgtcactc tgctgttttt cgggggactc tgcgtggctg ccagcgagtt ccaccgcagc       420
     aggcacagtg tgatcctcag cgctggcatc ttcttcgtct ctgcagggct aagcaacatc       480
     atcggcatca tagtttatat ctcagccaat gctggagacc ctgggcagag ggactctaaa       540
     aagagctact cctacggctg gtccttttat tttggagcct tctctttcat catcgcggaa       600
     attgtgggcg tggtcgccgt gcacatctat atcgagaagc atcagcagtt gcgtgccaga       660
     tcccattcag agctcctgaa gaagtctaca tttgcgcgcc tgccgcccta caggtataga       720
     ttccgaagac ggtcaagttc tcgctccact gaacccagat ctcgagacct ttctcccatc       780
     agcaaaggct tccacaccat cccttccacc gacatctcca tgttcaccct ctcccgggac       840
     ccctctaagc ttaccatggg gacccttctc aactctgacc gggaccatgc ttttctacag       900
     ttccacaact ccacacccaa agagttcaaa gagtcattgc ataacaatcc ggccaacaga       960
     cgtaccacgc ctgtctgagc tgacctctga cctctgcccc gccgcccagc acagccttgg      1020
     gggaagtgt                                                              1029
//


spacer
spacer