spacer

EBI Dbfetch

ID   BC145647; SV 1; linear; mRNA; STD; MUS; 1183 BP.
XX
AC   BC145647;
XX
DT   17-JUN-2007 (Rel. 92, Created)
DT   05-DEC-2007 (Rel. 94, Last updated, Version 3)
XX
DE   Mus musculus steroid 5 alpha-reductase 3, mRNA (cDNA clone MGC:175534
DE   IMAGE:40130950), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1183
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1183
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (12-JUN-2007) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 83bfd4f258b2d810cb69a50c3244a752.
DR   Ensembl-Gn; ENSMUSG00000029233; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031143; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Ambion
CC   cDNA Library Preparation: British Columbia Cancer Research Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRCK Plate: 7 Row: A Column: 7.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1183
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_377"
FT                   /clone="MGC:175534 IMAGE:40130950"
FT                   /tissue_type="Brain, PCR rescued clones"
FT                   /note="Vector: pCR4-TOPO; Clone identification sequence
FT                   tag: GTTTCATG"
FT                   /db_xref="taxon:10090"
FT   gene            1..1183
FT                   /gene="Srd5a3"
FT                   /note="synonyms: H5ar, A430076C09"
FT   CDS             52..1044
FT                   /codon_start=1
FT                   /gene="Srd5a3"
FT                   /product="Srd5a3 protein"
FT                   /db_xref="GOA:Q9WUP4"
FT                   /db_xref="InterPro:IPR001104"
FT                   /db_xref="MGI:MGI:1930252"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9WUP4"
FT                   /protein_id="AAI45648.1"
FT                   /translation="MAGWAGFELSALNPLRTLWLALAAAFLFALLLQLAPARLLPSCAL
FT                   FQDLLRYGKTKQSGSRRPAVCRAFDVPKRYFSHFYVISVVWNGSLLWLLSQSLFLGAPF
FT                   PNWLGALLRTLGATQFQALEMESKASRMPAAELALSAFLVLVFLWVHSLRRLFECFYVS
FT                   VFSNAAIHVVQYCFGLVYYVLVGLTVLSQVPMDDKNVYVLGKNLLIQARWFHILGMVMF
FT                   FWSSAHQYKCHVILSNLRRNKKGVVIHCQHRIPFGDWFEYVSSANYLAELMIYISMAVT
FT                   FGLHNLTWWLVVTYVFFSQALSAFFNHKFYRSTFVSYPKHRKAFLPFLF"
FT   misc_difference 330
FT                   /gene="Srd5a3"
FT                   /note="'G' in cDNA is 'A' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 343
FT                   /gene="Srd5a3"
FT                   /note="'C' in cDNA is 'T' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 376
FT                   /gene="Srd5a3"
FT                   /note="'G' in cDNA is 'A' in the mouse genome; amino acid
FT                   difference: 'G' in cDNA, 'S' in the mouse genome."
FT   misc_difference 405
FT                   /gene="Srd5a3"
FT                   /note="'G' in cDNA is 'A' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 540
FT                   /gene="Srd5a3"
FT                   /note="'C' in cDNA is 'T' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 567
FT                   /gene="Srd5a3"
FT                   /note="'C' in cDNA is 'T' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 642
FT                   /gene="Srd5a3"
FT                   /note="'C' in cDNA is 'T' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 944
FT                   /gene="Srd5a3"
FT                   /note="'T' in cDNA is 'C' in the mouse genome; amino acid
FT                   difference: 'F' in cDNA, 'S' in the mouse genome."
FT   misc_difference 1089
FT                   /gene="Srd5a3"
FT                   /note="'G' in cDNA is 'T' in the mouse genome."
FT   misc_difference 1162^1163
FT                   /gene="Srd5a3"
FT                   /note="4 bases in the mouse genome, AGCC, are not found in
FT                   cDNA."
XX
SQ   Sequence 1183 BP; 214 A; 341 C; 325 G; 303 T; 0 other;
     gagagaagga gggcggcgcg gcggcgcgca tctgtagccg gctcccgggc tatggctggg        60
     tgggccgggt ttgagctctc ggccctgaac cccctgcgga cgctgtggct ggcgctggcc       120
     gccgccttcc tgttcgcgct gctgctgcag ctggcgcccg ccaggctgct gccgagctgc       180
     gcgctcttcc aggacctgct ccgctacggg aagaccaagc agtccggctc gcggcgcccc       240
     gccgtctgca gggccttcga tgtccccaag aggtactttt ctcacttcta cgtcatctca       300
     gttgtgtgga atggctccct gctctggctg ctttctcagt cgctgttcct gggagcacct       360
     tttccaaact ggcttggtgc tctgctcaga actcttgggg ccacgcagtt ccaagccctg       420
     gagatggagt ccaaggcttc tcggatgcca gcggctgagc tggctctgtc tgccttcttg       480
     gtcttggtgt tcctctgggt ccacagcctt cggagactct ttgagtgctt ctacgtcagc       540
     gtcttctcta atgcagccat tcacgtcgtg cagtactgtt tcgggcttgt ctactatgtg       600
     cttgttggcc tgactgtact gagccaagtg cccatggatg acaagaatgt gtatgttctg       660
     gggaagaatc tactgataca agcccggtgg ttccacatcc tgggcatggt gatgttcttc       720
     tggtcatccg cccatcagta taaatgccac gtcatcctca gcaacctcag gagaaacaaa       780
     aaaggtgtgg tcatccactg ccagcaccgg atcccctttg gagactggtt cgagtacgtg       840
     tcttcagcta actacctagc agagctgatg atctacatct ccatggctgt cacctttggg       900
     ctccacaact taacctggtg gctggtggtg acgtatgtct tcttcagcca agccttgtcc       960
     gcattcttca accacaagtt ctacagaagc acatttgtct cctacccaaa gcataggaaa      1020
     gcgttcctcc catttttgtt ttaaagcggg ctttatggtg aagaaagcca ggtgacagat      1080
     tccattccga gaggcactga gacagagacc aaagtacact ttctgcggga atgtttgacg      1140
     gtccttgttc tacttcagag ccgagcagtg ttcaccgagc gag                        1183
//


spacer
spacer