Dbfetch

ID   BC141368; SV 1; linear; mRNA; STD; MUS; 4205 BP.
XX
AC   BC141368;
XX
DT   12-FEB-2009 (Rel. 99, Created)
DT   12-FEB-2009 (Rel. 99, Last updated, Version 1)
XX
DE   Mus musculus chemokine (C motif) receptor 1, mRNA (cDNA clone MGC:176330
DE   IMAGE:9055981), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4205
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-4205
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (03-MAY-2007) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; e17e8cc24c8092722edeedffde7355e5.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Ambion
CC   cDNA Library Preparation: British Columbia Cancer Research Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: LLDM Plate: 682 Row: b Column: 11
CC   single stranded.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4205
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_391"
FT                   /clone="MGC:176330 IMAGE:9055981"
FT                   /tissue_type="Brain,thymus,testicle,kidney,spleen,liver,
FT                   heart,lung,ovary,embryo - PCR rescued clones"
FT                   /note="Vector: pCR-XL-TOPO; Clone identification sequence
FT                   tag: CGGCTGGT"
FT                   /db_xref="taxon:10090"
FT   gene            1..4205
FT                   /gene="Xcr1"
FT                   /gene_synonym="GPR5"
FT   CDS             28..996
FT                   /codon_start=1
FT                   /gene="Xcr1"
FT                   /gene_synonym="GPR5"
FT                   /product="chemokine (C motif) receptor 1"
FT                   /db_xref="GOA:Q544D8"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR005393"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:1346338"
FT                   /db_xref="UniProtKB/TrEMBL:Q544D8"
FT                   /protein_id="AAI41369.1"
FT                   /translation="MESSTAFYDYHDKLSLLCENNVIFFSTISTIVLYSLVFLLSLVGN
FT                   SLVLWVLVKYENLESLTNIFILNLCLSDLMFSCLLPVLISAQWSWFLGDFFCKFFNMIF
FT                   GISLYSSIFFLTIMTIHRYLSVVSPISTLGIHTLRCRVLVTSCVWAASILFSIPDAVFH
FT                   KVISLNCKYSEHHGFLASVYQHNIFFLLSMGIILFCYVQILRTLFRTRSRQRHRTVRLI
FT                   FTVVVAYFLSWAPYNLTLFLKTGIIQQSCESLQQLDIAMIICRHLAFSHCCFNPVLYVF
FT                   VGIKFRRHLKHLFQQVWLCRKTSSTVPCSPGTFTYEGPSFY"
XX
SQ   Sequence 4205 BP; 1169 A; 991 C; 784 G; 1261 T; 0 other;
     ctcagtatcc ctgcatcccg cgtccagatg gagtcctcta cagcctttta tgattatcat        60
     gataaattga gtcttctatg tgagaacaat gtcatcttct tttccaccat ctctaccatt       120
     gtcctgtact ctctggtatt tctcctcagc cttgtgggta acagcctggt tttgtgggtc       180
     ttggtgaagt atgagaatct agagtcactc accaatatct tcatcctcaa cctgtgtctc       240
     tcagacctga tgttctcctg tctactgcct gtgttgatct cagcacaatg gagttggttt       300
     ctaggtgact tcttctgcaa gttcttcaac atgatcttcg gcatcagcct ctacagcagc       360
     atcttcttcc ttaccatcat gaccatccac cgatacctgt ctgtagtgag ccccatctct       420
     actctgggta tccataccct ccgctgccgt gtgctggtga catcatgtgt gtgggcagcc       480
     agcatcctgt tctccatccc tgatgctgtc ttccacaaag tgatctcctt aaattgtaaa       540
     tattctgaac atcatgggtt cttggcctca gtctaccagc acaacatctt cttcctcctc       600
     tccatgggaa tcatcctatt ctgttatgta cagattctca ggactttgtt tcgcacaagg       660
     tccagacaga gacaccgaac agtcaggctc atcttcaccg tcgtggtagc atacttcctc       720
     agctgggctc cctacaacct cacactcttc ctgaaaactg gaatcatcca gcagagctgt       780
     gagagccttc agcaactgga cattgctatg attatctgtc gccatttggc cttctctcat       840
     tgctgtttca acccagtgct ttatgtcttt gttgggatca agttccgcag acacctaaaa       900
     catctcttcc agcaggtctg gctgtgccgg aagacatcca gcactgttcc ctgctcccct       960
     ggtaccttta catatgaggg accctccttc tactgagagg agaggatggg cacatggaga      1020
     tgactatggg aggtaaagga agacaaggag aagtggatca ggaaggaaaa tataactgaa      1080
     gatactacag agtgtggagg aaagacatga tacccatggg gaagtggctt ccagctgggc      1140
     aagccaaagc aacacttcgt gcactcagtt catcatttat tctcttactt agacatagat      1200
     tgcttgttag tgatggtcag aagatcctaa atagaaggat ttctagactt taggagggct      1260
     tgaagcttat agtatgtgct aactgtgcag tgatgttgct ggtacatagg gttgccccaa      1320
     actatttttt tttcaccttg gtgatagctg actctgtgat tcttagcagc tacagaaaga      1380
     aaaaaaactc tcttcaggac aagaataatc acatctttaa ataagtacag tcacaatgaa      1440
     gtctatacca taaaatccca ctaaaatgaa gatggttctg agccgggtgt ggtggcgcat      1500
     gcctttaatc ccagcactca ggaggcagag acaggcagat ttctgagttt gaggccagcc      1560
     tggtctacag agtgagttcc aggacagcca gggctacaca gagaaaccct gtcttgaaaa      1620
     acaaaacaaa acaaaacaaa acaaaacaaa aaaacaacaa caacaaagat ggttccatat      1680
     tctggcaaca gctgctaaca cataagctgg cttttaaata tttagctcat aactgaaaga      1740
     aaaaatacaa tatgtgctac tgtctgcact aagtaattat ttggacaata caaagatgaa      1800
     taggatattg ctgctaactt tcagttgaca ccaatccatc caagaaggtc cagataagaa      1860
     aagtccactt aacagaggca ttcaggttga atattcctgt catttcatct cttccagatt      1920
     gagagaaaga tgacttcctt acatgtggat aataatgcca gcattcccct cttaaccatt      1980
     ctccagagct aaattctcct catgcaccac attccctttc gcagagccag gtcccgtgga      2040
     ttctgccttc ccaacatctc tccagcttat gagcacatac ccttgacttc atctttatag      2100
     tgccctctgt tccatagtat cttccttttg cttctatttt tcctctgtta catcttcctc      2160
     cttcaggaag ctgcctgcct gagatttatc ttttatttta cagctcctct gcctagagtc      2220
     tgtctttgac gctttaataa aattgtcctc aagctccctt ctgagttact tcttaaattc      2280
     ttttattaat aaaactagta acacaaaaga gggcccagat ttccctggta atataaggtt      2340
     actccatcag aatgctccag aatttcaggt aacattatta cctttggggc agtttagact      2400
     gttatatctg catccagggc caaagacaga actcagatcc tgttctttca accaaaaata      2460
     aatacataaa aacatataac agtagacttt aaagaattaa tgaaaaaatt aaaagacata      2520
     aaatagttat ggattaccca gaagaagtaa ctttcaagtg gatagaggga tggctcagca      2580
     gttaagagca ctggctactc ctccagaggg cctaaattca gttcccaaag cccacatggt      2640
     atctcccaac cattttaact gcagttccaa gggaatccat tgccctcttc tggcctcctt      2700
     tcctttgtac acgaagatga acatttcata tatcttacaa tgtgtcggtt agagatccct      2760
     cgggcacctt acacttcatc ctagtttata tctctgccca ttagccaggt gggcttgaaa      2820
     ttccttttct tctaaaagcc tcaatttcat ctttgaagtt cagaaatgaa ccctacctat      2880
     agcacagagc tgtgttgagt tttaaacata acattatata ggcttttggt tagggtatga      2940
     catattaggt ttttaatata tacaataatc tactgcacaa tattttggtc aatgttggac      3000
     cacatatcac tgtgctccct taagactaaa tcatctagtg atgtcatagt catcttaatt      3060
     tatctaacta tactccagat gaattgtcta tgaaattctc aaaatacatc attgccctta      3120
     aataacccat gattgcttga gacctgtctt cctcttctct gtaaatttat ttgggatcta      3180
     agtttcaaac aagggtgttt gaaatccctt ttgtgggaac aggactgagg atgggcattt      3240
     agaggcgaca gagtcacgtg acaactcctg gtaaataaag ctccagagat cagtatcagt      3300
     gtgcagatct gcatttattg ccaagcacat aagcttatat acagtatttg agccaatccc      3360
     aagcccctaa atccttggcc aagcataact tactacatct caccatatcc caataaaagc      3420
     tgtgactgat gaggtaactc agagagaagg ggtgtggcga gcattgtcac ctgtagggac      3480
     ttttgtgaag actcagaagc agccactgtc ttgaccttag ttcctttttg ctgtctcact      3540
     ggtgtcccgg gagccatctt agatctgaca ccatgtacag cagatcagga ctctgtggca      3600
     cagtgctctc caccccacat attccttcac aaggttgtct tccacatgcc tcacactctc      3660
     aatcttaaca tcccaaagct gttcaggctg tagtcagagc aagtttttct tagttcactc      3720
     tattgataaa tctttatttc tgatgtcatt tcctcccact tcttcccttt tttttgtttt      3780
     cctttgttaa cagaaagggg aatcatttct cttcgtgagg ttttttttat cctcatccac      3840
     aaactgacaa ctccatcaag ttaatatgtt gtctcatata cctccagtat aaaatatgaa      3900
     attaacttaa aagatttctt ttccttcctg tatgaattta tcctgagaac ctggaatgct      3960
     gaagtctggc agatgccact attagctaag tcctgtaagg tacacaagca tttctagcta      4020
     acatgatgaa aataaggcag tgtgaggagc cagccagagc taagaagcga acctaatcat      4080
     gggctgacat tcctatgtac tgtcccctgt ctttagcatg ttcatccata ctggacttgg      4140
     aatgcagtgt tctattgcac caggcttcag ggtgctttgc aactcagcaa caagcaaaca      4200
     cggga                                                                  4205
//