spacer

EBI Dbfetch

ID   BC141339; SV 1; linear; mRNA; STD; MUS; 1844 BP.
XX
AC   BC141339;
XX
DT   12-FEB-2009 (Rel. 99, Created)
DT   12-FEB-2009 (Rel. 99, Last updated, Version 1)
XX
DE   Mus musculus growth differentiation factor 6, mRNA (cDNA clone MGC:176300
DE   IMAGE:9055951), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1844
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1844
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (03-MAY-2007) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; cd99670d9ba71a67bd2a888c50c93e10.
DR   Ensembl-Gn; ENSMUSG00000051279; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000057613; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Ambion
CC   cDNA Library Preparation: British Columbia Cancer Research Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: LLDM Plate: 682 Row: a Column: 5
CC   single stranded.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1844
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_390"
FT                   /clone="MGC:176300 IMAGE:9055951"
FT                   /tissue_type="Brain,thymus,testicle,kidney,spleen,liver,
FT                   heart,lung,ovary,embryo - PCR rescued clones"
FT                   /note="Vector: pCR4-TOPO with reversed insert; Clone
FT                   identification sequence tag: CATACCCC"
FT                   /db_xref="taxon:10090"
FT   gene            1..1844
FT                   /gene="Gdf6"
FT                   /gene_synonym="GDF16"
FT                   /gene_synonym="BMP13"
FT   CDS             21..1385
FT                   /codon_start=1
FT                   /gene="Gdf6"
FT                   /gene_synonym="GDF16"
FT                   /gene_synonym="BMP13"
FT                   /product="growth differentiation factor 6"
FT                   /db_xref="GOA:A2AII0"
FT                   /db_xref="InterPro:IPR001111"
FT                   /db_xref="InterPro:IPR001839"
FT                   /db_xref="InterPro:IPR002405"
FT                   /db_xref="InterPro:IPR015615"
FT                   /db_xref="InterPro:IPR017948"
FT                   /db_xref="InterPro:IPR029034"
FT                   /db_xref="MGI:MGI:95689"
FT                   /db_xref="UniProtKB/TrEMBL:A2AII0"
FT                   /protein_id="AAI41340.1"
FT                   /translation="MDTPRVLLWAIFLISFLWDLPGFQQASISSSSSSSTELDSTKDVG
FT                   NRKEGKMQRTPQESAEGRTPPEHGLRQKDLRRRPPGQHQGQEPPGRGLRVVPHEYMLSI
FT                   YKTYSIAEKLGINASFFQSSKSANTITSFVDRGLDDLSHTPLRRQKYLFDVSTLSDKEE
FT                   LVGAELRLYRQAPPTPWGLPARPLHLQLFPCLSPLLLDARTLDPQGPTQAGWEVFDVWQ
FT                   GLRPQPWKQLCLELRAAWGELDAGDTGARARGPQQPPPLDLRSLGFGRRVRPPQERALL
FT                   VVFTRSQRKNLFTEMHEQLGSAEAAGAEGSWPAPSGSPDAGSWLPSPGRRRRRTAFASR
FT                   HGKRHGKKSRLRCSRKPLHVNFKELGWDDWIIAPLEYEAYHCEGVCDFPLRSHLEPTNH
FT                   AIIQTLMNSMDPGSTPPSCCVPTKLTPISILYIDAGNNVVYKQYEDMVVESCGCR"
XX
SQ   Sequence 1844 BP; 371 A; 536 C; 555 G; 382 T; 0 other;
     aacttagcca ctcgctcgcc atggacactc ctagggtcct tctctgggcg atcttcctca        60
     ttagcttcct ctgggatttg ccgggtttcc agcaggcttc catctcctcg tcctcctcct       120
     cctccaccga attggactcc accaaagacg tggggaaccg caaagaaggg aagatgcagc       180
     gaactccaca agagagtgcc gagggccgga cgcccccgga gcacgggctg cggcagaagg       240
     acctccggcg gcggccgccc ggacaacatc aggggcagga gccgccgggc agggggctgc       300
     gcgtggtgcc tcacgagtac atgctgtcaa tctacaagac ttactccatt gccgagaagc       360
     tgggcatcaa tgccagcttt ttccagtctt ccaagtcagc taatacgatc actagctttg       420
     tagacagagg actggacgat ctctcgcaca ctcctctccg gagacagaag tatttgtttg       480
     atgtgtccac actctcagac aaagaagagc tggtgggcgc agagctaagg ctttatcgcc       540
     aggcgccccc aacgccctgg gggctaccgg cccgaccgct gcacttgcag ctcttccctt       600
     gtttatcccc attgctactg gacgccagga ccctggatcc tcagggacca acccaggccg       660
     gctgggaagt cttcgacgtg tggcagggcc tgcgccctca gccttggaag cagctgtgcc       720
     tggagttgcg ggcagcctgg ggtgagctgg acgccgggga tacgggggcg cgcgcgaggg       780
     gtccccagca gccaccgcct ctggacctgc ggagtctggg cttcggtcgg agggtgaggc       840
     cgccccagga gcgcgccctg cttgtagtgt tcaccagatc gcagcgcaag aacctgttca       900
     ctgagatgca tgagcagctg ggctctgcag aggctgcggg agccgagggg tcatggccag       960
     cgccgtcggg ctccccagac gccgggtctt ggctgccctc gcccggccgc cggcggcgac      1020
     gcaccgcctt cgccagccgt cacggcaagc gacatggcaa gaagtccagg ctgcgctgca      1080
     gcagaaagcc tctgcacgtg aattttaagg agttaggctg ggacgactgg attatcgcgc      1140
     ccctagagta cgaggcctat cactgcgagg gcgtgtgcga ctttccgctg cgctcgcacc      1200
     ttgagcccac taaccatgcc atcattcaga cgctgatgaa ctccatggac ccgggctcca      1260
     ccccgcctag ctgctgcgtt cccaccaaac tgactcccat tagcatcctg tacatcgacg      1320
     cgggcaataa tgtagtctac aagcagtatg aggacatggt ggtggagtcc tgcggctgta      1380
     ggtagcggtg ctgtcccgcc acctgggcca gggaccatgg agggaggcct gactgccgag      1440
     aaaggagcag gagctggctt ggaagaggcc acaggtgggg gacagcctga aagtaggagc      1500
     acagtaagaa gcagcccagc cttcccagaa ccttccaacc cccaacccag aagcagctaa      1560
     gggtttcaca ctttgccttg ccagcctgga aagactagac aagaaggatt ctttctttta      1620
     ttatggcttt ggttctttgt ttgttttgtt ttgttttatc tccttggttt tgataggacg      1680
     tggaaggagg ggaaatgctt atctgttcac aagtgttctg tggattgggg gaggagggaa      1740
     taagagaaat aacctattac ttttgtccgc atctcagatt ggttgtttct acctgtgtaa      1800
     gaaagtgagg cctttgggtc tttctagcca agtctcagct ggcg                       1844
//


spacer
spacer