Dbfetch

ID   BC139414; SV 1; linear; mRNA; STD; MUS; 2937 BP.
XX
AC   BC139414;
XX
DT   13-MAY-2008 (Rel. 95, Created)
DT   13-MAY-2008 (Rel. 95, Last updated, Version 1)
XX
DE   Mus musculus thrombospondin 4, mRNA (cDNA clone MGC:171041 IMAGE:8862436),
DE   complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2937
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2937
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (29-MAR-2007) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; de31d1ecd8d0dde9fa152b748b51f863.
DR   Ensembl-Gn; ENSMUSG00000021702; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020820; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0020774; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0020747; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020770; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0020564; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0021207; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0020083; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0020523; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0020648; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0020628; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0020721; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0020657; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0021247; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019835; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0020140; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000022213; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0037814; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0037757; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0037720; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0037769; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0037522; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0038231; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0037490; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0037430; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0037574; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0037540; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0037694; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0037533; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0038283; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0037124; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0036931; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Ambion
CC   cDNA Library Preparation: British Columbia Cancer Research Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: LLDM Plate: 669 Row: n Column: 2.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2937
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_389"
FT                   /clone="MGC:171041 IMAGE:8862436"
FT                   /tissue_type="Brain,thymus,testicle,kidney,spleen,liver,
FT                   heart,lung,ovary,embryo - PCR rescued clones"
FT                   /note="Vector: pCR4-TOPO; Clone identification sequence
FT                   tag: CTCACGTC"
FT                   /db_xref="taxon:10090"
FT   gene            1..2937
FT                   /gene="Thbs4"
FT                   /note="synonym: TSP-4"
FT   CDS             26..2917
FT                   /codon_start=1
FT                   /gene="Thbs4"
FT                   /product="thrombospondin 4"
FT                   /db_xref="GOA:B2RTL6"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR001791"
FT                   /db_xref="InterPro:IPR001881"
FT                   /db_xref="InterPro:IPR003367"
FT                   /db_xref="InterPro:IPR008859"
FT                   /db_xref="InterPro:IPR013032"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR017897"
FT                   /db_xref="InterPro:IPR018097"
FT                   /db_xref="InterPro:IPR024665"
FT                   /db_xref="InterPro:IPR028974"
FT                   /db_xref="MGI:MGI:1101779"
FT                   /db_xref="UniProtKB/TrEMBL:B2RTL6"
FT                   /protein_id="AAI39415.1"
FT                   /translation="MPAPRAAAAAFLLLHLVLQPWQRTSAQATPQVFDLLPSSSQRLNP
FT                   SALQPVLTDPTLHEVYLISTFKLQSKSSATIFGLYSSSDNSKYFEFTVMGRLNKAILRY
FT                   LKNDGKIHLVVFNNLQLADGRRHRVLLRLSNLQRGDGSVELYLDCAQADSVRNLPRAFS
FT                   GLTQNPESIELRTFQRKPQDFLEELKLVVRGSLFQVASLQDCFLQQSEPLAATSTGDFN
FT                   RQFLGQMTQLNQLLGEVKDLLRQQVKETSFLRNTIAECQACGPLSFQSPTPNTLVPIAP
FT                   PAPPTRPTRHCDSSPCFRGVRCTDTRDGFQCGPCPDGYTGNGITCSDVDECKYHPCYPG
FT                   VRCVNLAPGFRCDACPVGFTGPMVQGVGINFAKTNKQVCTDVDECQNGACVLNSICINT
FT                   LGSYRCGPCKPGYTGDQTRGCKTERSCRNPEQNPCSVHAQCIEERQGDVTCVCGVGWAG
FT                   DGYVCGKDVDIDSYPDEELPCSARNCKKDNCKYVPNSGQEDADRDGIGDACDEDADGDG
FT                   ILNEQDNCVLTHNIDQRNSDKDIFGDACDNCRMVLNNDQKDTDGDGRGDACDDDMDGDG
FT                   IKNILDNCPRVPNRDQQDRDGDDVGDACDSCPDVSNPNQSDVDNDLVGDSCDTNQDSDG
FT                   DGHQDSTDNCPTVINSSQLDTDKDGIGDECDDDDDNDGIPDLVPPGPDNCRLVPNPAQE
FT                   DSNNDGVGDICEADFDQDQVIDHIDVCPENAEITLTDFRAYQTVVLDPEGDAQIDPNWV
FT                   VLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEGTFHVNTQTDDDYAGFIFGYQDSSSFYV
FT                   VMWKQTEQTYWQATPFRAVAEPGIQLKAVKSKTGPGEHLRNSLWHTGDTSDQVRLLWKD
FT                   SRNVGWKDKVSYRWFLQHRPQVGYIRVRFYEGSELVADSGVTIDTTMRGGRLGVFCFSQ
FT                   ENIIWSNLKYRCNDTIPEDFQEFQTQSFDRLDN"
XX
SQ   Sequence 2937 BP; 732 A; 771 C; 826 G; 608 T; 0 other;
     gccctcaggg agcagaagag tcaccatgcc ggccccacgc gcggccgcgg ccgccttcct        60
     cctgctgcac ctggtcctgc agccgtggca gcggacgagc gcccaggcca caccccaggt       120
     ctttgatctt ctaccgtcct ccagccagag gctgaacccc agcgccctgc agccagtcct       180
     gacagatccc accctgcacg aagtctatct catctccacc ttcaagctgc agagtaaaag       240
     ctcagccacc atctttggcc tctactcctc aagtgacaac agcaaatact ttgaattcac       300
     tgtgatggga cggctgaaca aagccatcct ccgctacctg aagaatgatg gaaagatcca       360
     tctggtggtg ttcaacaact tgcagctggc tgatgggagg cgccacaggg ttctcctgag       420
     actgagcaat ttgcagagag gagatggctc tgtagaactc tacctggact gcgctcaggc       480
     ggactcggtg cgcaacctcc ccagagcctt ttctggcctc acccagaacc cagagtccat       540
     tgaattgcgg acattccaga ggaagcccca ggacttcttg gaagagctga agctggtggt       600
     gcggggctcg ctgttccagg tggccagcct ccaagactgc ttcctgcagc agagtgagcc       660
     tctggctgcc acaagcacag gagactttaa tcgacagttc ttgggtcaaa tgacacaact       720
     gaaccagctc cttggagagg tgaaagatct tctgaggcag caggtcaagg aaacatcgtt       780
     tttgcgaaac accattgctg aatgccaagc ttgtggtcct ctcagctttc agtccccaac       840
     tccaaacaca ctggtgccca tagctcctcc agcaccccca actcgcccaa cacgccactg       900
     tgactccagc ccttgtttcc gaggtgtccg atgtacggac accagggatg gcttccagtg       960
     tggaccctgc ccagatggtt acacgggaaa cgggatcacc tgctctgacg tggatgagtg      1020
     caaataccat ccctgctatc caggtgtgcg ctgtgtgaat ttggctccgg gtttcagatg      1080
     tgacgcctgt ccagtaggtt tcacagggcc catggtgcag ggtgtcggga tcaactttgc      1140
     taaaacaaac aagcaggtgt gcactgatgt tgatgagtgt cagaatggag cgtgtgttct      1200
     gaattctatc tgcattaaca ctttgggatc ttatcgctgt gggccttgca aaccagggta      1260
     cactggtgat cagacgaggg gatgcaagac tgaaaggagc tgccggaacc cagagcagaa      1320
     cccatgcagt gtgcatgcgc agtgcattga ggagcggcaa ggggatgtga cgtgtgtgtg      1380
     tggtgttggc tgggctggtg acggctatgt ctgtggaaag gatgtggaca ttgacagtta      1440
     ccctgatgaa gaactgccat gctctgccag gaactgcaag aaggataact gcaagtatgt      1500
     gccaaactct ggccaggaag atgcagacag agatggcatc ggagacgcgt gtgatgagga      1560
     tgcagatgga gatgggatct tgaatgaaca ggacaactgt gtcctgactc acaatataga      1620
     ccaaaggaac agtgataaag atatctttgg ggatgcctgt gacaactgcc ggatggtcct      1680
     gaataatgac cagaaggata ctgacgggga tgggagagga gacgcctgtg atgacgacat      1740
     ggatggagat ggaataaaaa acattttgga caactgtccc agagttccca accgtgacca      1800
     gcaggatcgg gatggtgatg atgtcggaga cgcttgtgac agctgtcctg atgtcagtaa      1860
     ccctaaccag tcggatgtgg ataacgatct ggttggggac tcctgtgaca ccaaccaaga      1920
     cagtgacggg gatggccacc aggacagcac agacaactgc cccacagtca ttaacagctc      1980
     ccagctggac actgacaaag atgggatcgg cgatgaatgt gatgacgatg acgataacga      2040
     tggcatccca gacctggtgc ctcctggccc agacaactgc aggctcgtcc ccaacccagc      2100
     ccaggaagat agcaacaatg acggggtagg agatatctgt gaagctgact tcgaccagga      2160
     ccaggtcatc gatcacattg atgtgtgccc tgagaatgcg gagatcaccc tgactgactt      2220
     cagggcctac cagacagtgg tcctggaccc tgaaggggat gctcagatcg accccaactg      2280
     ggtggtcctg aaccagggca tggaaattgt gcagaccatg aacagtgacc ctggcctagc      2340
     tgttgggtac acggcattta acggagttga ctttgaaggg accttccacg taaacaccca      2400
     gacagatgat gactatgctg gctttatttt tggttaccaa gacagctcca gcttctatgt      2460
     agtcatgtgg aagcaaacgg agcagacata ctggcaggct acaccgttcc gtgcagtagc      2520
     agaacctggt attcagctca aggctgtgaa gtctaaaact ggcccagggg aacatctccg      2580
     aaactccctg tggcacacag gggacaccag cgaccaggtc aggctgctgt ggaaggactc      2640
     caggaatgtg ggctggaagg acaaggtctc ctaccgctgg ttcctgcagc ataggcccca      2700
     ggtgggctac atcagggtgc gcttttatga aggctcggag ttggtggctg actctggggt      2760
     caccatagac accaccatgc gtggaggccg acttggtgtg ttctgcttct ctcaagaaaa      2820
     catcatctgg tccaacctca agtaccgctg caacgacacc ataccagagg acttccagga      2880
     gttccagacc cagagttttg accgcttgga taattgagcc aagaagcaat cccacaa         2937
//