spacer

EBI Dbfetch

ID   BC139250; SV 1; linear; mRNA; STD; MUS; 1645 BP.
XX
AC   BC139250;
XX
DT   13-MAY-2008 (Rel. 95, Created)
DT   13-MAY-2008 (Rel. 95, Last updated, Version 1)
XX
DE   Mus musculus cytochrome P450, family 11, subfamily b, polypeptide 1, mRNA
DE   (cDNA clone MGC:170877 IMAGE:8862272), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1645
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1645
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (29-MAR-2007) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   Ensembl-Gn; ENSMUSG00000075604; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000170259; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Ambion
CC   cDNA Library Preparation: British Columbia Cancer Research Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: LLDM Plate: 669 Row: g Column: 6.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1645
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_390"
FT                   /clone="MGC:170877 IMAGE:8862272"
FT                   /tissue_type="Brain,thymus,testicle,kidney,spleen,liver,
FT                   heart,lung,ovary,embryo - PCR rescued clones"
FT                   /note="Vector: pCR4-TOPO with reversed insert; Clone
FT                   identification sequence tag: CAACGGAG"
FT                   /db_xref="taxon:10090"
FT   gene            1..1645
FT                   /gene="Cyp11b1"
FT                   /note="synonyms: FHI, CPN1"
FT   CDS             32..1537
FT                   /codon_start=1
FT                   /gene="Cyp11b1"
FT                   /product="cytochrome P450, family 11, subfamily b,
FT                   polypeptide 1"
FT                   /db_xref="GOA:Q3TG86"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002399"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="MGI:MGI:88583"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TG86"
FT                   /protein_id="AAI39251.1"
FT                   /translation="MTMALRVTTDVWLARPWQCLHRTRALGTTATLAPKTLQPFEAIPQ
FT                   YSRNKWLKMIQILREQGQENLHLEMHQVFRELGPIFRHSVGKTQIVFVTLPEDVEKLYQ
FT                   VESTHPCRMPLESWIVHRELRGLGRGVFLLNGPEWYFNRLQLNPNVLSPKAVQKFVPLV
FT                   DGIARDFVDNLKKKMLESVHGSFSMDFQSSVFNYTIEASHFVLFGERLGLIGRDLSPDS
FT                   LKFLHTLHSMFKTTTQLLYLPRSLTRWTSTRVWKENLESWDFISEYVTKCIKNVYRELA
FT                   EGRPQSWSVTAELVAERTLSMDAIQANSMELIAGSTDTTSTPLVMTFFELARNPDVQQA
FT                   LRQESLAAEASIAANPQKAMSDLPLLRAALKETLRLYPVGTFLERILSSDLVLQNYHVP
FT                   AGTVLNVNLYSMGRNPAVFPRPERYMPQRWLERKRSFKHLAFGFGVRQCLGRRLAEAEM
FT                   MLLLHHVLKSFHVETQEKEDVRMAYRFVLMPSSSPLLTFRPVN"
XX
SQ   Sequence 1645 BP; 396 A; 426 C; 442 G; 381 T; 0 other;
     ggccacggac taaacacagg aagagaggaa gatgacaatg gctctcaggg tgacaacaga        60
     tgtgtggctg gcaagaccct ggcagtgcct gcacaggaca agggcactgg gcaccacggc       120
     aacactggcc ccaaagaccc tgcagccctt tgaagccata ccacagtact ccaggaacaa       180
     gtggctgaag atgatacaga tcctgaggga gcagggccaa gaaaacctac acctggagat       240
     gcatcaggtc ttccgggagc tggggcccat tttcaggcac agtgtaggga aaacacagat       300
     cgtgtttgtg acgttgccgg aggatgttga gaagctgtac caggtagaga gtacgcaccc       360
     ttgccgcatg cccttggaat cctggatagt ccatagagaa ctccgtggcc tgggacgtgg       420
     tgtgttcttg ctaaatgggc cagaatggta cttcaaccga ctgcagctga acccaaatgt       480
     tctgtcacca aaagccgttc aaaaatttgt ccccttggtg gatgggatag caagggactt       540
     tgtggataac ctgaagaaga aaatgctgga aagtgtccat ggtagcttct ctatggactt       600
     tcagtccagt gtgttcaact ataccataga agctagccac tttgttcttt ttggggagcg       660
     gctgggcctc attggccgtg atctgagccc tgacagcctg aagttcctcc acaccctgca       720
     ctccatgttc aaaaccacca cacagctctt gtacttgccc aggagcctga cccgatggac       780
     aagcaccagg gtgtggaaag aaaacttaga gtcctgggat ttcatctctg aatatgtcac       840
     caaatgtatc aagaatgtgt atcgagagct ggcagagggt cgtccacagt cctggagtgt       900
     cacagcagag ctggtagctg agagaactct gtcaatggat gccatccagg ctaactcaat       960
     ggaactcatt gctggaagca ctgacacgac atcaaccccc ttggtaatga ctttctttga      1020
     gctggctcgg aacccagatg ttcagcaggc cctgaggcag gagagcctgg cagctgaggc      1080
     cagcatcgct gcaaatcctc agaaggccat gtcagacctg cccttgctga gggctgccct      1140
     taaagagacc ttgaggctct atcctgttgg tacttttctg gagagaattc taagctcaga      1200
     cttggtgctt cagaactacc atgtccctgc tgggacagtc ctcaatgtga atctgtattc      1260
     catgggccgg aaccctgcag tgttcccaag gcctgaacgc tatatgcctc agcgctggct      1320
     ggagaggaaa aggagtttca agcacctggc ctttggcttt ggggtgcgcc agtgcctggg      1380
     gaggcgcctg gcagaggcag agatgatgct cctgcttcac catgtgctga aatccttcca      1440
     cgtggagaca caagagaaag aggatgtgcg gatggcctac cgcttcgttt tgatgcccag      1500
     ctccagtcct ctcctcactt tcaggcctgt caactagtca cacagccttt ttcttttggt      1560
     gtcccaagat gtcaatagct tcctgttctg atgacacatt gccctctctt ctcttcctta      1620
     gagtgctatg cctgtggcca tgctc                                            1645
//


spacer
spacer