spacer

EBI Dbfetch

ID   BC138813; SV 1; linear; mRNA; STD; MUS; 2974 BP.
XX
AC   BC138813;
XX
DT   13-MAY-2008 (Rel. 95, Created)
DT   05-AUG-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Mus musculus neural precursor cell expressed, developmentally
DE   down-regulated 4, mRNA (cDNA clone MGC:170440 IMAGE:8861835), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2974
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2974
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (29-MAR-2007) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 6955904017b25cdcea82d053d2d19616.
DR   Ensembl-Gn; ENSMUSG00000032216; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000034740; mus_musculus.
DR   EuropePMC; PMC3387815; 22763434.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Ambion
CC   cDNA Library Preparation: British Columbia Cancer Research Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: LLDM Plate: 668 Row: e Column: 1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2974
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_411"
FT                   /clone="MGC:170440 IMAGE:8861835"
FT                   /tissue_type="Embryo, mouse"
FT                   /note="Vector: pCR4-TOPO; Clone identification sequence
FT                   tag: CCACGCCC"
FT                   /db_xref="taxon:10090"
FT   gene            1..2974
FT                   /gene="Nedd4"
FT                   /note="synonyms: Nedd4-1, mKIAA0093"
FT   CDS             89..2752
FT                   /codon_start=1
FT                   /gene="Nedd4"
FT                   /product="neural precursor cell expressed, developmentally
FT                   down-regulated 4"
FT                   /db_xref="GOA:B2RSC8"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR000569"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="InterPro:IPR024928"
FT                   /db_xref="MGI:MGI:97297"
FT                   /db_xref="UniProtKB/TrEMBL:B2RSC8"
FT                   /protein_id="AAI38814.1"
FT                   /translation="MSSDMAADESEAPVLSEDEVWEFCLDKTEDGGGSPGSDVTDTCEP
FT                   PCGCWELNPNSLEEEHVLFTADPYLELHNDDTRVVRVKVIAGIGLAKKDILGASDPYVR
FT                   VTLYDPMSGILTSVQTKTIKKSLNPKWNEEILFRVLPQRHRILFEVFDENRLTRDDFLG
FT                   QVDVPLYPLPTENPRMERPYTFKDFVLHPRSHKSRVKGYLRLKMTYLPKNGSEDENADQ
FT                   AEELEPGWVVLDQPDAATHLPHPPEPSPLPPGWEERQDVLGRTYYVNHESRRTQWKRPS
FT                   PDDDLTDEDNDDMQLQAQRAFTTRRQISEDVDGPDNRESPENWEIVREDENTEYSGQAV
FT                   QSPPSGHIDVQTHLAEEFNTRLAVCGNPATSQPVTSSNHSSRGGSLQTCIFEEQPTLPV
FT                   LLPTSSGLPPGWEEKQDDRGRSYYVDHNSKTTTWSKPTMQDDPRSKIPAHLRGKTDSND
FT                   LGPLPPGWEERTHTDGRVFFINHNIKKTQWEDPRLQNVAITGPAVPYSRDYKRKYEFFR
FT                   RKLKKQTDIPNKFEMKLRRANILEDSYRRIMGVKRADLLKARLWIEFDGEKGLDYGGVA
FT                   REWFFLISKEMFNPYYGLFEYSATDNYTLQINPNSGLCNEDHLSYFKFIGRVAGMAVYH
FT                   GKLLDGFFIRPFYKMMLQKLITLHDMESVDSEYYSSLRWILENDPTELDLRFIIDEELF
FT                   GQTHQHELKTGGSEIVVTNKNKKEYIYLVIQWRFVNRIQKQMAAFKEGFFELIPQDLIK
FT                   IFDENELELLMCGLGDVDVNDWREHTKYKNGYSMNHQVIHWFWKAVWMMDSEKRIRLLQ
FT                   FVTGTSRVPMNGFAELYGSNGPQSFTVEQWGTPDKLPRAHTCFNRLDLPPYESFDELWD
FT                   KLQMAIENTQGFDGVD"
XX
SQ   Sequence 2974 BP; 860 A; 686 C; 720 G; 708 T; 0 other;
     acgcctcctc ctcctcttcc tctctccttc tctctcggtc tctcgctctc tctcgccgct        60
     gcagcctagt aggggcgctt cgtccagcat gagctcggac atggcagccg acgagtcgga       120
     ggccccagta ctctcggagg acgaggtatg ggagttttgc ctggataaga cagaagatgg       180
     tggcggatcc cccggaagtg atgttacaga cacttgtgag cctccatgtg gatgctggga       240
     gttgaatccg aattccctgg aagaggagca cgtgctgttc actgctgatc cgtacctgga       300
     gctccacaac gatgacacac gagttgtgag agtgaaggtt atagctggca taggcctggc       360
     caagaaagac atcttgggag ccagtgatcc ttacgtaaga gtgacattgt atgacccgat       420
     gagtggaatc cttaccagcg tgcagacaaa aactatcaaa aagtctttga atccaaaatg       480
     gaatgaagaa atactgttca gggtccttcc acagcgacac cgcattcttt tcgaagtgtt       540
     tgatgaaaat cgtttgacaa gagatgattt cctaggtcaa gtggatgtcc ctctctatcc       600
     tttaccgact gaaaacccaa gaatggagag accatataca tttaaggatt ttgttcttca       660
     tccaagaagt cacaaatcaa gagttaaagg ttatctgaga ttaaaaatga cttatttacc       720
     taaaaatggc tcagaagatg aaaatgcaga ccaggctgag gagttagagc ctggctgggt       780
     tgttttggac caaccagatg ctgccactca tttgccgcat ccaccagaac cctctcccct       840
     acctccagga tgggaagaga ggcaggatgt ccttggaagg acctactacg taaaccatga       900
     atctagaaga acacagtgga aaaggccaag ccctgacgat gacctcacgg atgaagacaa       960
     tgatgatatg cagctgcaag cgcagcgagc attcaccacc aggcggcaga tatcggagga      1020
     tgtggatggc cctgacaacc gggagtcccc tgagaattgg gaaatcgtac gagaagatga      1080
     aaacaccgag tatagtggtc aggctgtcca gtcacctcca tcgggtcaca ttgatgtgca      1140
     gactcacctt gcagaagagt ttaataccag acttgccgtg tgtggaaatc cagccaccag      1200
     ccagccggtt accagctcaa atcattccag cagaggaggc agcttgcaga cctgtatctt      1260
     tgaggaacag cctacacttc ctgtgctttt gcctacttca tctggattgc caccaggttg      1320
     ggaagaaaaa caagatgaca gaggaagatc atactatgta gaccacaact ctaaaaccac      1380
     cacatggtcc aagcccacca tgcaggatga tccaagatcg aaaatccctg ctcatctgag      1440
     aggaaagact gactccaatg acctgggacc cttacctcca ggctgggaag aaagaaccca      1500
     cacagatggg cgagtcttct tcataaacca caatataaag aagacccagt gggaagatcc      1560
     tcgcctgcag aacgtggcaa tcactggacc agcagtgccc tactccagag attacaagag      1620
     aaagtacgag ttcttcagaa ggaagctcaa gaagcagact gacattccaa acaaatttga      1680
     aatgaagctt cgccgcgcaa acattctgga ggattcttac cggaggatta tgggtgtgaa      1740
     gagagctgac ttgctcaagg ccagactctg gattgagttt gatggtgaaa agggccttga      1800
     ctatggaggg gttgccagag agtggttctt cctcatctcg aaggaaatgt tcaaccctta      1860
     ctacggcctg tttgaatatt ctgctacgga taattacacc ctacagataa atcctaactc      1920
     gggcttgtgt aatgaagatc acctctcata cttcaagttc attggccgtg tggctgggat      1980
     ggcagtttat catggcaagc tgttggatgg gtttttcatc cgtccgtttt acaagatgat      2040
     gcttcagaaa ctgataacac tgcacgacat ggagtccgtg gatagtgaat attacagttc      2100
     tctgcgatgg attcttgaaa atgacccgac ggagctggac ctgagattta tcatagatga      2160
     agaacttttt ggacagacac atcagcacga actgaaaacc ggaggatcag agattgttgt      2220
     caccaataag aacaaaaagg agtatatcta ccttgtaata caatggcgat ttgtgaaccg      2280
     tatccagaag caaatggcag cttttaaaga gggatttttt gaactgatac cacaggatct      2340
     catcaagata tttgatgaaa atgagctaga gcttctcatg tgtggtctgg gagatgtgga      2400
     tgtgaacgac tggcgggaac acacaaaata caaaaatggc tacagcatga accaccaggt      2460
     catccactgg ttctggaagg ctgtttggat gatggattcg gaaaaaagaa tacgcttact      2520
     tcagtttgtc actggcacat cccgtgtgcc gatgaatggg tttgctgaac tctatggctc      2580
     gaatggacca caatccttca cagtggaaca atggggcacc cctgataagc tgccaagagc      2640
     acacacctgc ttcaatcgcc tggacctgcc accctacgaa tcctttgacg aactctggga      2700
     taaacttcag atggcaattg agaacacaca gggctttgat ggcgttgatt agattacaaa      2760
     aaaaaacaag ctgtggtgtc ttgtacacca tagtttctaa gcaaaagcaa aaacaaaatc      2820
     acattttaac attttccaga tagtttctaa aagatggtca ctggctcttc ccaccgagac      2880
     cagaggacag tttatccatg atttagccac caccatgctg acctgttcac ttgtccagtt      2940
     actttgtcca gttgttgggg ttcatgtgta cggc                                  2974
//


spacer
spacer