spacer

EBI Dbfetch

ID   BC138768; SV 1; linear; mRNA; STD; MUS; 1029 BP.
XX
AC   BC138768;
XX
DT   13-MAY-2008 (Rel. 95, Created)
DT   13-MAY-2008 (Rel. 95, Last updated, Version 1)
XX
DE   Mus musculus sprouty homolog 2 (Drosophila), mRNA (cDNA clone MGC:170395
DE   IMAGE:8861790), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1029
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1029
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (29-MAR-2007) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 907c59d9b3c0f348668e7cede0386cba.
DR   Ensembl-Gn; ENSMUSG00000022114; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000022709; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Ambion
CC   cDNA Library Preparation: British Columbia Cancer Research Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: LLDM Plate: 668 Row: c Column: 4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1029
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_416"
FT                   /clone="MGC:170395 IMAGE:8861790"
FT                   /tissue_type="Lung, mouse"
FT                   /note="Vector: pCR4-TOPO with reversed insert; Clone
FT                   identification sequence tag: CCTCCGCA"
FT                   /db_xref="taxon:10090"
FT   gene            1..1029
FT                   /gene="Spry2"
FT                   /note="synonym: sprouty2"
FT   CDS             36..983
FT                   /codon_start=1
FT                   /gene="Spry2"
FT                   /product="sprouty homolog 2 (Drosophila)"
FT                   /db_xref="GOA:B2RS85"
FT                   /db_xref="InterPro:IPR007875"
FT                   /db_xref="MGI:MGI:1345138"
FT                   /db_xref="UniProtKB/TrEMBL:B2RS85"
FT                   /protein_id="AAI38769.1"
FT                   /translation="MEARAQSGNGSQPLLQTAHDSGRQRGEPDPRDALTQQVHVLSLDQ
FT                   IRAIRNTNEYTEGPTVVPRPGLKPAPRPSTQHKHERLHGLPEHRQPPRLQPSQVHSSRA
FT                   PLSRSISTVSSGSRSSTRTSTSSSSSEQRLLGPSFSHGPAAADGIIRVQPKSELKPGDV
FT                   KPLSKDDLGLHAYRCEDCGKCKCKECTYPRPLPSDWICDKQCLCSAQNVIDYGTCVCCV
FT                   KGLFYHCSNDDEDNCADNPCSCSQSHCCTRWSAMGVMSLFLPCLWCYLPAKGCLKLCQG
FT                   CYDRVNRPGCRCKNSNTVCCKVPTVPPRNFEKPT"
XX
SQ   Sequence 1029 BP; 234 A; 292 C; 277 G; 226 T; 0 other;
     taagcctgct ggggtgaaca cactgccaag acctgatgga ggccagagct cagagtggca        60
     acgggtcgca gcctttgctg cagacagccc atgacagtgg caggcagcgc ggggagccgg       120
     atccaagaga tgcccttacc cagcaggtac acgtcttgtc tctggatcag atcagagcca       180
     tccgaaacac caatgagtac acagagggcc ctactgtggt cccaagacct gggctcaagc       240
     ctgctcctcg cccctccact cagcacaaac atgaaagact ccacggtctg ccggagcacc       300
     gccagcctcc caggctccag ccctcgcagg tccattcttc acgggcccct ctgtccaggt       360
     ccatcagcac tgtcagctca gggtctcgga gcagtacaag gacaagtacc agcagcagct       420
     cctcggaaca gagactgtta ggaccgtcct tctcccacgg gcctgctgct gctgatggaa       480
     taatccgagt gcagcctaaa tcggagctca agcctggtga cgttaagcca ctgagcaagg       540
     atgatttggg tctccatgcc tacaggtgtg aggactgcgg caagtgcaag tgtaaggagt       600
     gcacctaccc gaggcccctg ccgtcggact ggatctgtga caagcagtgc ctctgctcag       660
     cccagaacgt cattgactat gggacttgtg tgtgctgtgt gaaaggtctc ttctatcact       720
     gctccaatga cgatgaggac aattgtgctg acaacccgtg ctcttgcagc cagtcccatt       780
     gttgtacgcg atggtcagcg atgggagtca tgtctctctt tttgccttgt ttatggtgtt       840
     accttccagc caagggttgc cttaaattgt gccaggggtg ttatgaccga gtgaacaggc       900
     cgggttgtcg ttgtaaaaac tcaaatacag tttgctgcaa agttcccact gtccccccca       960
     ggaactttga aaagccgaca tagcattatt aatcaggaat attgcagtaa tagggattgt      1020
     tgctccgcc                                                              1029
//


spacer
spacer