spacer

EBI Dbfetch

ID   BC138744; SV 1; linear; mRNA; STD; MUS; 1970 BP.
XX
AC   BC138744;
XX
DT   12-FEB-2009 (Rel. 99, Created)
DT   12-FEB-2009 (Rel. 99, Last updated, Version 1)
XX
DE   Mus musculus prostaglandin E receptor 1 (subtype EP1), mRNA (cDNA clone
DE   MGC:170371 IMAGE:8861766), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1970
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1970
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (29-MAR-2007) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 66ad38c911e92f04a199d5a8c349a250.
DR   Ensembl-Gn; ENSMUSG00000019464; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000019608; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Ambion
CC   cDNA Library Preparation: British Columbia Cancer Research Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: LLDM Plate: 668 Row: b Column: 4
CC   single stranded.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1970
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_390"
FT                   /clone="MGC:170371 IMAGE:8861766"
FT                   /tissue_type="Brain,thymus,testicle,kidney,spleen,liver,
FT                   heart,lung,ovary,embryo - PCR rescued clones"
FT                   /note="Vector: pCR4-TOPO with reversed insert; Clone
FT                   identification sequence tag: CCTTGCCT"
FT                   /db_xref="taxon:10090"
FT   gene            1..1970
FT                   /gene="Ptger1"
FT                   /gene_synonym="EP1"
FT                   /gene_synonym="42kDa"
FT   CDS             257..1474
FT                   /codon_start=1
FT                   /gene="Ptger1"
FT                   /gene_synonym="EP1"
FT                   /gene_synonym="42kDa"
FT                   /product="prostaglandin E receptor 1 (subtype EP1)"
FT                   /db_xref="GOA:B2RS62"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000708"
FT                   /db_xref="InterPro:IPR001244"
FT                   /db_xref="InterPro:IPR008365"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:97793"
FT                   /db_xref="UniProtKB/TrEMBL:B2RS62"
FT                   /protein_id="AAI38745.1"
FT                   /translation="MSPCGLNLSLADEAATCATPRLPNTSVVLPTGDNGTSPALPIFSM
FT                   TLGAVSNVLALALLAQVAGRMRRRRSAATFLLFVASLLAIDLAGHVIPGALVLRLYTAG
FT                   RAPAGGACHFLGGCMVFFGLCPLLLGCGMAVERCVGVTQPLIHAARVSVARARLALAVL
FT                   AAMALAVALLPLVHVGRYELQYPGTWCFISLGPRGGWRQALLAGLFAGLGLAALLAALV
FT                   CNTLSGLALLRARWRRRRSRRFRKTAGPDDRRRWGSRGPRLASASSASSITSATATLRS
FT                   SRGGGSARRVHAHDVEMVGQLVGIMVVSCICWSPLLVLVVLAIGGWNSNSLQRPLFLAV
FT                   RLASWNQILDPWVYILLRQAMLRQLLRLLPLRVSAKGGPTELGLTKSAWEASSLRSSRH
FT                   SGFSHL"
XX
SQ   Sequence 1970 BP; 344 A; 632 C; 586 G; 408 T; 0 other;
     cccagttgcc ctgactgttg ccagcagttt tgcccactca aggctcccag ccccagagag        60
     caaacatgca tggggtggag cagcccctgg aggccagtga agtgcgggtg gaggcggcac       120
     ggagccgagg agccgcccca ggaagaggga gcggcctgcc gggagccagg gagtagctgg       180
     agcaggcagc aggagccaag ttccaggcca tggggaccct gcatcctgag cagcactggc       240
     cctcttggcc actgatatga gcccctgcgg gcttaacctg agcctagcgg atgaggcagc       300
     aacgtgcgca acacccaggc tccccaatac atctgtggtg ctgccaacag gcgataatgg       360
     cacatcacca gcgctgccta tcttctccat gacgctgggt gctgtgtcca acgtgctggc       420
     gctggcgctg ctggcccagg ttgcaggccg aatgcggcgg cgccgctcgg ctgccacctt       480
     cctgttgttc gtcgccagcc tgcttgccat cgacctagca ggccatgtga tcccgggcgc       540
     cctggtgctt cgcctgtata ctgcggggcg tgcgcctgct ggaggggcgt gtcatttcct       600
     gggtggctgc atggtcttct tcggcctgtg cccacttttg cttggctgtg gcatggccgt       660
     agagcgctgt gtgggtgtca cgcagccact gatccacgcg gcgcgcgtat ctgtggcccg       720
     cgcacgcctg gcactagccg tgctggctgc catggctttg gcagtggcgc tgctgccact       780
     ggtacacgtg ggtcgctacg agttacagta ccctggcacc tggtgtttta ttagccttgg       840
     gcctcgtgga ggttggcgcc aggcgttgct tgccggcctc ttcgccggcc ttggcctggc       900
     cgcgctcctt gcggcattag tgtgcaatac gctcagcggc ctggcgctcc tccgtgcccg       960
     ctggagacgg cgtcgctctc gacgattccg aaagaccgca ggtcccgatg atcgccggcg      1020
     ctggggatct cgtggacccc gcttggcctc cgcctcgtct gcctcatcca tcacttcagc      1080
     cacagccacc ctccgcagct ctcggggcgg cggctccgcg cgcagggttc acgcacacga      1140
     tgtggaaatg gtgggccagc tcgtgggcat catggtggtg tcgtgcatct gctggagccc      1200
     cctgctggtg ttggtggtgt tggccatcgg gggctggaac tctaactccc tgcagcggcc      1260
     actctttctg gctgtacgcc tcgcatcgtg gaaccagatc ctggacccat gggtgtacat      1320
     cctgctgcgc caggccatgc tgcgccaact gcttcgcctc ctacccctga gggtcagtgc      1380
     caagggtggt ccaacggagc tgggcctaac caagagtgcc tgggaagcca gttcactgcg      1440
     tagttcccgg cacagtggtt tcagtcacct ctgaatgtgc ccagaagcta agtcaaacca      1500
     ttctgggctg ggctcaaggg tatagagtct caaactcagt gtgcctaggg cgctgcgtcc      1560
     tgtgggtcca caacactgtc accgcacagg ggtgaaagag gctccactgg ggacgagtac      1620
     agttctaacg atggtcacgc gatggcccag atacatggga tgctcgaaac accagaggtg      1680
     ggactcccca ggccaacagc ttgaagagca tgcgcacagc gccgcaacct tagttctaag      1740
     attcgggctc tccataaata gagcaaagtt ttggattcac ttcccatctc tgtcaccacc      1800
     ccaatagact cttgcaagcg tctatcccaa actatcccaa gaatctcaac accttctacc      1860
     cacacggcct taaaacccca atgctctcca acatacccct aagcccacta ctgcatgttc      1920
     ccatcttgac ctttcaaatg tgccccatca gtcctgcccc caagagtctg                 1970
//


spacer
spacer