Dbfetch

ID   BC138717; SV 1; linear; mRNA; STD; MUS; 2223 BP.
XX
AC   BC138717;
XX
DT   13-MAY-2008 (Rel. 95, Created)
DT   13-MAY-2008 (Rel. 95, Last updated, Version 1)
XX
DE   Mus musculus polycystic kidney disease 2-like 2, mRNA (cDNA clone
DE   MGC:170344 IMAGE:8861739), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2223
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2223
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (29-MAR-2007) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 162c6ef7a27746b04a76553deb8042a0.
DR   Ensembl-Gn; ENSMUSG00000014503; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024239; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0024205; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0024174; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024205; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023973; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024647; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023448; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0023941; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0024073; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0024039; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0024154; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024067; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024695; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023191; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023511; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000014647; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000166156; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0049220; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0049200; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0049161; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0049161; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0048905; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0049651; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049000; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0048829; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0048938; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0048899; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0049051; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0048901; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0049756; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0048597; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0048203; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Ambion
CC   cDNA Library Preparation: British Columbia Cancer Research Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: LLDM Plate: 668 Row: a Column: 1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2223
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_390"
FT                   /clone="MGC:170344 IMAGE:8861739"
FT                   /tissue_type="Brain,thymus,testicle,kidney,spleen,liver,
FT                   heart,lung,ovary,embryo - PCR rescued clones"
FT                   /note="Vector: pCR4-TOPO with reversed insert; Clone
FT                   identification sequence tag: CAGCGCGC"
FT                   /db_xref="taxon:10090"
FT   gene            1..2223
FT                   /gene="Pkd2l2"
FT                   /note="synonym: TRPP5"
FT   CDS             30..1895
FT                   /codon_start=1
FT                   /gene="Pkd2l2"
FT                   /product="polycystic kidney disease 2-like 2"
FT                   /db_xref="GOA:Q9JLG4"
FT                   /db_xref="InterPro:IPR003915"
FT                   /db_xref="InterPro:IPR013122"
FT                   /db_xref="MGI:MGI:1858231"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JLG4"
FT                   /protein_id="AAI38718.1"
FT                   /translation="MSEATWWYRGGTSKHDLHYRREAEVNTTLEELLLYFIFLINLCIL
FT                   TFGMVNPHMYYLNKVMSSLFVDTSLPDDERSSFRSIRSITEFWKFMEGPLIDGLYWDSW
FT                   YGNKQLYSVKNSSRIYYENVLLGIPRVRQLRVRNNTCKVYPAFQSLVSDCYSKYTVENE
FT                   DFSDFGLKRNPEWTHTPSSRTAPWHWGFVGVYRDGGYIVTLSKSKSETKAKFVDLRLNN
FT                   WISRGTRAVFIDFSLYNANVNLFCIIRLLAEFPATGGLLTSWQFYSVKLLRYVSYYDYF
FT                   IASCEVIFCIFLFVFIIQELRKVNEFKSAYFRSVWNWLEMLLLLLCFLAVSFYAYCNMQ
FT                   SFLLLGQLLKNTDSYPDFYFLAYWHIYYNNVIAITIFFAWIKIFKFISFNETMSQLSST
FT                   LSRCMKDIVGFAIMFFIIFSAYAQLGFLVFGSQVDDFSTFQNSIFAQFRIVLGDFNFAG
FT                   IQQANWILGPIYFITFIFFVFFVLLNMFLAIINDTYSEVKADYSIGRRPDFELGKIIQK
FT                   SCFNVLEKLRLKKAQAKEEKKMQTTDLAQRARRDGFDESEIQEAEQMKRWKERLEKKYY
FT                   STEIQDDYQPVTQQEFRELFLYAVELEKELHYVSLKLNQLMRKLH"
XX
SQ   Sequence 2223 BP; 628 A; 484 C; 484 G; 627 T; 0 other;
     gtggaacgga ccgtgtggta tgctccgcga tgtctgaggc gacttggtgg taccgaggag        60
     ggacttcaaa acatgacctg cattacagaa gggaagcgga ggttaacacc acactcgagg       120
     agttgttact ctattttatt ttcttaataa atctatgcat attgactttt gggatggtca       180
     atccacatat gtactattta aacaaagtta tgtcgtctct gtttgtggac acttctctac       240
     ctgatgatga aagaagcagc tttaggtcca ttcggagcat aactgagttt tggaagttca       300
     tggaaggacc cctcatcgac ggcttgtact gggactcgtg gtatggcaac aaacagctgt       360
     acagtgtgaa gaacagcagc cgcatctact acgagaacgt tcttctcggc atccccagag       420
     tgcggcaact gcgagtccga aacaacactt gcaaggtcta cccagctttc cagtccctgg       480
     tcagcgactg ctacagcaag tacacagtgg aaaacgaaga cttctctgat tttggcctca       540
     aacgcaatcc agaatggacg cacacacctt cttcccgcac tgccccatgg cactgggggt       600
     ttgttggcgt ataccgagat ggaggatata tagtcacgtt atcaaaatca aaatctgaaa       660
     ccaaagccaa atttgttgac cttcgactga acaactggat tagcagaggc accagggctg       720
     tttttattga tttctccctg tacaatgcta atgtcaacct gttttgcatc atcaggctgc       780
     tggcagagtt ccctgcgacg ggtgggctcc tcacctcctg gcagttctac tctgtgaagc       840
     tcctcagata cgtctcctac tacgactact tcattgcctc ctgtgaagtc atattttgta       900
     tttttctctt tgtcttcata atacaagaac tgaggaaagt gaacgagttt aagtctgcct       960
     atttcagaag tgtctggaac tggctggaga tgctgctcct gctgctctgt tttctcgccg      1020
     tgtctttcta tgcatactgt aacatgcaga gctttctctt gcttggacag ctgctgaaaa      1080
     acactgacag ctatcccgac ttttacttcc ttgcatactg gcacatttac tataacaacg      1140
     taattgctat cactatcttc tttgcatgga taaagatatt caagttcata agcttcaatg      1200
     agacaatgtc gcagctgtca tcaacactct cccgctgcat gaaggacatc gtggggttcg      1260
     ccatcatgtt cttcatcatc ttctctgctt atgcccagtt gggatttctg gtttttgggt      1320
     cacaggttga tgatttttca acttttcaaa attccatatt tgcacaattt cgaattgtcc      1380
     tcggggactt taattttgct ggcatccagc aggccaactg gatcttgggg cccatctact      1440
     tcatcacgtt catcttcttc gtgttctttg tgctcctgaa catgttcttg gcaataatta      1500
     atgacaccta ttctgaagtt aaggctgatt attcaatagg cagaagacca gattttgaac      1560
     ttggtaaaat aattcaaaag agttgcttta atgttctcga gaaactcaga ctcaagaaag      1620
     ctcaagctaa agaagaaaag aaaatgcaaa ccactgactt ggcccagaga gccagaagag      1680
     acggctttga tgaaagtgag atccaagagg cagagcagat gaaaagatgg aaggaaaggc      1740
     ttgaaaaaaa gtattattct acagaaattc aagacgatta tcagcctgtc actcagcaag      1800
     aattccgaga gctcttttta tacgcggtgg agcttgagaa ggaattacac tatgtcagtt      1860
     taaaactgaa ccaactgatg agaaagctgc actagcaggc tgacaagtgg agtcatttta      1920
     taagaaaagg caaccgaaga atttcattca gtatgaagat tttttcctct caattttctt      1980
     cagtaatgca aaagaaaaaa caaaaagtaa acagaagagc tttttatttc aaagttcttg      2040
     aagtaaaaga gtaaaactct tgtcctttgc taacagccgt gtctgcagta aaacaatgaa      2100
     ggagcctgcg tgtttcctaa gtgtggagag gatctgcggg aatgtggaac agctttcctt      2160
     gcctactgga accacaaaca agcacacaat gggactctct gagtgcctga caaagtgaac      2220
     gca                                                                    2223
//