spacer

EBI Dbfetch

ID   BC138669; SV 1; linear; mRNA; STD; MUS; 3410 BP.
XX
AC   BC138669;
XX
DT   12-FEB-2009 (Rel. 99, Created)
DT   12-FEB-2009 (Rel. 99, Last updated, Version 1)
XX
DE   Mus musculus 5-hydroxytryptamine (serotonin) receptor 1A, mRNA (cDNA clone
DE   MGC:170295 IMAGE:8861690), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3410
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-3410
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (29-MAR-2007) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; ef6e2f7d9b272945a79a4ab3caa2cdfa.
DR   Ensembl-Gn; ENSMUSG00000021721; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000022235; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Ambion
CC   cDNA Library Preparation: British Columbia Cancer Research Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRCK Plate: 16 Row: H Column: 3
CC   single stranded.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3410
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_377"
FT                   /clone="MGC:170295 IMAGE:8861690"
FT                   /tissue_type="Brain, PCR rescued clones"
FT                   /note="Vector: pCR4-TOPO; Clone identification sequence
FT                   tag: AACGTGCG"
FT                   /db_xref="taxon:10090"
FT   gene            1..3410
FT                   /gene="Htr1a"
FT   CDS             269..1534
FT                   /codon_start=1
FT                   /gene="Htr1a"
FT                   /product="5-hydroxytryptamine (serotonin) receptor 1A"
FT                   /db_xref="GOA:Q64264"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000610"
FT                   /db_xref="InterPro:IPR002231"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:96273"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q64264"
FT                   /protein_id="AAI38670.1"
FT                   /translation="MDMFSLGQGNNTTTSLEPFGTGGNDTGLSNVTFSYQVITSLLLGT
FT                   LIFCAVLGNACVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTL
FT                   GQVTCDLFIALDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLI
FT                   GFLISIPPMLGWRTPEDRSNPNECTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAA
FT                   RFRIRKTVKKVEKKGAGTSFGTSSAPPPKKSLNGQPGSGDCRRSAENRAVGTPCANGAV
FT                   RQGEDDATLEVIEVHRVGNSKGHLPLPSESGATSYVPACLERKNERTAEAKRKMALARE
FT                   RKTVKTLGIIMGTFILCWLPFFIVALVLPFCESSCHMPELLGAIINWLGYSNSLLNPVI
FT                   YAYFNKDFQNAFKKIIKCKFCR"
XX
SQ   Sequence 3410 BP; 769 A; 905 C; 850 G; 886 T; 0 other;
     tggaagatgc tttcagccca actacagttt cctagctgga gcctctgagc gctcaggacc        60
     cgcgggagcc aagcaagaga gcgccggtga gtgctcctct cagatgcctt cgccagagca       120
     agtaagaact tcccgctcca gtctctagat cccctccctt cgaaactccc cagaaaggaa       180
     ggaagaccct agggggaggg gcgagggaga tccccttgca tttctttttc cctcccttcc       240
     ccccacccca gcgggagtgc aggcaggcat ggatatgttc agtcttggcc agggcaacaa       300
     caccacaacg tccctggagc ccttcgggac aggcggcaac gatactggcc tctccaacgt       360
     gaccttcagc taccaagtga tcacctctct tttgctgggg acgctcattt tctgcgcggt       420
     gctcggcaat gcctgcgtgg ttgctgccat cgccctggag cgctcccttc agaatgttgc       480
     caactatctc atcggctcct tggcggtcac cgatctcatg gtgtcagtgc tggtgctgcc       540
     catggctgct ctgtaccagg tgctcaacaa gtggactctg ggtcaggtca cctgtgacct       600
     gtttatcgcc ctggatgtgc tgtgctgcac ttcgtccatc ctgcacctgt gcgccatcgc       660
     gctagacagg tactgggcaa tcaccgaccc tatagactac gtgaacaaga ggacgccccg       720
     gcgcgccgct gcgctgatct cgctcacttg gctcattggc tttctcatct ccatcccgcc       780
     tatgctgggc tggcgcaccc cggaagaccg ctcgaacccc aacgagtgca ccatcagcaa       840
     ggaccacggg tacaccatct actccacttt cggcgctttc tatattccgc tgctgctcat       900
     gctggtcctc tatgggcgca tcttcagagc cgcgcgcttc cgaatccgca agacggtcaa       960
     gaaggtggaa aagaagggag cgggcaccag cttcggaaca tcgtcggccc cgccccccaa      1020
     gaagagcctg aatggtcagc caggtagtgg ggactgcagg cgcagtgctg agaacagggc      1080
     ggtggggact ccgtgcgcta atggggcggt gagacagggt gaggacgacg ccaccctgga      1140
     ggtgatcgag gtgcatcgag tgggcaactc caaagggcac cttcctctgc ccagcgaatc      1200
     aggagctacc tcctatgtcc ccgcctgctt ggagagaaaa aatgagcgca ctgctgaggc      1260
     aaagcgcaag atggccttgg cccgtgagag gaagacagtg aagacactgg gcatcatcat      1320
     gggcaccttc atcctctgct ggctgccctt tttcattgtg gccctggtcc tacctttctg      1380
     tgagagcagt tgccacatgc ctgagttgtt gggtgccata attaactggc taggctactc      1440
     caactccctg ctcaacccag ttatttatgc ttatttcaac aaagactttc aaaacgcttt      1500
     taagaagatc atcaagtgca agttctgccg ctgatgatga tgatggtggt ggtagtggtg      1560
     gtaatagtgg tggtgatgga gaaggaagaa gtggaggaag agtgtagggc ttacaggacc      1620
     cttcctgttc actcaatatc cccgccctgg aagcaacacc taagaaaact tgcttttcct      1680
     agaacacgca gcttcttagc ccatggcttt cagatcttct ctctctatct cattttaagg      1740
     ggacagtgct ttttgcagaa atcttagaga acccctagca tctgtttgta aaattattgg      1800
     ctcggtcttt ggccctagga tcagttttga tagttgcaat aacctcctct ctattcgaaa      1860
     tcccaattct tcacgatgga agtttaaacc tcggcgattc aaggaagaaa acccaaacag      1920
     aaaatataaa ctgtatggac atctaccatg cccactagga ctgccaccct ctgccctata      1980
     tctggaactt tgaggttcaa gactgctctg tctctccctc cctcttgctc tagaaacatc      2040
     tgttcccttt gggtgtcaat gtacactgct gattctggtc tccatgcact cacggctggt      2100
     ctggggaagt tggaactact ttgggttatg gtgccctgga attgtttgcc ttgctgaata      2160
     gcaaaagatc cctttcccca atgcacagca cccactttct gtattttgtt tgtttgtttg      2220
     ttttaactca aaatcaagtg acaaagatgt ctgctggagt ggacttataa gcaagaagcc      2280
     aggcccaaaa ggaagagcca agaaggcctg cggatgtttt cctgtcctgg tgtcagcact      2340
     caccaaagaa attgacaatc agactatttg gaaggaagag ttttattcct gtagtttgtt      2400
     ggcttttctg taagttctgg aaaggccttg tggactgcag aaggcgccca ctgctggcca      2460
     gggagggctc attgagggtg ctgagatgcc cgggatggct cacctcaccc tcagtttctt      2520
     ttctaggagt gagctatgcc agagcagctc accttgagtt tgcagcctcc gggttcctcc      2580
     actcacctct cacagtatcc aggagctagt agagaagttt gagtttgtgc aagaggttgg      2640
     agacttagaa tttctaagga agtgtgggtg tgaggcacgt agaggaggta aggagcaaaa      2700
     gggctcctaa gtgcttccaa ctcctgcggc gcgcccaggg ggtgggggtg acctaaaggg      2760
     gcaattttaa gcataggatg caaagtttct caatctaccc cttccccctt tcaaggaaca      2820
     gcattgtgta gcatttccta aaaatgcccg gatttattct ccgggacatt ctgtgctcac      2880
     acaaatttcg cagatctctg ggctctcatt gtgaagggta tcaacacctc accattacct      2940
     acctaggatc ttgatctcag agacctaaaa gagagagcga tctctgtgga gtcccagcca      3000
     agtcagcccc caaattctga gggtaaaacc agttttgtgt cctctcaatt tttaaagcat      3060
     ttttctccgc taggggttct tttcctgctg ttatttttgc tgtcccaccc ccacctcaga      3120
     gaagaaaatt atttaggtgc ttcctttgaa tgtacatttc tagctaagtg agagggcatc      3180
     aaatggtttt gcgttatatc tgaacttcga attttctgtt gaataatggt ttccttttca      3240
     agcaattata cggagatttt tttcaccccc catccccttc agctgtatct ttccaatgtc      3300
     tgcacctgct gttttgaaaa cccgtgctgc attttttttt aaattgccaa agttgctggt      3360
     gagatctccc ccttgtgttt ataaacaggg agaaaggact gccctgccac                 3410
//


spacer
spacer