spacer

EBI Dbfetch

ID   BC138630; SV 1; linear; mRNA; STD; MUS; 2594 BP.
XX
AC   BC138630;
XX
DT   12-FEB-2009 (Rel. 99, Created)
DT   12-FEB-2009 (Rel. 99, Last updated, Version 1)
XX
DE   Mus musculus neurotensin receptor 1, mRNA (cDNA clone MGC:170255
DE   IMAGE:8861650), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2594
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2594
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (29-MAR-2007) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; cf3875ef125d73c62698c2f74253b958.
DR   Ensembl-Gn; ENSMUSG00000027568; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029084; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000170448; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Ambion
CC   cDNA Library Preparation: British Columbia Cancer Research Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRCK Plate: 16 Row: F Column: 16
CC   single stranded.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2594
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_378"
FT                   /clone="MGC:170255 IMAGE:8861650"
FT                   /tissue_type="Brain, PCR rescued clones"
FT                   /note="Vector: pCR4-TOPO with reversed insert; Clone
FT                   identification sequence tag: ACCCGTTT"
FT                   /db_xref="taxon:10090"
FT   gene            1..2594
FT                   /gene="Ntsr1"
FT                   /gene_synonym="NT-1R"
FT                   /gene_synonym="NTR-1"
FT                   /gene_synonym="NTR1"
FT   CDS             192..1466
FT                   /codon_start=1
FT                   /gene="Ntsr1"
FT                   /gene_synonym="NT-1R"
FT                   /gene_synonym="NTR-1"
FT                   /gene_synonym="NTR1"
FT                   /product="Ntsr1 protein"
FT                   /db_xref="GOA:A2ACT4"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR003984"
FT                   /db_xref="InterPro:IPR003985"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:97386"
FT                   /db_xref="UniProtKB/TrEMBL:A2ACT4"
FT                   /protein_id="AAI38631.1"
FT                   /translation="MHLNSSVQQGAPSEPGAQPFPHPQFGLETMLLALSLSNGSGNSSE
FT                   SILEPNSNLDVNTDIYSKVLVTAVYLALFVVGTVGNSVTAFTLARKKSLQSLQSTVHYH
FT                   LGSLALSDLLILLLAMPVELYNFIWVHHPWAFGDAGCRGYYFLRDACTYATALNVASLS
FT                   VERYLAICHPFKAKTLMSRSRTKKFISAIWLASALLAVPMLFTMGLQNRSADGQHPGGL
FT                   VCTPTVDTATVKVVIQVNTFMSFLFPMLIISILNTVIANKLTVMVHQAAEQGRGVCTVG
FT                   THNSLEHSTFNMSIEPGRVQALRHGVLVLRAVVIAFVVCWLPYHVRRLMFCYISDEQWT
FT                   TFLFDFYHYFYMLTNALFYVSSAINPILYNLVSANFRQVFLSTLACLCPGWRRRRKKRP
FT                   TFSRKPNSMSSNHAFSTSATRETLY"
XX
SQ   Sequence 2594 BP; 573 A; 794 C; 674 G; 553 T; 0 other;
     aagagtggat ccctgagccg gcacgtctcg agccccagag ctcccaggat ctcctggata        60
     gctggcttcg ccgccggacg gcacgccccc cttagcttcc acaccctctc ctctgagcgc       120
     ctcctcatct gcccctggag ggactttcac cttcaaaggt gcaggacaaa gccgcatatc       180
     tggcgcccac catgcacctc aacagctccg tgcagcaggg agccccaagt gaacccggtg       240
     cccagccctt cccacatcca cagttcggac tggagacgat gctcctggcg ctcagcttga       300
     gcaatggttc tggcaattcc tcagaatcca tcctggagcc caacagcaac ctggacgtga       360
     acactgacat ttattccaag gtgctggtga ccgctgtata cctggcactt tttgtggtgg       420
     gcactgtggg caactcggtg acagccttca ctctagcgcg gaagaagtcg ctgcagagcc       480
     tgcagagcac tgtgcattac cacctgggta gcctggcact gtctgacctg ctcatcctgc       540
     tgctggccat gcccgtggag ctgtacaact tcatctgggt gcaccatccc tgggcctttg       600
     gggatgctgg ctgccgtggc tactatttcc tgcgagatgc ctgcacctat gccacagccc       660
     tcaatgtagc cagcctgagt gtggagcgct acttggccat ctgccatccc ttcaaggcca       720
     agaccctcat gtcccgcagc cgcaccaaga aattcatcag tgccatatgg ctagcctcgg       780
     cgctgctggc tgtacccatg cttttcacca tgggcctgca gaaccgcagt gccgatggcc       840
     agcaccctgg tggcctggtg tgcacaccca cggtggacac agccaccgtc aaggtcgtca       900
     tccaggttaa caccttcatg tccttcctgt ttcccatgct gatcatctcc atcctaaaca       960
     ctgtgatagc caacaaactg accgtcatgg tgcaccaggc tgccgagcag ggccgtggtg      1020
     tgtgcaccgt gggcacccac aacagtttag agcacagcac gttcaacatg tccatcgagc      1080
     caggccgtgt ccaggccctg cgccatggag tcctcgtctt acgtgctgtg gtaatcgcct      1140
     ttgtggtctg ctggctgccc taccacgtgc ggcgcctcat gttctgctat atctcagatg      1200
     aacagtggac tacgttcctc ttcgacttct accactattt ctatatgctg accaacgctc      1260
     tcttctacgt cagctcagcc atcaatccca tcctttacaa cctcgtctcc gccaacttcc      1320
     gccaggtctt cctgtccaca ctggcttgcc tctgtcctgg gtggcgccgc cgccgaaaga      1380
     agaggccaac gttctccagg aagccaaaca gcatgtccag caaccatgcg ttttccacca      1440
     gcgccacccg ggaaaccctg tactaggcca tgaggagact aatggatgtt ttagaagcaa      1500
     gaaatgaaag caccacattg ggcctggaca gatgagctgt tgtaaccata acagcacctt      1560
     ggaactgcac tggcagggcg agacagtgtc tgatgttgga cttgggttca gagacacagg      1620
     ctccatctca gcccctttat gcctctactc ctgccctggt ccagcagata ccatagcact      1680
     ctctgagcct tatgtccaga ccctttcttg gcaggctggt acactgccct tcccagagtg      1740
     gtccagagaa gccccaaaat tactgtgtaa ggtccagggc ccacagctgg aagctgtggg      1800
     aatccatgcc acacctggat ggctatggcc cactaaagag accccaattc ccacatgccc      1860
     aggaaggata aaagggctgg cctggaatca acacaggaca agcttcaagt ggctttgcac      1920
     ggggaccttc acctcttgga tctgcagaag gatggaagat aagtgggatc cagcctcccc      1980
     agtccaggtg gctttgctgg ggacattcat ggttctgcgt ctcatataca gatgtataga      2040
     ctaaggtctg acagcagctg gcttcaggct gggacttctg agaaggggca ctgagccagg      2100
     tcctcagcaa gatgccagtg tctgagactc cacaggtaag gggaggccaa gcaccccagc      2160
     atctagctgg ccagcagccc tggactgagg catatgtcaa tttgttaacc agccgccaag      2220
     cagccaccct ggcccaggtt ctaggcgcct ggaaaagcag gcacccttca tctctgggag      2280
     ctgtctccaa acaagacagg cccattcagc ctccagccaa caagctggct gggcacttgg      2340
     agacagtccc aggatgccat gcaccaacaa ggtagaagta gcaggagagt caagtgtagc      2400
     cttttgcaaa agagccttag ctctgttgtc tgggagagag atggctggac atgcagctgc      2460
     tctgtaagga tgaaattgcc acgggacatg ggaggctcag tcacagccca ggctagcctc      2520
     tgctccctct gaactataaa acaatgggtg aaaagtcagg gtatctgtgg tcacccagag      2580
     aaatggggag ggtg                                                        2594
//


spacer
spacer