spacer

EBI Dbfetch

ID   BC138620; SV 1; linear; mRNA; STD; MUS; 2922 BP.
XX
AC   BC138620;
XX
DT   13-MAY-2008 (Rel. 95, Created)
DT   13-MAY-2008 (Rel. 95, Last updated, Version 1)
XX
DE   Mus musculus a disintegrin-like and metallopeptidase (reprolysin type) with
DE   thrombospondin type 1 motif, 5 (aggrecanase-2), mRNA (cDNA clone MGC:170245
DE   IMAGE:8861640), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2922
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2922
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (29-MAR-2007) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 9fd07fd2e57dbbf95ee3d9d32a20c84e.
DR   Ensembl-Gn; ENSMUSG00000022894; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000023611; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Ambion
CC   cDNA Library Preparation: British Columbia Cancer Research Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: LLDM Plate: 667 Row: l Column: 22.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2922
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_378"
FT                   /clone="MGC:170245 IMAGE:8861640"
FT                   /tissue_type="Brain, PCR rescued clones"
FT                   /note="Vector: pCR4-TOPO with reversed insert; Clone
FT                   identification sequence tag: TGTGCGTC"
FT                   /db_xref="taxon:10090"
FT   gene            1..2922
FT                   /gene="Adamts5"
FT                   /note="synonyms: ADAMTS11, ASMP-2, ADAMTS1, ADAM-TS5"
FT   CDS             43..2835
FT                   /codon_start=1
FT                   /gene="Adamts5"
FT                   /product="a disintegrin-like and metallopeptidase
FT                   (reprolysin type) with thrombospondin type 1 motif, 5
FT                   (aggrecanase-2)"
FT                   /db_xref="GOA:Q9R001"
FT                   /db_xref="InterPro:IPR000884"
FT                   /db_xref="InterPro:IPR001590"
FT                   /db_xref="InterPro:IPR002870"
FT                   /db_xref="InterPro:IPR010294"
FT                   /db_xref="InterPro:IPR013273"
FT                   /db_xref="InterPro:IPR013276"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="MGI:MGI:1346321"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9R001"
FT                   /protein_id="AAI38621.1"
FT                   /translation="MRLEWAPLLLLLLLLSASCLSLAADSPAAAPAQDKTRQPQAAAAA
FT                   AEPDQPQGEETRERGHLQPLAGQRRSGGLVQNIDQLYSGGGKVGYLVYAGGRRFLLDLE
FT                   RDDTVGAAGSIVTAGGGLSASSGHRGHCFYRGTVDGSPRSLAVFDLCGGLDGFFAVKHA
FT                   RYTLKPLLRGSWAEYERIYGDGSSRILHVYNREGFSFEALPPRASCETPASPSGPQESP
FT                   SVHSRSRRRSALAPQLLDHSAFSPSGNAGPQTWWRRRRRSISRARQVELLLVADSSMAR
FT                   MYGRGLQHYLLTLASIANRLYSHASIENHIRLAVVKVVVLTDKDTSLEVSKNAATTLKN
FT                   FCKWQHQHNQLGDDHEEHYDAAILFTREDLCGHHSCDTLGMADVGTICSPERSCAVIED
FT                   DGLHAAFTVAHEIGHLLGLSHDDSKFCEENFGTTEDKRLMSSILTSIDASKPWSKCTSA
FT                   TITEFLDDGHGNCLLDLPRKQILGPEELPGQTYDATQQCNLTFGPEYSVCPGMDVCARL
FT                   WCAVVRQGQMVCLTKKLPAVEGTPCGKGRVCLQGKCVDKTKKKYYSTSSHGNWGSWGPW
FT                   GQCSRSCGGGVQFAYRHCNNPAPRNSGRYCTGKRAIYRSCSVTPCPPNGKSFRHEQCEA
FT                   KNGYQSDAKGVKTFVEWVPKYAGVLPADVCKLTCRAKGTGYYVVFSPKVTDGTECRPYS
FT                   NSVCVRGRCVRTGCDGIIGSKLQYDKCGVCGGDNSSCTKIIGTFNKKSKGYTDVVRIPE
FT                   GATHIKVRQFKAKDQTRFTAYLALKKKTGEYLINGKYMISTSETIIDINGTVMNYSGWS
FT                   HRDDFLHGMGYSATKEILIVQILATDPTKALDVRYSFFVPKKTTQKVNSVISHGSNKVG
FT                   PHSTQLQWVTGPWLACSRTCDTGWHTRTVQCQDGNRKLAKGCLLSQRPSAFKQCLLKKC
FT                   "
XX
SQ   Sequence 2922 BP; 705 A; 776 C; 826 G; 615 T; 0 other;
     gctagactca gtcgcgcagc ccctcccggc gggcagcgca ctatgcggct cgagtgggcg        60
     cccttgttgc tgctactgct gctgctgagc gcgtcctgcc tgtccctggc cgctgacagc       120
     cccgccgcgg cacctgccca ggataaaacc aggcagcctc aggctgcagc agcggccgcc       180
     gagccggacc agccgcaggg ggaggaaaca cgggagcgag gccatttaca acccttggcc       240
     gggcagcgca ggagcggcgg gctggtccag aatatagacc aactctactc tggcggtggc       300
     aaagtgggct accttgtcta cgcgggcggc cggaggttcc tgctggacct ggagagagat       360
     gacacagtgg gtgctgctgg tagcatcgtt actgcaggag gagggctgag cgcatcctct       420
     ggccaccggg gtcactgttt ctacagaggc accgtggacg gcagccctcg atccctagct       480
     gtctttgacc tctgcggggg tctcgatggc ttctttgcag tcaagcatgc gcgctacact       540
     ctaaagccac tcctgcgtgg gtcctgggca gagtatgaac gaatttatgg ggatggatct       600
     tcccgcatcc tgcatgtcta caaccgcgag ggctttagct tcgaggccct gccgccacgc       660
     gccagttgcg agactcctgc atccccatct gggccccaag agagcccctc ggtgcacagt       720
     agatctagga gacgctcagc gctggccccg cagctgctgg accactcagc tttctcgcca       780
     tctgggaacg cgggacctca gacttggtgg aggcgtaggc gccgttccat ctccagggcc       840
     cgccaggtgg agctcctctt ggtggctgac tcgtccatgg ccaggatgta tgggcggggc       900
     ctgcagcatt acctgctgac cctggcctcc atcgccaaca ggctgtacag tcatgcaagc       960
     attgagaacc acatccgcct ggcggtggtg aaggtggtgg tgctgacgga caaggacacg      1020
     agtctggagg tgagcaagaa tgcggccacg accctcaaga acttttgcaa atggcagcac      1080
     caacataacc agctagggga tgatcacgaa gagcactacg atgcagccat cctgttcacc      1140
     cgagaggatt tatgtgggca tcattcatgt gacaccctgg gaatggcaga cgttgggacc      1200
     atatgttctc cggagcgcag ctgtgcagtg attgaagatg atggcctcca tgcagccttc      1260
     actgtggctc atgaaattgg gcatctactt ggcctttctc atgacgattc caaattctgt      1320
     gaagagaact tcggtactac agaagacaag cgtttaatgt cttcaatcct taccagcatc      1380
     gatgcatcca agccctggtc caaatgcacg tcagccacca tcacagaatt cctggatgat      1440
     ggtcatggta attgtttgct agacctacca cggaagcaga ttttgggtcc cgaggaactc      1500
     ccaggacaga cctacgatgc cacccagcag tgcaacttga catttgggcc tgagtactcg      1560
     gtgtgccctg gcatggatgt ctgtgcgcgg ctgtggtgtg ctgtggtgcg ccaaggccaa      1620
     atggtgtgtc tgaccaagaa gctgccggct gtggagggca ctccctgtgg gaagggaaga      1680
     gtctgccttc aaggcaaatg tgtggacaaa actaagaaaa aatattactc gacatcaagc      1740
     catggaaatt gggggtcctg gggcccctgg ggtcagtgtt ctcgctcatg cgggggagga      1800
     gtgcagtttg cctaccgcca ttgtaataac cctgcacctc gaaacagtgg ccgctactgc      1860
     acagggaaga gggccatata ccgttcctgc agtgttacac cctgcccacc caatggtaaa      1920
     tcttttcgcc atgagcagtg tgaagccaaa aatggctatc agtctgatgc aaaaggagtc      1980
     aaaacatttg tagaatgggt tcccaaatat gcaggtgtcc tgccggcaga tgtgtgcaag      2040
     cttacctgca gagctaaggg cacaggctac tatgtggtct tttctccaaa ggttacggat      2100
     gggactgaat gcaggccgta cagcaactct gtgtgtgtcc gaggacggtg tgtgagaact      2160
     ggatgtgacg gcattattgg ctcaaagcta caatatgaca agtgtggagt gtgcggaggg      2220
     gataactcca gttgtacaaa gattatcgga accttcaata aaaaaagcaa gggttatact      2280
     gacgttgtga ggatccctga aggagcaacc cacataaaag tccgacagtt caaagccaaa      2340
     gaccagacta gattcactgc ctacttagcc ctgaagaaga aaactggcga gtaccttatc      2400
     aatggcaagt acatgatttc cacttcagag accatcatcg acatcaatgg taccgtcatg      2460
     aactacagtg gatggagcca cagagatgat tttttacatg ggatgggcta ttcagccaca      2520
     aaagaaatcc tgatcgtgca gatccttgcc acagacccaa ctaaagcgct agacgtccgt      2580
     tacagctttt ttgttcccaa gaagaccact caaaaagtaa actctgtcat cagccatggc      2640
     agcaacaagg tgggaccaca ctctacacag ctgcagtggg tgacaggtcc atggctggcc      2700
     tgctccagga cctgtgacac aggctggcac actaggaccg tgcagtgcca ggatggaaac      2760
     aggaaattag ctaaaggatg ccttctctct cagaggcctt ctgcatttaa gcaatgtctg      2820
     ctgaagaaat gttagcctgt ggtttactct aatgcacaaa aaaacaacag gaggatcatc      2880
     gcagatacag ctgtggtgaa gacaaggcct acccaaagca ca                         2922
//


spacer
spacer