Dbfetch

ID   BC138593; SV 1; linear; mRNA; STD; MUS; 1907 BP.
XX
AC   BC138593;
XX
DT   13-MAY-2008 (Rel. 95, Created)
DT   13-MAY-2008 (Rel. 95, Last updated, Version 1)
XX
DE   Mus musculus bone morphogenetic protein 6, mRNA (cDNA clone MGC:170218
DE   IMAGE:8861613), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1907
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1907
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (29-MAR-2007) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 6572e4482acd034b7d956aa5b93ba0e4.
DR   Ensembl-Gn; ENSMUSG00000039004; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020472; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0020426; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0020404; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020422; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0020221; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0020855; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0019736; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0020182; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0020304; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0020283; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0020379; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0020313; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0020898; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019491; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0019798; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000171970; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0036798; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0036731; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0036700; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0036751; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0036505; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0037209; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0036430; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0036413; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0036557; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0036528; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0036692; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0036522; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0037260; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0036078; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0035922; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Ambion
CC   cDNA Library Preparation: British Columbia Cancer Research Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: LLDM Plate: 667 Row: k Column: 19.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1907
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_378"
FT                   /clone="MGC:170218 IMAGE:8861613"
FT                   /tissue_type="Brain, PCR rescued clones"
FT                   /note="Vector: pCR4-TOPO with reversed insert; Clone
FT                   identification sequence tag: TTCTGTCC"
FT                   /db_xref="taxon:10090"
FT   gene            1..1907
FT                   /gene="Bmp6"
FT   CDS             138..1670
FT                   /codon_start=1
FT                   /gene="Bmp6"
FT                   /product="bone morphogenetic protein 6"
FT                   /db_xref="GOA:P20722"
FT                   /db_xref="InterPro:IPR001111"
FT                   /db_xref="InterPro:IPR001839"
FT                   /db_xref="InterPro:IPR015615"
FT                   /db_xref="InterPro:IPR017948"
FT                   /db_xref="InterPro:IPR029034"
FT                   /db_xref="MGI:MGI:88182"
FT                   /db_xref="UniProtKB/Swiss-Prot:P20722"
FT                   /protein_id="AAI38594.1"
FT                   /translation="MPGLGRRAQWLCWWWGLLCSCGPPPLRPPLPVAAAAAGGQLLGAG
FT                   GSPVRAEQPPPQSSSSGFLYRRLKTHEKREMQKEILSVLGLPHRPRPLHGLQQPQPPVL
FT                   PPQQQQQQQQQQTAREEPPPGRLKSAPLFMLDLYNALSNDDEEDGASEGVGQEPGSHGG
FT                   ASSSQLRQPSPGAAHSLNRKSLLAPGPGGGASPLTSAQDSAFLNDADMVMSFVNLVEYD
FT                   KEFSPHQRHHKEFKFNLSQIPEGEAVTAAEFRVYKDCVVGSFKNQTFLISIYQVLQEHQ
FT                   HRDSDLFLLDTRVVWASEEGWLEFDITATSNLWVVTPQHNMGLQLSVVTRDGLHVNPRA
FT                   AGLVGRDGPYDKQPFMVAFFKVSEVHVRTTRSASSRRRQQSRNRSTQSQDVSRGSGSSD
FT                   YNGSELKTACKKHELYVSFQDLGWQDWIIAPKGYAANYCDGECSFPLNAHMNATNHAIV
FT                   QTLVHLMNPEYVPKPCCAPTKLNAISVLYFDDNSNVILKKYRNMVVRACGCH"
XX
SQ   Sequence 1907 BP; 386 A; 583 C; 589 G; 349 T; 0 other;
     agtgccagaa ccgggaagag agcccgccga gaggtggcgg gggctgccca ctccgagggc        60
     cacagcctcc gcgctccggc ctcgctccgc cgctcgacgc ctcgcgggcc ccgcgggggc       120
     agccgggctg ggcggcgatg cccgggctgg ggcggagggc gcagtggctg tgctggtggt       180
     gggggttgct gtgcagctgc ggccccccgc cactgcggcc ccctctgccg gtagccgcgg       240
     ccgccgccgg ggggcagctg ctgggagccg gcgggagccc ggtgcgcgct gagcagccac       300
     cgccacagtc ctcttcttcg ggcttcctct atcggcggct caagacccac gagaagcggg       360
     agatgcaaaa ggagatcctg tcggtgctgg ggctcccgca caggccgcgg cccctgcacg       420
     gtctccagca gcctcagccc ccggtgctcc cgccacagca gcagcagcag cagcagcagc       480
     agcagacggc ccgcgaggag ccccctccag ggcggctgaa gtccgctcca ctcttcatgc       540
     tggatctcta caacgccctg tccaatgacg acgaagagga tggggcatcg gagggtgtgg       600
     ggcaagagcc tgggtcccac ggaggggcca gctcgtccca gctcaggcag ccgtctcccg       660
     gcgctgcaca ctccttgaac cgcaagagtc tcctggcccc gggacccggt ggcggtgcgt       720
     ccccactgac tagcgcgcag gacagcgctt tcctcaacga cgcggacatg gtcatgagct       780
     ttgtgaacct ggtggagtac gacaaggagt tctccccaca tcaacgacac cacaaagagt       840
     tcaagttcaa cctatcccag attcctgagg gtgaggcggt gacggctgct gagttccgcg       900
     tctacaagga ctgtgtggtg gggagtttta aaaaccaaac ctttcttatc agcatttacc       960
     aagtcttgca ggagcatcag cacagagact ctgacctatt tttgttggac acccgggtgg      1020
     tgtgggcctc agaagaaggt tggctggaat ttgacatcac agcaactagc aatctgtggg      1080
     tggtgacacc gcagcacaac atggggctcc agctgagtgt ggtgactcgg gatggactcc      1140
     acgtcaaccc ccgtgcggcg ggcctggtgg gcagagacgg cccttacgac aagcagccct      1200
     tcatggtggc cttcttcaag gtgagcgagg tccacgtgcg caccaccagg tcagcctcca      1260
     gtcggcggcg gcagcagagt cgcaaccggt ccacccagtc gcaggacgtg tcccggggct      1320
     ccggttcttc agactacaac ggcagtgagt taaaaacagc ttgcaagaag catgagctct      1380
     atgtgagctt ccaggacctg ggatggcagg actggatcat tgcacccaaa ggctacgctg      1440
     ccaactactg tgatggagag tgttccttcc cactcaacgc acacatgaat gccaccaacc      1500
     acgccattgt acagaccttg gtccacctta tgaatcccga gtacgtcccc aaaccatgct      1560
     gcgcaccaac caaactgaat gccatctcgg ttctttactt cgatgataac tccaatgtca      1620
     tcttgaaaaa gtacaggaat atggtcgtga gagcttgtgg ttgccattaa gttgaagctg      1680
     gtgtgtgtgt gtgggtgggg gcatggttct gccttggatt cctaacaaca acatctgcct      1740
     taaaccacga acaacagcac agcgaagcgg gatggtgaca cacagaggga tcgtgacacg      1800
     cagacacatc tcccgctggt gccttaccca cggaggcttt tatgaggacc ttgtcaaggg      1860
     ctttcccagt tcctaactga gcagttgctg gtctgcagga agctgga                    1907
//