Dbfetch

ID   BC138503; SV 1; linear; mRNA; STD; MUS; 1052 BP.
XX
AC   BC138503;
XX
DT   13-MAY-2008 (Rel. 95, Created)
DT   13-MAY-2008 (Rel. 95, Last updated, Version 1)
XX
DE   Mus musculus calcium channel, voltage-dependent, gamma subunit 4, mRNA
DE   (cDNA clone MGC:170128 IMAGE:8861523), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1052
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1052
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (29-MAR-2007) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 469f1f07e88a8c38674853e18a7b8f0d.
DR   Ensembl-Gn; ENSMUSG00000020723; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000021066; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Ambion
CC   cDNA Library Preparation: British Columbia Cancer Research Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: LLDM Plate: 667 Row: h Column: 1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1052
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_378"
FT                   /clone="MGC:170128 IMAGE:8861523"
FT                   /tissue_type="Brain, PCR rescued clones"
FT                   /note="Vector: pCR4-TOPO with reversed insert; Clone
FT                   identification sequence tag: CGACTGCA"
FT                   /db_xref="taxon:10090"
FT   gene            1..1052
FT                   /gene="Cacng4"
FT   CDS             20..1003
FT                   /codon_start=1
FT                   /gene="Cacng4"
FT                   /product="calcium channel, voltage-dependent, gamma subunit
FT                   4"
FT                   /db_xref="GOA:A2AAU2"
FT                   /db_xref="InterPro:IPR004031"
FT                   /db_xref="InterPro:IPR005423"
FT                   /db_xref="InterPro:IPR008368"
FT                   /db_xref="MGI:MGI:1859167"
FT                   /db_xref="UniProtKB/TrEMBL:A2AAU2"
FT                   /protein_id="AAI38504.1"
FT                   /translation="MVRCDRGLQMLLTTAGAFAAFSLMAIAIGTDYWLYSSAHICNGTN
FT                   LTMDDGPPPRRARGDLTHSGLWRVCCIEGIYRGHCFRINHFPEDNDYDHDSSEYLLRIV
FT                   RASSVFPILSTILLLLGGLCIGAGRIYSRKNNIVLSAGILFVAAGLSNIIGIIVYISSN
FT                   TGDPSDKRDEDKKNHYNYGWSFYFGALSFIVAETVGVLAVNIYIEKNKELRFKTKREFL
FT                   KASSSSPYARMPSYRYRRRRSRSSSRSTEASPSRDASPVGLKITGAIPMGELSMYTLSR
FT                   EPLKVTTAASYSPDQDAGFLQMHDFFQQDLKEGFHVSMLNRRTTPV"
XX
SQ   Sequence 1052 BP; 221 A; 338 C; 279 G; 214 T; 0 other;
     ggactatgag gcgcccacca tggtgcgatg cgaccgcggg ctgcagatgc tgctgaccac        60
     ggccggagcc ttcgccgcct tctcgctcat ggccatcgcc atcggcaccg actactggct       120
     gtactccagc gcgcacatct gcaacggcac caacctgacc atggacgacg ggcccccgcc       180
     ccgccgcgct cgcggcgacc tcacccattc gggactgtgg cgggtgtgtt gcatcgaagg       240
     catctataga gggcactgct tccggatcaa ccacttccca gaggacaacg attacgacca       300
     cgacagctcc gagtacctcc tccgcattgt gcgagcctcc agtgtctttc ccatcctcag       360
     caccattctg ctcctgctcg gagggctctg catcggcgct gggaggatct acagccgcaa       420
     gaacaatatt gtcctcagcg cgggaatcct ctttgtggcg gcaggcctca gtaatatcat       480
     cggtatcatc gtctacattt ccagcaacac gggcgacccc agtgacaaac gtgacgaaga       540
     caaaaagaac cattacaact acggctggtc tttttacttt ggagccctgt cgtttattgt       600
     ggcggagacc gtgggcgtcc tggctgtaaa catttacatt gagaaaaata aagagttgag       660
     gtttaagacc aagcgggagt tccttaaggc ctcttcctcc tctccttacg ccaggatgcc       720
     gagctacagg taccggcgac ggcggtccag gtccagttca aggtccacgg aggcctcacc       780
     ctccagggat gcatctcccg tgggcctgaa gatcaccgga gccattccca tgggtgagct       840
     gtccatgtac acgctatcca gagaacccct taaggtgacc acagctgcga gctacagtcc       900
     ggaccaggac gctggcttcc tgcagatgca tgacttcttc caacaggacc taaaggaagg       960
     tttccatgtc agcatgctga accggcggac aactcccgtg tgacccgccc acccctctcg      1020
     gcacaggcct cccccaaggt ggctgtttgt gt                                    1052
//