spacer

EBI Dbfetch

ID   BC138448; SV 1; linear; mRNA; STD; MUS; 5034 BP.
XX
AC   BC138448;
XX
DT   13-MAY-2008 (Rel. 95, Created)
DT   12-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Mus musculus adenylate cyclase 10, mRNA (cDNA clone MGC:170073
DE   IMAGE:8861468), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-5034
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-5034
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (29-MAR-2007) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; a8e9143d8f7063ac757f7afe17261700.
DR   Ensembl-Gn; ENSMUSG00000026567; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027852; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000148550; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Ambion
CC   cDNA Library Preparation: British Columbia Cancer Research Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: LLDM Plate: 667 Row: e Column: 18.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5034
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_391"
FT                   /clone="MGC:170073 IMAGE:8861468"
FT                   /tissue_type="Brain,thymus,testicle,kidney,spleen,liver,
FT                   heart,lung,ovary,embryo - PCR rescued clones"
FT                   /note="Vector: pCR-XL-TOPO; Clone identification sequence
FT                   tag: GAAGGTAG"
FT                   /db_xref="taxon:10090"
FT   gene            1..5034
FT                   /gene="Adcy10"
FT                   /note="synonyms: sAC, 4931412F17"
FT   CDS             95..4939
FT                   /codon_start=1
FT                   /gene="Adcy10"
FT                   /product="adenylate cyclase 10"
FT                   /db_xref="GOA:Q8C0T9"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR016577"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:2660854"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8C0T9"
FT                   /protein_id="AAI38449.1"
FT                   /translation="MSARRQELQDRAIVKIAAHLPDLIVYGDFSPERPSVKCFDGVLMF
FT                   VDISGFTAMTEKFSTAMYMDRGAEQLVEILNYYISAIVEKVLIFGGDILKFAGDALLAL
FT                   WKVERKQLKNIITVVIKCSLEIHGLFEAKEAEEGLDIRVKIGLAAGHITMLVFGDETRN
FT                   YFLVIGQAVDDVRLAQNMAQMNDVILSPNCWQLCDRSMIEIERIPDQRAVKVSFLKPPP
FT                   TFNFDEFFTKCMGFMDYYPSGDHKNFLRLACMLESDPELELSLQKYVMEIILKQIDDKQ
FT                   LRGYLSELRPVTIVFVNLMFKEQDKVEVIGSAIQAACVHITSVLKVFRGQINKVFMFDK
FT                   GCSFLCVFGFPGEKAPDEITHALESAVDIFDFCSQVHKIRTVSIGVASGIVFCGIVGHT
FT                   VRHEYTVIGQKVNIAARMMMYYPGIVSCDSVTYDGSNLPAYFFKELPKKVMKGVADPGP
FT                   VYQCLGLNEKVMFGMAYLICNRYEGYPLLGRVREIDYFMSTMKDFLMTNCSRVLMYEGL
FT                   PGYGKSQVLMEIEYLASQHENHRAVAIALTKISFHQNFYTIQILMANVLGLDTCKHYKE
FT                   RQTNLQNRVKTLLDEKFHCLLNDIFHVQFPVSREMSRMSKIRKQKQLEALFMKILAQTV
FT                   REERIIFIIDEAQFVDGTSWAFIEKLIRSMPIFIVMSLAPFSEVPCAAANAIMKNRNTT
FT                   YITLGTMQPQEIRDKVCVDLSVSSIPRELDSYLVEGSCGIPYYCEELLKNLDHHRVLLF
FT                   QQAETEQKTNVTWNNMFKHSVRPTDDMQLFTSISEGQKEVCYLVSGVRLNNLSPPASLK
FT                   EISLVQLDSMSLSHQMLVRCAAIIGLTFTTELLFEILPCWNMKMMIKALATLVESNVFN
FT                   CFRSSKDLQLALKQNVPTFEVHYRSLALKLKEGLTYGEEEELREMEGEVVECRILRFCR
FT                   PIMQKTAYELWLKDQKKVLHLKCARFLEESAHRCNHCRNVDFIPYHHFIVDIRLNTLDM
FT                   DTVKRMVTSQGFKIDEEEAIFSKSELPRKYKFPENLSITEIREKILHFFDNVILKMKSS
FT                   PNDIIPLESCQCKELLQIVILPLAQHFVALEENNKALYYFLELASAYLILGDNYNAYMY
FT                   LGEGERLLKSLTNEDSWSQTFEYATFYSLKAEVCFNMGQMVLAKKMLRKALKLLNRMFP
FT                   CNLLTLTFQMHVEKNRLSHFMNQHTQEGSVPGKKLAQLYLQASCFSLLWRIYSLNFFFH
FT                   YKYYGHLAAMMEMNTSLETQNDFQIIKAYLDFSLYHHLAGYQGVWFKYEILVMEQLLNL
FT                   PLKGEAIEIMAYTADTLGHIKFLMGHLDLAIELGSRAHRMWSLLRNPNKYQMVLCRLSK
FT                   PLFLKSRYKHLVQVLGWLWDLSVTEEDIFSKAFFYFVCLDIMLYSGFIYRTFEECLEFI
FT                   HHNEDNRILKFQSGLLLGLYSCIAVWYARLQEWDNFNKFSDRAKHLVTRRTPTVLYYEG
FT                   ISRYMEGQVLHLQKQIEEQAENAQDSGVEILKALETLVAQNTTGPVFYPRLYHLMAYVC
FT                   ILMGDGHSCDFFLNTALELSETHGNLLEKCWLSMSKEWWYSASELTGDQWLQTVLSLPS
FT                   WDKIVSGKGGQRKRSWSWFCPPNFSMVSWSQPQCA"
XX
SQ   Sequence 5034 BP; 1362 A; 1166 C; 1217 G; 1289 T; 0 other;
     ggctcgagct tctccacagt cttggagaac agagaagacc tacttgggga gacagtttcc        60
     tggtgctgaa aaatcctgac cattgtcctt gaacatgagt gcgcgaaggc aggaattaca       120
     agacagggca atcgtcaaga tagctgctca cttaccagac ctcatcgtct acggagattt       180
     ctctccggaa cggccgtcag taaaatgttt tgatggagtt ctgatgtttg ttgatatttc       240
     aggttttact gcaatgactg agaagttcag cacggccatg tacatggacc gaggagccga       300
     acagctcgtg gagatcctca actactacat aagtgccata gtggagaaag tgctgatttt       360
     tggaggagac atcctaaaat ttgcaggtga tgccttgctg gccctgtgga aagtggaacg       420
     aaagcaactg aagaacatca tcacggtggt gattaagtgc agcctggaga tccatggctt       480
     gtttgaagcc aaggaggctg aagaaggcct ggacattcga gttaagatag ggctggctgc       540
     tggccacatc accatgttgg tctttgggga tgaaacacgg aactacttcc tggtgattgg       600
     ccaggcggtg gatgatgtcc gccttgctca gaacatggct cagatgaacg acgttatttt       660
     gtcaccaaac tgctggcagc tctgtgatcg gagcatgatt gaaattgaga ggattccaga       720
     tcagagagca gttaaggtta gcttcttaaa accaccccca acctttaatt ttgacgagtt       780
     tttcacaaaa tgtatgggct tcatggatta ttatccttct ggtgaccaca aaaacttcct       840
     aaggcttgcc tgcatgctgg agtctgatcc tgaactcgag ctgtctctac aaaagtacgt       900
     gatggaaatc attttgaagc agatcgatga caagcagctg cggggctatt tatctgagct       960
     tcgccctgtg acaattgtgt ttgtgaactt gatgtttaaa gagcaagaca aagtagaagt      1020
     cataggctca gccatccaag ctgcctgtgt acacatcact tctgtcttga aggtcttccg      1080
     aggccagatc aataaggtct tcatgtttga taagggctgc tccttcctct gtgtcttcgg      1140
     cttccctggg gaaaaggctc ccgatgagat cactcatgcg ctggaaagtg ccgtggatat      1200
     atttgacttc tgctcccagg tccacaaaat ccgtactgtc tccatcggtg ttgccagtgg      1260
     gattgtcttc tgtgggatcg ttggacacac tgtgagacat gagtacacag tcatcggtca      1320
     gaaggtcaac attgctgcca ggatgatgat gtactacccg ggcatcgtga gctgcgactc      1380
     tgtcacctac gatggcagca acctaccagc ctactttttt aaggagcttc cgaagaaagt      1440
     tatgaaagga gttgcagatc ctggacccgt gtatcagtgt ttgggcctca atgagaaagt      1500
     catgtttggt atggcatatc tcatctgcaa cagatatgag ggctaccctt tgctgggacg      1560
     tgttagggag atcgactatt tcatgtctac tatgaaggac tttttgatga cgaactgcag      1620
     ccgagttcta atgtatgaag gattaccagg atatggaaaa agccaggtac tcatggaaat      1680
     cgaatatctg gcctctcagc atgagaacca cagggctgtt gctattgcac tgactaagat      1740
     cagcttccat caaaattttt atactatcca gatactcatg gctaatgtac taggtctgga      1800
     cacttgtaaa cattacaaag aacgacagac caatcttcaa aatagagtca agacgctgtt      1860
     ggatgagaag ttccactgtc ttcttaatga catcttccat gttcagttcc ctgtttcccg      1920
     ggagatgtcc aggatgagca agataagaaa acagaagcaa ctggaagccc tgtttatgaa      1980
     gatcttggcg caaacagtga gagaagaaag gattattttc atcatcgatg aggcccagtt      2040
     tgtggatgga acctcctggg ccttcataga gaagctcatc cgctctatgc ccatcttcat      2100
     cgttatgtcc ctggctcctt tctctgaagt tccctgtgca gctgccaatg ccataatgaa      2160
     gaaccggaac accacctaca tcacgcttgg taccatgcag cctcaggaaa tccgggacaa      2220
     ggtctgtgtt gaccttagtg taagcagcat ccccagagag ctcgactcgt acctggtaga      2280
     gggaagctgc gggattccgt attactgtga agaattgctg aaaaacctcg accaccacag      2340
     agttctcctt tttcaacaag cagagactga gcaaaagaca aacgtgacct ggaataacat      2400
     gttcaagcac tctgttaggc caacagatga catgcaactt ttcacttcca tatctgaggg      2460
     gcagaaagaa gtctgttacc ttgtgagtgg tgtcaggctg aataatttgt cacctccagc      2520
     atcgctaaaa gagatatctc tggtccagct ggacagcatg agcctttccc atcagatgct      2580
     ggtgagatgc gctgccatca ttggcctaac cttcaccacg gagctgctgt ttgagattct      2640
     cccctgctgg aacatgaaga tgatgatcaa ggccctggcc accctagtgg aatcaaatgt      2700
     tttcaattgc ttccggagta gcaaagatct tcaactagcc ttaaaacaaa atgtgccaac      2760
     atttgaggtt cattatcgct ctttggccct gaagctcaag gaagggttaa cttacggcga      2820
     agaggaggag ctccgtgaga tggaaggaga ggtggttgag tgccggatcc ttcggttctg      2880
     cagacccata atgcagaaga cagcctacga actgtggctc aaggaccaga agaaagtctt      2940
     gcatctgaaa tgtgcccgct ttttggaaga aagtgcccat cggtgcaacc actgcagaaa      3000
     cgtagacttc attccctacc accatttcat agtggacatt cgactcaaca ctttggatat      3060
     ggacactgtc aagaggatgg tgacatccca aggatttaaa attgacgaag aggaagccat      3120
     cttttctaag tcagagctcc ctaggaaata caagttcccc gagaatctca gcatcacaga      3180
     aataagggaa aaaatcttgc atttctttga caatgtcatc ctaaagatga aatcgtctcc      3240
     aaatgacatc atccctctgg aatcctgcca gtgtaaggaa ctgctccaga ttgtcatcct      3300
     gcctctggcc caacatttcg tagccttaga agaaaacaac aaagccttgt actacttcct      3360
     agaactggca tctgcctacc tcatcctggg agacaactat aatgcgtaca tgtatttggg      3420
     cgagggagaa aggctgctga aatctctgac gaatgaagat tcttggagtc agacctttga      3480
     atatgctacc ttttatagtc tcaaggctga ggtctgtttt aacatggggc agatggtcct      3540
     cgccaagaag atgctgagga aggcgctgaa gctgctcaac agaatgtttc cctgcaatct      3600
     gctcaccctg actttccaaa tgcatgtgga gaaaaacaga ctctcccact tcatgaacca      3660
     gcatacccag gagggctcgg tgccagggaa gaaactggca caactttacc tgcaagcttc      3720
     ctgcttctcc ttgctgtgga ggatctacag cttgaacttc tttttccact acaagtatta      3780
     cggtcatctg gccgcgatga tggaaatgaa cacttccctg gaaactcaaa atgacttcca      3840
     gatcatcaag gcttacctgg acttttccct gtaccaccac ctcgctggct accagggcgt      3900
     gtggttcaaa tatgaaatac tggtcatgga gcagctcctg aacctccccc tgaaaggcga      3960
     ggccattgag atcatggcgt atacagccga cacactgggc cacatcaagt tcttaatggg      4020
     tcatctggac ttggccattg agttaggctc tcgagcccac aggatgtggt cacttcttcg      4080
     gaatcccaac aaataccaga tggttctctg cagactgagt aaacctcttt tcttgaaaag      4140
     cagatataaa catttggtcc aggtgctggg atggttgtgg gacctttctg taacagaaga      4200
     ggacatcttc agcaaggcat ttttctattt cgtctgcttg gacatcatgc tttattctgg      4260
     cttcatttac agaacatttg aagaatgctt ggaattcata caccacaatg aagacaacag      4320
     aatcctcaag ttccagagcg gactcctcct gggactttac tcctgcatcg ctgtctggta      4380
     tgccagactt caagagtggg acaactttaa caaattttcc gacagagcta agcatctcgt      4440
     gacacgaaga accccgacag ttctttacta cgaagggatc tctaggtaca tggaagggca      4500
     agtcctccac ttgcagaagc aaatagaaga acaggccgag aacgctcagg acagtggggt      4560
     ggagatactc aaggccttgg agacccttgt ggctcaaaat accaccggcc ccgtcttcta      4620
     cccgaggctc taccatctga tggcctatgt ctgcatacta atgggagacg ggcacagctg      4680
     tgacttcttc ctgaacacag ccttggagct ttctgagaca catgggaatt tgctggagaa      4740
     atgttggcta agcatgagca aggaatggtg gtactcagcc tccgagttaa caggagatca      4800
     atggcttcag acagtcttga gtcttccatc atgggataaa attgtatcag gcaagggagg      4860
     tcagaggaaa cgttcgtgga gttggttctg tccccccaac ttttcaatgg tttcctggag      4920
     tcaacctcag tgtgcatgac agcttggagc tgcacaggat tgcaaatgtc aaacctctgt      4980
     cgaggtctga agcagcaaga ttagaaagaa taaagttgtc tgtgccagct tccg            5034
//


spacer
spacer