spacer

EBI Dbfetch

ID   BC138259; SV 1; linear; mRNA; STD; MUS; 4237 BP.
XX
AC   BC138259;
XX
DT   13-MAY-2008 (Rel. 95, Created)
DT   13-MAY-2008 (Rel. 95, Last updated, Version 1)
XX
DE   Mus musculus klotho, mRNA (cDNA clone MGC:169883 IMAGE:8861278), complete
DE   cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4237
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-4237
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (29-MAR-2007) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 2f5382bb13c688b6e83ca4bfd034cf9c.
DR   Ensembl-Gn; ENSMUSG00000058488; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000078856; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Ambion
CC   cDNA Library Preparation: British Columbia Cancer Research Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: LLDM Plate: 666 Row: m Column: 20.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4237
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_392"
FT                   /clone="MGC:169883 IMAGE:8861278"
FT                   /tissue_type="Brain,thymus,testicle,kidney,spleen,liver,
FT                   heart,lung,ovary,embryo - PCR rescued clones"
FT                   /note="Vector: pCR-XL-TOPO with reversed insert; Clone
FT                   identification sequence tag: TTTCGAAG"
FT                   /db_xref="taxon:10090"
FT   gene            1..4237
FT                   /gene="Kl"
FT                   /note="synonym: alpha-kl"
FT   CDS             111..3155
FT                   /codon_start=1
FT                   /gene="Kl"
FT                   /product="klotho"
FT                   /db_xref="GOA:O35082"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018120"
FT                   /db_xref="InterPro:IPR028546"
FT                   /db_xref="MGI:MGI:1101771"
FT                   /db_xref="UniProtKB/Swiss-Prot:O35082"
FT                   /protein_id="AAI38260.1"
FT                   /translation="MLARAPPRRPPRLVLLRLLLLHLLLLALRARCLSAEPGQGAQTWA
FT                   RFARAPAPEAAGLLHDTFPDGFLWAVGSAAYQTEGGWRQHGKGASIWDTFTHHSGAAPS
FT                   DSPIVVAPSGAPSPPLSSTGDVASDSYNNVYRDTEGLRELGVTHYRFSISWARVLPNGT
FT                   AGTPNREGLRYYRRLLERLRELGVQPVVTLYHWDLPQRLQDTYGGWANRALADHFRDYA
FT                   ELCFRHFGGQVKYWITIDNPYVVAWHGYATGRLAPGVRGSSRLGYLVAHNLLLAHAKVW
FT                   HLYNTSFRPTQGGRVSIALSSHWINPRRMTDYNIRECQKSLDFVLGWFAKPIFIDGDYP
FT                   ESMKNNLSSLLPDFTESEKRLIRGTADFFALSFGPTLSFQLLDPNMKFRQLESPNLRQL
FT                   LSWIDLEYNHPPIFIVENGWFVSGTTKRDDAKYMYYLKKFIMETLKAIRLDGVDVIGYT
FT                   AWSLMDGFEWHRGYSIRRGLFYVDFLSQDKELLPKSSALFYQKLIEDNGFPPLPENQPL
FT                   EGTFPCDFAWGVVDNYVQVDTTLSQFTDPNVYLWDVHHSKRLIKVDGVVAKKRKPYCVD
FT                   FSAIRPQITLLREMRVTHFRFSLDWALILPLGNQTQVNHTVLHFYRCMISELVHANITP
FT                   VVALWQPAAPHQGLPHALAKHGAWENPHTALAFADYANLCFKELGHWVNLWITMNEPNT
FT                   RNMTYRAGHHLLRAHALAWHLYDDKFRAAQKGKISIALQADWIEPACPFSQNDKEVAER
FT                   VLEFDIGWLAEPIFGSGDYPRVMRDWLNQKNNFLLPYFTEDEKKLVRGSFDFLAVSHYT
FT                   TILVDWEKEDPMKYNDYLEVQEMTDITWLNSPSQVAVVPWGLRKVLNWLRFKYGDLPMY
FT                   VTANGIDDDPHAEQDSLRIYYIKNYVNEALKAYVLDDINLCGYFAYSLSDRSAPKSGFY
FT                   RYAANQFEPKPSMKHYRKIIDSNGFLGSGTLGRFCPEEYTVCTECGFFQTRKSLLVFIS
FT                   FLVFTFIISLALIFHYSKKGQRSYK"
XX
SQ   Sequence 4237 BP; 967 A; 1130 C; 1072 G; 1068 T; 0 other;
     gataatcatt gctcgtgggg cggcgggagc gggggtgggc accgcgtagg gagggcggcg        60
     gggcgcgggc atataggggc gcggcgcggt gccctcccgg ctcccgcagc atgctagccc       120
     gcgcccctcc tcgccgcccg ccgcggctgg tgctgctccg tttgctgttg ctgcatctgc       180
     tgctgctcgc cctgcgcgcc cgctgcctga gcgctgagcc gggtcagggc gcgcagacct       240
     gggctcgctt cgcgcgcgct cctgccccag aggccgctgg cctcctccac gacaccttcc       300
     ccgacggttt cctctgggcg gtaggcagcg ccgcctatca gaccgagggc ggctggcgac       360
     agcacggcaa aggcgcgtcc atctgggaca ctttcaccca tcactctggg gcggccccgt       420
     ccgactcccc gatcgtcgtg gcgccgtcgg gtgccccgtc gcctcccctg tcctccactg       480
     gagatgtggc cagcgatagt tacaacaacg tctaccgcga cacagagggg ctgcgcgaac       540
     tgggggtcac ccactaccgc ttctccatat cgtgggcgcg ggtgctcccc aatggcaccg       600
     cgggcactcc caaccgcgag gggctgcgct actaccggcg gctgctggag cggctgcggg       660
     agctgggcgt gcagccggtg gttaccctgt accattggga cctgccacag cgcctgcagg       720
     acacctatgg cggatgggcc aatcgcgccc tggccgacca tttcagggat tatgccgagc       780
     tctgcttccg ccacttcggt ggtcaggtca agtactggat caccattgac aacccctacg       840
     tggtggcctg gcacgggtat gccaccgggc gcctggcccc gggcgtgagg ggcagctcca       900
     ggctcgggta cctggttgcc cacaacctac ttttggctca tgccaaagtc tggcatctct       960
     acaacacctc tttccgcccc acacagggag gccgggtgtc tatcgcctta agctcccatt      1020
     ggatcaatcc tcgaagaatg actgactata atatcagaga atgccagaag tctcttgact      1080
     ttgtgctagg ctggtttgcc aaacccatat ttattgatgg cgactaccca gagagtatga      1140
     agaacaacct ctcgtctctt ctgcctgatt ttactgaatc tgagaagagg ctcatcagag      1200
     gaactgctga cttttttgct ctctccttcg gaccaacctt gagctttcag ctattggacc      1260
     ctaacatgaa gttccgccaa ttggagtctc ccaacctgag gcagcttctg tcttggatag      1320
     atctggaata taaccaccct ccaatattta ttgtggaaaa tggctggttt gtctcgggaa      1380
     ccaccaaaag ggatgatgcc aaatatatgt attatctcaa gaagttcata atggaaacct      1440
     taaaagcaat cagactggat ggggtcgacg tcattgggta caccgcgtgg tcgctcatgg      1500
     acggtttcga gtggcatagg ggctacagca tccggcgagg actcttctac gttgactttc      1560
     tgagtcagga caaggagctg ttgccaaagt cttcggcctt gttctaccaa aagctgatag      1620
     aggacaatgg ctttcctcct ttacctgaaa accagcccct tgaagggaca tttccctgtg      1680
     actttgcttg gggagttgtt gacaactacg ttcaagtgga cactactctc tctcagttta      1740
     ctgacccgaa tgtctatctg tgggatgtgc atcacagtaa gaggcttatt aaagtagacg      1800
     gggttgtagc caagaagaga aaaccttact gtgttgattt ctctgccatc cggcctcaga      1860
     taaccttact tcgagaaatg cgggtcaccc actttcgctt ctccctggac tgggccctga      1920
     tcttgcctct gggtaaccag acccaagtga accacacggt tctgcacttc taccgctgca      1980
     tgatcagcga gctggtgcac gccaacatca ctccagtggt ggccctgtgg cagccagcag      2040
     ccccgcacca aggcctgcca catgcccttg caaaacatgg ggcctgggag aacccgcaca      2100
     ctgctctggc gtttgcagac tacgcaaacc tgtgttttaa agagttgggt cactgggtca      2160
     atctctggat caccatgaac gagccaaaca cacggaacat gacctatcgt gccgggcacc      2220
     acctcctgag agcccatgcc ttggcttggc atctgtacga tgacaagttt agggcggctc      2280
     agaaaggcaa aatatccatc gccttgcagg ctgactggat agaaccggcc tgccctttct      2340
     ctcaaaatga caaagaagtg gccgagagag ttttggaatt tgatataggc tggctggcag      2400
     agcctatttt tggttccgga gattatccac gtgtgatgag ggactggctg aaccaaaaaa      2460
     acaattttct tttgccctat ttcaccgaag atgaaaaaaa gctagtccgg ggttcctttg      2520
     acttcctggc ggtgagtcat tacaccacca ttctggtaga ctgggaaaag gaggatccga      2580
     tgaaatacaa cgattacttg gaggtacagg agatgactga catcacatgg ctcaactctc      2640
     ccagtcaggt ggcagtggtg ccttgggggc tgcgcaaagt gctcaactgg ctaaggttca      2700
     agtacggaga cctcccgatg tatgtgacag ccaatggaat cgatgatgac ccccacgccg      2760
     agcaagactc actgaggatc tattatatta agaattatgt gaatgaggct ctgaaagcct      2820
     acgtgttgga cgacatcaac ctttgtggct actttgcgta ttcacttagt gatcgctcag      2880
     ctcccaagtc tggcttttat cgatatgctg cgaatcagtt tgagcccaaa ccatctatga      2940
     aacattacag gaaaattatt gacagcaatg gcttcctggg ttctggaaca ctgggaaggt      3000
     tttgtccaga agaatacact gtgtgcaccg aatgtggatt ttttcaaacc cggaagtctt      3060
     tgctggtctt catctcgttt cttgttttta cttttattat ttctcttgct ctcatttttc      3120
     actactccaa gaaaggccag agaagttata agtaatgtga acgtctgcct ggccattcgc      3180
     tttgggatca agatgtacac gccgtcagcc gtttgcacct ctctgtgttg tgagccgcat      3240
     tccacacatt tcgattctag aaaacccttt ttgtcatggg tggtagaggt tttaaacagg      3300
     aattggtgag aataaaatat tgcagggtga atggtatctg aatctgctct ctttggtggc      3360
     aattacggaa ttatactcac cacagtttct acagtgcccc ggaatggaag gcatagaata      3420
     cggtagggat aacagtgcca agcagacaga agtttaaaga acaactttag ggacttgttt      3480
     atccatggcc atttttaaat tcactcctgt tggggagtaa cactctctca attaccatct      3540
     taacacctgg actttacctg atccagtttt acaaggtgaa gtagaaaaat atccagtaaa      3600
     ggtggccaag agccctgagt ccagagcagc ccattaagaa gcactattcc taccaaatgc      3660
     tgctaatgtc aatttacaaa tatacttaga aagcacatta tggacatttg tattcttgtg      3720
     aatgtttttg aggtgtgccc taaaccccag atccttgagg gctttctctt accaactttc      3780
     ctttcagagc ctgcttgttg gagattcttc cccagccccc ttcccctttc cctcttgctc      3840
     tgccccacct cgctccaccc agcttgctcc agcccaaaga ttctttattt gtttctcatt      3900
     accgaaggtt gtgagccacc atgtggtttc tgggatttga actcatgacc tccggaggag      3960
     ctgtcatgct cttaaccagc ccatgttgaa gattcttttg ataaatattc acaaaaaata      4020
     aagatgagcc atgagctgtt ggcctcttcg gaagcggaaa ctgagtgatt tgattgaaca      4080
     tccttttatc tttgaccaga ccttggaatg aatgcaatga cctttcccac aggaagaagg      4140
     aggagctctc agtcaaactg taaagaatgc ctcttcagaa tatgctgtca gtgcttggat      4200
     gccatgatgt tcaactttct tagtcgatcc ggcagca                               4237
//


spacer
spacer