spacer

EBI Dbfetch

ID   BC138250; SV 1; linear; mRNA; STD; MUS; 1664 BP.
XX
AC   BC138250;
XX
DT   13-MAY-2008 (Rel. 95, Created)
DT   13-MAY-2008 (Rel. 95, Last updated, Version 1)
XX
DE   Mus musculus G-protein coupled receptor 3, mRNA (cDNA clone MGC:169874
DE   IMAGE:8861269), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1664
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1664
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (29-MAR-2007) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 37129ec57a518440735005e9b87552c9.
DR   Ensembl-Gn; ENSMUSG00000049649; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000052090; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105911; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Ambion
CC   cDNA Library Preparation: British Columbia Cancer Research Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: LLDM Plate: 666 Row: m Column: 11.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1664
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_389"
FT                   /clone="MGC:169874 IMAGE:8861269"
FT                   /tissue_type="Brain,thymus,testicle,kidney,spleen,liver,
FT                   heart,lung,ovary,embryo - PCR rescued clones"
FT                   /note="Vector: pCR4-TOPO; Clone identification sequence
FT                   tag: GCTTGACT"
FT                   /db_xref="taxon:10090"
FT   gene            1..1664
FT                   /gene="Gpr3"
FT                   /note="synonym: Gpcr21"
FT   CDS             446..1438
FT                   /codon_start=1
FT                   /gene="Gpr3"
FT                   /product="Gpr3 protein"
FT                   /db_xref="GOA:P35413"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000723"
FT                   /db_xref="InterPro:IPR000984"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:101908"
FT                   /db_xref="UniProtKB/Swiss-Prot:P35413"
FT                   /protein_id="AAI38251.1"
FT                   /translation="MMWGAGSSMAWFSAGSGSVNVSSVDPVEEPTGPATLLPSPRAWDV
FT                   VLCISGTLVSCENALVVAIIVGTPAFRAPMFLLVGSLAVADLLAGLGLVLHFAADFCIG
FT                   SPEMSLMLVGVLAMAFTASIGSLLAITVDRYLSLYNALTYYSETTVTRTYVMLALVWVG
FT                   ALGLGLVPVLAWNCRDGLTTCGVVYPLSKNHLVVLAIAFFMVFGIMLQLYAQICRIVCR
FT                   HAQQIALQRHLLPASHYVATRKGIATLAVVLGAFAACWLPFTVYCLLGDADSPRLYTYL
FT                   TLLPATYNSMINPVIYAFRNQDVQKVLWAICCCCSTSKIPFRSRSPSDV"
XX
SQ   Sequence 1664 BP; 298 A; 485 C; 460 G; 421 T; 0 other;
     cgtgaatcgt gaggggtctg ggagcttcag gaaccaagtc atcgtgtctg gtgggaggga        60
     gctgactgct cttcttcttg acgtgtttcc ctcccctatt catgagccta ttgagggcac       120
     accttgaatc ctgtgcttcc cctattcact tatggtaagc tttgatttac ttctttgacc       180
     acgtgtggcc aagaggtctt caggacttag aggaatggag gggagggtga agggacacag       240
     aaaagggacc accgagaaaa agggacccct gtttagaggc ctggaggcat cagaggacaa       300
     aaaccacagg acatgaattg ggggtgtggg gtgtgcagga catccgtacc ctacctgtta       360
     tcctgacagg tttcttttct cgaagggcct cctgtcagga tacgggcctg ccagcatctc       420
     ataggacctt tcttctacag gtaccatgat gtggggagca ggaagctcta tggcctggtt       480
     ctcagctggc tcaggcagtg tgaacgtgag cagcgtggac ccagtagagg aacccacagg       540
     cccagctaca ctgctgccct ctcccagggc ctgggatgtg gtgctgtgca tctcaggcac       600
     cctggtgtcc tgcgagaacg cgctggtggt ggccatcatt gtgggcactc ctgccttccg       660
     cgcccccatg ttcctgctgg tgggtagctt ggccgtagca gacctgctgg caggcctggg       720
     cctggtcctg cactttgcgg ctgacttctg cattggctca ccagagatga gcttgatgct       780
     ggtcggcgtg ctagcaatgg ccttcactgc cagcatcggc agcctgctgg ccattaccgt       840
     tgaccgctac ctttccctgt acaatgctct cacttactac tcagagacaa cggtaactcg       900
     gacttatgtg atgctggcct tggtgtgggt gggtgccctg ggcctggggc tggttcccgt       960
     gctggcctgg aactgccggg atggcctgac cacgtgtggt gtggtctatc cactctccaa      1020
     gaaccatctg gtggttctgg ccatcgcctt cttcatggtg tttggcatca tgttgcagct      1080
     ctatgcccag atctgccgca tcgtctgccg ccatgcccag cagatcgccc tccaacgaca      1140
     cctgctgcct gcctctcact acgtggccac ccgcaagggc atcgccacat tggctgtggt      1200
     gcttggcgcc tttgctgcct gttggttgcc cttcactgtc tactgcctcc tgggagatgc      1260
     cgactctccc cgtctctaca cctatcttac cctgctccca gccacctaca actccatgat      1320
     caaccctgtc atctacgcct ttcgcaacca agatgtgcag aaggtgctgt gggccatctg      1380
     ctgctgctgt tccacttcca agattccatt ccggtcccgg tcccctagtg atgtctagtt      1440
     tcatcctggt gaacctgtgg ctttgactac tatagaactc cagagtgtta ggtccaccag      1500
     ggcttaattc caatccccag ctccacgccc ttaagaccca gctggttctg gagttctagg      1560
     acgttgggtg ttttaggatc ttattcaaga ttcctgcggg ggcccacccc agctgaccgc      1620
     gtggctctag aatgttccag atggtcaggg tcccactcgg aaat                       1664
//


spacer
spacer