Dbfetch

ID   BC138154; SV 1; linear; mRNA; STD; MUS; 1401 BP.
XX
AC   BC138154;
XX
DT   13-MAY-2008 (Rel. 95, Created)
DT   13-MAY-2008 (Rel. 95, Last updated, Version 1)
XX
DE   Mus musculus reticulon 4 receptor-like 2, mRNA (cDNA clone MGC:169778
DE   IMAGE:8861173), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1401
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1401
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (29-MAR-2007) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 939595401bb7f17263950676099bd0df.
DR   Ensembl-Gn; ENSMUSG00000050896; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025915; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0025889; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0025859; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025886; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025645; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0026332; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0025106; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0025626; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0025757; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0025720; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0025845; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025750; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0026388; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024850; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0025176; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000054514; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0055677; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0055710; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0055660; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0055642; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0055365; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0056124; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0055574; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0055320; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0055424; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0055385; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0055522; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0055385; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0056276; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0055186; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0054645; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Ambion
CC   cDNA Library Preparation: British Columbia Cancer Research Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: LLDM Plate: 666 Row: i Column: 11.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1401
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_377"
FT                   /clone="MGC:169778 IMAGE:8861173"
FT                   /tissue_type="Brain, PCR rescued clones"
FT                   /note="Vector: pCR4-TOPO; Clone identification sequence
FT                   tag: GTGTAAAT"
FT                   /db_xref="taxon:10090"
FT   gene            1..1401
FT                   /gene="Rtn4rl2"
FT                   /note="synonyms: Ngr2, Ngrh1, Ngrl3"
FT   CDS             65..1327
FT                   /codon_start=1
FT                   /gene="Rtn4rl2"
FT                   /product="reticulon 4 receptor-like 2"
FT                   /db_xref="GOA:Q7M6Z0"
FT                   /db_xref="InterPro:IPR000483"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="MGI:MGI:2669796"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7M6Z0"
FT                   /protein_id="AAI38155.1"
FT                   /translation="MLPGLRRLLQGPASACLLLTLLALPSVTPSCPMLCTCYSSPPTVS
FT                   CQANNFSSVPLSLPPSTQRLFLQNNLIRSLRPGTFGPNLLTLWLFSNNLSTIHPGTFRH
FT                   LQALEELDLGDNRHLRSLEPDTFQGLERLQSLHLYRCQLSSLPGNIFRGLVSLQYLYLQ
FT                   ENSLLHLQDDLFADLANLSHLFLHGNRLRLLTEHVFRGLGSLDRLLLHGNRLQGVHRAA
FT                   FHGLSRLTILYLFNNSLASLPGEALADLPALEFLRLNANPWACDCRARPLWAWFQRARV
FT                   SSSDVTCATPPERQGRDLRALRDSDFQACPPPTPTRPGSRARGNSSSNHLYGVAEAGAP
FT                   PADPSTLYRDLPAEDSRGRQGGDAPTEDDYWGGYGGEDQRGEQTCPGAACQAPADSRGP
FT                   ALSAGLRTPLLCLLPLALHHL"
XX
SQ   Sequence 1401 BP; 203 A; 568 C; 397 G; 233 T; 0 other;
     ggataaggga gcgagtggga gtgccctccc ccccgccgcc ccctcccccg atcgtcgaga        60
     caagatgctg cccgggctcc ggcgcctgct gcaaggtcct gcctcagcct gcctactgct       120
     gacactcctg gcccttcctt ccgtgacccc cagctgtcct atgctctgca cctgctactc       180
     ctccccgccc accgtgagct gccaggccaa caacttctcc tcagtgccgc tgtccttgcc       240
     acccagtaca cagagactct tcttgcagaa caacctcatc cgctcactgc ggccaggcac       300
     ctttgggccc aacctgctca ccctgtggct cttctccaac aacctctcca ccatccaccc       360
     tggcaccttc cgccacctgc aggccctaga agaactggac ctcggtgaca accggcacct       420
     gcgctccctg gagcccgaca ccttccaggg tctggagagg ctgcagtcac tacacctgta       480
     tcgttgccag ctcagcagcc tgcctggcaa cattttccga ggcttggtca gcctacagta       540
     cctctacctc caggagaaca gcctgctcca tctacaggat gacttgttcg cggacctggc       600
     caacctgagc cacctcttcc tccacgggaa ccgcctgcgg ctgctcacgg agcacgtgtt       660
     ccgcggcttg ggcagcctgg accggctgtt gctgcacggg aaccggctgc agggcgtgca       720
     ccgcgcggct ttccacggcc tcagccgcct caccatcctc tacctgttca acaacagcct       780
     ggcctcgctg ccgggagagg cgctggccga cctgccggcg ctcgagttcc tgcggctcaa       840
     cgccaacccc tgggcgtgcg actgccgcgc tcggccgctc tgggcttggt tccagcgcgc       900
     gcgggtgtcc agctccgacg tgacctgcgc caccccgccc gagcgccagg gccgggacct       960
     gcgcgcgctg cgcgactccg atttccaagc gtgcccgccg cccacgccca cgcggccggg      1020
     cagccgcgcc cgcggcaaca gctcttccaa ccacctgtac ggcgtggccg aggctggcgc      1080
     tccccccgca gacccgtcca cgctctaccg agatctgccc gccgaggact cgcgggggcg      1140
     ccagggcggg gacgcgccca ccgaggacga ctactggggg ggctacggcg gcgaggacca      1200
     gcggggcgag cagacgtgtc ccggggccgc gtgccaggcg cccgcagact cgcgtggccc      1260
     cgcgctctcg gccgggctgc gcacccctct gctctgcctc ttgcccctgg cgctccatca      1320
     cctctgactg cggtgcttag acggaagagg ccacgccttg gccccgctcc ccttctctgc      1380
     cccaaggagc ctcagctcca t                                                1401
//