Dbfetch

ID   BC138098; SV 1; linear; mRNA; STD; MUS; 1257 BP.
XX
AC   BC138098;
XX
DT   12-FEB-2009 (Rel. 99, Created)
DT   12-FEB-2009 (Rel. 99, Last updated, Version 1)
XX
DE   Mus musculus homeo box A1, mRNA (cDNA clone MGC:169722 IMAGE:8861117),
DE   complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1257
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1257
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (29-MAR-2007) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; ad20df37078a7ee4bc77e3d8440db100.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Ambion
CC   cDNA Library Preparation: British Columbia Cancer Research Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRCK Plate: 17 Row: C Column: 21
CC   single stranded.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1257
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_389"
FT                   /clone="MGC:169722 IMAGE:8861117"
FT                   /tissue_type="Brain,thymus,testicle,kidney,spleen,liver,
FT                   heart,lung,ovary,embryo - PCR rescued clones"
FT                   /note="Vector: pCR4-TOPO; Clone identification sequence
FT                   tag: TCCCTCTT"
FT                   /db_xref="taxon:10090"
FT   gene            1..1257
FT                   /gene="Hoxa1"
FT                   /gene_synonym="ERA1"
FT   CDS             31..1044
FT                   /codon_start=1
FT                   /gene="Hoxa1"
FT                   /gene_synonym="ERA1"
FT                   /product="homeo box A1"
FT                   /db_xref="GOA:B9EHK8"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017970"
FT                   /db_xref="InterPro:IPR020479"
FT                   /db_xref="MGI:MGI:96170"
FT                   /db_xref="UniProtKB/TrEMBL:B9EHK8"
FT                   /protein_id="AAI38099.1"
FT                   /translation="MDNARMNSFLEYPILGSGDSGTCSARAYPSDHGITTFQSCAVSAN
FT                   SCGGDDRFLVGRGVQISSPHHHHHHHHHHHHPQTATYQTSGNLGISYSHSSCGPSYGAQ
FT                   NFSAPYGPYGLNQEADVSGGYPPCAPAVYSGNLSTPMVQHHHHHQGYAGGTVGSPQYIH
FT                   HSYGQEQQTLALATYNNSLSPLHASHQEACRSPASETSSPAQTFDWMKVKRNPPKTGKV
FT                   GEYGYVGQPNAVRTNFTTKQLTELEKEFHFNKYLTRARRVEIAASLQLNETQVKIWFQN
FT                   RRMKQKKREKEGLLPISPATPPGSDEKTEESSEKSSPSPSAPSPASSTSDTLTTSH"
XX
SQ   Sequence 1257 BP; 293 A; 409 C; 288 G; 267 T; 0 other;
     gcttcgcagg atccaatcac tcagtgacag atggacaatg caagaatgaa ctcctttctg        60
     gaatacccca tccttggcag tggcgactct gggacctgct cggcgcgagc ttacccctct       120
     gaccatggga ttacaacttt ccaatcctgc gcggtcagtg ccaacagctg cggcggcgac       180
     gaccgcttcc tagtgggcag gggggtgcag atcagctcgc cccaccacca ccaccaccac       240
     caccaccacc atcaccaccc ccagacggct acttaccaga cttctggaaa ccttgggatt       300
     tcttattccc actcgagttg tggtccaagc tatggcgcgc agaacttcag tgcgccttat       360
     ggcccctatg gattaaatca ggaagcagac gtaagtggtg ggtacccccc gtgcgctccc       420
     gctgtttact ctggaaacct ctcgactccc atggtccagc atcaccacca ccaccagggt       480
     tatgctgggg gcacagtggg ctcgccccag tacattcacc actcatatgg acaagagcag       540
     cagactctgg ccctggccac gtataataac tccttatccc ctctccacgc cagccaccaa       600
     gaagcctgtc gttcccctgc ttcagagacg tcttctccag cgcagacctt tgactggatg       660
     aaagttaaaa gaaaccctcc caaaacaggg aaagttggag agtacggcta cgtgggtcaa       720
     cccaacgcag tgcgcaccaa tttcaccacc aagcagctca cagagctgga gaaggagttc       780
     cacttcaaca agtaccttac acgagcgcgc agggtggaga ttgccgcgtc cctacagctc       840
     aatgagaccc aggtgaagat ctggttccag aatcgccgca tgaagcagaa gaagcgtgag       900
     aaggaggggc tcctgcccat ctcccctgcc actcctcctg gcagcgatga gaaaacggaa       960
     gaatcatctg agaaatctag cccctcgccc agtgcccctt ctccggcatc gtctacctca      1020
     gacactctga ctacctccca ctgaggctac tccagcccaa ctctgcagcc caggcttctc      1080
     cctgggctgg gatttcttac ccaaagcaca ttcttagctt atcttccttt ctttacagac      1140
     tctctcttcc tttctcgtcc catctgggga gctcctggcc aagataaggt atttccagag      1200
     aattctggag ccttggttgg aagttaactc cttcatccac atcgggtgtc cacatca         1257
//