spacer

EBI Dbfetch

ID   BC138097; SV 1; linear; mRNA; STD; MUS; 1254 BP.
XX
AC   BC138097;
XX
DT   12-FEB-2009 (Rel. 99, Created)
DT   12-FEB-2009 (Rel. 99, Last updated, Version 1)
XX
DE   Mus musculus homeo box A1, mRNA (cDNA clone MGC:169721 IMAGE:8861116),
DE   complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1254
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1254
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (29-MAR-2007) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 4083b0d8348e997bacbcb3ef5b13b8b2.
DR   Ensembl-Gn; ENSMUSG00000029844; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000000964; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Ambion
CC   cDNA Library Preparation: British Columbia Cancer Research Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: LLDM Plate: 666 Row: g Column: 2
CC   single stranded.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1254
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_382"
FT                   /clone="MGC:169721 IMAGE:8861116"
FT                   /tissue_type="Testicle, PCR rescued clones"
FT                   /note="Vector: pCR4-TOPO with reversed insert; Clone
FT                   identification sequence tag: AGCATCCT"
FT                   /db_xref="taxon:10090"
FT   gene            1..1254
FT                   /gene="Hoxa1"
FT                   /gene_synonym="ERA1"
FT   CDS             31..1041
FT                   /codon_start=1
FT                   /gene="Hoxa1"
FT                   /gene_synonym="ERA1"
FT                   /product="homeo box A1"
FT                   /db_xref="GOA:B9EHK7"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017970"
FT                   /db_xref="InterPro:IPR020479"
FT                   /db_xref="MGI:MGI:96170"
FT                   /db_xref="UniProtKB/TrEMBL:B9EHK7"
FT                   /protein_id="AAI38098.1"
FT                   /translation="MDNARMNSFLEYPILGSGDSGTCSARAYPSDHGITTFQSCAVSAN
FT                   SCGGDDRFLVGRGVQISSPHHHHHHHHHHHPQTATYQTSGNLGISYSHSSCGPSYGAQN
FT                   FSAPYGPYGLNQEADVSGGYPPCAPAVYSGNLSTPMVQHHHHHQGYAGGTVGSPQYIHH
FT                   SYGQEQQTLALATYNNSLSPLHASHQEACRSPASETSSPAQTFDWMKVKRNPPKTGKVG
FT                   EYGYVGQPNAVRTNFTTKQLTELEKEFHFNKYLTRARRVEIAASLQLNETQVKIWFQNR
FT                   RMKQKKREKEGLLPISPATPPGSDEKTEESSEKSSPSPSAPSPASSTSDTLTTSH"
XX
SQ   Sequence 1254 BP; 292 A; 407 C; 288 G; 267 T; 0 other;
     gcttcgcagg atccaatcac tcagtgacag atggacaatg caagaatgaa ctcctttctg        60
     gaatacccca tccttggcag tggcgactct gggacctgct cggcgcgagc ttacccctct       120
     gaccatggga ttacaacttt ccaatcctgc gcggtcagtg ccaacagctg cggcggcgac       180
     gaccgcttcc tagtgggcag gggggtgcag atcagctcgc cccaccacca ccaccaccac       240
     caccaccatc accaccccca gacggctact taccagactt ctggaaacct tgggatttct       300
     tattcccact cgagttgtgg tccaagctat ggcgcgcaga acttcagtgc gccttatggc       360
     ccctatggat taaatcagga agcagacgta agtggtgggt accccccgtg cgctcccgct       420
     gtttactctg gaaacctctc gactcccatg gtccagcatc accaccacca ccagggttat       480
     gctgggggca cagtgggctc gccccagtac attcaccact catatggaca agagcagcag       540
     actctggccc tggccacgta taataactcc ttatcccctc tccacgccag ccaccaagaa       600
     gcctgtcgtt cccctgcttc agagacgtct tctccagcgc agacctttga ctggatgaaa       660
     gttaaaagaa accctcccaa aacagggaaa gttggagagt acggctacgt gggtcaaccc       720
     aacgcagtgc gcaccaattt caccaccaag cagctcacag agctggagaa ggagttccac       780
     ttcaacaagt accttacacg agcgcgcagg gtggagattg ccgcgtccct acagctcaat       840
     gagacccagg tgaagatctg gttccagaat cgccgcatga agcagaagaa gcgtgagaag       900
     gaggggctcc tgcccatctc ccctgccact cctcctggca gcgatgagaa aacggaagaa       960
     tcatctgaga aatctagccc ctcgcccagt gccccttctc cggcatcgtc tacctcagac      1020
     actctgacta cctcccactg aggctactcc agcccaactc tgcagcccag gcttctccct      1080
     gggctgggat ttcttaccca aagcacattc ttagcttatc ttcctttctt tacagactct      1140
     ctcttccttt ctcgtcccat ctggggagct cctggccaag ataaggtatt tccagagaat      1200
     tctggagcct tggttggaag ttaactcctt catccacatc gggtgtccac atca            1254
//


spacer
spacer