Dbfetch

ID   BC138060; SV 1; linear; mRNA; STD; MUS; 2626 BP.
XX
AC   BC138060;
XX
DT   13-MAY-2008 (Rel. 95, Created)
DT   13-MAY-2008 (Rel. 95, Last updated, Version 1)
XX
DE   Mus musculus dopamine receptor 5, mRNA (cDNA clone MGC:169684
DE   IMAGE:8861079), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2626
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2626
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (29-MAR-2007) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 6850bcaa87df79948cfaed850550a430.
DR   Ensembl-Gn; ENSMUSG00000039358; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000041646; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Ambion
CC   cDNA Library Preparation: British Columbia Cancer Research Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: LLDM Plate: 666 Row: e Column: 13.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2626
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_377"
FT                   /clone="MGC:169684 IMAGE:8861079"
FT                   /tissue_type="Brain, PCR rescued clones"
FT                   /note="Vector: pCR4-TOPO; Clone identification sequence
FT                   tag: TACGTACA"
FT                   /db_xref="taxon:10090"
FT   gene            1..2626
FT                   /gene="Drd5"
FT   CDS             27..1463
FT                   /codon_start=1
FT                   /gene="Drd5"
FT                   /product="dopamine receptor 5"
FT                   /db_xref="GOA:B2RQS5"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000497"
FT                   /db_xref="InterPro:IPR000929"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:94927"
FT                   /db_xref="UniProtKB/TrEMBL:B2RQS5"
FT                   /protein_id="AAI38061.1"
FT                   /translation="MLPPGRNGTAHRARLGLQRQLAQVDAPGGSAAPLGPAQVVTAGLL
FT                   TLLIVWTLLGNVLVCAAIVRSRHLRAKMTNIFIVSLAVSDLFVALLVMPWKAVAEVAGY
FT                   WPFGAFCDIWVAFDIMCSTASILNLCIISVDRYWAISRPFRYERKMTQRVALVMVALAW
FT                   TLSILISFIPVQLNWHRDKAGSQGREGLLSNETPWEEGWELDGRTENCDSSLNRTYAIS
FT                   SSLISFYIPVAIMIVTYTRIYRIAQVQIRRISSLERAAEHAQSCRSRGACEPDPSLRAS
FT                   IKKETKVFKTLSVIMGVFVCCWLPFFILNCMVPFCSSGDAQGPRTGFPCVSETTFDIFV
FT                   WFGWANSSLNPIIYAFNADFRKVFAQLLGCSHLCFRTPVQTVNISNELISYNQDTVFHR
FT                   EIAAAYVHMIPNAVSSGDREVGEEEEAEEEGPFDHMSQISPTTPDGDLAAESVWELDCE
FT                   EEVSLGKISPLTPNCFHKTA"
XX
SQ   Sequence 2626 BP; 569 A; 709 C; 676 G; 672 T; 0 other;
     agtgagcccg agctacccag cgcgacatgc tgcctcctgg gcgcaatggc accgcacatc        60
     gggcgcggct ggggttgcag aggcaactgg cgcaggtgga cgcccccggg ggctcagcag       120
     ccccactggg acccgcgcag gtggtcaccg ctggcctcct gactctctta atcgtctgga       180
     ccttgctcgg caacgtccta gtgtgtgctg ctatcgtccg cagccgccac ctgcgcgcca       240
     aaatgaccaa catcttcatc gtatctctgg ccgtctcaga cctcttcgtg gcattgctgg       300
     tcatgccttg gaaggccgtg gctgaggtgg ccgggtactg gccctttggg gcattctgcg       360
     acatctgggt ggcctttgac atcatgtgct ccactgcttc catcctgaat ctgtgtatca       420
     tcagcgtgga ccggtactgg gctatttcca gacccttccg ctacgagcgc aagatgaccc       480
     agcgtgtagc cctggtcatg gtggccctgg cctggacctt gtccatcctc atctccttta       540
     tcccggtcca actcaattgg cacagagaca aggcaggctc ccagggccga gagggcctgc       600
     tgtccaatga gacaccctgg gaggaaggtt gggagctaga cgggagaaca gagaactgtg       660
     actccagcct gaaccgaacc tacgccatct cctcgtcgct catcagcttc tatatcccgg       720
     tagccatcat gatagtgacc tacacgcgca tctaccgcat tgcacaggtt cagatccgcc       780
     gtatctcctc cctagaaagg gcagctgagc atgctcagag ttgccggagc cgtggggcct       840
     gcgaacctga ccccagcctg cgagcatcca tcaagaagga gaccaaggtc ttcaaaaccc       900
     tgtccgtgat catgggggtc ttcgtgtgct gctggttgcc tttcttcatc ctgaactgta       960
     tggttccctt ctgcagcagt ggagatgccc agggcccaag gactggcttc ccttgtgtca      1020
     gcgagaccac cttcgacata ttcgtctggt ttggctgggc caactcctct ctcaacccca      1080
     tcatctatgc ctttaatgca gacttccgga aggtgttcgc ccagctgctg gggtgcagcc      1140
     acctctgctt ccggaccccc gtgcagacgg taaacatcag taatgaactt atttcctaca      1200
     accaagacac ggtcttccac agggagatcg ctgctgccta tgtccacatg atcccaaatg      1260
     cggtgtcctc cggagacagg gaggtgggag aggaggagga ggcggaggag gaggggcctt      1320
     tcgatcacat gtctcaaatc tctccaacga ccccagatgg tgacctggct gctgagtctg      1380
     tctgggagct tgactgtgag gaggaggttt ccttaggcaa aatctcacca ctcaccccca      1440
     attgtttcca taaaactgct tagaaacacc ctcatgggca tgtacagttg tggccatatt      1500
     tacaagcatg cacaaatgcg cgcgcacacg cacacaaata tacacactcc tggtgtgctt      1560
     atgctttctg tagtcctgct gcgtagaaac caaacgattc ttagctgaga aaatgaatga      1620
     gcagaggctg ttggaataaa ctcagatatt ctgggcacag aagagagttc cctttagaga      1680
     cgagaaagtg gaacctggtc ctttaagaag tacacctcaa tttacccttt ctaacagagg      1740
     cttgttctgt gacttgcacc tgggttgctt tttaaatgac aggtctgagt ggcaattgct      1800
     ggtatggtct gtgactttct agactttggg accatagccc cctgttctcg ggctgctgct      1860
     ttagtgcagg ttgaagggtc tttcctgtgg ccgggatttc tccctgattt gttgtggttt      1920
     ccataagcgc acagtacatt catttgtggc tgggaggagg ggcagtcacc tttgctttgc      1980
     cagttggtgc tcagtgtttc tcctagagaa accacaagtg ccagtgctct tggaagacag      2040
     caggattttg gagtacacat ttgttttctg agcagctttg cttagggaac tcgcagaaca      2100
     aagggccttg aggaaatgct gacttcttgg atttcttttt tcttagtcag tcacaccttc      2160
     aggacacact gacggctcat ttcacctaca cagtattaga tgcgggattc tcaagcctga      2220
     gactcaatta cggttgtttt tttttttttt ttatcttttg gaactgtctt ctagaagtat      2280
     aggagacaat ggtcctgctt gctagataga taccctcggc tcatgggaaa gaccccctaa      2340
     cataactcat cttctccatc tctcatctag ggtgtttcag agcgacatgg cttcagtaaa      2400
     ccacaatttc tagggtcttt tagatgtgat atgcttcaaa atgcttcaaa accgaaatcc      2460
     tgctttgaag cagacgattt tctttgcagg ccattgcaaa tggaatgaac ttcagcctat      2520
     atatgcagaa agccagaggc aacacatgcc tggatgaact tgcagggtta ggggctcacg      2580
     gaggagccca cctgtctttt tgctttccca ccctgcactg agtacg                     2626
//