spacer

EBI Dbfetch

ID   BC137969; SV 1; linear; mRNA; STD; MUS; 3320 BP.
XX
AC   BC137969;
XX
DT   13-MAY-2008 (Rel. 95, Created)
DT   13-MAY-2008 (Rel. 95, Last updated, Version 1)
XX
DE   Mus musculus opioid receptor, delta 1, mRNA (cDNA clone MGC:169593
DE   IMAGE:8860988), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3320
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-3320
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (29-MAR-2007) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; e17742afb8e836ee2e34c38ab249cef5.
DR   Ensembl-Gn; ENSMUSG00000050511; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000056336; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Ambion
CC   cDNA Library Preparation: British Columbia Cancer Research Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: LLDM Plate: 666 Row: a Column: 18.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3320
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_390"
FT                   /clone="MGC:169593 IMAGE:8860988"
FT                   /tissue_type="Brain,thymus,testicle,kidney,spleen,liver,
FT                   heart,lung,ovary,embryo - PCR rescued clones"
FT                   /note="Vector: pCR4-TOPO with reversed insert; Clone
FT                   identification sequence tag: ACTAAACA"
FT                   /db_xref="taxon:10090"
FT   gene            1..3320
FT                   /gene="Oprd1"
FT                   /note="synonyms: DOR-1, mDOR"
FT   CDS             29..1147
FT                   /codon_start=1
FT                   /gene="Oprd1"
FT                   /product="opioid receptor, delta 1"
FT                   /db_xref="GOA:A2AD37"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000321"
FT                   /db_xref="InterPro:IPR001418"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:97438"
FT                   /db_xref="UniProtKB/TrEMBL:A2AD37"
FT                   /protein_id="AAI37970.1"
FT                   /translation="MELVPSARAELQSSPLVNLSDAFPSAFPSAGANASGSPGARSASS
FT                   LALAIAITALYSAVCAVGLLGNVLVMFGIVRYTKLKTATNIYIFNLALADALATSTLPF
FT                   QSAKYLMETWPFGELLCKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPA
FT                   KAKLINICIWVLASGVGVPIMVMAVTQPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAF
FT                   VVPILIITVCYGLMLLRLRSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFV
FT                   IVWTLVDINRRDPLVVAALHLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRTPCGRQ
FT                   EPGSLRRPRQATTRERVTACTPSDGPGGGAAA"
XX
SQ   Sequence 3320 BP; 731 A; 927 C; 916 G; 746 T; 0 other;
     gcacggtgga gacggacacg gcggcgccat ggagctggtg ccctctgccc gtgcggagct        60
     gcagtcctcg cccctcgtca acctctcgga cgcctttccc agcgccttcc ccagcgcggg       120
     cgccaatgcg tcggggtcgc cgggagcccg tagtgcctcg tccctcgccc tagccatcgc       180
     catcaccgcg ctctactcgg ctgtgtgcgc agtggggctt ctgggcaacg tgctcgtcat       240
     gtttggcatc gtccggtaca ccaaattgaa gaccgccacc aacatctaca tcttcaatct       300
     ggctttggct gatgcgctgg ccaccagcac gctgcccttc cagagcgcca agtacttgat       360
     ggaaacgtgg ccgtttggcg agctgctgtg caaggctgtg ctctccattg actactacaa       420
     catgttcact agcatcttca ccctcaccat gatgagcgtg gaccgctaca ttgctgtctg       480
     ccatcctgtc aaagccctgg acttccggac accagccaag gccaagctga tcaatatatg       540
     catctgggtc ttggcttcag gtgtcggggt ccccatcatg gtcatggcag tgacccaacc       600
     ccgggatggt gcagtggtat gcatgctcca gttccccagt cccagctggt actgggacac       660
     tgtgaccaag atctgcgtgt tcctctttgc cttcgtggtg ccgatcctca tcatcacggt       720
     gtgctatggc ctcatgctac tgcgcctgcg cagcgtgcgt ctgctgtccg gttccaagga       780
     gaaggaccgc agcctgcggc gcatcacgcg catggtgctg gtggtggtgg gcgccttcgt       840
     ggtgtgctgg gcgcccatcc acatcttcgt catcgtctgg acgctggtgg acatcaatcg       900
     gcgcgaccca cttgtggtgg ccgcactgca cctgtgcatt gcgctgggct acgccaacag       960
     cagcctcaac ccggttctct acgccttcct ggacgagaac ttcaagcgct gcttccgcca      1020
     gctctgtcgc acgccctgcg gccgccaaga acccggcagt ctccgtcgtc cccgccaggc      1080
     caccacgcgt gagcgtgtca ctgcctgcac cccctccgac ggcccgggcg gtggcgctgc      1140
     cgcctgacct acccgacctt ccccttaaac gcccctccca agtgaagtga tccagaggcc      1200
     acaccgagct ccctgggagg ctgtggccac caccaggaca gctagaattg ggcctgcaca      1260
     gaggggaggc ctcctgtggg gacggggcct gagggatcaa aggctccagg ttggaacggt      1320
     gggggtgagg aagcagagct ggtgattcct aaactgtatc cattagtaag gcctctccaa      1380
     tgggacagag cctccgcctt gagataacat cgggttctgg cctttttgaa cacccagctc      1440
     cagtccaaga cccaaggatt ccagctccag gaaccaggag gggcagtgat ggggtcgatg      1500
     atttggtttg gctgagagtc ccagcatttg tgttatgggg aggatctctc atcttagaga      1560
     agataagggg acagggcatt caggcaaggc agcttggggt ttggtcagga gataagcgcc      1620
     cccttccctt ggggggagga taagtggggg atggtcaacg ttggagaaga gtcaaagttc      1680
     tcaccacctt tctaactact cagctaaact cgttgaggct agggccaacg tgacttctct      1740
     gtagagagga tacaagccgg gcctgatggg gcaggcctgt gtaatcccag tcatagtgga      1800
     ggctgaggct ggaaaattaa ggaccaacag cctgggcaat ttagtgtctc aaaataaaat      1860
     gtaaagaggg ctgggaatgt agctcagtgg tagggtgttt gtgtgaggct ctgggatcaa      1920
     taagacaaaa caaccaacca accaaaaacc ttccaaacaa caaaaccaac cctcaaacca      1980
     aaaaactatg tgggtgtctc tgagtctggt ttgaagagaa cccgcagccc tgtatccctg      2040
     tggggctgtg gacagtgggc agaagcagag gctccctgga tcctgaacaa gggccccaaa      2100
     agcaagttct aaagggaccc ctgaaaccga gtaagccttt gtgtcaagaa gtgggagtag      2160
     aaccagaaag gtggctgagt gattaagggc acgtgactct cttgcagagg acataggttc      2220
     gattcccagc acccacatag tggctcacag ccatctgtaa ccccagtcgc agtcaatcta      2280
     atgctttcca acaactgtgg gcaccagaca tgaacatggt acacatacat acatatatac      2340
     atacatacag gtgaaacact cagacacata aaataaatct tcttttaaaa gtggtggcgc      2400
     atgcctttgg tcccagcacc tgggaggcag aggccagcct ggtctacatg gtgagttcca      2460
     ggatgctcag ggctacatgg tgagaccctg tctcaataaa agtgtgtgtt gtagggagag      2520
     taaatcgtga ggcagggggc tgaggcctct gcttacaggt taaatcctga agcctgaaca      2580
     tggatgcttt tggggttcct ggggtactag tgtatgtggc tcagtaccag agcaccgaga      2640
     ccctttgttt gagccccccc gtatgtggta acatgaataa ggattctcac caaatacttg      2700
     gacccttgat aagaacccgg aagaagactc ttgccccttc tcccagcgtc tggctgtcca      2760
     tcagatgcct ggtgtccatg actcccaggg actggaactg ccccagtcgg actctgcttt      2820
     gaagggattg agggaagaag ggcttttata gcagtgatgt cggtgtggcc ctttgctctc      2880
     tcccatttct cctgagtccc tcatttgctc tcgctgcaga gggtggccca gaaactgatc      2940
     caggctctcc tggatctcag ctcccctgga tgtcattgtt tgccctgtcc ccgttcctcc      3000
     tccactgcct gagggagcaa cctgcccctg actccctatt gaagcagtct gctgacatcc      3060
     ttgtaaaaac aaatttaatt ctcttccttt tttgggacag atgggaagaa attgacgcct      3120
     ttgtctcaaa ccaaaaaaga aagaagcaga gagacaatat acttcttttc tttttgacag      3180
     ccatttcttt ggaacaaaag ctgcaggctg tcactccagc agggacctaa ctgccttccg      3240
     ggaggcggga gctagactag tgagtagaaa aggttccttt gatggacaaa gcatagtcct      3300
     tttctccctg tggggtccct                                                  3320
//


spacer
spacer