spacer

EBI Dbfetch

ID   BC137958; SV 1; linear; mRNA; STD; MUS; 3315 BP.
XX
AC   BC137958;
XX
DT   13-MAY-2008 (Rel. 95, Created)
DT   13-MAY-2008 (Rel. 95, Last updated, Version 1)
XX
DE   Mus musculus opioid receptor, delta 1, mRNA (cDNA clone MGC:169582
DE   IMAGE:8860977), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3315
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-3315
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (29-MAR-2007) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 0a66338cb1b85a6c11ddfb7aec79487c.
DR   Ensembl-Gn; ENSMUSG00000050511; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000056336; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Ambion
CC   cDNA Library Preparation: British Columbia Cancer Research Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: LLDM Plate: 666 Row: a Column: 7.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3315
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_390"
FT                   /clone="MGC:169582 IMAGE:8860977"
FT                   /tissue_type="Brain,thymus,testicle,kidney,spleen,liver,
FT                   heart,lung,ovary,embryo - PCR rescued clones"
FT                   /note="Vector: pCR4-TOPO with reversed insert; Clone
FT                   identification sequence tag: CCCTACTT"
FT                   /db_xref="taxon:10090"
FT   gene            1..3315
FT                   /gene="Oprd1"
FT                   /note="synonyms: DOR-1, mDOR"
FT   CDS             29..1147
FT                   /codon_start=1
FT                   /gene="Oprd1"
FT                   /product="opioid receptor, delta 1"
FT                   /db_xref="GOA:A2AD37"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000321"
FT                   /db_xref="InterPro:IPR001418"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:97438"
FT                   /db_xref="UniProtKB/TrEMBL:A2AD37"
FT                   /protein_id="AAI37959.1"
FT                   /translation="MELVPSARAELQSSPLVNLSDAFPSAFPSAGANASGSPGARSASS
FT                   LALAIAITALYSAVCAVGLLGNVLVMFGIVRYTKLKTATNIYIFNLALADALATSTLPF
FT                   QSAKYLMETWPFGELLCKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPA
FT                   KAKLINICIWVLASGVGVPIMVMAVTQPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAF
FT                   VVPILIITVCYGLMLLRLRSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFV
FT                   IVWTLVDINRRDPLVVAALHLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRTPCGRQ
FT                   EPGSLRRPRQATTRERVTACTPSDGPGGGAAA"
XX
SQ   Sequence 3315 BP; 734 A; 923 C; 912 G; 746 T; 0 other;
     gcacggtgga gacggacacg gcggcgccat ggagctggtg ccctctgccc gtgcggagct        60
     gcagtcctcg cccctcgtca acctctcgga cgcctttccc agcgccttcc ccagcgcggg       120
     cgccaatgcg tcggggtcgc cgggagcccg tagtgcctcg tccctcgccc tagccatcgc       180
     catcaccgcg ctctactcgg ctgtgtgcgc agtggggctt ctgggcaacg tgctcgtcat       240
     gtttggcatc gtccggtaca ccaaattgaa gaccgccacc aacatctaca tcttcaatct       300
     ggctttggct gatgcgctgg ccaccagcac gctgcccttc cagagcgcca agtacttgat       360
     ggaaacgtgg ccgtttggcg agctgctgtg caaggctgtg ctctccattg actactacaa       420
     catgttcact agcatcttca ccctcaccat gatgagcgtg gaccgctaca ttgctgtctg       480
     ccatcctgtc aaagccctgg acttccggac accagccaag gccaagctga tcaatatatg       540
     catctgggtc ttggcttcag gtgtcggggt ccccatcatg gtcatggcag tgacccaacc       600
     ccgggatggt gcagtggtat gcatgctcca gttccccagt cccagctggt actgggacac       660
     tgtgaccaag atctgcgtgt tcctctttgc cttcgtggtg ccgatcctca tcatcacggt       720
     gtgctatggc ctcatgctgc tgcgcctgcg cagcgtgcgt ctgctgtccg gttccaagga       780
     gaaggaccgc agcctgcggc gtatcacgcg catggtgctg gtggtggtgg gcgccttcgt       840
     cgtgtgctgg gcgcccatcc acatcttcgt catcgtctgg acgctggtgg acatcaatcg       900
     gcgcgaccca cttgtggtgg ccgcactgca cctgtgcatt gcgctgggct acgccaacag       960
     cagcctcaac ccggttctct atgccttcct ggacgagaac ttcaagcgct gcttccgcca      1020
     gctctgtcgc acgccctgcg gccgccaaga acccggcagt ctccgtcgtc cccgccaggc      1080
     caccacgcgt gagcgtgtca ctgcctgcac cccctccgac ggcccgggcg gtggcgctgc      1140
     cgcctgacct acccgacctt ccccttaagc gcccctccca agtgaagtga tccagaggcc      1200
     acaccgagct ccctgggagg ctgtggccac caccaggaca gctagaattg ggcctgcaca      1260
     gaggggaggc ctcctgtggg gacggggcct gagggatcaa aggctccagg ttggaacagt      1320
     gggggtgagg gagcagagct ggtgattcct aaactgtatc cattagtaag gcctctccaa      1380
     tgggacagag cctccgcctt gagataacat cgggttctgg cctttttgaa cacccagctc      1440
     cagtccaaga cccaaggatt ccagctccag gaactaggag gggcagtgat ggggtcgatg      1500
     atttggtttg gctgagagtc ccagcatttg tgttatgggg aggatctctc atcttagaga      1560
     agataagggg acagggcatt caggcaaggc agcttggggt ttggtcggga gataagcgcc      1620
     cccttccctg gggggaggat aagtggggga tggtcaacgt tggagaagag tcaaagttct      1680
     caccaccttt ctaactactc agctaaactc cttgaggcta ggtccaacgt gacttctctg      1740
     tagagaggat acaagccggg cctgatgggg caggcctgtg taatcccagt catagtggag      1800
     gctgaggctg gaaaattaag gaccaacagc ctgggcaatt tagtgtctca aaataaaatg      1860
     taaagagggc tgggaatgta gctcagtggt agggtgtttg tgtgaggctc tgggatcaat      1920
     aaaacaaaac aaccaaccaa ccaaaaacct tccaaacaac aaaaccaacc ctcaaaccaa      1980
     aaaactatgt gggtgtctct gagtctggtt tgaagagaac ccgcagccct gtatccctgt      2040
     ggggctgtgg acagtgggca gaagcagagg ctccctggat cctgaacaag ggccccaaaa      2100
     gcaagttcta aagggacccc tgaaaccgag taagcctttg tgtcaagaag tgggagtaga      2160
     accagaaagg tggctgagtg attaagggcg cgtgactctc ttgcagagga cataggttcc      2220
     attcccagca cccacatagt ggctcacagc catctgtaac cccagtcgca gtcaatctaa      2280
     tgctttccaa caactgtggg caccagacat gaacatggta cacatacata catatataca      2340
     tacatacagg tgaaacactc agacacataa aataaatctt cttttaaaag tggtggcaca      2400
     tgcctttaat cccagcacct gggaggcaga ggccagcctg gtctacatag tgagttccag      2460
     gatgctcagg gctacatggt gagaccctgt ctcaataaaa gtgtgtgttg tagggagagt      2520
     aaatggtgag gcagggggct gaggcctctg cttacaggtt aaatcctgaa gcctgaacat      2580
     ggatgctttt ggggttcctg gggtactagt gtatgtggct cagtaccaga gcaccgagac      2640
     cctttgtttg agcccccccg tatgtggtaa catgaataag gattctcacc aaatacttgg      2700
     acccttgata agaacccgga agaagactct tgccccttct cccagcgtct ggctgtccat      2760
     cagatgcctg gtgtccatga ctcccaggga ctggaactgc ccaagtcgga ctctgctttg      2820
     aagggattga gggaagaagg gcttttatag cagtgatgtc ggtgtggccc tttgctctct      2880
     cccatttccc ctgagtccct catttgctct cactgcagag ggtggcccag aaactgatcc      2940
     aggctctcct ggatctcagc tcccctggat gtcattgttt gccctgtccc cgtgcctcct      3000
     ccactgcctg agggagcaac ctgcccctga ctccctattg aagcagtctg ctgacatcct      3060
     tgtaaaaaca aatttaattc tcttcctttt ttgggacaga tgggaagaaa ttgacgcctt      3120
     tgtctcaaac caaaaaagaa agaagcagag agacaatata cttcttttct ttttgacagc      3180
     catttctttg gaacaaaagc tgcaggctgt cactccagca gggacctaac tgccttccgg      3240
     gaggcgggag ctagactagt gagtagaaaa ggttcctttg atggacaaag catagtcctt      3300
     ttctccctgt ggggt                                                       3315
//


spacer
spacer