spacer

EBI Dbfetch

ID   BC137604; SV 1; linear; mRNA; STD; MUS; 1821 BP.
XX
AC   BC137604;
XX
DT   13-MAY-2008 (Rel. 95, Created)
DT   13-MAY-2008 (Rel. 95, Last updated, Version 1)
XX
DE   Mus musculus 5-hydroxytryptamine (serotonin) receptor 1F, mRNA (cDNA clone
DE   MGC:169228 IMAGE:8860623), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1821
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1821
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (29-MAR-2007) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; fdf32b8cd24bf6c2ec189a864d523723.
DR   Ensembl-Gn; ENSMUSG00000050783; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000063076; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Ambion
CC   cDNA Library Preparation: British Columbia Cancer Research Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: LLDM Plate: 665 Row: b Column: 13.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1821
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_378"
FT                   /clone="MGC:169228 IMAGE:8860623"
FT                   /tissue_type="Brain, PCR rescued clones"
FT                   /note="Vector: pCR4-TOPO with reversed insert; Clone
FT                   identification sequence tag: GCGATATA"
FT                   /db_xref="taxon:10090"
FT   gene            1..1821
FT                   /gene="Htr1f"
FT   CDS             166..1266
FT                   /codon_start=1
FT                   /gene="Htr1f"
FT                   /product="5-hydroxytryptamine (serotonin) receptor 1F"
FT                   /db_xref="GOA:Q543V2"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000450"
FT                   /db_xref="InterPro:IPR002231"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:99842"
FT                   /db_xref="UniProtKB/TrEMBL:Q543V2"
FT                   /protein_id="AAI37605.1"
FT                   /translation="MDFLNASDQNLTSEELLNRMPSKILVSLTLSGLALMTTTINSLVI
FT                   AAIIVTRKLHHPANYLICSLAVTDFLVAVLVMPFSIVYIVRESWIMGQVLCDIWLSVDI
FT                   ICCTCSILHLSAIALDRYRAITDAVEYARKRTPRHAGIMITIVWVISVFISMPPLFWRH
FT                   QGTSRDDECVIKHDHIVSTIYSTFGAFYIPLVLILILYYKIYRAARTLYHKRQASRMIK
FT                   EELNGQVFLESGEKSIKLVSTSYMLEKSLSDPSTDFDRIHSTVKSPRSELKHEKSWRRQ
FT                   KISGTRERKAATTLGLILGAFVICWLPFFVKELVVNVCEKCKISEEMSNFLAWLGYLNS
FT                   LINPLIYTIFNEDFKKAFQKLVRCRY"
XX
SQ   Sequence 1821 BP; 562 A; 360 C; 363 G; 536 T; 0 other;
     ccttagcttc gctctgggga agctgagttg agatggcatt gaactgtgaa tggctgacta        60
     atttctcacc agatcaggag gtgaagtgag aatgaagacc aacagttgag cctgccacac       120
     cacggtattc atttcttcaa ctatattaac attttaacaa aaaaaatgga ttttttaaac       180
     gcatcagacc aaaacttgac ctctgaggaa ctgttaaacc gaatgccatc caaaattctg       240
     gtatccctca ctctgtctgg gctggcattg atgacaacca ccatcaactc cctcgtgatc       300
     gctgcgatca ttgtgactcg gaagctgcac cacccagcca actatttaat ttgttccttg       360
     gcagttacag attttcttgt agctgtcctg gtgatgccct tcagtattgt gtacattgtg       420
     agagagagct ggattatggg acaagtactc tgtgacattt ggctgagtgt cgacatcatc       480
     tgttgtacgt gttccatctt gcatctgtcg gctatagcct tggataggta ccgcgccatc       540
     acagatgcag ttgaatacgc caggaagagg actcccaggc atgccggcat catgatcacg       600
     atcgtgtggg ttatatctgt gttcatctct atgcctcctc tcttctggag gcaccaagga       660
     actagccgtg atgatgagtg tgtcatcaaa catgaccaca ttgtttccac aatttactcc       720
     acgtttggag ctttctacat cccgcttgta ttgatattga tcctctacta caaaatatac       780
     agagcagcaa ggacactgta ccacaagaga caagcgagtc ggatgataaa ggaggagctg       840
     aacggtcaag tcttcttgga gagcggtgag aagagcatta aactggtctc cacatcctac       900
     atgttagaaa aatccttgtc cgatccatca acggactttg atagaattca cagcaccgtg       960
     aaaagtccca gatcggaact gaagcatgag aaatcttgga gaagacagaa aatctcaggc      1020
     accagagaac gcaaagcagc cactaccctg ggattgatct tgggtgcatt tgtaatatgt      1080
     tggctgccct tttttgtaaa agaattggtt gttaatgtct gtgaaaaatg taaaatttct      1140
     gaagaaatgt caaacttttt ggcatggctt ggttacctga attcccttat aaatccactg      1200
     atttatacca tctttaatga agacttcaag aaagctttcc aaaaacttgt acgatgccga      1260
     tattaggata aaagaaacct aattttaaag tgcggaggct ttatttgttg gggggagggg      1320
     cagggataat taaatgaatg taaagtaaga aaacatttaa atttttagag aaaatatatt      1380
     aaaactgcta aaattataag aggataaatt tatttttaat agcaccaaga aaataagatg      1440
     tattcatttg gccataattt taatgttctc aagattagga aataatttat gcagctcagc      1500
     tcgtaatatt ttgtctatgc aatataccta agaagctaac tagaaataca tatatataat      1560
     aattgataat atatgcatat atattatcaa ttacaatgct ttccaggttt atatgttaca      1620
     acaactagag acatttttaa ctagcatctt tccactggta atttctgtca cctcattgct      1680
     taaccactaa tttatagaaa aatattcaat gtaatgctac tattgcccct tctccatctt      1740
     ctccactaca aaggtggaga tatagcaaca gcagctccta tttagcctta gcagagaaga      1800
     tatgaagctc agcggctttg a                                                1821
//


spacer
spacer