Dbfetch

ID   BC134358; SV 1; linear; mRNA; STD; MUS; 275 BP.
XX
AC   BC134358;
XX
DT   07-MAR-2007 (Rel. 90, Created)
DT   07-MAR-2007 (Rel. 90, Last updated, Version 1)
XX
DE   Mus musculus defensin beta 3, mRNA (cDNA clone MGC:156345 IMAGE:40049234),
DE   complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-275
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-275
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (04-MAR-2007) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 69a1a81aa8607e9d25ec15216892dcaf.
DR   Ensembl-Gn; ENSMUSG00000039775; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0033419; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0033400; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0033330; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0033400; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033112; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0033914; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0032435; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0033086; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0033240; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0033188; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0033333; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033225; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0033931; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032148; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0032552; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000033852; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0088303; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0088389; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0088320; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0088338; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0087901; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0088854; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0088431; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0087848; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0088047; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0087884; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0088076; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0087923; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0089144; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0087842; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0086941; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Baylor Human Genome Sequencing Center
CC   cDNA Library Preparation: Baylor Human Genome Sequencing Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRCG Plate: 18 Row: d Column: 2.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..275
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_285"
FT                   /clone="MGC:156345 IMAGE:40049234"
FT                   /tissue_type="PCR rescued clones"
FT                   /note="Vector: pCR-Blunt II-TOPO with reversed insert;
FT                   Clone identification sequence tag: TTAA sequenced from the
FT                   forward primer"
FT                   /db_xref="taxon:10090"
FT   gene            1..275
FT                   /gene="Defb3"
FT                   /note="synonym: mBD-3"
FT   CDS             14..205
FT                   /codon_start=1
FT                   /gene="Defb3"
FT                   /product="defensin beta 3"
FT                   /db_xref="GOA:Q9WTL0"
FT                   /db_xref="InterPro:IPR001855"
FT                   /db_xref="MGI:MGI:1351612"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9WTL0"
FT                   /protein_id="AAI34359.1"
FT                   /translation="MRIHYLLFAFLLVLLSPPAAFSKKINNPVSCLRKGGRCWNRCIGN
FT                   TRQIGSCGVPFLKCCKRK"
XX
SQ   Sequence 275 BP; 84 A; 62 C; 59 G; 70 T; 0 other;
     ccaggcttca gtcatgagga tccattacct tctctttgca tttctcctgg tgctgctgtc        60
     tccacctgca gcttttagca aaaaaatcaa caatccagta agttgtttga ggaaaggagg       120
     cagatgctgg aatcggtgca ttggcaacac tcgtcagatt ggcagttgtg gagttccttt       180
     cctcaaatgc tgcaagagaa aatagagaag accaagatcc cgttaaacaa agaaaacacc       240
     agaatttgct cctccatgaa gatggacaaa actta                                  275
//