Dbfetch

ID   BC133712; SV 1; linear; mRNA; STD; MUS; 3972 BP.
XX
AC   BC133712;
XX
DT   07-MAR-2007 (Rel. 90, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Mus musculus transient receptor potential cation channel, subfamily M,
DE   member 5, mRNA (cDNA clone MGC:161367 IMAGE:40143371), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3972
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-3972
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (02-MAR-2007) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; aa5d19d3cebb760744a59b676a78edac.
DR   Ensembl-Gn; ENSMUSG00000009246; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0033269; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0033252; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0033183; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0033252; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0032968; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0033762; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0032290; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0032939; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0033093; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0033041; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0033185; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033075; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0033782; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031999; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0032402; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000009390; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000150867; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0087808; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0087896; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0087832; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0087851; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0087414; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0088356; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0087936; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0087357; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0087555; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0087392; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0087584; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0087432; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0088653; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0087342; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0086446; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Baylor Human Genome Sequencing Center
CC   cDNA Library Preparation: Baylor Human Genome Sequencing Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRCG Plate: 12 Row: h Column: 4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3972
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_285"
FT                   /clone="MGC:161367 IMAGE:40143371"
FT                   /tissue_type="PCR rescued clones"
FT                   /note="Vector: pCR-Blunt II-TOPO with reversed insert;
FT                   Clone identification sequence tag: NA"
FT                   /db_xref="taxon:10090"
FT   gene            1..3972
FT                   /gene="Trpm5"
FT                   /note="synonyms: Ltrpc5, Mtr1"
FT   CDS             5..3481
FT                   /codon_start=1
FT                   /gene="Trpm5"
FT                   /product="Trpm5 protein"
FT                   /db_xref="GOA:Q9JJH7"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR029577"
FT                   /db_xref="MGI:MGI:1861718"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JJH7"
FT                   /protein_id="AAI33713.1"
FT                   /translation="MQTTQSSCPGSPPDTEDGWEPILSRGEINFGGSGKKRGKFVKVPS
FT                   SVAPSVLFELLLTEWHLPAPNLVVSLVGEERPLAMKSWLRDVLRKGLVKAAQSTGAWIL
FT                   TSALHVGLARHVGQAVRDHSLASTSTKIRVVAIGMASLDRILHRQLLDGVHQKEDTPIH
FT                   YPADEGNIQGPLCPLDSNLSHFILVESGALGSGNDGLTELQLSLEKHISQQRTGYGGTS
FT                   CIQIPVLCLLVNGDPNTLERISRAVEQAAPWLILAGSGGIADVLAALVSQPHLLVPQVA
FT                   EKQFREKFPSECFSWEAIVHWTELLQNIAAHPHLLTVYDFEQEGSEDLDTVILKALVKA
FT                   CKSHSQEAQDYLDELKLAVAWDRVDIAKSEIFNGDVEWKSCDLEEVMTDALVSNKPDFV
FT                   RLFVDSGADMAEFLTYGRLQQLYHSVSPKSLLFELLQRKHEEGRLTLAGLGAQQARELP
FT                   IGLPAFSLHEVSRVLKDFLHDACRGFYQDGRRMEERGPPKRPAGQKWLPDLSRKSEDPW
FT                   RDLFLWAVLQNRYEMATYFWAMGREGVAAALAACKIIKEMSHLEKEAEVARTMREAKYE
FT                   QLALDLFSECYGNSEDRAFALLVRRNHSWSRTTCLHLATEADAKAFFAHDGVQAFLTKI
FT                   WWGDMATGTPILRLLGAFTCPALIYTNLISFSEDAPQRMDLEDLQEPDSLDMEKSFLCS
FT                   RGGQLEKLTEAPRAPGDLGPQAAFLLTRWRKFWGAPVTVFLGNVVMYFAFLFLFTYVLL
FT                   VDFRPPPQGPSGSEVTLYFWVFTLVLEEIRQGFFTDEDTHLVKKFTLYVEDNWNKCDMV
FT                   AIFLFIVGVTCRMVPSVFEAGRTVLAIDFMVFTLRLIHIFAIHKQLGPKIIIVERMMKD
FT                   VFFFLFFLSVWLVAYGVTTQALLHPNDGRLEWIFRRVLYRPYLQIFGQIPLDEIDEARV
FT                   NCSLHPLLLESSASCPNLYANWLVILLLVTFLLVTNVLLMNLLIAMFSYTFQVVQGNAD
FT                   MFWKFQRYHLIVEYHGRPALAPPFILLSHLSLVLKQVFRKEAQHKRQHLERDLPDPLDQ
FT                   KIITWETVQKENFLSTMEKRRRDSEGEVLRKTAHRVDLIAKYIGGLREQEKRIKCLESQ
FT                   ANYCMLLLSSMTDTLAPGGTYSSSQNCGCRSQPASARDREYLESGLPPSDT"
XX
SQ   Sequence 3972 BP; 875 A; 1111 C; 1086 G; 900 T; 0 other;
     aacaatgcaa acaacccaga gctcctgccc cggcagcccc ccagatactg aggatggctg        60
     ggagcccatc ctatccaggg gagagatcaa cttcggaggg tctgggaaga agcgaggcaa       120
     gtttgtgaag gtgccaagca gtgtggcccc ctccgtgctt tttgaactcc tgctcaccga       180
     gtggcacctg ccagccccca acctggtggt gtccctggtg ggtgaggaac gacctttggc       240
     tatgaagtcg tggcttcggg atgtcctgcg caaggggctg gtgaaagcag ctcagagcac       300
     aggtgcctgg atcctgacca gtgccctcca cgtgggcctg gcccgccatg ttggacaagc       360
     tgtacgtgat cactctctgg ctagcacatc caccaagatc cgtgtagtgg ccatcggaat       420
     ggcctctctg gatcgaatcc ttcaccgtca acttctagat ggtgtccacc aaaaggagga       480
     tactcccatc cactacccag cagatgaggg caacattcag ggacccctct gccccctgga       540
     cagcaatctc tcccacttca tccttgtgga gtcaggcgcc cttgggagtg ggaacgatgg       600
     gctgacagag ctgcagctga gcctggagaa gcacatctct cagcagagga caggttatgg       660
     gggcaccagc tgcatccaga tacctgtcct ttgcctgttg gtcaatggtg accccaacac       720
     cctagagagg atttccaggg cagtggagca ggctgcccca tggctgatcc tggcaggttc       780
     tggtggcatt gctgatgtac tcgctgccct ggtgagccag cctcatctcc tggtgcccca       840
     ggtggctgag aagcagttca gagagaaatt ccccagcgag tgtttctctt gggaagccat       900
     tgtacactgg acagagctgt tacagaacat tgctgcacac ccccacctgc tcacagtata       960
     cgacttcgag caggagggtt cggaggacct ggacactgtc atcctcaagg cacttgtgaa      1020
     agcctgcaag agccacagcc aagaagccca agactaccta gatgagctca agttagcagt      1080
     ggcctgggat cgcgtggaca ttgccaagag tgaaatcttc aatggggacg tggaatggaa      1140
     gtcctgtgac ttggaagagg tgatgacaga tgccctcgtg agcaacaagc ctgactttgt      1200
     ccgcctcttt gtggacagcg gtgctgacat ggccgagttc ttgacctatg ggcggctgca      1260
     gcagctttac cattctgtgt cccccaagag cctcctcttt gaactgctgc agcgtaagca      1320
     tgaggagggt aggctgacac tggccggcct gggtgcccag caggctcggg agctgcccat      1380
     tggtctgcct gccttctcac tccacgaggt ctcccgtgta ctcaaagact tcctgcatga      1440
     cgcctgccgt ggcttctacc aggacgggcg caggatggag gagagagggc cacctaagcg      1500
     gcccgcaggc cagaagtggc tgccagacct cagtaggaag agtgaagacc cttggaggga      1560
     cctgttcctc tgggctgtgc tgcagaatcg ttatgagatg gccacatact tctgggccat      1620
     gggccgggag ggtgtggctg ctgctctggc tgcctgcaag atcataaagg aaatgtccca      1680
     cctggagaaa gaggcagagg tggcccgcac catgcgtgag gccaagtatg agcagctggc      1740
     cctggatctt ttctcagagt gctacggcaa cagtgaggac cgtgcctttg ccctgctggt      1800
     gcgaaggaac cacagctgga gcaggaccac gtgcctgcac ctggccactg aagctgatgc      1860
     caaggccttc tttgcccatg acggtgtgca agcattcctg accaagatct ggtggggaga      1920
     catggccaca ggcacaccca tcctacggct tctgggtgcc ttcacctgcc cagccctcat      1980
     ctacacaaac ctcatctcct tcagtgagga tgccccgcag aggatggacc tagaagatct      2040
     gcaggagcca gacagcttgg atatggaaaa gagcttccta tgcagccggg gtggccaatt      2100
     ggagaagcta acagaggcac caagggctcc aggcgatcta ggcccacaag ctgccttcct      2160
     gctcacacgg tggaggaagt tctggggcgc tcctgtgact gtgttcctgg ggaatgtggt      2220
     catgtacttc gcattcctct tcctgttcac ctatgtcctg ctggtggact tcaggccacc      2280
     accccagggg ccgtctggat ccgaggttac cctctatttc tgggtgttca cactggtgct      2340
     ggaggaaatc cgacagggct tcttcacaga tgaggacacg cacctggtga agaaattcac      2400
     tctgtatgtg gaagacaact ggaacaagtg tgacatggtg gccatcttcc tgttcattgt      2460
     gggagtcacc tgtagaatgg tgccctcggt gtttgaggct ggcaggaccg ttctggccat      2520
     tgacttcatg gtgttcacac ttcggctcat ccacatcttt gctattcaca agcagttggg      2580
     ccctaagatc atcattgtag agcgaatgat gaaggatgtc ttctttttcc tcttcttcct      2640
     gagcgtatgg cttgtggcct atggtgtgac cactcaggcc ctgctgcatc ccaatgatgg      2700
     ccgtttggag tggattttcc gccgtgtgct atacaggcct tacctgcaga tctttgggca      2760
     aatccctctg gatgaaattg atgaggctcg tgtgaactgt tctcttcacc ctctgctgct      2820
     ggaaagctcg gcttcctgcc ctaatctcta tgccaactgg ctggtcattc tcctgctggt      2880
     taccttcctg cttgtcacta atgtgctgct catgaacctt ctgatcgcca tgttcagcta      2940
     cacattccag gtggtgcaag gcaatgcaga catgttctgg aagtttcaac gctaccacct      3000
     catcgttgaa taccatggaa gaccagctct ggccccgccc ttcatcctgc tcagccacct      3060
     gagcctggtg ctcaagcagg tcttcaggaa ggaagcccag cataagcgac aacatctgga      3120
     gagagacttg cctgacccct tggaccagaa gatcattacc tgggaaacgg ttcaaaagga      3180
     gaacttcctg agtaccatgg agaaacggag gagggacagc gagggggagg tgctgaggaa      3240
     aacggcacac agagtggact tgattgccaa atacatcggg gggctgagag agcaagaaaa      3300
     gaggatcaag tgtctggaat cacaggccaa ctactgtatg ctcctcttgt cctctatgac      3360
     ggatacactg gctccaggag gcacctactc aagctctcag aactgtggtt gcaggagtca      3420
     gccagcctct gctagagaca gggagtacct agagtctggc ttgccaccct ctgacacctg      3480
     aaatggagaa accacttgct ctagagcccc agacctggcc acatcgagtt tttggggcac      3540
     atcaaccttc ccccactccc agcagcccca agaaatggtc ttcaaggcct tgctacagat      3600
     cacttcttgg acatcccttc ctaagagaat gaaactcatg tctttggcat ctattcggga      3660
     gcctcagaag tatcctctcc agcagggcaa gatttttcat gtcccactaa agctttcact      3720
     ggcttggact ggacagctgg atctggccaa gtcctacata ggacaccatc tgcctggatg      3780
     gggctactta ggtctaaccc ctgtcttacc ctgagttcct aagaagccaa cctcttaaac      3840
     actagaggtt tctttctgac ccctgaccca ctcattagct gaccagctcc tagagggcag      3900
     gactcagatc tattgtaatt acctcccatc tttcaccccc cacagcatta tctgtctgat      3960
     cattctggct tg                                                          3972
//