spacer

EBI Dbfetch

ID   BC132543; SV 1; linear; mRNA; STD; MUS; 2155 BP.
XX
AC   BC132543;
XX
DT   02-FEB-2007 (Rel. 90, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus frizzled homolog 8 (Drosophila), mRNA (cDNA clone MGC:164174
DE   IMAGE:40130820), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2155
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2155
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (31-JAN-2007) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; a95b57c8a8c86ef218dae989ef94d454.
DR   Ensembl-Gn; ENSMUSG00000036904; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000041080; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Ambion
CC   cDNA Library Preparation: British Columbia Cancer Research Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRCK Plate: 6 Row: K Column: 21.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2155
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_378"
FT                   /clone="MGC:164174 IMAGE:40130820"
FT                   /tissue_type="Brain, PCR rescued clones"
FT                   /note="Vector: pCR4-TOPO with reversed insert; Clone
FT                   identification sequence tag: AGTGGATT"
FT                   /db_xref="taxon:10090"
FT   gene            1..2155
FT                   /gene="Fzd8"
FT                   /note="synonyms: Fz8, mFZ8"
FT   misc_feature    1..2155
FT                   /gene="Fzd8"
FT                   /note="This cDNA sequence aligns to the mouse C57BL/6J
FT                   genome (build 36) without differences"
FT   CDS             65..2122
FT                   /codon_start=1
FT                   /gene="Fzd8"
FT                   /product="frizzled homolog 8 (Drosophila)"
FT                   /db_xref="GOA:Q61091"
FT                   /db_xref="InterPro:IPR000539"
FT                   /db_xref="InterPro:IPR015526"
FT                   /db_xref="InterPro:IPR017981"
FT                   /db_xref="InterPro:IPR020067"
FT                   /db_xref="MGI:MGI:108460"
FT                   /db_xref="PDB:1IJY"
FT                   /db_xref="PDB:4F0A"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q61091"
FT                   /protein_id="AAI32544.1"
FT                   /translation="MEWGYLLEVTSLLAALAVLQRSSGAAAASAKELACQEITVPLCKG
FT                   IGYNYTYMPNQFNHDTQDEAGLEVHQFWPLVEIQCSPDLKFFLCSMYTPICLEDYKKPL
FT                   PPCRSVCERAKAGCAPLMRQYGFAWPDRMRCDRLPEQGNPDTLCMDYNRTDLTTAAPSP
FT                   PRRLPPPPPPGEQPPSGSGHSRPPGARPPHRGGSSRGSGDAAAAPPSRGGKARPPGGGA
FT                   APCEPGCQCRAPMVSVSSERHPLYNRVKTGQIANCALPCHNPFFSQDERAFTVFWIGLW
FT                   SVLCFVSTFATVSTFLIDMERFKYPERPIIFLSACYLFVSVGYLVRLVAGHEKVACSGG
FT                   APGAGGAGGAGGAAAAGAGAAGAGASSPGARGEYEELGAVEQHVRYETTGPALCTVVFL
FT                   LVYFFGMASSIWWVILSLTWFLAAGMKWGNEAIAGYSQYFHLAAWLVPSVKSIAVLALS
FT                   SVDGDPVAGICYVGNQSLDNLRGFVLAPLVIYLFIGTMFLLAGFVSLFRIRSVIKQQGG
FT                   PTKTHKLEKLMIRLGLFTVLYTVPAAVVVACLFYEQHNRPRWEATHNCPCLRDLQPDQA
FT                   RRPDYAVFMLKYFMCLVVGITSGVWVWSGKTLESWRALCTRCCWASKGAAVGAGAGGSG
FT                   PGGSGPGPGGGGGHGGGGGSLYSDVSTGLTWRSGTASSVSYPKQMPLSQV"
XX
SQ   Sequence 2155 BP; 344 A; 701 C; 700 G; 410 T; 0 other;
     cctcactgca gagccctcct gcgcgccgcc tagagaagga ggacttgggg tcccagcgcg        60
     cagcatggag tggggttacc tgttggaagt gacctcgctc ctagccgcct tggcggtgct       120
     acagcgctct agcggcgctg ccgcggcttc ggccaaggag ctggcgtgcc aagagatcac       180
     ggtgccgttg tgcaaaggca tcggttacaa ctacacttac atgcccaacc agttcaacca       240
     cgacacgcaa gatgaggcgg gcctagaggt gcaccagttt tggccgctgg tggagataca       300
     gtgctccccg gacctcaagt tctttctgtg tagcatgtac acgcccatct gcctggagga       360
     ctacaagaag cctctgccgc cttgtcgctc tgtgtgtgaa cgcgccaagg ccggctgcgc       420
     gccgctcatg cgccagtacg gctttgcttg gcctgaccgc atgcgctgcg atcggttgcc       480
     ggagcagggc aacccggaca ctctgtgcat ggactacaac cgcaccgacc tcaccacggc       540
     cgcgcccagc ccaccgcgcc gcctgcctcc gccgcctcct cccggcgagc agccgccctc       600
     tggcagcggc cacagccgcc cgccaggggc caggccccca catcgtggcg gcagcagtag       660
     gggcagcggg gacgcggcgg ctgcgccccc ttcgcgcggc gggaaggcga ggccccctgg       720
     tggcggcgct gctccctgcg agccggggtg ccagtgccgc gcgcccatgg tgagcgtgtc       780
     cagcgaacgc cacccgctct acaaccgcgt caagaccggc cagatcgcca actgtgcgct       840
     gccctgccac aaccccttct ttagccagga tgagcgcgcc ttcaccgtct tctggatcgg       900
     cctgtggtcg gtgctctgct tcgtctccac cttcgccact gtctctacct tcctcatcga       960
     tatggagcgc tttaagtacc cggaacggcc catcatattc ctctccgcct gttacctctt      1020
     cgtgtctgtc gggtacctgg tgcgcctggt ggcaggacat gagaaagtgg cctgcagcgg      1080
     cggcgctccg ggtgctggcg gagctggggg tgcgggcggc gcggcggcgg ctggcgcagg      1140
     ggcagcggga gcgggggcga gcagcccggg cgcgcgcggc gagtacgagg agctgggtgc      1200
     agtcgagcag catgttcgct atgaaaccac tggccccgcg ctgtgcacgg tggtctttct      1260
     ccttgtctac ttttttggca tggccagctc catctggtgg gtaatcctgt cgctcacgtg      1320
     gttcttggca gctggcatga agtggggtaa tgaggccata gcaggctact cgcagtactt      1380
     ccacctggcc gcgtggcttg tgcccagcgt caagtccatc gcggtgctgg cgctcagctc      1440
     cgtagacggc gacccggtgg cgggcatctg ctacgtgggc aaccagagcc ttgacaacct      1500
     acgcggcttt gtgctggcgc cactggttat ctacctcttc attgggacta tgtttctgtt      1560
     agctggcttc gtgtcgctgt tccgaatccg ttcagtcatc aagcagcaag gaggcccaac      1620
     taagacacac aagctagaaa aactcatgat ccgcttgggc ctcttcaccg tgctctacac      1680
     ggtgcccgct gccgtcgttg tcgcctgcct tttctatgag cagcacaacc gaccgcgctg      1740
     ggaggccacg cacaactgcc catgccttcg ggacctgcaa ccggaccagg ctcgcaggcc      1800
     cgattacgcg gtcttcatgc tcaagtactt catgtgccta gtagtgggca tcacatcggg      1860
     cgtgtgggtc tggtccggca agactctgga gtcctggcgc gcgttgtgca ctaggtgctg      1920
     ctgggccagc aagggcgctg cagtaggcgc gggcgctgga ggcagcggcc ctgggggcag      1980
     tggacccggg cccggcggag gtgggggaca cggcggaggc gggggatccc tctacagcga      2040
     cgtcagtacc ggcctgacgt ggcggtctgg cacggccagc tctgtatctt accctaagca      2100
     aatgccattg tcccaggtct gaaccctacg tggatgccca gaaggggcgg agagg           2155
//


spacer
spacer