spacer

EBI Dbfetch

ID   BC131654; SV 1; linear; mRNA; STD; MUS; 3582 BP.
XX
AC   BC131654;
XX
DT   31-JAN-2007 (Rel. 90, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Mus musculus desmoglein 2, mRNA (cDNA clone MGC:150161 IMAGE:40110531),
DE   complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3582
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-3582
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (29-JAN-2007) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; a72946f3eb50ee4b9337ea4a5a06a1f6.
DR   Ensembl-Gn; ENSMUSG00000044393; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000059787; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Baylor Human Genome Sequencing Center
CC   cDNA Library Preparation: Baylor Human Genome Sequencing Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAM Plate: 28 Row: k Column: 4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3582
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_284"
FT                   /clone="MGC:150161 IMAGE:40110531"
FT                   /tissue_type="PCR rescued clones"
FT                   /note="Vector: pCR-Blunt II-TOPO; Clone identification
FT                   sequence tag: GTTCTAT sequenced from the reverse primer"
FT                   /db_xref="taxon:10090"
FT   gene            1..3582
FT                   /gene="Dsg2"
FT   CDS             146..3514
FT                   /codon_start=1
FT                   /gene="Dsg2"
FT                   /product="desmoglein 2"
FT                   /db_xref="GOA:O55111"
FT                   /db_xref="InterPro:IPR000233"
FT                   /db_xref="InterPro:IPR002126"
FT                   /db_xref="InterPro:IPR009122"
FT                   /db_xref="InterPro:IPR009123"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR020894"
FT                   /db_xref="InterPro:IPR027397"
FT                   /db_xref="MGI:MGI:1196466"
FT                   /db_xref="UniProtKB/Swiss-Prot:O55111"
FT                   /protein_id="AAI31655.1"
FT                   /translation="MARSPGDRCALLLLVQLLAVVCLDFGNGLHLEVFSPRNEGKPFPK
FT                   HTHLVRQKRAWITAPVALREGEDLSRKNPIAKIHSDLAEEKGIKITYKYTGKGITEPPF
FT                   GIFVFDRNTGELNITSILDREETPYFLLTGYALDSRGNNLEKPLELRIKVLDINDNEPV
FT                   FTQEVFVGSIEELSAAHTLVMKITATDADDPETLNAKVSYRIVSQEPANSHMFYLNKDT
FT                   GEIYTTSFTLDREEHSSYSLTVEARDGNGQITDKPVQQAQVQIRILDVNDNIPVVENKM
FT                   YEGTVEENQVNVEVMRIKVTDADEVGSDNWLANFTFASGNEGGYFHIETDTQTNEGIVT
FT                   LVKEVDYEEMKKLDLSIIVTNKAAFHKSILSKYKATPIPITVKVKNVVEGIHFKSSVVS
FT                   FRASEAMDRSSLSRSIGNFQVFDEDTGQAAKVTYVKVQDTDNWVSVDSVTSEIKLVKIP
FT                   DFESRYVQNGTYTAKVVAISKEHPQKTITGTIVITVEDVNDNCPVLVDSVRSVCEDEPY
FT                   VNVTAEDLDGAQNSAPFSFSIIDQPPGTAQKWKITHQESTSVLLQQSERKRGRSEIPFL
FT                   ISDSQGFSCPERQVLQLTVCECLKGGGCVAAQYDNYVGLGPAAIALMILALLLLLLVPL
FT                   LLLICHCGGGAKGFTPIPGTIEMLHPWNNEGAPPEDKVVPSLLVADHAESSAVRGGVGG
FT                   AMLKEGMMKGSSSASVTKGQHELSEVDGRWEEHRSLLTAGATHHVRTAGTIAANEAVRT
FT                   RATGSSRDMSGARGAVAVNEEFLRSYFTEKAASYNGEDDLHMAKDCLLVYSQEDTASLR
FT                   GSVGCCSFIEGELDDLFLDDLGLKFKTLAEVCLGRKIDLDVDIEQRQKPVREASVSAAS
FT                   GSHYEQAVTSSESAYSSNTGFPAPKPLHEVHTEKVTQEIVTESSVSSRQSQKVVPPPDP
FT                   VASGNIIVTETSYAKGSAVPPSTVLLAPRQPQSLIVTERVYAPTSTLVDQHYANEEKVL
FT                   VTERVIQPNGGIPKPLEVTQHLKDAQYVMVRERESILAPSSGVQPTLAMPSVAAGGQNV
FT                   TVTERILTPASTLQSSYQIPSETSITARNTVLSSVGSIGPLPNLDLEESDRPNSTITTS
FT                   STRVTKHSTMQHSYS"
XX
SQ   Sequence 3582 BP; 974 A; 906 C; 957 G; 745 T; 0 other;
     ggctaccctt tctgacccgg gcacacctgg aaccgcaccc cgggtcccgc agagtcagag        60
     aagggcggcc ccgggaggga cctgcccagg aggatccgca gggcgccggc gaggcccgga       120
     ggcgagggcg cggcggatcg aggcgatggc gcggagcccg ggtgaccggt gcgccctgct       180
     gctgctggtg cagctgctgg cggtggtctg cttggacttt ggaaacggac ttcacttaga       240
     ggtcttcagc ccaagaaatg aaggcaaacc gttccctaag cacactcact tggttcgtca       300
     aaagagggcc tggatcactg cccctgtggc tctgcgggag ggcgaagacc tgtccagaaa       360
     gaacccgatt gccaagatac actctgacct tgcagaagaa aaagggataa aaatcacgta       420
     caagtacact gggaagggaa ttacagaacc gcctttcggc atattcgtct ttgatagaaa       480
     cacaggagaa ctgaacatca ctagcattct tgaccgggaa gaaacaccat attttctgct       540
     gacaggctat gcattggact ccagaggaaa caacctggaa aagcccttgg aactacgcat       600
     caaagttctg gacatcaatg acaacgagcc agtgttcaca caggaggtct ttgttgggtc       660
     cattgaggaa ttgagtgcag cacatacact tgtgatgaaa atcaccgcca cagatgcaga       720
     tgacccggag actctgaatg ctaaagtctc ctacagaatt gtctctcagg agcctgcaaa       780
     tagtcatatg ttctacctaa ataaagacac gggggagatc tatacgacca gttttacttt       840
     ggacagagag gaacacagca gctattcctt gacggtggaa gcaagagatg gtaacgggca       900
     gataacagac aagccagtcc agcaagctca agttcagatc cgtatattgg atgtcaatga       960
     caatatacct gtggtagaaa acaaaatgta tgaggggaca gtggaagaaa accaggtcaa      1020
     tgtagaagtc atgcggatca aagtgaccga tgcagatgaa gtgggctctg ataactggct      1080
     agcaaacttt acatttgcat caggaaatga agggggctat ttccacattg agactgacac      1140
     acagactaat gaagggattg tgacccttgt caaggaagtg gactatgaag aaatgaagaa      1200
     gctagacttg agcatcattg tcactaacaa agcagctttc cacaagtcca ttctgagcaa      1260
     gtacaaggcc acgcccattc ccatcactgt caaggtcaag aacgtggttg aaggcattca      1320
     tttcaagagc agcgtagtct ctttccgagc tagtgaggca atggatagat ccagcctcag      1380
     caggtcgatt ggaaattttc aagtttttga tgaagacact ggtcaagcag ctaaagtaac      1440
     atatgtaaaa gtgcaagaca ctgacaactg ggtctctgtg gactccgtca cttcagagat      1500
     taagcttgta aagattcctg actttgaatc tagatatgtc caaaatggta cctacactgc      1560
     aaaggttgtg gccatatcca aagaacatcc tcaaaaaacc atcactggca ccatcgttat      1620
     cactgttgaa gacgtcaatg acaattgtcc cgtgctggtg gactctgtac ggagtgtctg      1680
     tgaggatgaa ccatatgtga atgtcactgc agaggatttg gatggggccc agaacagtgc      1740
     gccattcagc ttctccatca ttgaccagcc tcctggaacg gcacagaagt ggaaaataac      1800
     gcaccaggaa agtaccagtg tgctgctgca gcagagcgag cggaaacgcg ggagaagtga      1860
     gattcccttc ctcatttccg acagccaggg cttcagctgc cccgaaaggc aggtccttca      1920
     gctcactgta tgcgagtgtc tgaagggcgg tggctgtgtg gctgcacagt atgacaacta      1980
     cgtcgggttg ggccctgccg ccatcgctct catgattcta gcactcctgc tcctgctcct      2040
     ggtgccgctc ttgctgttga tatgccactg tggagggggc gccaaaggct tcacccccat      2100
     tcctgggaca atagagatgc tgcacccttg gaataatgaa ggggcacctc ctgaggacaa      2160
     ggtggtgcca tcgcttctgg tggccgatca tgcagagagc tcggcagtga gaggcggcgt      2220
     aggaggtgcg atgctcaagg aaggcatgat gaaaggcagc agctcagctt ccgttaccaa      2280
     agggcagcat gagctgtctg aggttgacgg aagatgggaa gaacacagaa gcctcctcac      2340
     cgctggggcc actcaccatg taaggacagc aggaaccatc gctgccaacg aagccgtaag      2400
     gacaagagcc acggggtctt ccagagacat gagtggggct cgaggagccg ttgccgtgaa      2460
     tgaggaattc ttaagaagtt acttcacaga gaaagcggcc tcctacaatg gggaagacga      2520
     ccttcacatg gccaaagact gccttctcgt ttactctcag gaagacacgg cctccctccg      2580
     aggctcggtc gggtgctgca gtttcatcga gggagaactc gatgacctgt tcctggatga      2640
     tcttggcctt aaattcaaga ccctagctga agtttgccta ggtcgaaaga tcgatctgga      2700
     tgtggacatt gaacagaggc agaagccggt cagagaagcg agcgtgagtg cagcttctgg      2760
     ctcgcactat gagcaagcgg taaccagctc agagagcgcg tactcctcta acaccggctt      2820
     ccccgccccc aaacctctgc acgaagtgca cacagagaaa gtcacacagg aaatcgtcac      2880
     tgagagctct gtatcttcca ggcagagtca gaaggtagta ccgccacctg atcctgtggc      2940
     ttctggtaat attatagtga cggaaacttc ctatgccaaa ggctcagcag tgccacccag      3000
     cactgtgctc ctggctccca gacagccaca gagcctgatc gtgacagaga gggtgtatgc      3060
     tccaacctcc accttggtgg atcagcatta tgccaatgaa gaaaaagtcc ttgttaccga      3120
     acgagtgatc cagcctaatg ggggcatccc taagcccctt gaggtcaccc agcatctgaa      3180
     agatgcacag tatgtaatgg tgagggaaag agagagcatc cttgctccca gctcaggcgt      3240
     gcagcccact ctggcaatgc ccagcgtggc agcaggagga cagaatgtca ccgtgacaga      3300
     aagaatacta actcctgctt ccactctgca gtccagctac cagattccca gtgaaacctc      3360
     catcacggct aggaacactg tgctctctag tgtgggaagc ataggtcctc tgcccaattt      3420
     agatctagag gaatctgatc gtcccaattc tactataacc acatcttcca ccagggtcac      3480
     caagcatagc accatgcaac attcttactc ctaaagagaa gccagccgca gtcggatctg      3540
     gaccttaact agcatccact ggatgtgtgt gtccatgccc ca                         3582
//


spacer
spacer