Dbfetch

ID   BC130221; SV 1; linear; mRNA; STD; MUS; 2213 BP.
XX
AC   BC130221;
XX
DT   04-JAN-2007 (Rel. 90, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus solute carrier family 9 (sodium/hydrogen exchanger), member 6,
DE   mRNA (cDNA clone MGC:161237 IMAGE:40141414), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2213
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2213
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (22-DEC-2006) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; f10ddbc102695b0d81a3bc3f6df1f667.
DR   Ensembl-Gn; ENSMUSG00000060681; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000077741; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Baylor Human Genome Sequencing Center
CC   cDNA Library Preparation: Baylor Human Genome Sequencing Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRCG Plate: 12 Row: b Column: 6.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2213
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_284"
FT                   /clone="MGC:161237 IMAGE:40141414"
FT                   /tissue_type="PCR rescued clones"
FT                   /note="Vector: pCR-Blunt II-TOPO; Clone identification
FT                   sequence tag: TGTCCCCC sequenced from the reverse primer"
FT                   /db_xref="taxon:10090"
FT   gene            1..2213
FT                   /gene="Slc9a6"
FT                   /note="synonyms: mKIAA0267, 3732426M05, NHE6"
FT   misc_difference 1..8
FT                   /gene="Slc9a6"
FT                   /note="8 bases at the 5' end do not align to the mouse
FT                   genome."
FT   CDS             11..2119
FT                   /codon_start=1
FT                   /gene="Slc9a6"
FT                   /product="solute carrier family 9 (sodium/hydrogen
FT                   exchanger), member 6"
FT                   /db_xref="GOA:A1L3P4"
FT                   /db_xref="InterPro:IPR002090"
FT                   /db_xref="InterPro:IPR004709"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR018422"
FT                   /db_xref="MGI:MGI:2443511"
FT                   /db_xref="UniProtKB/TrEMBL:A1L3P4"
FT                   /protein_id="AAI30222.1"
FT                   /translation="MAGARRGWRLAPVRRGVCGPRARPLMRPLWLLFAVSFFGWTGALD
FT                   GSGGTTRAMDEEIVSEKQAEESHRQDSANLLIFILLLTLTILTIWLFKHRRARFLHETG
FT                   LAMIYGLLVGLVLRYGIHVPSDVNNVTLSCEVQSSPTTLLVNVSGKFYEYTLKGEISSH
FT                   ELNNVQDNEMLRKVTFDPEVFFNILLPPIIFYAGYSLKRRHFFRNLGSILAYAFLGTAI
FT                   SCFVIGSIMYGCVTLMKVTGQLAGDFYFTDCLLFGAIVSATDPVTVLAIFHELQVDVEL
FT                   YALLFGESVLNDAVAIVLSSSIVAYQPAGDNSHTFDVTAMFKSIGIFLGIFSGSFAMGA
FT                   ATGVVTALVTKFTKLREFQLLETGLFFLMSWSTFLLAEAWGFTGVVAVLFCGITQAHYT
FT                   YNNLSTESQHRTKQLFELLNFLAENFIFSYMGLTLFTFQNHVFNPTFVVGAFIAIFLGR
FT                   AANIYPLSLLLNLGRRSKIGSNFQHMMMFAGLRGAMAFALAIRDTATYARQMMFSTTLL
FT                   IVFFTVWVFGGGTTAMLSCLHIRVGVDSDQEHLGVPDNERRTTKAESAWLFRMWYNFDH
FT                   NYLKPLLTHSGPPLTTTLPACCGPIARCLTSPQAYENQEQLKDDDSDLILNDGDISLTY
FT                   GDSTVNTESATASAPRRFMGNSSEDALDRELTFGDHELVIRGTRLVLPMDDSEPALNSL
FT                   DDTRHSPA"
XX
SQ   Sequence 2213 BP; 506 A; 532 C; 550 G; 625 T; 0 other;
     aacagaagac atggctgggg ctcggcgcgg ctggcggctg gcgcccgttc gccgtggcgt        60
     ctgcgggccc cgggcgcgtc cgctcatgcg gcccctttgg ttgctcttcg cagtgagctt       120
     ctttggctgg accggggctc tggacggctc cgggggaacg accagagcca tggacgagga       180
     gatcgtgtcc gagaagcagg cggaggagag ccatcggcag gacagcgcca acctgctcat       240
     cttcatcctg ctgctcaccc tcaccattct gacgatctgg ctcttcaagc accgccgggc       300
     ccgcttcctg cacgaaaccg gccttgctat gatttatggt cttttggtag gcctcgtgct       360
     tcggtacggc attcatgttc caagcgatgt gaataatgtg actctgagct gtgaagtgca       420
     gtcaagtcca actaccttgt tggtcaacgt cagtggaaaa ttttatgagt atacgctgaa       480
     aggagagatt agctcacatg aactcaacaa tgttcaagat aatgaaatgc ttaggaaggt       540
     tacttttgat ccagaagtct ttttcaacat actgcttcct cctatcatat tttatgcagg       600
     gtacagtctc aaaaggagac atttcttccg gaaccttggg tctatcttag catatgcctt       660
     tcttggaaca gcaatttctt gtttcgttat tgggtccatc atgtatggct gtgtaaccct       720
     gatgaaggtg accgggcagc tcgcgggaga tttttacttt acagattgct tgctgtttgg       780
     tgccattgtt tcagccaccg acccagtgac tgttcttgcc atcttccatg agcttcaagt       840
     tgacgttgaa ctctacgctc ttctcttcgg ggaaagtgtc ctcaatgacg cggttgccat       900
     agtgctgtcc tcctcaatag tggcatacca gccagcggga gacaacagcc acacctttga       960
     cgttacagcc atgttcaaat ctattggaat cttccttggg atcttcagtg gatcttttgc      1020
     aatgggtgct gcaacaggcg tggtaacagc tttagtgaca aagttcacaa agctgagaga      1080
     gttccagctg ttggagacag gccttttctt cttgatgtcc tggagcacct ttcttctggc      1140
     tgaagcatgg ggtttcacag gtgtggttgc agtattgttt tgtggcatca cacaagcaca      1200
     ttacacgtac aataatttgt ctacagagtc tcagcataga acaaagcagt tgtttgagct      1260
     tctcaatttt ttagcggaga atttcatctt ttcctacatg gggctgacgc tgttcacctt      1320
     ccagaatcac gtctttaacc caacatttgt cgtaggagca ttcattgcta ttttcttggg      1380
     aagagctgcc aatatttatc ccttgtctct cttacttaat ttgggtagaa gaagtaagat      1440
     tggatcaaat tttcaacaca tgatgatgtt tgctggtctt cgtggtgcaa tggcatttgc      1500
     cttggccatt cgagatactg ccacttatgc acgacaaatg atgttcagca ccacacttct      1560
     gatcgtgttt tttactgtgt gggtatttgg tggtggcacc actgccatgc tgtcatgcct      1620
     gcatataagg gttggtgttg attcagacca agaacatttg ggtgttcctg acaacgaaag      1680
     gagaaccacc aaagcagaga gtgcctggct ctttcggatg tggtacaact tcgatcataa      1740
     ctatctgaag cccctgctga cccacagtgg gcctcctctg actaccacac tcccagcctg      1800
     ctgtgggcca atcgccaggt gcctgaccag cccccaagca tatgaaaacc aggagcagtt      1860
     gaaagatgat gactctgatc tcattctcaa tgatggtgat atcagtctga catatgggga      1920
     ttctactgtg aacaccgagt ccgcaacagc cagcgcccca aggagattta tgggcaacag      1980
     ttctgaagat gccttggacc gggagcttac atttggggac cacgaactag tcattcgtgg      2040
     cacacgcctg gttcttccga tggatgattc tgaacctgcg ttaaattcat tagatgatac      2100
     gagacacagt ccggcctaag cgctctgatg ctcagttagt ggtttgtaaa ctttgcacat      2160
     gtgattgtga agaaatgtgt actacctaca agtcctagtg catgtctctg aat             2213
//