spacer

EBI Dbfetch

ID   BC130027; SV 1; linear; mRNA; STD; MUS; 1582 BP.
XX
AC   BC130027;
XX
DT   03-JAN-2007 (Rel. 90, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Mus musculus matrix metallopeptidase 10, mRNA (cDNA clone MGC:161197
DE   IMAGE:40140858), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1582
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1582
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (22-DEC-2006) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 2b696ebfcd587560ae93b852206c5f4d.
DR   Ensembl-Gn; ENSMUSG00000047562; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000034488; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Baylor Human Genome Sequencing Center
CC   cDNA Library Preparation: Baylor Human Genome Sequencing Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRCG Plate: 13 Row: h Column: 4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1582
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_285"
FT                   /clone="MGC:161197 IMAGE:40140858"
FT                   /tissue_type="PCR rescued clones"
FT                   /note="Vector: pCR-Blunt II-TOPO with reversed insert;
FT                   Clone identification sequence tag: CCACTACA sequenced from
FT                   the forward primer"
FT                   /db_xref="taxon:10090"
FT   gene            1..1582
FT                   /gene="Mmp10"
FT   CDS             45..1475
FT                   /codon_start=1
FT                   /gene="Mmp10"
FT                   /product="matrix metallopeptidase 10"
FT                   /db_xref="GOA:A1L3D0"
FT                   /db_xref="InterPro:IPR000585"
FT                   /db_xref="InterPro:IPR001818"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR006026"
FT                   /db_xref="InterPro:IPR016293"
FT                   /db_xref="InterPro:IPR018486"
FT                   /db_xref="InterPro:IPR018487"
FT                   /db_xref="InterPro:IPR021158"
FT                   /db_xref="InterPro:IPR021190"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="MGI:MGI:97007"
FT                   /db_xref="UniProtKB/TrEMBL:A1L3D0"
FT                   /protein_id="AAI30028.1"
FT                   /translation="MEPLAILALLSLPICSAYPLHGAVTQGHPSMDLAQQYLEKYYNFK
FT                   KNEKQIFKRKDSSPVVKKIQEMQKFLGLEMTGKLDSNTMELMHKPRCGVPDVGGFSTFP
FT                   GSPKWRKSHITYRIVNYTPDLPRQSVDSAIEKALKVWEEVTPLTFSRISEGEADIMISF
FT                   AVGEHGDFYPFDGPGQSLAHAYPPGPGFYGDVHFDDDEKWTLAPSGTNLFLVAAHELGH
FT                   SLGLFHSDKKESLMYPVYRFSTSPANFHLSQDDIEGIQSLYGAGPSSDATVVPVLSVSP
FT                   RPETPDKCDPALSFDSVSTLRGEVLFFKDRYFWRRSHWNPEPEFHLISAFWPTLPSDLD
FT                   AAYEAHNTDSVLIFKGSQFWAVRGNEVQAGYPKGIHTLGFPPTVKKIDAAVFEKEKKKT
FT                   YFFVGDKYWRFDETRHVMDKGFPRQITDDFPGIEPQVDAVLHEFGFFYFFRGSSQFEFD
FT                   PNARTVTHILKSNSWLLC"
XX
SQ   Sequence 1582 BP; 431 A; 372 C; 367 G; 412 T; 0 other;
     acaggcacga ggaaggatcg gtttttaaag taaagactgt ctgtatggag ccactagcca        60
     tcctggcact gctgagccta ccaatctgct cagcgtatcc tctgcatggg gcagtgacac       120
     aaggccaccc aagcatggat cttgctcagc aatacctaga aaaatactac aactttaaaa       180
     aaaatgagaa acaaattttc aaaagaaagg acagtagtcc tgttgtcaaa aaaattcaag       240
     aaatgcagaa gttcctcggg ttggagatga cagggaagct ggactccaac actatggagc       300
     tgatgcacaa gcccaggtgt ggtgttcctg atgttggtgg cttcagtacc ttcccaggtt       360
     cgccaaaatg gaggaaatcc cacatcacct acaggattgt gaattataca ccagatttgc       420
     caagacagag tgtggattct gccattgaga aagctttgaa ggtctgggag gaggtgaccc       480
     cactcacttt ctccaggatc tctgaaggag aggctgacat aatgatctcc tttgcagttg       540
     gagaacacgg agacttttac ccttttgatg ggccaggaca gagtctggct catgcctacc       600
     cacctggccc tggattttat ggagatgttc acttcgatga tgatgagaaa tggacacttg       660
     caccctcagg gaccaactta ttcctggttg cagcccatga acttggccac tccctgggtc       720
     tctttcattc cgacaagaaa gaatctctga tgtacccagt ctacaggttc tccacaagcc       780
     cagctaactt ccacctttct caagatgata tagagggcat tcaatccctg tatggagccg       840
     gtccctcctc cgatgccaca gtggttcctg tgttgtctgt ctctccaaga cctgagaccc       900
     cagacaaatg tgatcctgct ttgtcctttg attcagtcag cacgctgaga ggggaagtcc       960
     tattctttaa agacaggtac ttctggcgca gatcccattg gaatcccgag cctgaatttc      1020
     atttgatatc agcattttgg cccactcttc cttcagactt agatgctgcc tatgaggctc      1080
     acaacacgga cagtgttctg atttttaaag gaagtcagtt ctgggcagtc cgaggaaatg      1140
     aagtccaagc aggctaccca aaggggatcc acactctcgg ttttcctccc accgtgaaga      1200
     agattgatgc agctgttttt gaaaaggaga agaagaaaac gtacttcttt gtaggggaca      1260
     aatactggag atttgatgag acaagacatg ttatggataa aggcttccca agacagataa      1320
     cagatgattt tccaggaatt gagccacaag ttgatgctgt gttacacgaa tttgggtttt      1380
     tttatttctt ccgaggatca tcacagttcg agtttgaccc caatgccagg acggtgacac      1440
     acatactgaa gagcaacagc tggctgctgt gctgatcatc atgacaagac atatacaacc      1500
     ctgtaaaatg agtctcatga cttcccacct actttattat gtgtcagaat gattagttgc      1560
     tcctgcatgt tctgtggctc cg                                               1582
//


spacer
spacer